F487254
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 976 | 567 | 774 | 402 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10112091|Ga0105240_101120913 |
| Length | 471 |
| Sequence | MDDEVCSKRFDRGRSVVAGGAKFFAKQPSTFSRHALEGAKEGGDARVLPQGWRGQSRRVGVDILKIRDAKDVETVVRAAIASEQPLEIIGHGSRRGIGQVMATNAVLDLSALNGVTSYEPNELIITVEAGAPLADVLSLIDSKNQQFAFEPMDTAPLFGTAGLGTIGGMIGTGLAGPRRIKAGGARDHLLGAHAVSGFGDSFKTGGKVVKNVTGYDLCKLLAGSFGTLAVMTEVTLKVMPRPESERTLVLGSLDDLTANRAMTAALGSPFDVSAAAHLPPSTPRPSVGGLDRLGSPDGAVTLVRLEGIPASAAHRAASLAKTLAPFGTAEMLEDAVSAEVWRSIRDVEPFAAKGALGARPVWRIVCPPAAGGALGEGLARETGGEVIYDWGGGLIWAALPPKPDAQAALVRSRVSAAGGHAMLLRASEEVRRNVDVFHPQARGVAALGERVRQSFDPKQILNRGRMIRGAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 10 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 11 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 12 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 13 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 14 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 15 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 16 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 17 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 18 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 19 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 20 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 21 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 22 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 23 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 24 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 25 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 26 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 27 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 28 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 29 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 30 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 31 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 32 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 33 | 2791355199 | |||
| 34 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 35 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 36 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 37 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 38 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 39 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 40 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 41 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 42 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 43 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 44 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 45 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 46 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 47 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 48 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 49 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 50 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 51 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 52 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 53 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 54 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 55 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 56 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 57 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 58 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 59 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 60 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 61 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 62 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 63 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 64 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 65 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 66 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 67 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 68 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 69 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 70 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 71 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 72 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 73 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 74 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 75 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 76 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 77 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 78 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 79 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 80 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 81 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 82 | 2904699407 | |||
| 83 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 84 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 85 | 2906610324 | |||
| 86 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 87 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 88 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 89 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 90 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 91 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 92 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 93 | 2922368715 | |||
| 94 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 95 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 96 | 2922425934 | |||
| 97 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 98 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 99 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 100 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 101 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 102 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 103 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 104 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 105 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 106 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 107 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 108 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 109 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 110 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 111 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 112 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 113 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 114 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 115 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 116 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 117 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 118 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 119 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 120 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 121 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 122 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 123 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 124 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 125 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 126 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 127 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 128 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 129 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 130 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 131 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 132 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 133 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 134 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 135 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 136 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 137 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 138 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 139 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 140 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 141 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 142 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 143 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 144 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 145 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 146 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 147 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 148 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 149 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 150 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 151 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 152 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 153 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 154 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 155 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 156 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 157 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 158 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 159 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 160 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 161 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 162 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 163 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 164 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 165 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 166 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 167 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 168 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 169 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 170 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 171 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 172 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 173 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 174 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 175 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 176 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 177 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 178 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 180 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 181 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 182 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 184 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 185 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 186 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 187 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 188 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 189 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 190 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 191 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 192 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 193 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 194 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 195 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 196 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 197 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 198 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 199 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 200 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 201 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 202 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 203 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 204 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 205 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 206 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 208 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 209 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 210 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 211 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 212 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 213 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 214 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 215 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 216 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 217 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 218 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 219 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 220 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 221 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 222 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 223 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 224 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 225 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 226 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 227 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 228 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 229 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 230 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 231 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 232 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 233 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 234 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 235 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 236 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 237 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 238 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 240 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 241 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 242 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 244 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 245 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 246 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 247 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 248 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 249 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 250 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 251 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 252 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 253 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 254 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 255 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 256 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 257 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 258 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 259 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 260 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 261 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 262 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 263 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 264 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 265 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 266 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 267 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 268 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 269 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 270 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 271 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 272 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 273 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 274 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 275 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 276 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 277 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 278 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 279 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 280 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 281 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 282 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 325 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 326 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 327 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 328 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 334 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 335 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 336 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 337 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 338 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 339 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 340 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 341 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 342 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 343 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 344 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 345 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 346 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 347 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 348 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 349 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 350 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 351 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 352 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 353 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 354 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 355 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 356 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 357 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 358 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 359 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 360 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 361 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 362 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 363 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 364 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 365 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 366 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 367 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 368 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 369 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 370 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 371 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 372 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 373 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 374 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 375 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 376 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 377 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 378 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 379 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 380 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 381 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 382 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 439 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 440 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 441 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 442 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 443 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 444 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 445 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 446 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 447 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 448 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 449 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 450 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 451 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 452 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 453 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 454 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 455 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 456 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 457 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 458 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 459 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 460 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 461 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 462 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 463 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 467 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 470 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 472 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 473 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 474 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 475 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 476 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 477 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 478 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 479 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 480 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 481 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 482 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 483 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 484 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 485 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 486 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 487 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 488 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 489 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 490 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 491 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 492 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 493 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 494 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 497 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 499 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 500 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 501 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 502 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 503 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 504 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 505 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 506 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 507 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 508 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 509 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 510 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 511 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 512 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 513 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 514 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 515 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 516 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 517 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 518 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 519 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 520 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 521 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 522 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 523 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 524 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 525 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 526 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 527 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 528 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 529 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 530 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 531 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 532 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 533 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
| 534 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 535 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 536 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 537 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 538 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 539 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 540 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 541 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 542 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 543 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 544 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 545 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 546 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 547 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 548 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 549 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 550 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 551 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 552 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 553 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 554 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 555 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 556 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 557 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 558 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 559 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 560 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 561 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 562 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 563 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 564 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 565 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 566 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 567 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.71 |
| Metatranscriptomes | 0 |
| Isolates | 20.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.48 |
| Nodule | 18.03 |
| Rhizoplane | 6.76 |
| Rhizosphere | 54.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10013644 | 3300001989 | Bacteria | 2963 |
| 2 | JGI24735J21928_10025316 | 3300002067 | Bacteria | 1791 |
| 3 | JGI25406J46586_10005786 | 3300003203 | Bacteria | 5719 |
| 4 | JGI25165J46597_1004010 | 3300003214 | Bacteria | 3349 |
| 5 | JGI25165J46597_1004774 | 3300003214 | Bacteria | 2786 |
| 6 | JGI25153J46596_10008980 | 3300003215 | Bacteria | 4707 |
| 7 | JGI25153J46596_10013010 | 3300003215 | Bacteria | 3547 |
| 8 | JGI25153J46596_10016633 | 3300003215 | Bacteria | 2934 |
| 9 | JGI25153J46596_10019877 | 3300003215 | Bacteria | 2556 |
| 10 | JGI25153J46596_10030363 | 3300003215 | Bacteria | 1840 |
| 11 | JGI25160J50197_1002626 | 3300003354 | Bacteria | 8277 |
| 12 | Ga0065165_1004408 | 3300005262 | Bacteria | 8766 |
| 13 | Ga0065165_1005651 | 3300005262 | Bacteria | 6913 |
| 14 | Ga0065165_1008089 | 3300005262 | Bacteria | 5014 |
| 15 | Ga0065704_10070332 | 3300005289 | Bacteria | 31943 |
| 16 | Ga0070658_10055370 | 3300005327 | Bacteria | 3223 |
| 17 | Ga0070683_100144293 | 3300005329 | Bacteria | 2256 |
| 18 | Ga0070683_100206815 | 3300005329 | Bacteria | 1864 |
| 19 | Ga0070670_100129126 | 3300005331 | Bacteria | 2182 |
| 20 | Ga0068869_100011774 | 3300005334 | Bacteria | 5753 |
| 21 | Ga0068869_100024984 | 3300005334 | Bacteria | 4143 |
| 22 | Ga0070680_100049028 | 3300005336 | Bacteria | 3442 |
| 23 | Ga0070680_100089673 | 3300005336 | Bacteria | 2544 |
| 24 | Ga0070680_100101875 | 3300005336 | Bacteria | 2384 |
| 25 | Ga0068868_100061300 | 3300005338 | Bacteria | 2980 |
| 26 | Ga0068868_100070715 | 3300005338 | Bacteria | 2782 |
| 27 | Ga0070660_100015960 | 3300005339 | Bacteria | 5440 |
| 28 | Ga0070660_100174624 | 3300005339 | Bacteria | 1737 |
| 29 | Ga0070691_10013655 | 3300005341 | Bacteria | 3723 |
| 30 | Ga0070668_100056424 | 3300005347 | Bacteria | 3033 |
| 31 | Ga0070668_100087515 | 3300005347 | Bacteria | 2451 |
| 32 | Ga0070668_100146050 | 3300005347 | Bacteria | 1909 |
| 33 | Ga0070668_100223338 | 3300005347 | Bacteria | 1554 |
| 34 | Ga0070669_100053671 | 3300005353 | Bacteria | 2950 |
| 35 | Ga0070671_100124208 | 3300005355 | Bacteria | 2172 |
| 36 | Ga0070674_100018087 | 3300005356 | Bacteria | 4448 |
| 37 | Ga0070659_100035956 | 3300005366 | Bacteria | 3859 |
| 38 | Ga0070667_100092241 | 3300005367 | Bacteria | 2605 |
| 39 | Ga0070709_10001202 | 3300005434 | Bacteria | 14225 |
| 40 | Ga0070709_10010701 | 3300005434 | Bacteria | 5089 |
| 41 | Ga0070709_10063877 | 3300005434 | Bacteria | 2353 |
| 42 | Ga0070709_10095195 | 3300005434 | Bacteria | 1972 |
| 43 | Ga0070714_100043807 | 3300005435 | Bacteria | 3787 |
| 44 | Ga0070714_100054175 | 3300005435 | Bacteria | 3426 |
| 45 | Ga0070714_100211245 | 3300005435 | Bacteria | 1779 |
| 46 | Ga0070713_100003811 | 3300005436 | Bacteria | 9975 |
| 47 | Ga0070713_100016005 | 3300005436 | Bacteria | 5628 |
| 48 | Ga0070713_100048160 | 3300005436 | Bacteria | 3508 |
| 49 | Ga0070710_10003163 | 3300005437 | Bacteria | 7808 |
| 50 | Ga0070710_10023913 | 3300005437 | Bacteria | 3217 |
| 51 | Ga0070711_100021396 | 3300005439 | Bacteria | 4182 |
| 52 | Ga0070711_100057793 | 3300005439 | Bacteria | 2687 |
| 53 | Ga0070663_100038640 | 3300005455 | Bacteria | 3330 |
| 54 | Ga0070678_100066627 | 3300005456 | Bacteria | 2677 |
| 55 | Ga0070662_100033636 | 3300005457 | Bacteria | 3611 |
| 56 | Ga0070662_100040915 | 3300005457 | Bacteria | 3303 |
| 57 | Ga0068867_100029024 | 3300005459 | Bacteria | 3985 |
| 58 | Ga0070685_10007116 | 3300005466 | Bacteria | 5713 |
| 59 | Ga0070706_100132226 | 3300005467 | Bacteria | 2329 |
| 60 | Ga0070698_100114551 | 3300005471 | Bacteria | 2661 |
| 61 | Ga0070699_100076792 | 3300005518 | Bacteria | 2908 |
| 62 | Ga0070679_100007378 | 3300005530 | Bacteria | 10275 |
| 63 | Ga0070679_100015717 | 3300005530 | Bacteria | 7278 |
| 64 | Ga0070679_100330849 | 3300005530 | Bacteria | 1472 |
| 65 | Ga0070684_100005066 | 3300005535 | Bacteria | 10062 |
| 66 | Ga0070684_100022108 | 3300005535 | Bacteria | 5301 |
| 67 | Ga0068853_100017422 | 3300005539 | Bacteria | 5930 |
| 68 | Ga0068853_100023427 | 3300005539 | Bacteria | 5168 |
| 69 | Ga0068853_100178962 | 3300005539 | Bacteria | 1922 |
| 70 | Ga0070672_100035145 | 3300005543 | Bacteria | 3807 |
| 71 | Ga0070686_100027608 | 3300005544 | Bacteria | 3436 |
| 72 | Ga0070665_100030612 | 3300005548 | Bacteria | 5414 |
| 73 | Ga0070665_100188160 | 3300005548 | Bacteria | 2065 |
| 74 | Ga0068855_100011878 | 3300005563 | Bacteria | 10529 |
| 75 | Ga0068855_100012917 | 3300005563 | Bacteria | 10077 |
| 76 | Ga0068855_100024679 | 3300005563 | Bacteria | 7191 |
| 77 | Ga0070664_100210482 | 3300005564 | Bacteria | 1737 |
| 78 | Ga0068857_100004377 | 3300005577 | Bacteria | 11936 |
| 79 | Ga0068857_100018829 | 3300005577 | Bacteria | 6060 |
| 80 | Ga0068857_100177034 | 3300005577 | Bacteria | 1940 |
| 81 | Ga0068854_100007607 | 3300005578 | Bacteria | 6929 |
| 82 | Ga0068854_100066695 | 3300005578 | Bacteria | 2620 |
| 83 | Ga0068854_100093480 | 3300005578 | Bacteria | 2241 |
| 84 | Ga0068854_100107665 | 3300005578 | Bacteria | 2098 |
| 85 | Ga0068854_100211574 | 3300005578 | Bacteria | 1530 |
| 86 | Ga0068856_100000046 | 3300005614 | Bacteria | 109174 |
| 87 | Ga0068856_100026401 | 3300005614 | Bacteria | 5664 |
| 88 | Ga0068852_100040881 | 3300005616 | Bacteria | 3916 |
| 89 | Ga0068852_100086520 | 3300005616 | Bacteria | 2794 |
| 90 | Ga0068852_100090609 | 3300005616 | Bacteria | 2735 |
| 91 | Ga0068852_100190743 | 3300005616 | Bacteria | 1934 |
| 92 | Ga0068859_100089615 | 3300005617 | Bacteria | 3126 |
| 93 | Ga0068859_100376721 | 3300005617 | Bacteria | 1515 |
| 94 | Ga0068864_100043041 | 3300005618 | Bacteria | 3865 |
| 95 | Ga0068864_100103201 | 3300005618 | Bacteria | 2531 |
| 96 | Ga0068866_10023188 | 3300005718 | Bacteria | 2883 |
| 97 | Ga0068866_10080700 | 3300005718 | Bacteria | 1746 |
| 98 | Ga0068861_100064113 | 3300005719 | Bacteria | 2826 |
| 99 | Ga0068851_10005968 | 3300005834 | Bacteria | 5546 |
| 100 | Ga0068851_10060065 | 3300005834 | Bacteria | 1946 |
| 101 | Ga0068863_100039597 | 3300005841 | Bacteria | 4484 |
| 102 | Ga0068858_100032070 | 3300005842 | Bacteria | 4880 |
| 103 | Ga0068860_100001738 | 3300005843 | Bacteria | 23223 |
| 104 | Ga0068860_100127814 | 3300005843 | Bacteria | 2436 |
| 105 | Ga0068860_100306905 | 3300005843 | Bacteria | 1556 |
| 106 | Ga0068862_100048515 | 3300005844 | Bacteria | 3625 |
| 107 | Ga0068862_100070598 | 3300005844 | Bacteria | 3015 |
| 108 | Ga0081455_10005256 | 3300005937 | Bacteria | 14228 |
| 109 | Ga0081455_10017866 | 3300005937 | Bacteria | 6780 |
| 110 | Ga0081455_10061213 | 3300005937 | Bacteria | 3169 |
| 111 | Ga0081540_1001673 | 3300005983 | Bacteria | 18856 |
| 112 | Ga0081540_1002366 | 3300005983 | Bacteria | 15399 |
| 113 | Ga0081540_1002776 | 3300005983 | Bacteria | 14204 |
| 114 | Ga0081540_1003496 | 3300005983 | Bacteria | 12400 |
| 115 | Ga0081540_1021133 | 3300005983 | Bacteria | 3888 |
| 116 | Ga0081539_10000585 | 3300005985 | Bacteria | 74791 |
| 117 | Ga0081539_10001606 | 3300005985 | Bacteria | 37203 |
| 118 | Ga0081539_10030383 | 3300005985 | Bacteria | 3355 |
| 119 | Ga0070717_10005166 | 3300006028 | Bacteria | 9518 |
| 120 | Ga0070717_10032987 | 3300006028 | Bacteria | 4175 |
| 121 | Ga0070717_10051648 | 3300006028 | Bacteria | 3385 |
| 122 | Ga0075365_10019222 | 3300006038 | Bacteria | 4213 |
| 123 | Ga0075365_10022691 | 3300006038 | Bacteria | 3937 |
| 124 | Ga0075365_10051990 | 3300006038 | Bacteria | 2708 |
| 125 | Ga0075368_10007787 | 3300006042 | Bacteria | 3795 |
| 126 | Ga0075368_10021410 | 3300006042 | Bacteria | 2456 |
| 127 | Ga0075363_100007732 | 3300006048 | Bacteria | 4964 |
| 128 | Ga0075364_10028214 | 3300006051 | Bacteria | 3592 |
| 129 | Ga0075364_10052430 | 3300006051 | Bacteria | 2665 |
| 130 | Ga0075364_10211068 | 3300006051 | Bacteria | 1317 |
| 131 | Ga0070715_10004200 | 3300006163 | Bacteria | 4692 |
| 132 | Ga0070716_100001652 | 3300006173 | Bacteria | 10064 |
| 133 | Ga0070712_100020630 | 3300006175 | Bacteria | 4314 |
| 134 | Ga0070712_100023949 | 3300006175 | Bacteria | 4039 |
| 135 | Ga0075367_10014420 | 3300006178 | Bacteria | 4279 |
| 136 | Ga0075367_10049824 | 3300006178 | Bacteria | 2470 |
| 137 | Ga0075367_10084476 | 3300006178 | Bacteria | 1925 |
| 138 | Ga0075367_10098252 | 3300006178 | Bacteria | 1787 |
| 139 | Ga0075367_10123619 | 3300006178 | Bacteria | 1596 |
| 140 | Ga0075369_10061748 | 3300006186 | Bacteria | 1636 |
| 141 | Ga0075366_10003115 | 3300006195 | Bacteria | 8673 |
| 142 | Ga0097621_100308317 | 3300006237 | Bacteria | 1400 |
| 143 | Ga0068871_100018443 | 3300006358 | Bacteria | 5304 |
| 144 | Ga0075434_100082073 | 3300006871 | Bacteria | 3221 |
| 145 | Ga0068865_100114281 | 3300006881 | Bacteria | 1996 |
| 146 | Ga0097620_100089618 | 3300006931 | Bacteria | 3126 |
| 147 | Ga0097620_100376717 | 3300006931 | Bacteria | 1515 |
| 148 | Ga0099824_1003256 | 3300006942 | Bacteria | 23739 |
| 149 | Ga0099824_1018316 | 3300006942 | Bacteria | 5785 |
| 150 | Ga0099822_1004597 | 3300006943 | Bacteria | 17990 |
| 151 | Ga0099823_1026917 | 3300006944 | Bacteria | 5045 |
| 152 | Ga0099794_10044796 | 3300007265 | Bacteria | 2115 |
| 153 | Ga0105240_10013102 | 3300009093 | Bacteria | 11411 |
| 154 | Ga0105240_10030379 | 3300009093 | Bacteria | 7023 |
| 155 | Ga0105240_10072778 | 3300009093 | Bacteria | 4247 |
| 156 | Ga0105240_10099112 | 3300009093 | Bacteria | 3547 |
| 157 | Ga0105240_10112091 | 3300009093 | Bacteria | 3298 |
| 158 | Ga0105240_10162984 | 3300009093 | Bacteria | 2647 |
| 159 | Ga0105240_10167449 | 3300009093 | Bacteria | 2605 |
| 160 | Ga0105245_10007957 | 3300009098 | Bacteria | 9269 |
| 161 | Ga0105245_10231046 | 3300009098 | Bacteria | 1789 |
| 162 | Ga0105243_10085790 | 3300009148 | Bacteria | 2581 |
| 163 | Ga0105241_10008432 | 3300009174 | Bacteria | 7578 |
| 164 | Ga0105241_10015297 | 3300009174 | Bacteria | 5618 |
| 165 | Ga0105241_10167678 | 3300009174 | Bacteria | 1811 |
| 166 | Ga0105242_10112498 | 3300009176 | Bacteria | 2323 |
| 167 | Ga0105237_10007238 | 3300009545 | Bacteria | 12171 |
| 168 | Ga0105237_10024463 | 3300009545 | Bacteria | 6177 |
| 169 | Ga0105237_10029665 | 3300009545 | Bacteria | 5558 |
| 170 | Ga0105237_10049111 | 3300009545 | Bacteria | 4243 |
| 171 | Ga0105237_10312233 | 3300009545 | Bacteria | 1575 |
| 172 | Ga0105238_10002788 | 3300009551 | Bacteria | 17442 |
| 173 | Ga0105238_10019066 | 3300009551 | Bacteria | 6989 |
| 174 | Ga0105238_10019125 | 3300009551 | Bacteria | 6978 |
| 175 | Ga0105238_10030290 | 3300009551 | Bacteria | 5508 |
| 176 | Ga0105238_10071778 | 3300009551 | Bacteria | 3459 |
| 177 | Ga0105249_10022299 | 3300009553 | Bacteria | 5672 |
| 178 | Ga0105239_10022535 | 3300010375 | Bacteria | 6944 |
| 179 | Ga0105239_10027593 | 3300010375 | Bacteria | 6248 |
| 180 | Ga0105239_10054445 | 3300010375 | Bacteria | 4388 |
| 181 | Ga0105239_10060216 | 3300010375 | Bacteria | 4167 |
| 182 | Ga0105239_10070576 | 3300010375 | Bacteria | 3838 |
| 183 | Ga0105239_10073800 | 3300010375 | Bacteria | 3751 |
| 184 | Ga0105239_10119042 | 3300010375 | Bacteria | 2931 |
| 185 | Ga0105239_10129001 | 3300010375 | Bacteria | 2811 |
| 186 | Ga0105239_10142409 | 3300010375 | Bacteria | 2672 |
| 187 | Ga0105239_10413418 | 3300010375 | Bacteria | 1527 |
| 188 | Ga0105246_10105134 | 3300011119 | Bacteria | 2063 |
| 189 | Ga0157370_10007873 | 3300013104 | Bacteria | 11550 |
| 190 | Ga0157370_10106780 | 3300013104 | Bacteria | 2620 |
| 191 | Ga0157370_10273247 | 3300013104 | Bacteria | 1561 |
| 192 | Ga0157369_10007217 | 3300013105 | Bacteria | 12807 |
| 193 | Ga0157369_10017046 | 3300013105 | Bacteria | 8162 |
| 194 | Ga0157369_10022283 | 3300013105 | Bacteria | 7072 |
| 195 | Ga0157374_10026351 | 3300013296 | Bacteria | 5231 |
| 196 | Ga0157374_10202426 | 3300013296 | Bacteria | 1944 |
| 197 | Ga0157374_10206425 | 3300013296 | Bacteria | 1925 |
| 198 | Ga0157378_10003222 | 3300013297 | Bacteria | 14517 |
| 199 | Ga0157378_10073464 | 3300013297 | Bacteria | 3075 |
| 200 | Ga0157378_10123168 | 3300013297 | Bacteria | 2392 |
| 201 | Ga0163162_10153430 | 3300013306 | Bacteria | 2422 |
| 202 | Ga0163162_10274148 | 3300013306 | Bacteria | 1819 |
| 203 | Ga0157375_10029256 | 3300013308 | Bacteria | 5178 |
| 204 | Ga0157375_10145312 | 3300013308 | Bacteria | 2502 |
| 205 | Ga0163163_10030032 | 3300014325 | Bacteria | 5232 |
| 206 | Ga0163163_10190091 | 3300014325 | Bacteria | 2102 |
| 207 | Ga0163163_10197585 | 3300014325 | Bacteria | 2059 |
| 208 | Ga0157380_10070533 | 3300014326 | Bacteria | 2824 |
| 209 | Ga0157380_10095888 | 3300014326 | Bacteria | 2459 |
| 210 | Ga0157379_10169060 | 3300014968 | Bacteria | 1973 |
| 211 | Ga0157376_10034960 | 3300014969 | Bacteria | 4061 |
| 212 | Ga0163161_10030838 | 3300017792 | Bacteria | 3817 |
| 213 | Ga0214544_1000007 | 3300021320 | Bacteria | 379989 |
| 214 | Ga0214542_1000007 | 3300021321 | Bacteria | 291816 |
| 215 | Ga0214545_1000006 | 3300021324 | Bacteria | 291693 |
| 216 | Ga0214543_1000009 | 3300021327 | Bacteria | 384302 |
| 217 | Ga0213871_10032557 | 3300021441 | Bacteria | 1366 |
| 218 | Ga0209148_1000335 | 3300025254 | Bacteria | 63754 |
| 219 | Ga0209233_1001244 | 3300025261 | Bacteria | 10240 |
| 220 | Ga0209233_1015771 | 3300025261 | Bacteria | 2095 |
| 221 | Ga0209455_1001768 | 3300025272 | Bacteria | 9156 |
| 222 | Ga0209564_1000971 | 3300025295 | Bacteria | 36259 |
| 223 | Ga0209564_1005380 | 3300025295 | Bacteria | 7336 |
| 224 | Ga0209564_1007038 | 3300025295 | Bacteria | 5896 |
| 225 | Ga0209564_1019099 | 3300025295 | Bacteria | 2578 |
| 226 | Ga0209758_1000106 | 3300025297 | Bacteria | 218450 |
| 227 | Ga0209758_1000344 | 3300025297 | Bacteria | 85133 |
| 228 | Ga0209758_1001622 | 3300025297 | Bacteria | 25624 |
| 229 | Ga0209758_1002973 | 3300025297 | Bacteria | 16248 |
| 230 | Ga0209758_1007055 | 3300025297 | Bacteria | 7794 |
| 231 | Ga0209758_1012733 | 3300025297 | Bacteria | 4667 |
| 232 | Ga0209758_1016727 | 3300025297 | Bacteria | 3705 |
| 233 | Ga0209256_1014971 | 3300025299 | Bacteria | 2745 |
| 234 | Ga0207426_1000819 | 3300025302 | Bacteria | 33379 |
| 235 | Ga0207426_1004720 | 3300025302 | Bacteria | 6519 |
| 236 | Ga0207426_1012541 | 3300025302 | Bacteria | 3178 |
| 237 | Ga0207426_1012642 | 3300025302 | Bacteria | 3163 |
| 238 | Ga0209051_1021162 | 3300025303 | Bacteria | 2779 |
| 239 | Ga0209257_1012480 | 3300025304 | Bacteria | 3916 |
| 240 | Ga0207696_1000560 | 3300025711 | Bacteria | 29472 |
| 241 | Ga0207692_10000264 | 3300025898 | Bacteria | 17986 |
| 242 | Ga0207692_10053897 | 3300025898 | Bacteria | 2050 |
| 243 | Ga0207688_10040757 | 3300025901 | Bacteria | 2581 |
| 244 | Ga0207688_10054206 | 3300025901 | Bacteria | 2249 |
| 245 | Ga0207647_10003678 | 3300025904 | Bacteria | 11473 |
| 246 | Ga0207699_10014138 | 3300025906 | Bacteria | 4105 |
| 247 | Ga0207699_10037075 | 3300025906 | Bacteria | 2784 |
| 248 | Ga0207699_10057243 | 3300025906 | Bacteria | 2327 |
| 249 | Ga0207699_10075669 | 3300025906 | Bacteria | 2071 |
| 250 | Ga0207643_10077208 | 3300025908 | Bacteria | 1925 |
| 251 | Ga0207705_10063283 | 3300025909 | Bacteria | 2673 |
| 252 | Ga0207707_10000575 | 3300025912 | Bacteria | 37261 |
| 253 | Ga0207707_10005305 | 3300025912 | Bacteria | 11268 |
| 254 | Ga0207695_10000123 | 3300025913 | Bacteria | 232059 |
| 255 | Ga0207695_10006774 | 3300025913 | Bacteria | 14771 |
| 256 | Ga0207695_10037000 | 3300025913 | Bacteria | 5269 |
| 257 | Ga0207695_10235647 | 3300025913 | Bacteria | 1733 |
| 258 | Ga0207695_10251545 | 3300025913 | Bacteria | 1666 |
| 259 | Ga0207671_10005835 | 3300025914 | Bacteria | 11190 |
| 260 | Ga0207671_10014011 | 3300025914 | Bacteria | 6360 |
| 261 | Ga0207671_10018857 | 3300025914 | Bacteria | 5287 |
| 262 | Ga0207671_10067553 | 3300025914 | Bacteria | 2662 |
| 263 | Ga0207693_10001910 | 3300025915 | Bacteria | 18229 |
| 264 | Ga0207693_10002004 | 3300025915 | Bacteria | 17879 |
| 265 | Ga0207693_10023244 | 3300025915 | Bacteria | 4923 |
| 266 | Ga0207693_10029960 | 3300025915 | Bacteria | 4295 |
| 267 | Ga0207693_10054652 | 3300025915 | Bacteria | 3132 |
| 268 | Ga0207663_10000684 | 3300025916 | Bacteria | 15034 |
| 269 | Ga0207660_10008892 | 3300025917 | Bacteria | 6493 |
| 270 | Ga0207660_10032853 | 3300025917 | Bacteria | 3584 |
| 271 | Ga0207657_10011680 | 3300025919 | Bacteria | 8704 |
| 272 | Ga0207657_10027023 | 3300025919 | Bacteria | 5261 |
| 273 | Ga0207652_10005891 | 3300025921 | Bacteria | 9919 |
| 274 | Ga0207652_10014514 | 3300025921 | Bacteria | 6382 |
| 275 | Ga0207652_10081825 | 3300025921 | Bacteria | 2824 |
| 276 | Ga0207694_10006382 | 3300025924 | Bacteria | 8990 |
| 277 | Ga0207694_10012632 | 3300025924 | Bacteria | 6364 |
| 278 | Ga0207694_10019123 | 3300025924 | Bacteria | 5178 |
| 279 | Ga0207659_10056798 | 3300025926 | Bacteria | 2804 |
| 280 | Ga0207687_10032786 | 3300025927 | Bacteria | 3520 |
| 281 | Ga0207687_10056601 | 3300025927 | Bacteria | 2751 |
| 282 | Ga0207687_10239914 | 3300025927 | Bacteria | 1436 |
| 283 | Ga0207700_10006661 | 3300025928 | Bacteria | 7004 |
| 284 | Ga0207700_10011618 | 3300025928 | Bacteria | 5626 |
| 285 | Ga0207700_10017252 | 3300025928 | Bacteria | 4818 |
| 286 | Ga0207700_10115569 | 3300025928 | Bacteria | 2167 |
| 287 | Ga0207664_10008459 | 3300025929 | Bacteria | 7179 |
| 288 | Ga0207664_10052199 | 3300025929 | Bacteria | 3233 |
| 289 | Ga0207644_10058184 | 3300025931 | Bacteria | 2793 |
| 290 | Ga0207644_10083738 | 3300025931 | Bacteria | 2363 |
| 291 | Ga0207690_10056649 | 3300025932 | Bacteria | 2645 |
| 292 | Ga0207706_10070643 | 3300025933 | Bacteria | 3071 |
| 293 | Ga0207706_10086337 | 3300025933 | Bacteria | 2758 |
| 294 | Ga0207686_10033506 | 3300025934 | Bacteria | 3067 |
| 295 | Ga0207665_10001660 | 3300025939 | Bacteria | 14973 |
| 296 | Ga0207665_10033566 | 3300025939 | Bacteria | 3403 |
| 297 | Ga0207691_10037606 | 3300025940 | Bacteria | 4481 |
| 298 | Ga0207689_10019363 | 3300025942 | Bacteria | 5737 |
| 299 | Ga0207689_10048121 | 3300025942 | Bacteria | 3517 |
| 300 | Ga0207689_10059119 | 3300025942 | Bacteria | 3153 |
| 301 | Ga0207661_10000727 | 3300025944 | Bacteria | 21473 |
| 302 | Ga0207661_10002678 | 3300025944 | Bacteria | 12262 |
| 303 | Ga0207667_10003446 | 3300025949 | Bacteria | 19521 |
| 304 | Ga0207667_10022727 | 3300025949 | Bacteria | 6918 |
| 305 | Ga0207667_10050466 | 3300025949 | Bacteria | 4389 |
| 306 | Ga0207667_10080586 | 3300025949 | Bacteria | 3373 |
| 307 | Ga0207667_10195800 | 3300025949 | Bacteria | 2073 |
| 308 | Ga0207667_10215786 | 3300025949 | Bacteria | 1966 |
| 309 | Ga0207668_10024248 | 3300025972 | Bacteria | 3912 |
| 310 | Ga0207668_10101009 | 3300025972 | Bacteria | 2143 |
| 311 | Ga0207668_10203213 | 3300025972 | Bacteria | 1579 |
| 312 | Ga0207640_10023994 | 3300025981 | Bacteria | 3673 |
| 313 | Ga0207640_10046213 | 3300025981 | Bacteria | 2800 |
| 314 | Ga0207640_10261182 | 3300025981 | Bacteria | 1349 |
| 315 | Ga0207677_10028853 | 3300026023 | Bacteria | 3517 |
| 316 | Ga0207677_10032157 | 3300026023 | Bacteria | 3370 |
| 317 | Ga0207703_10014373 | 3300026035 | Bacteria | 6173 |
| 318 | Ga0207703_10036684 | 3300026035 | Bacteria | 3903 |
| 319 | Ga0207703_10041661 | 3300026035 | Bacteria | 3681 |
| 320 | Ga0207703_10046636 | 3300026035 | Bacteria | 3491 |
| 321 | Ga0207639_10008373 | 3300026041 | Bacteria | 7088 |
| 322 | Ga0207639_10048136 | 3300026041 | Bacteria | 3225 |
| 323 | Ga0207639_10080896 | 3300026041 | Bacteria | 2572 |
| 324 | Ga0207678_10015465 | 3300026067 | Bacteria | 6708 |
| 325 | Ga0207678_10092405 | 3300026067 | Bacteria | 2586 |
| 326 | Ga0207678_10108112 | 3300026067 | Bacteria | 2372 |
| 327 | Ga0207678_10135176 | 3300026067 | Bacteria | 2104 |
| 328 | Ga0207678_10194201 | 3300026067 | Bacteria | 1735 |
| 329 | Ga0207702_10000003 | 3300026078 | Bacteria | 434196 |
| 330 | Ga0207702_10000014 | 3300026078 | Bacteria | 253304 |
| 331 | Ga0207702_10106163 | 3300026078 | Bacteria | 2488 |
| 332 | Ga0207648_10033893 | 3300026089 | Bacteria | 4503 |
| 333 | Ga0207676_10119667 | 3300026095 | Bacteria | 2218 |
| 334 | Ga0207676_10144666 | 3300026095 | Bacteria | 2040 |
| 335 | Ga0207674_10003672 | 3300026116 | Bacteria | 18726 |
| 336 | Ga0207674_10013223 | 3300026116 | Bacteria | 9176 |
| 337 | Ga0207674_10017295 | 3300026116 | Bacteria | 7867 |
| 338 | Ga0207674_10029815 | 3300026116 | Bacteria | 5740 |
| 339 | Ga0207675_100025081 | 3300026118 | Bacteria | 5549 |
| 340 | Ga0207675_100037081 | 3300026118 | Bacteria | 4548 |
| 341 | Ga0207675_100189164 | 3300026118 | Bacteria | 1974 |
| 342 | Ga0207683_10016200 | 3300026121 | Bacteria | 6345 |
| 343 | Ga0207683_10034454 | 3300026121 | Bacteria | 4400 |
| 344 | Ga0207683_10138572 | 3300026121 | Bacteria | 2191 |
| 345 | Ga0207698_10041783 | 3300026142 | Bacteria | 3420 |
| 346 | Ga0207698_10119439 | 3300026142 | Bacteria | 2228 |
| 347 | Ga0209389_1000016 | 3300027296 | Bacteria | 184844 |
| 348 | Ga0209389_1006299 | 3300027296 | Bacteria | 10277 |
| 349 | Ga0209589_1000005 | 3300027357 | Bacteria | 530958 |
| 350 | Ga0209589_1000031 | 3300027357 | Bacteria | 147054 |
| 351 | Ga0209489_100005 | 3300027361 | Bacteria | 530958 |
| 352 | Ga0209489_100057 | 3300027361 | Bacteria | 147398 |
| 353 | Ga0209489_100063 | 3300027361 | Bacteria | 144408 |
| 354 | Ga0209700_100006 | 3300027363 | Bacteria | 530958 |
| 355 | Ga0209700_100012 | 3300027363 | Bacteria | 357892 |
| 356 | Ga0209179_1007032 | 3300027512 | Bacteria | 1842 |
| 357 | Ga0209588_1004507 | 3300027671 | Bacteria | 3934 |
| 358 | Ga0268266_10002572 | 3300028379 | Bacteria | 19242 |
| 359 | Ga0268266_10006470 | 3300028379 | Bacteria | 10721 |
| 360 | Ga0268266_10088547 | 3300028379 | Bacteria | 2709 |
| 361 | Ga0268265_10043749 | 3300028380 | Bacteria | 3330 |
| 362 | Ga0268265_10058502 | 3300028380 | Bacteria | 2943 |
| 363 | Ga0268264_10000042 | 3300028381 | Bacteria | 372069 |
| 364 | Ga0268264_10106463 | 3300028381 | Bacteria | 2448 |
| 365 | Ga0268264_10157323 | 3300028381 | Bacteria | 2043 |
| 366 | Ga0268264_10203776 | 3300028381 | Bacteria | 1812 |
| 367 | Ga0265323_10002731 | 3300028653 | Bacteria | 7956 |
| 368 | Ga0265336_10006513 | 3300028666 | Bacteria | 4205 |
| 369 | Ga0307517_10000542 | 3300028786 | Bacteria | 64617 |
| 370 | Ga0307517_10103031 | 3300028786 | Bacteria | 2233 |
| 371 | Ga0307515_10011730 | 3300028794 | Bacteria | 16583 |
| 372 | Ga0265338_10001876 | 3300028800 | Bacteria | 32924 |
| 373 | Ga0265330_10017807 | 3300031235 | Bacteria | 3269 |
| 374 | Ga0265332_10009250 | 3300031238 | Bacteria | 4402 |
| 375 | Ga0265328_10000019 | 3300031239 | Bacteria | 130536 |
| 376 | Ga0265328_10003191 | 3300031239 | Bacteria | 7276 |
| 377 | Ga0265328_10004115 | 3300031239 | Bacteria | 6350 |
| 378 | Ga0265325_10023765 | 3300031241 | Bacteria | 3341 |
| 379 | Ga0265340_10004701 | 3300031247 | Bacteria | 7593 |
| 380 | Ga0265340_10012973 | 3300031247 | Bacteria | 4391 |
| 381 | Ga0265339_10002202 | 3300031249 | Bacteria | 14147 |
| 382 | Ga0265339_10016301 | 3300031249 | Bacteria | 4433 |
| 383 | Ga0265331_10000057 | 3300031250 | Bacteria | 175827 |
| 384 | Ga0265331_10006010 | 3300031250 | Bacteria | 7241 |
| 385 | Ga0265316_10089842 | 3300031344 | Bacteria | 2344 |
| 386 | Ga0307513_10266762 | 3300031456 | Bacteria | 1498 |
| 387 | Ga0307509_10083085 | 3300031507 | Bacteria | 3302 |
| 388 | Ga0307508_10000019 | 3300031616 | Bacteria | 197575 |
| 389 | Ga0307508_10071751 | 3300031616 | Bacteria | 3037 |
| 390 | Ga0265314_10020295 | 3300031711 | Bacteria | 5129 |
| 391 | Ga0265314_10030455 | 3300031711 | Bacteria | 3994 |
| 392 | Ga0265342_10012767 | 3300031712 | Bacteria | 5673 |
| 393 | Ga0307405_10048853 | 3300031731 | Bacteria | 2612 |
| 394 | Ga0307415_100063976 | 3300032126 | Bacteria | 2558 |
| 395 | Ga0307510_10115942 | 3300033180 | Bacteria | 2402 |
| 396 | Ga0307510_10145585 | 3300033180 | Bacteria | 2002 |
| 397 | Ga0315911_1000012 | 3300033442 | Bacteria | 248988 |
| 398 | Ga0373934_0030873 | 3300035086 | Bacteria | 2097 |
| 399 | Ga0373944_0018534 | 3300035089 | Bacteria | 1989 |
| 400 | Ga0373923_0004450 | 3300035111 | Bacteria | 4649 |
| 401 | Ga0373936_0016236 | 3300035113 | Bacteria | 2863 |
| 402 | Ga0373936_0030237 | 3300035113 | Bacteria | 2136 |
| 403 | Ga0373954_0008297 | 3300035118 | Bacteria | 4557 |
| 404 | Ga0373954_0008487 | 3300035118 | Bacteria | 4511 |
| 405 | Ga0373946_0010355 | 3300035171 | Bacteria | 3449 |
| 406 | Ga0373946_0022473 | 3300035171 | Bacteria | 2456 |
| 407 | Ga0373955_0006973 | 3300035172 | Bacteria | 5171 |
| 408 | Ga0373924_0024123 | 3300035410 | Bacteria | 2394 |
| 409 | Ga0373924_0043449 | 3300035410 | Bacteria | 1845 |
| 410 | Ga0373927_0007379 | 3300035695 | Bacteria | 7440 |
| 411 | Ga0373933_0000063 | 3300035724 | Bacteria | 64367 |
| 412 | Ga0373933_0003606 | 3300035724 | Bacteria | 8588 |
| 413 | Ga0373947_0028315 | 3300035725 | Bacteria | 3284 |
| 414 | Ga0373947_0085843 | 3300035725 | Bacteria | 1955 |
| 415 | Ga0373937_0053044 | 3300036401 | Bacteria | 3719 |
| 416 | Ga0373937_0057792 | 3300036401 | Bacteria | 3564 |
| 417 | Ga0373937_0087029 | 3300036401 | Bacteria | 2891 |
| 418 | Ga0373925_0019502 | 3300037068 | Bacteria | 4934 |
| 419 | Ga0373925_0022023 | 3300037068 | Bacteria | 4644 |
| 420 | Ga0373925_0025305 | 3300037068 | Bacteria | 4336 |
| 421 | Ga0373925_0038739 | 3300037068 | Bacteria | 3525 |
| 422 | Ga0395900_0001282 | 3300037418 | Bacteria | 30694 |
| 423 | Ga0395900_0067613 | 3300037418 | Bacteria | 3671 |
| 424 | Ga0395900_0341655 | 3300037418 | Bacteria | 1472 |
| 425 | Ga0395898_0027294 | 3300037466 | Bacteria | 5734 |
| 426 | Ga0395898_0085381 | 3300037466 | Bacteria | 3042 |
| 427 | Ga0395898_0087149 | 3300037466 | Bacteria | 3008 |
| 428 | Ga0395898_0088298 | 3300037466 | Bacteria | 2985 |
| 429 | Ga0395898_0096861 | 3300037466 | Bacteria | 2834 |
| 430 | Ga0395901_0014860 | 3300038443 | Bacteria | 7909 |
| 431 | Ga0395901_0224459 | 3300038443 | Bacteria | 1963 |
| 432 | Ga0395901_0318392 | 3300038443 | Bacteria | 1610 |
| 433 | Ga0436365_1202634 | 3300039437 | Bacteria | 25883 |
| 434 | Ga0436365_1288625 | 3300039437 | Bacteria | 2516 |
| 435 | Ga0436363_0080461 | 3300039450 | Bacteria | 4222 |
| 436 | Ga0436362_0204850 | 3300039453 | Bacteria | 1764 |
| 437 | Ga0466972_0000236 | 3300044658 | Bacteria | 38201 |
| 438 | Ga0466972_0063454 | 3300044658 | Bacteria | 1769 |
| 439 | Ga0466966_0000288 | 3300044684 | Bacteria | 33104 |
| 440 | Ga0466966_0035051 | 3300044684 | Bacteria | 3244 |
| 441 | Ga0466961_0000235 | 3300044693 | Bacteria | 37337 |
| 442 | Ga0466963_0086943 | 3300044694 | Bacteria | 2125 |
| 443 | Ga0466964_0031049 | 3300044706 | Bacteria | 2117 |
| 444 | Ga0466964_0079553 | 3300044706 | Bacteria | 1404 |
| 445 | Ga0466968_0016360 | 3300044735 | Bacteria | 2952 |
| 446 | Ga0466960_0019224 | 3300044901 | Bacteria | 3006 |
| 447 | Ga0466959_0006430 | 3300045049 | Bacteria | 8136 |
| 448 | Ga0466959_0009264 | 3300045049 | Bacteria | 6997 |
| 449 | Ga0466959_0027342 | 3300045049 | Bacteria | 4232 |
| 450 | Ga0495617_039677 | 3300046452 | Bacteria | 1575 |
| 451 | Ga0495592_0050471 | 3300046454 | Bacteria | 3091 |
| 452 | Ga0495592_0081475 | 3300046454 | Bacteria | 2340 |
| 453 | Ga0495603_0023144 | 3300046455 | Bacteria | 3761 |
| 454 | Ga0495629_0002515 | 3300046459 | Bacteria | 14070 |
| 455 | Ga0495629_0008117 | 3300046459 | Bacteria | 7727 |
| 456 | Ga0495629_0038364 | 3300046459 | Bacteria | 3374 |
| 457 | Ga0495629_0160184 | 3300046459 | Bacteria | 1563 |
| 458 | Ga0495638_0026917 | 3300046460 | Bacteria | 3725 |
| 459 | Ga0495651_0045854 | 3300046462 | Bacteria | 3385 |
| 460 | Ga0495651_0067067 | 3300046462 | Bacteria | 2738 |
| 461 | Ga0495653_0003036 | 3300046463 | Bacteria | 13460 |
| 462 | Ga0495582_0019551 | 3300046473 | Bacteria | 3704 |
| 463 | Ga0495605_0029156 | 3300046474 | Bacteria | 2844 |
| 464 | Ga0495605_0056394 | 3300046474 | Bacteria | 1895 |
| 465 | Ga0495605_0072470 | 3300046474 | Bacteria | 1624 |
| 466 | Ga0495639_0009404 | 3300046475 | Bacteria | 4191 |
| 467 | Ga0495664_0006419 | 3300046477 | Bacteria | 6493 |
| 468 | Ga0495664_0042090 | 3300046477 | Bacteria | 2704 |
| 469 | Ga0495664_0065981 | 3300046477 | Bacteria | 2158 |
| 470 | Ga0495584_0070347 | 3300046491 | Bacteria | 1759 |
| 471 | Ga0495583_0024173 | 3300046506 | Bacteria | 3059 |
| 472 | Ga0495583_0063342 | 3300046506 | Bacteria | 1644 |
| 473 | Ga0495606_0003865 | 3300046507 | Bacteria | 15462 |
| 474 | Ga0495606_0029482 | 3300046507 | Bacteria | 3851 |
| 475 | Ga0495608_0043419 | 3300046511 | Bacteria | 3003 |
| 476 | Ga0495608_0130491 | 3300046511 | Bacteria | 1608 |
| 477 | Ga0495616_0088388 | 3300046513 | Bacteria | 1471 |
| 478 | Ga0495618_0052160 | 3300046514 | Bacteria | 2585 |
| 479 | Ga0495628_0049043 | 3300046516 | Bacteria | 3344 |
| 480 | Ga0495628_0094609 | 3300046516 | Bacteria | 2309 |
| 481 | Ga0495631_0017099 | 3300046518 | Bacteria | 3437 |
| 482 | Ga0495632_0030931 | 3300046519 | Bacteria | 2773 |
| 483 | Ga0495648_0000649 | 3300046524 | Bacteria | 37131 |
| 484 | Ga0495648_0031693 | 3300046524 | Bacteria | 3478 |
| 485 | Ga0495648_0044319 | 3300046524 | Bacteria | 2778 |
| 486 | Ga0495666_0053983 | 3300046526 | Bacteria | 1928 |
| 487 | Ga0495652_0016058 | 3300046529 | Bacteria | 6699 |
| 488 | Ga0495652_0033935 | 3300046529 | Bacteria | 4450 |
| 489 | Ga0495640_0042704 | 3300046533 | Bacteria | 3161 |
| 490 | Ga0495640_0045017 | 3300046533 | Bacteria | 3064 |
| 491 | Ga0495640_0080903 | 3300046533 | Bacteria | 2160 |
| 492 | Ga0495598_0014360 | 3300046537 | Bacteria | 1980 |
| 493 | Ga0495645_0046463 | 3300046543 | Bacteria | 3164 |
| 494 | Ga0495645_0196283 | 3300046543 | Bacteria | 1372 |
| 495 | Ga0495622_0004932 | 3300046557 | Bacteria | 6178 |
| 496 | Ga0495622_0015822 | 3300046557 | Bacteria | 3507 |
| 497 | Ga0495622_0038758 | 3300046557 | Bacteria | 2219 |
| 498 | Ga0495667_0012133 | 3300046559 | Bacteria | 5839 |
| 499 | Ga0495656_0019770 | 3300046615 | Bacteria | 2603 |
| 500 | Ga0495656_0030282 | 3300046615 | Bacteria | 2186 |
| 501 | Ga0495634_0007549 | 3300046642 | Bacteria | 8155 |
| 502 | Ga0495634_0029266 | 3300046642 | Bacteria | 3814 |
| 503 | Ga0495634_0038466 | 3300046642 | Bacteria | 3262 |
| 504 | Ga0495634_0057304 | 3300046642 | Bacteria | 2601 |
| 505 | Ga0495611_0080621 | 3300046648 | Bacteria | 1496 |
| 506 | Ga0495625_0042665 | 3300046660 | Bacteria | 3295 |
| 507 | Ga0495625_0086035 | 3300046660 | Bacteria | 2181 |
| 508 | Ga0495625_0175878 | 3300046660 | Bacteria | 1426 |
| 509 | Ga0495635_0004510 | 3300046663 | Bacteria | 9646 |
| 510 | Ga0495635_0004984 | 3300046663 | Bacteria | 9242 |
| 511 | Ga0495588_0001769 | 3300046674 | Bacteria | 9196 |
| 512 | Ga0495588_0023947 | 3300046674 | Bacteria | 3028 |
| 513 | Ga0495588_0063922 | 3300046674 | Bacteria | 1909 |
| 514 | Ga0495657_0038140 | 3300046675 | Bacteria | 3308 |
| 515 | Ga0495599_0017414 | 3300046678 | Bacteria | 4468 |
| 516 | Ga0495623_0014742 | 3300046679 | Bacteria | 5053 |
| 517 | Ga0495646_0028816 | 3300046680 | Bacteria | 3474 |
| 518 | Ga0495646_0066578 | 3300046680 | Bacteria | 2130 |
| 519 | Ga0495658_0022933 | 3300046683 | Bacteria | 3308 |
| 520 | Ga0495669_0080887 | 3300046684 | Bacteria | 1491 |
| 521 | Ga0495613_0070562 | 3300046689 | Bacteria | 2547 |
| 522 | Ga0495624_0091617 | 3300046690 | Bacteria | 1875 |
| 523 | Ga0495670_0051750 | 3300046691 | Bacteria | 2056 |
| 524 | Ga0495670_0100066 | 3300046691 | Bacteria | 1492 |
| 525 | Ga0495600_0001327 | 3300046809 | Bacteria | 13654 |
| 526 | Ga0495600_0037631 | 3300046809 | Bacteria | 3146 |
| 527 | Ga0495600_0038744 | 3300046809 | Bacteria | 3102 |
| 528 | Ga0495600_0070118 | 3300046809 | Bacteria | 2290 |
| 529 | Ga0495604_0005219 | 3300047317 | Bacteria | 10290 |
| 530 | Ga0495604_0024477 | 3300047317 | Bacteria | 4817 |
| 531 | Ga0495636_0063400 | 3300047318 | Bacteria | 1566 |
| 532 | Ga0495674_0041940 | 3300047319 | Bacteria | 4084 |
| 533 | Ga0495674_0097029 | 3300047319 | Bacteria | 2511 |
| 534 | Ga0495672_0008799 | 3300047320 | Bacteria | 7394 |
| 535 | Ga0495672_0056956 | 3300047320 | Bacteria | 2272 |
| 536 | Ga0495676_0093774 | 3300047321 | Bacteria | 2238 |
| 537 | Ga0495680_0003661 | 3300047322 | Bacteria | 15002 |
| 538 | Ga0495680_0109034 | 3300047322 | Bacteria | 2054 |
| 539 | Ga0495687_004291 | 3300047443 | Bacteria | 9730 |
| 540 | Ga0495675_0015773 | 3300047444 | Bacteria | 4778 |
| 541 | Ga0495684_0022805 | 3300047471 | Bacteria | 4814 |
| 542 | Ga0495684_0038906 | 3300047471 | Bacteria | 3646 |
| 543 | Ga0495686_0018546 | 3300047472 | Bacteria | 4667 |
| 544 | Ga0495593_0025657 | 3300047673 | Bacteria | 3262 |
| 545 | Ga0495593_0029204 | 3300047673 | Bacteria | 3025 |
| 546 | Ga0495593_0042238 | 3300047673 | Bacteria | 2448 |
| 547 | Ga0495602_0014364 | 3300048088 | Bacteria | 8042 |
| 548 | Ga0495602_0105763 | 3300048088 | Bacteria | 2299 |
| 549 | Ga0496100_0031049 | 3300048903 | Bacteria | 3318 |
| 550 | Ga0496101_0010847 | 3300048904 | Bacteria | 6028 |
| 551 | Ga0496101_0112309 | 3300048904 | Bacteria | 2052 |
| 552 | Ga0496101_0192403 | 3300048904 | Bacteria | 1575 |
| 553 | Ga0496102_0001565 | 3300048905 | Bacteria | 20210 |
| 554 | Ga0496102_0028540 | 3300048905 | Bacteria | 4985 |
| 555 | Ga0496102_0033893 | 3300048905 | Bacteria | 4591 |
| 556 | Ga0496102_0299683 | 3300048905 | Bacteria | 1515 |
| 557 | Ga0496103_0000216 | 3300048906 | Bacteria | 57167 |
| 558 | Ga0496103_0101270 | 3300048906 | Bacteria | 1823 |
| 559 | Ga0496104_0004865 | 3300048907 | Bacteria | 11707 |
| 560 | Ga0496104_0015011 | 3300048907 | Bacteria | 7006 |
| 561 | Ga0496104_0018893 | 3300048907 | Bacteria | 6295 |
| 562 | Ga0496104_0021345 | 3300048907 | Bacteria | 5945 |
| 563 | Ga0496104_0078869 | 3300048907 | Bacteria | 3138 |
| 564 | Ga0496104_0143714 | 3300048907 | Bacteria | 2292 |
| 565 | Ga0496105_0001894 | 3300048908 | Bacteria | 15008 |
| 566 | Ga0496105_0038908 | 3300048908 | Bacteria | 3919 |
| 567 | Ga0496105_0094256 | 3300048908 | Bacteria | 2472 |
| 568 | Ga0496105_0164707 | 3300048908 | Bacteria | 1819 |
| 569 | Ga0496106_0001950 | 3300048909 | Bacteria | 15496 |
| 570 | Ga0496106_0002951 | 3300048909 | Bacteria | 12659 |
| 571 | Ga0496106_0026469 | 3300048909 | Bacteria | 4319 |
| 572 | Ga0496106_0028587 | 3300048909 | Bacteria | 4153 |
| 573 | Ga0496106_0147303 | 3300048909 | Bacteria | 1855 |
| 574 | Ga0496107_0015001 | 3300048910 | Bacteria | 5426 |
| 575 | Ga0496107_0035613 | 3300048910 | Bacteria | 3568 |
| 576 | Ga0496107_0060337 | 3300048910 | Bacteria | 2745 |
| 577 | Ga0496108_0000392 | 3300048911 | Bacteria | 36249 |
| 578 | Ga0496108_0005832 | 3300048911 | Bacteria | 9985 |
| 579 | Ga0496108_0022594 | 3300048911 | Bacteria | 5172 |
| 580 | Ga0496108_0052648 | 3300048911 | Bacteria | 3412 |
| 581 | Ga0496109_0000509 | 3300048912 | Bacteria | 33001 |
| 582 | Ga0496109_0055952 | 3300048912 | Bacteria | 3599 |
| 583 | Ga0496109_0238360 | 3300048912 | Bacteria | 1712 |
| 584 | Ga0496109_0262283 | 3300048912 | Bacteria | 1627 |
| 585 | Ga0496110_0029205 | 3300048913 | Bacteria | 4743 |
| 586 | Ga0496110_0170341 | 3300048913 | Bacteria | 1975 |
| 587 | Ga0496111_0006836 | 3300048914 | Bacteria | 7440 |
| 588 | Ga0496111_0035754 | 3300048914 | Bacteria | 3552 |
| 589 | Ga0496111_0049333 | 3300048914 | Bacteria | 3035 |
| 590 | Ga0496111_0083074 | 3300048914 | Bacteria | 2340 |
| 591 | Ga0496112_0000040 | 3300048915 | Bacteria | 89057 |
| 592 | Ga0496112_0006065 | 3300048915 | Bacteria | 10559 |
| 593 | Ga0496112_0007813 | 3300048915 | Bacteria | 9521 |
| 594 | Ga0496112_0008690 | 3300048915 | Bacteria | 9107 |
| 595 | Ga0496112_0032434 | 3300048915 | Bacteria | 5072 |
| 596 | Ga0496112_0052096 | 3300048915 | Bacteria | 4016 |
| 597 | Ga0496112_0086930 | 3300048915 | Bacteria | 3093 |
| 598 | Ga0496112_0091397 | 3300048915 | Bacteria | 3013 |
| 599 | Ga0496112_0128734 | 3300048915 | Bacteria | 2502 |
| 600 | Ga0496113_0017331 | 3300048916 | Bacteria | 4997 |
| 601 | Ga0496113_0028154 | 3300048916 | Bacteria | 4038 |
| 602 | Ga0496113_0099655 | 3300048916 | Bacteria | 2250 |
| 603 | Ga0496113_0169806 | 3300048916 | Bacteria | 1727 |
| 604 | Ga0496114_0011949 | 3300048917 | Bacteria | 6946 |
| 605 | Ga0496114_0027083 | 3300048917 | Bacteria | 4696 |
| 606 | Ga0496114_0050645 | 3300048917 | Bacteria | 3457 |
| 607 | Ga0496114_0087277 | 3300048917 | Bacteria | 2645 |
| 608 | Ga0496115_0000756 | 3300048918 | Bacteria | 23793 |
| 609 | Ga0496115_0023231 | 3300048918 | Bacteria | 4811 |
| 610 | Ga0496115_0039367 | 3300048918 | Bacteria | 3754 |
| 611 | Ga0496115_0040356 | 3300048918 | Bacteria | 3710 |
| 612 | Ga0496115_0048024 | 3300048918 | Bacteria | 3414 |
| 613 | Ga0496115_0073616 | 3300048918 | Bacteria | 2773 |
| 614 | Ga0496116_0040312 | 3300048919 | Bacteria | 3217 |
| 615 | Ga0496117_0003371 | 3300048920 | Bacteria | 18615 |
| 616 | Ga0496117_0038536 | 3300048920 | Bacteria | 3540 |
| 617 | Ga0496117_0069258 | 3300048920 | Bacteria | 2377 |
| 618 | Ga0496119_0043022 | 3300048922 | Bacteria | 2858 |
| 619 | Ga0496119_0043984 | 3300048922 | Bacteria | 2817 |
| 620 | Ga0496119_0066698 | 3300048922 | Bacteria | 2125 |
| 621 | Ga0496121_0001173 | 3300048924 | Bacteria | 45935 |
| 622 | Ga0496121_0002762 | 3300048924 | Bacteria | 26052 |
| 623 | Ga0496121_0003837 | 3300048924 | Bacteria | 20905 |
| 624 | Ga0496121_0018985 | 3300048924 | Bacteria | 6899 |
| 625 | Ga0496121_0043710 | 3300048924 | Bacteria | 3875 |
| 626 | Ga0496121_0081260 | 3300048924 | Bacteria | 2566 |
| 627 | Ga0496121_0099240 | 3300048924 | Bacteria | 2251 |
| 628 | Ga0496121_0193722 | 3300048924 | Bacteria | 1455 |
| 629 | Ga0496122_0035139 | 3300048925 | Bacteria | 4086 |
| 630 | Ga0496123_0113378 | 3300048926 | Bacteria | 1544 |
| 631 | Ga0496124_0004260 | 3300048927 | Bacteria | 16834 |
| 632 | Ga0496124_0071010 | 3300048927 | Bacteria | 2888 |
| 633 | Ga0496125_0000839 | 3300048928 | Bacteria | 49399 |
| 634 | Ga0496125_0001026 | 3300048928 | Bacteria | 43365 |
| 635 | Ga0496125_0030954 | 3300048928 | Bacteria | 4778 |
| 636 | Ga0496125_0140610 | 3300048928 | Bacteria | 1679 |
| 637 | Ga0496126_0010612 | 3300048929 | Bacteria | 9633 |
| 638 | Ga0496126_0015628 | 3300048929 | Bacteria | 7626 |
| 639 | Ga0496126_0029109 | 3300048929 | Bacteria | 5250 |
| 640 | Ga0496126_0032627 | 3300048929 | Bacteria | 4904 |
| 641 | Ga0496126_0044597 | 3300048929 | Bacteria | 4082 |
| 642 | Ga0496126_0048944 | 3300048929 | Bacteria | 3860 |
| 643 | Ga0496126_0050767 | 3300048929 | Bacteria | 3779 |
| 644 | Ga0496126_0072813 | 3300048929 | Bacteria | 3056 |
| 645 | Ga0496126_0100535 | 3300048929 | Bacteria | 2531 |
| 646 | Ga0496126_0111002 | 3300048929 | Bacteria | 2388 |
| 647 | Ga0496126_0111385 | 3300048929 | Bacteria | 2384 |
| 648 | Ga0496126_0170151 | 3300048929 | Bacteria | 1856 |
| 649 | Ga0496126_0236451 | 3300048929 | Bacteria | 1528 |
| 650 | Ga0501032_0012150 | 3300049569 | Bacteria | 6164 |
| 651 | Ga0501032_0054044 | 3300049569 | Bacteria | 2703 |
| 652 | Ga0501032_0177644 | 3300049569 | Bacteria | 1394 |
| 653 | Ga0501033_0002602 | 3300049570 | Bacteria | 15216 |
| 654 | Ga0501033_0095080 | 3300049570 | Bacteria | 2178 |
| 655 | Ga0501033_0109417 | 3300049570 | Bacteria | 2012 |
| 656 | Ga0501034_0014203 | 3300049571 | Bacteria | 8207 |
| 657 | Ga0501034_0065672 | 3300049571 | Bacteria | 3641 |
| 658 | Ga0501036_0052145 | 3300049572 | Bacteria | 3464 |
| 659 | Ga0501036_0081623 | 3300049572 | Bacteria | 2732 |
| 660 | Ga0501036_0082533 | 3300049572 | Bacteria | 2717 |
| 661 | Ga0501037_0000360 | 3300049573 | Bacteria | 38185 |
| 662 | Ga0501037_0027235 | 3300049573 | Bacteria | 4222 |
| 663 | Ga0501037_0061883 | 3300049573 | Bacteria | 2730 |
| 664 | Ga0501038_0003992 | 3300049574 | Bacteria | 13699 |
| 665 | Ga0501038_0047864 | 3300049574 | Bacteria | 3702 |
| 666 | Ga0501038_0089226 | 3300049574 | Bacteria | 2586 |
| 667 | Ga0501038_0128060 | 3300049574 | Bacteria | 2087 |
| 668 | Ga0501043_0011214 | 3300049579 | Bacteria | 7020 |
| 669 | Ga0501043_0044164 | 3300049579 | Bacteria | 3504 |
| 670 | Ga0501043_0057581 | 3300049579 | Bacteria | 3051 |
| 671 | Ga0501043_0088389 | 3300049579 | Bacteria | 2435 |
| 672 | Ga0501043_0270953 | 3300049579 | Bacteria | 1303 |
| 673 | Ga0501046_0080362 | 3300049580 | Bacteria | 2519 |
| 674 | Ga0501046_0088741 | 3300049580 | Bacteria | 2381 |
| 675 | Ga0501047_0028277 | 3300049581 | Bacteria | 5404 |
| 676 | Ga0501047_0067439 | 3300049581 | Bacteria | 3448 |
| 677 | Ga0501047_0117071 | 3300049581 | Bacteria | 2546 |
| 678 | Ga0501048_0070694 | 3300049582 | Bacteria | 2465 |
| 679 | Ga0501067_0039868 | 3300049583 | Bacteria | 2608 |
| 680 | Ga0501068_0008490 | 3300049584 | Bacteria | 5719 |
| 681 | Ga0501070_0021051 | 3300049586 | Bacteria | 5472 |
| 682 | Ga0501070_0032117 | 3300049586 | Bacteria | 4395 |
| 683 | Ga0501071_0010315 | 3300049587 | Bacteria | 6257 |
| 684 | Ga0501072_0210770 | 3300049588 | Bacteria | 1548 |
| 685 | Ga0501073_0012737 | 3300049589 | Bacteria | 6135 |
| 686 | Ga0501074_0004048 | 3300049590 | Bacteria | 10458 |
| 687 | Ga0501075_0120236 | 3300049591 | Bacteria | 1999 |
| 688 | Ga0501079_0148750 | 3300049741 | Bacteria | 1826 |
| 689 | Ga0501080_0028736 | 3300049742 | Bacteria | 5176 |
| 690 | Ga0501080_0049107 | 3300049742 | Bacteria | 3927 |
| 691 | Ga0501080_0069251 | 3300049742 | Bacteria | 3281 |
| 692 | Ga0501081_0115517 | 3300049743 | Bacteria | 1908 |
| 693 | Ga0501035_0009962 | 3300049822 | Bacteria | 8821 |
| 694 | Ga0501035_0028696 | 3300049822 | Bacteria | 5078 |
| 695 | Ga0501035_0061707 | 3300049822 | Bacteria | 3336 |
| 696 | Ga0501035_0150994 | 3300049822 | Bacteria | 2016 |
| 697 | Ga0501044_0019074 | 3300049823 | Bacteria | 7342 |
| 698 | Ga0501044_0053817 | 3300049823 | Bacteria | 4139 |
| 699 | Ga0501044_0228834 | 3300049823 | Bacteria | 1807 |
| 700 | Ga0501044_0298157 | 3300049823 | Bacteria | 1541 |
| 701 | Ga0501044_0333733 | 3300049823 | Bacteria | 1438 |
| 702 | Ga0501045_0009389 | 3300049824 | Bacteria | 6840 |
| 703 | nmdc:mga03n38_1224_c1 | 3300050490 | Bacteria | 7213 |
| 704 | nmdc:mga00v17_165644_c1 | 3300050491 | Bacteria | 1424 |
| 705 | nmdc:mga00v17_22736_c1 | 3300050491 | Bacteria | 3621 |
| 706 | nmdc:mga00v17_58338_c1 | 3300050491 | Bacteria | 2364 |
| 707 | nmdc:mga0yw44_25749_c1 | 3300050492 | Bacteria | 3351 |
| 708 | nmdc:mga0yw44_3932_c1 | 3300050492 | Bacteria | 6708 |
| 709 | nmdc:mga0k408_24734_c1 | 3300050493 | Bacteria | 3397 |
| 710 | nmdc:mga0k408_62514_c1 | 3300050493 | Bacteria | 2165 |
| 711 | nmdc:mga06z11_14893_c1 | 3300050494 | Bacteria | 3456 |
| 712 | nmdc:mga06z11_3608_c1 | 3300050494 | Bacteria | 6000 |
| 713 | nmdc:mga06z11_76486_c1 | 3300050494 | Bacteria | 1785 |
| 714 | nmdc:mga04h51_3545_c1 | 3300050495 | Bacteria | 3800 |
| 715 | nmdc:mga05p37_155473_c1 | 3300050507 | Bacteria | 2795 |
| 716 | Ga0495601_0127614 | 3300053077 | Bacteria | 1655 |
| 717 | Ga0495612_0020807 | 3300053078 | Bacteria | 2630 |
| 718 | Ga0500635_0021420 | 3300053080 | Bacteria | 1992 |
| 719 | Ga0495619_0005038 | 3300053085 | Bacteria | 8390 |
| 720 | Ga0495619_0040076 | 3300053085 | Bacteria | 3061 |
| 721 | Ga0495619_0040908 | 3300053085 | Bacteria | 3030 |
| 722 | Ga0495619_0165255 | 3300053085 | Bacteria | 1529 |
| 723 | Ga0500578_0040949 | 3300053086 | Bacteria | 2977 |
| 724 | Ga0500578_0081756 | 3300053086 | Bacteria | 2054 |
| 725 | Ga0500643_000180 | 3300053087 | Bacteria | 61907 |
| 726 | Ga0500647_0040501 | 3300053091 | Bacteria | 2235 |
| 727 | Ga0500651_0004278 | 3300053093 | Bacteria | 7975 |
| 728 | Ga0500566_0000128 | 3300053094 | Bacteria | 38564 |
| 729 | Ga0500566_0004762 | 3300053094 | Bacteria | 8085 |
| 730 | Ga0500566_0018358 | 3300053094 | Bacteria | 4107 |
| 731 | Ga0500566_0035916 | 3300053094 | Bacteria | 2878 |
| 732 | Ga0500640_000843 | 3300053095 | Bacteria | 8465 |
| 733 | Ga0500648_062773 | 3300053097 | Bacteria | 2105 |
| 734 | Ga0500554_002044 | 3300053102 | Bacteria | 3911 |
| 735 | Ga0500557_000046 | 3300053105 | Bacteria | 59508 |
| 736 | Ga0500569_001091 | 3300053109 | Bacteria | 4962 |
| 737 | Ga0500572_001063 | 3300053111 | Bacteria | 8139 |
| 738 | Ga0500572_001245 | 3300053111 | Bacteria | 7178 |
| 739 | Ga0500595_000398 | 3300053119 | Bacteria | 27905 |
| 740 | Ga0500595_013722 | 3300053119 | Bacteria | 3098 |
| 741 | Ga0500595_015261 | 3300053119 | Bacteria | 2887 |
| 742 | Ga0500595_020160 | 3300053119 | Bacteria | 2405 |
| 743 | Ga0500595_025514 | 3300053119 | Bacteria | 2047 |
| 744 | Ga0500607_077495 | 3300053121 | Bacteria | 1701 |
| 745 | Ga0500614_000326 | 3300053123 | Bacteria | 12307 |
| 746 | Ga0500642_0000038 | 3300053130 | Bacteria | 98299 |
| 747 | Ga0500559_0000487 | 3300053136 | Bacteria | 28032 |
| 748 | Ga0500559_0001215 | 3300053136 | Bacteria | 15283 |
| 749 | Ga0500559_0009416 | 3300053136 | Bacteria | 4228 |
| 750 | Ga0500568_0021740 | 3300053139 | Bacteria | 2756 |
| 751 | Ga0500568_0022636 | 3300053139 | Bacteria | 2685 |
| 752 | Ga0500573_0003111 | 3300053140 | Bacteria | 8508 |
| 753 | Ga0500590_100662 | 3300053148 | Bacteria | 1388 |
| 754 | Ga0500603_000386 | 3300053150 | Bacteria | 11545 |
| 755 | Ga0500603_003082 | 3300053150 | Bacteria | 3597 |
| 756 | Ga0500603_003906 | 3300053150 | Bacteria | 3189 |
| 757 | Ga0500616_0004532 | 3300053153 | Bacteria | 9853 |
| 758 | Ga0500620_001302 | 3300053155 | Bacteria | 4520 |
| 759 | Ga0500630_000855 | 3300053159 | Bacteria | 14148 |
| 760 | Ga0500633_0030481 | 3300053160 | Bacteria | 1735 |
| 761 | Ga0500638_010856 | 3300053162 | Bacteria | 4011 |
| 762 | Ga0500638_018643 | 3300053162 | Bacteria | 3240 |
| 763 | Ga0500639_000125 | 3300053163 | Bacteria | 36885 |
| 764 | Ga0500639_122397 | 3300053163 | Bacteria | 1247 |
| 765 | Ga0500636_0002084 | 3300053177 | Bacteria | 11042 |
| 766 | Ga0500637_0000118 | 3300053178 | Bacteria | 28882 |
| 767 | Ga0500637_0022252 | 3300053178 | Bacteria | 3451 |
| 768 | Ga0500576_054585 | 3300053725 | Bacteria | 1763 |
| 769 | Ga0500625_017981 | 3300053729 | Bacteria | 3305 |
| 770 | Ga0500596_006889 | 3300053735 | Bacteria | 1889 |
| 771 | Ga0500601_000862 | 3300053737 | Bacteria | 3683 |
| 772 | Ga0500661_000042 | 3300055283 | Bacteria | 19485 |
| 773 | Ga0501082_0082237 | 3300060353 | Bacteria | 2778 |
| 774 | Ga0466962_0057626 | 3300061719 | Bacteria | 1855 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053163 | Ga0500639_122397 | Ga0500639_122397_41_1159 | 342 |
| 2 | 3300005289 | Ga0065704_10070332 | Ga0065704_1007033227 | 370 |
| 3 | 3300025711 | Ga0207696_1000560 | Ga0207696_10005608 | 370 |
| 4 | 3300048905 | Ga0496102_0001565 | Ga0496102_0001565_4239_5375 | 370 |
| 5 | 3300048906 | Ga0496103_0000216 | Ga0496103_0000216_5285_6421 | 370 |
| 6 | 3300048920 | Ga0496117_0003371 | Ga0496117_0003371_13241_14377 | 370 |
| 7 | 3300036401 | Ga0373937_0087029 | Ga0373937_0087029_407_1705 | 371 |
| 8 | 3300031247 | Ga0265340_10012973 | Ga0265340_100129732 | 373 |
| 9 | 3300031249 | Ga0265339_10002202 | Ga0265339_1000220210 | 373 |
| 10 | 3300039437 | Ga0436365_1288625 | Ga0436365_1288625_638_1792 | 374 |
| 11 | 3300039453 | Ga0436362_0204850 | Ga0436362_0204850_428_1648 | 375 |
| 12 | 3300005262 | Ga0065165_1004408 | Ga0065165_100440810 | 376 |
| 13 | 3300031731 | Ga0307405_10048853 | Ga0307405_100488532 | 378 |
| 14 | 3300046452 | Ga0495617_039677 | Ga0495617_039677_248_1486 | 378 |
| 15 | 3300048926 | Ga0496123_0113378 | Ga0496123_0113378_64_1317 | 378 |
| 16 | 3300053121 | Ga0500607_077495 | Ga0500607_077495_32_1228 | 378 |
| 17 | 3300005334 | Ga0068869_100011774 | Ga0068869_1000117746 | 379 |
| 18 | 3300005336 | Ga0070680_100049028 | Ga0070680_1000490283 | 379 |
| 19 | 3300005338 | Ga0068868_100070715 | Ga0068868_1000707152 | 379 |
| 20 | 3300005339 | Ga0070660_100015960 | Ga0070660_1000159603 | 379 |
| 21 | 3300005341 | Ga0070691_10013655 | Ga0070691_100136553 | 379 |
| 22 | 3300005355 | Ga0070671_100124208 | Ga0070671_1001242082 | 379 |
| 23 | 3300005539 | Ga0068853_100017422 | Ga0068853_1000174223 | 379 |
| 24 | 3300005563 | Ga0068855_100012917 | Ga0068855_1000129176 | 379 |
| 25 | 3300005577 | Ga0068857_100004377 | Ga0068857_1000043776 | 379 |
| 26 | 3300005578 | Ga0068854_100107665 | Ga0068854_1001076652 | 379 |
| 27 | 3300005618 | Ga0068864_100043041 | Ga0068864_1000430412 | 379 |
| 28 | 3300005834 | Ga0068851_10005968 | Ga0068851_100059685 | 379 |
| 29 | 3300009093 | Ga0105240_10030379 | Ga0105240_100303792 | 379 |
| 30 | 3300009174 | Ga0105241_10015297 | Ga0105241_100152971 | 379 |
| 31 | 3300009545 | Ga0105237_10029665 | Ga0105237_100296653 | 379 |
| 32 | 3300009545 | Ga0105237_10049111 | Ga0105237_100491114 | 379 |
| 33 | 3300009551 | Ga0105238_10002788 | Ga0105238_100027889 | 379 |
| 34 | 3300010375 | Ga0105239_10027593 | Ga0105239_100275935 | 379 |
| 35 | 3300010375 | Ga0105239_10060216 | Ga0105239_100602164 | 379 |
| 36 | 3300013104 | Ga0157370_10007873 | Ga0157370_100078733 | 379 |
| 37 | 3300013105 | Ga0157369_10017046 | Ga0157369_100170465 | 379 |
| 38 | 3300013296 | Ga0157374_10026351 | Ga0157374_100263515 | 379 |
| 39 | 3300025906 | Ga0207699_10037075 | Ga0207699_100370752 | 379 |
| 40 | 3300025908 | Ga0207643_10077208 | Ga0207643_100772082 | 379 |
| 41 | 3300025912 | Ga0207707_10000575 | Ga0207707_1000057536 | 379 |
| 42 | 3300025913 | Ga0207695_10006774 | Ga0207695_100067748 | 379 |
| 43 | 3300025914 | Ga0207671_10005835 | Ga0207671_100058354 | 379 |
| 44 | 3300025917 | Ga0207660_10008892 | Ga0207660_100088927 | 379 |
| 45 | 3300025919 | Ga0207657_10027023 | Ga0207657_100270233 | 379 |
| 46 | 3300025921 | Ga0207652_10005891 | Ga0207652_100058915 | 379 |
| 47 | 3300025924 | Ga0207694_10012632 | Ga0207694_100126322 | 379 |
| 48 | 3300025927 | Ga0207687_10032786 | Ga0207687_100327863 | 379 |
| 49 | 3300025928 | Ga0207700_10115569 | Ga0207700_101155692 | 379 |
| 50 | 3300025931 | Ga0207644_10083738 | Ga0207644_100837382 | 379 |
| 51 | 3300025942 | Ga0207689_10019363 | Ga0207689_100193632 | 379 |
| 52 | 3300025949 | Ga0207667_10003446 | Ga0207667_1000344613 | 379 |
| 53 | 3300025949 | Ga0207667_10195800 | Ga0207667_101958002 | 379 |
| 54 | 3300025972 | Ga0207668_10024248 | Ga0207668_100242484 | 379 |
| 55 | 3300025981 | Ga0207640_10261182 | Ga0207640_102611821 | 379 |
| 56 | 3300026023 | Ga0207677_10032157 | Ga0207677_100321574 | 379 |
| 57 | 3300026035 | Ga0207703_10014373 | Ga0207703_100143732 | 379 |
| 58 | 3300026041 | Ga0207639_10008373 | Ga0207639_100083737 | 379 |
| 59 | 3300026095 | Ga0207676_10144666 | Ga0207676_101446662 | 379 |
| 60 | 3300026116 | Ga0207674_10003672 | Ga0207674_1000367210 | 379 |
| 61 | 3300026118 | Ga0207675_100025081 | Ga0207675_1000250812 | 379 |
| 62 | 3300028379 | Ga0268266_10006470 | Ga0268266_1000647012 | 379 |
| 63 | 3300047320 | Ga0495672_0056956 | Ga0495672_0056956_1095_2261 | 379 |
| 64 | 3300048904 | Ga0496101_0192403 | Ga0496101_0192403_61_1299 | 379 |
| 65 | 3300048905 | Ga0496102_0299683 | Ga0496102_0299683_196_1434 | 379 |
| 66 | 3300048916 | Ga0496113_0169806 | Ga0496113_0169806_71_1309 | 379 |
| 67 | 3300048929 | Ga0496126_0015628 | Ga0496126_0015628_1530_2738 | 379 |
| 68 | 3300025915 | Ga0207693_10023244 | Ga0207693_100232442 | 380 |
| 69 | 3300025915 | Ga0207693_10029960 | Ga0207693_100299605 | 380 |
| 70 | 3300026142 | Ga0207698_10041783 | Ga0207698_100417832 | 380 |
| 71 | 3300048906 | Ga0496103_0101270 | Ga0496103_0101270_501_1697 | 380 |
| 72 | 3300048909 | Ga0496106_0001950 | Ga0496106_0001950_2189_3427 | 380 |
| 73 | 3300048916 | Ga0496113_0017331 | Ga0496113_0017331_3527_4723 | 380 |
| 74 | 3300048920 | Ga0496117_0038536 | Ga0496117_0038536_440_1678 | 380 |
| 75 | 3300048922 | Ga0496119_0043022 | Ga0496119_0043022_407_1603 | 380 |
| 76 | 3300048924 | Ga0496121_0002762 | Ga0496121_0002762_8111_9349 | 380 |
| 77 | 3300048927 | Ga0496124_0004260 | Ga0496124_0004260_9953_11191 | 380 |
| 78 | 3300048929 | Ga0496126_0010612 | Ga0496126_0010612_8122_9360 | 380 |
| 79 | 3300053119 | Ga0500595_015261 | Ga0500595_015261_1140_2381 | 380 |
| 80 | 3300005437 | Ga0070710_10003163 | Ga0070710_100031631 | 381 |
| 81 | 3300005439 | Ga0070711_100057793 | Ga0070711_1000577932 | 381 |
| 82 | 3300005455 | Ga0070663_100038640 | Ga0070663_1000386402 | 381 |
| 83 | 3300005456 | Ga0070678_100066627 | Ga0070678_1000666272 | 381 |
| 84 | 3300005466 | Ga0070685_10007116 | Ga0070685_100071163 | 381 |
| 85 | 3300005548 | Ga0070665_100030612 | Ga0070665_1000306125 | 381 |
| 86 | 3300006048 | Ga0075363_100007732 | Ga0075363_1000077324 | 381 |
| 87 | 3300013297 | Ga0157378_10003222 | Ga0157378_1000322212 | 381 |
| 88 | 3300026067 | Ga0207678_10092405 | Ga0207678_100924052 | 381 |
| 89 | 3300026121 | Ga0207683_10138572 | Ga0207683_101385722 | 381 |
| 90 | 3300028379 | Ga0268266_10002572 | Ga0268266_100025728 | 381 |
| 91 | 3300046459 | Ga0495629_0008117 | Ga0495629_0008117_770_2005 | 381 |
| 92 | 3300046462 | Ga0495651_0045854 | Ga0495651_0045854_833_2068 | 381 |
| 93 | 3300046513 | Ga0495616_0088388 | Ga0495616_0088388_79_1362 | 381 |
| 94 | 3300046514 | Ga0495618_0052160 | Ga0495618_0052160_151_1386 | 381 |
| 95 | 3300046529 | Ga0495652_0033935 | Ga0495652_0033935_2605_3840 | 381 |
| 96 | 3300046533 | Ga0495640_0042704 | Ga0495640_0042704_897_2132 | 381 |
| 97 | 3300046537 | Ga0495598_0014360 | Ga0495598_0014360_283_1521 | 381 |
| 98 | 3300046557 | Ga0495622_0015822 | Ga0495622_0015822_2239_3474 | 381 |
| 99 | 3300046615 | Ga0495656_0019770 | Ga0495656_0019770_263_1501 | 381 |
| 100 | 3300046642 | Ga0495634_0057304 | Ga0495634_0057304_80_1315 | 381 |
| 101 | 3300046663 | Ga0495635_0004984 | Ga0495635_0004984_1564_2799 | 381 |
| 102 | 3300046675 | Ga0495657_0038140 | Ga0495657_0038140_1828_3063 | 381 |
| 103 | 3300046691 | Ga0495670_0100066 | Ga0495670_0100066_106_1344 | 381 |
| 104 | 3300046809 | Ga0495600_0038744 | Ga0495600_0038744_770_2005 | 381 |
| 105 | 3300047317 | Ga0495604_0024477 | Ga0495604_0024477_1546_2781 | 381 |
| 106 | 3300047318 | Ga0495636_0063400 | Ga0495636_0063400_42_1280 | 381 |
| 107 | 3300047673 | Ga0495593_0029204 | Ga0495593_0029204_1554_2789 | 381 |
| 108 | 3300048903 | Ga0496100_0031049 | Ga0496100_0031049_1434_2672 | 381 |
| 109 | 3300048907 | Ga0496104_0004865 | Ga0496104_0004865_594_1829 | 381 |
| 110 | 3300048909 | Ga0496106_0147303 | Ga0496106_0147303_137_1375 | 381 |
| 111 | 3300048918 | Ga0496115_0048024 | Ga0496115_0048024_10_1245 | 381 |
| 112 | 3300048918 | Ga0496115_0073616 | Ga0496115_0073616_354_1592 | 381 |
| 113 | 3300048924 | Ga0496121_0099240 | Ga0496121_0099240_407_1642 | 381 |
| 114 | 3300048929 | Ga0496126_0170151 | Ga0496126_0170151_189_1424 | 381 |
| 115 | 3300050490 | nmdc:mga03n38_1224_c1 | nmdc:mga03n38_1224_c1_4196_5434 | 381 |
| 116 | 3300050494 | nmdc:mga06z11_3608_c1 | nmdc:mga06z11_3608_c1_2423_3661 | 381 |
| 117 | 3300053085 | Ga0495619_0040908 | Ga0495619_0040908_1526_2761 | 381 |
| 118 | 3300005841 | Ga0068863_100039597 | Ga0068863_1000395973 | 382 |
| 119 | 3300005937 | Ga0081455_10017866 | Ga0081455_100178664 | 382 |
| 120 | 3300006038 | Ga0075365_10022691 | Ga0075365_100226912 | 382 |
| 121 | 3300025913 | Ga0207695_10251545 | Ga0207695_102515452 | 382 |
| 122 | 3300035171 | Ga0373946_0022473 | Ga0373946_0022473_691_1929 | 382 |
| 123 | 3300035725 | Ga0373947_0028315 | Ga0373947_0028315_659_1897 | 382 |
| 124 | 3300037068 | Ga0373925_0038739 | Ga0373925_0038739_899_2137 | 382 |
| 125 | 3300037466 | Ga0395898_0096861 | Ga0395898_0096861_66_1292 | 382 |
| 126 | 3300046689 | Ga0495613_0070562 | Ga0495613_0070562_365_1603 | 382 |
| 127 | 3300050507 | nmdc:mga05p37_155473_c1 | nmdc:mga05p37_155473_c1_852_2090 | 382 |
| 128 | 3300053094 | Ga0500566_0035916 | Ga0500566_0035916_1029_2267 | 382 |
| 129 | 3300053097 | Ga0500648_062773 | Ga0500648_062773_750_1988 | 382 |
| 130 | 3300053119 | Ga0500595_025514 | Ga0500595_025514_145_1383 | 382 |
| 131 | 3300053136 | Ga0500559_0009416 | Ga0500559_0009416_2977_4215 | 382 |
| 132 | 3300053140 | Ga0500573_0003111 | Ga0500573_0003111_6929_8167 | 382 |
| 133 | 3300053178 | Ga0500637_0022252 | Ga0500637_0022252_2178_3416 | 382 |
| 134 | 3300005983 | Ga0081540_1002776 | Ga0081540_10027765 | 383 |
| 135 | 3300005983 | Ga0081540_1003496 | Ga0081540_10034964 | 383 |
| 136 | 3300046460 | Ga0495638_0026917 | Ga0495638_0026917_1844_3082 | 383 |
| 137 | 3300046518 | Ga0495631_0017099 | Ga0495631_0017099_2110_3348 | 383 |
| 138 | 3300046524 | Ga0495648_0044319 | Ga0495648_0044319_825_2063 | 383 |
| 139 | 3300046615 | Ga0495656_0030282 | Ga0495656_0030282_283_1521 | 383 |
| 140 | 3300046660 | Ga0495625_0175878 | Ga0495625_0175878_177_1415 | 383 |
| 141 | 3300048929 | Ga0496126_0050767 | Ga0496126_0050767_2403_3641 | 383 |
| 142 | 3300005336 | Ga0070680_100089673 | Ga0070680_1000896732 | 384 |
| 143 | 3300031616 | Ga0307508_10000019 | Ga0307508_1000001996 | 384 |
| 144 | 3300033442 | Ga0315911_1000012 | Ga0315911_100001219 | 384 |
| 145 | 3300005843 | Ga0068860_100001738 | Ga0068860_10000173810 | 387 |
| 146 | 3300025297 | Ga0209758_1016727 | Ga0209758_10167273 | 387 |
| 147 | 3300028381 | Ga0268264_10000042 | Ga0268264_10000042243 | 387 |
| 148 | 3300031239 | Ga0265328_10004115 | Ga0265328_100041154 | 387 |
| 149 | 3300031250 | Ga0265331_10006010 | Ga0265331_100060106 | 387 |
| 150 | 3300005327 | Ga0070658_10055370 | Ga0070658_100553703 | 388 |
| 151 | 3300005336 | Ga0070680_100101875 | Ga0070680_1001018752 | 388 |
| 152 | 3300005435 | Ga0070714_100211245 | Ga0070714_1002112452 | 388 |
| 153 | 3300005563 | Ga0068855_100011878 | Ga0068855_1000118781 | 388 |
| 154 | 3300025928 | Ga0207700_10017252 | Ga0207700_100172522 | 388 |
| 155 | 3300025929 | Ga0207664_10008459 | Ga0207664_100084594 | 388 |
| 156 | 3300025949 | Ga0207667_10022727 | Ga0207667_100227274 | 388 |
| 157 | 3300031239 | Ga0265328_10000019 | Ga0265328_10000019112 | 388 |
| 158 | 3300031241 | Ga0265325_10023765 | Ga0265325_100237652 | 388 |
| 159 | 3300031616 | Ga0307508_10071751 | Ga0307508_100717513 | 388 |
| 160 | 3300048908 | Ga0496105_0164707 | Ga0496105_0164707_403_1641 | 388 |
| 161 | 3300048925 | Ga0496122_0035139 | Ga0496122_0035139_1220_2488 | 388 |
| 162 | 3300048929 | Ga0496126_0032627 | Ga0496126_0032627_1453_2721 | 388 |
| 163 | iso_pu_bacteria | 8002060224 | 8002062440 | 388 |
| 164 | 3300005467 | Ga0070706_100132226 | Ga0070706_1001322261 | 389 |
| 165 | 3300005471 | Ga0070698_100114551 | Ga0070698_1001145512 | 389 |
| 166 | 3300006178 | Ga0075367_10084476 | Ga0075367_100844762 | 389 |
| 167 | 3300032126 | Ga0307415_100063976 | Ga0307415_1000639762 | 389 |
| 168 | 3300046526 | Ga0495666_0053983 | Ga0495666_0053983_384_1835 | 389 |
| 169 | 3300046557 | Ga0495622_0038758 | Ga0495622_0038758_717_2168 | 389 |
| 170 | 3300046674 | Ga0495588_0023947 | Ga0495588_0023947_461_1795 | 389 |
| 171 | 3300048924 | Ga0496121_0018985 | Ga0496121_0018985_792_2057 | 389 |
| 172 | 3300050493 | nmdc:mga0k408_62514_c1 | nmdc:mga0k408_62514_c1_421_1659 | 389 |
| 173 | iso_pu_bacteria | 2908739725 | 2908740257 | 389 |
| 174 | 3300005338 | Ga0068868_100061300 | Ga0068868_1000613002 | 390 |
| 175 | 3300005578 | Ga0068854_100093480 | Ga0068854_1000934802 | 390 |
| 176 | 3300005614 | Ga0068856_100000046 | Ga0068856_10000004660 | 390 |
| 177 | 3300005616 | Ga0068852_100190743 | Ga0068852_1001907432 | 390 |
| 178 | 3300005618 | Ga0068864_100103201 | Ga0068864_1001032013 | 390 |
| 179 | 3300005937 | Ga0081455_10005256 | Ga0081455_1000525612 | 390 |
| 180 | 3300005937 | Ga0081455_10061213 | Ga0081455_100612132 | 390 |
| 181 | 3300005983 | Ga0081540_1001673 | Ga0081540_100167311 | 390 |
| 182 | 3300007265 | Ga0099794_10044796 | Ga0099794_100447962 | 390 |
| 183 | 3300009098 | Ga0105245_10007957 | Ga0105245_1000795711 | 390 |
| 184 | 3300010375 | Ga0105239_10070576 | Ga0105239_100705762 | 390 |
| 185 | 3300013296 | Ga0157374_10206425 | Ga0157374_102064252 | 390 |
| 186 | 3300013306 | Ga0163162_10274148 | Ga0163162_102741482 | 390 |
| 187 | 3300013308 | Ga0157375_10145312 | Ga0157375_101453122 | 390 |
| 188 | 3300014325 | Ga0163163_10190091 | Ga0163163_101900913 | 390 |
| 189 | 3300014969 | Ga0157376_10034960 | Ga0157376_100349602 | 390 |
| 190 | 3300025901 | Ga0207688_10040757 | Ga0207688_100407572 | 390 |
| 191 | 3300025927 | Ga0207687_10056601 | Ga0207687_100566012 | 390 |
| 192 | 3300026023 | Ga0207677_10028853 | Ga0207677_100288533 | 390 |
| 193 | 3300026035 | Ga0207703_10036684 | Ga0207703_100366844 | 390 |
| 194 | 3300026067 | Ga0207678_10015465 | Ga0207678_100154655 | 390 |
| 195 | 3300026067 | Ga0207678_10194201 | Ga0207678_101942012 | 390 |
| 196 | 3300026078 | Ga0207702_10000014 | Ga0207702_10000014114 | 390 |
| 197 | 3300026095 | Ga0207676_10119667 | Ga0207676_101196672 | 390 |
| 198 | 3300026121 | Ga0207683_10016200 | Ga0207683_100162005 | 390 |
| 199 | 3300026142 | Ga0207698_10119439 | Ga0207698_101194392 | 390 |
| 200 | 3300027671 | Ga0209588_1004507 | Ga0209588_10045074 | 390 |
| 201 | 3300031239 | Ga0265328_10003191 | Ga0265328_100031912 | 390 |
| 202 | 3300031250 | Ga0265331_10000057 | Ga0265331_1000005776 | 390 |
| 203 | 3300031711 | Ga0265314_10020295 | Ga0265314_100202953 | 390 |
| 204 | 3300035118 | Ga0373954_0008297 | Ga0373954_0008297_3231_4469 | 390 |
| 205 | 3300035172 | Ga0373955_0006973 | Ga0373955_0006973_3608_4846 | 390 |
| 206 | 3300035410 | Ga0373924_0024123 | Ga0373924_0024123_798_2036 | 390 |
| 207 | 3300035724 | Ga0373933_0003606 | Ga0373933_0003606_6155_7393 | 390 |
| 208 | 3300044658 | Ga0466972_0000236 | Ga0466972_0000236_5527_6762 | 390 |
| 209 | 3300044658 | Ga0466972_0063454 | Ga0466972_0063454_241_1521 | 390 |
| 210 | 3300044735 | Ga0466968_0016360 | Ga0466968_0016360_1359_2594 | 390 |
| 211 | 3300046459 | Ga0495629_0002515 | Ga0495629_0002515_4465_5703 | 390 |
| 212 | 3300046463 | Ga0495653_0003036 | Ga0495653_0003036_4052_5290 | 390 |
| 213 | 3300046642 | Ga0495634_0007549 | Ga0495634_0007549_1516_2754 | 390 |
| 214 | 3300046663 | Ga0495635_0004510 | Ga0495635_0004510_1470_2708 | 390 |
| 215 | 3300046809 | Ga0495600_0037631 | Ga0495600_0037631_877_2115 | 390 |
| 216 | 3300047319 | Ga0495674_0097029 | Ga0495674_0097029_142_1380 | 390 |
| 217 | 3300048904 | Ga0496101_0112309 | Ga0496101_0112309_68_1333 | 390 |
| 218 | 3300048908 | Ga0496105_0094256 | Ga0496105_0094256_96_1334 | 390 |
| 219 | 3300048909 | Ga0496106_0028587 | Ga0496106_0028587_565_1830 | 390 |
| 220 | 3300048910 | Ga0496107_0015001 | Ga0496107_0015001_2366_3631 | 390 |
| 221 | 3300048911 | Ga0496108_0022594 | Ga0496108_0022594_3491_4756 | 390 |
| 222 | 3300048912 | Ga0496109_0262283 | Ga0496109_0262283_41_1306 | 390 |
| 223 | 3300048913 | Ga0496110_0170341 | Ga0496110_0170341_126_1391 | 390 |
| 224 | 3300048914 | Ga0496111_0049333 | Ga0496111_0049333_1101_2366 | 390 |
| 225 | 3300048915 | Ga0496112_0008690 | Ga0496112_0008690_3961_5226 | 390 |
| 226 | 3300048915 | Ga0496112_0091397 | Ga0496112_0091397_1573_2862 | 390 |
| 227 | 3300048916 | Ga0496113_0099655 | Ga0496113_0099655_236_1501 | 390 |
| 228 | 3300048917 | Ga0496114_0027083 | Ga0496114_0027083_2928_4193 | 390 |
| 229 | 3300048918 | Ga0496115_0000756 | Ga0496115_0000756_13672_14937 | 390 |
| 230 | 3300049572 | Ga0501036_0082533 | Ga0501036_0082533_707_1948 | 390 |
| 231 | 3300053077 | Ga0495601_0127614 | Ga0495601_0127614_142_1380 | 390 |
| 232 | 3300053085 | Ga0495619_0005038 | Ga0495619_0005038_4544_5782 | 390 |
| 233 | 3300003214 | JGI25165J46597_1004010 | JGI25165J46597_10040103 | 391 |
| 234 | 3300003214 | JGI25165J46597_1004774 | JGI25165J46597_10047742 | 391 |
| 235 | 3300003215 | JGI25153J46596_10030363 | JGI25153J46596_100303632 | 391 |
| 236 | 3300005262 | Ga0065165_1008089 | Ga0065165_10080893 | 391 |
| 237 | 3300005439 | Ga0070711_100021396 | Ga0070711_1000213961 | 391 |
| 238 | 3300006028 | Ga0070717_10032987 | Ga0070717_100329874 | 391 |
| 239 | 3300006051 | Ga0075364_10028214 | Ga0075364_100282144 | 391 |
| 240 | 3300006178 | Ga0075367_10014420 | Ga0075367_100144203 | 391 |
| 241 | 3300006942 | Ga0099824_1018316 | Ga0099824_10183163 | 391 |
| 242 | 3300009093 | Ga0105240_10167449 | Ga0105240_101674492 | 391 |
| 243 | 3300010375 | Ga0105239_10119042 | Ga0105239_101190422 | 391 |
| 244 | 3300025261 | Ga0209233_1001244 | Ga0209233_10012444 | 391 |
| 245 | 3300025295 | Ga0209564_1005380 | Ga0209564_10053806 | 391 |
| 246 | 3300025297 | Ga0209758_1000106 | Ga0209758_100010637 | 391 |
| 247 | 3300025299 | Ga0209256_1014971 | Ga0209256_10149712 | 391 |
| 248 | 3300025303 | Ga0209051_1021162 | Ga0209051_10211621 | 391 |
| 249 | 3300025304 | Ga0209257_1012480 | Ga0209257_10124803 | 391 |
| 250 | 3300025914 | Ga0207671_10014011 | Ga0207671_100140114 | 391 |
| 251 | 3300027296 | Ga0209389_1006299 | Ga0209389_10062999 | 391 |
| 252 | 3300027357 | Ga0209589_1000031 | Ga0209589_10000314 | 391 |
| 253 | 3300027361 | Ga0209489_100057 | Ga0209489_100057143 | 391 |
| 254 | 3300035113 | Ga0373936_0030237 | Ga0373936_0030237_149_1405 | 391 |
| 255 | 3300039437 | Ga0436365_1202634 | Ga0436365_1202634_8242_9477 | 391 |
| 256 | 3300044706 | Ga0466964_0031049 | Ga0466964_0031049_352_1632 | 391 |
| 257 | 3300046462 | Ga0495651_0067067 | Ga0495651_0067067_678_1916 | 391 |
| 258 | 3300046680 | Ga0495646_0028816 | Ga0495646_0028816_577_1812 | 391 |
| 259 | 3300047472 | Ga0495686_0018546 | Ga0495686_0018546_59_1297 | 391 |
| 260 | 3300049587 | Ga0501071_0010315 | Ga0501071_0010315_4583_5824 | 391 |
| 261 | 3300050491 | nmdc:mga00v17_22736_c1 | nmdc:mga00v17_22736_c1_821_2071 | 391 |
| 262 | 3300050494 | nmdc:mga06z11_14893_c1 | nmdc:mga06z11_14893_c1_375_1625 | 391 |
| 263 | 3300053091 | Ga0500647_0040501 | Ga0500647_0040501_299_1555 | 391 |
| 264 | 3300053094 | Ga0500566_0000128 | Ga0500566_0000128_12419_13675 | 391 |
| 265 | 3300053095 | Ga0500640_000843 | Ga0500640_000843_6509_7765 | 391 |
| 266 | 3300053111 | Ga0500572_001063 | Ga0500572_001063_6788_8044 | 391 |
| 267 | 3300053123 | Ga0500614_000326 | Ga0500614_000326_6755_8011 | 391 |
| 268 | 3300053136 | Ga0500559_0001215 | Ga0500559_0001215_6872_8128 | 391 |
| 269 | 3300053148 | Ga0500590_100662 | Ga0500590_100662_44_1300 | 391 |
| 270 | 3300053150 | Ga0500603_003082 | Ga0500603_003082_1857_3113 | 391 |
| 271 | 3300053159 | Ga0500630_000855 | Ga0500630_000855_10025_11281 | 391 |
| 272 | 3300053163 | Ga0500639_000125 | Ga0500639_000125_19876_21132 | 391 |
| 273 | iso_pu_bacteria | 2513237141 | 2513887874 | 391 |
| 274 | 3300003203 | JGI25406J46586_10005786 | JGI25406J46586_100057861 | 392 |
| 275 | 3300003215 | JGI25153J46596_10008980 | JGI25153J46596_100089804 | 392 |
| 276 | 3300003215 | JGI25153J46596_10013010 | JGI25153J46596_100130103 | 392 |
| 277 | 3300005339 | Ga0070660_100174624 | Ga0070660_1001746242 | 392 |
| 278 | 3300005347 | Ga0070668_100223338 | Ga0070668_1002233381 | 392 |
| 279 | 3300005530 | Ga0070679_100015717 | Ga0070679_1000157176 | 392 |
| 280 | 3300005983 | Ga0081540_1021133 | Ga0081540_10211332 | 392 |
| 281 | 3300005985 | Ga0081539_10001606 | Ga0081539_1000160626 | 392 |
| 282 | 3300006028 | Ga0070717_10005166 | Ga0070717_100051665 | 392 |
| 283 | 3300006042 | Ga0075368_10021410 | Ga0075368_100214102 | 392 |
| 284 | 3300009551 | Ga0105238_10019066 | Ga0105238_100190664 | 392 |
| 285 | 3300025295 | Ga0209564_1007038 | Ga0209564_10070385 | 392 |
| 286 | 3300025295 | Ga0209564_1019099 | Ga0209564_10190992 | 392 |
| 287 | 3300025297 | Ga0209758_1000344 | Ga0209758_100034410 | 392 |
| 288 | 3300025297 | Ga0209758_1001622 | Ga0209758_100162222 | 392 |
| 289 | 3300025921 | Ga0207652_10081825 | Ga0207652_100818252 | 392 |
| 290 | 3300025928 | Ga0207700_10006661 | Ga0207700_100066614 | 392 |
| 291 | 3300025972 | Ga0207668_10203213 | Ga0207668_102032132 | 392 |
| 292 | 3300026118 | Ga0207675_100189164 | Ga0207675_1001891642 | 392 |
| 293 | 3300028794 | Ga0307515_10011730 | Ga0307515_100117304 | 392 |
| 294 | 3300031456 | Ga0307513_10266762 | Ga0307513_102667622 | 392 |
| 295 | 3300035695 | Ga0373927_0007379 | Ga0373927_0007379_2044_3339 | 392 |
| 296 | 3300046455 | Ga0495603_0023144 | Ga0495603_0023144_861_2099 | 392 |
| 297 | 3300046507 | Ga0495606_0003865 | Ga0495606_0003865_8615_9958 | 392 |
| 298 | 3300046648 | Ga0495611_0080621 | Ga0495611_0080621_97_1335 | 392 |
| 299 | 3300048915 | Ga0496112_0000040 | Ga0496112_0000040_41073_42311 | 392 |
| 300 | 3300048917 | Ga0496114_0050645 | Ga0496114_0050645_1193_2431 | 392 |
| 301 | 3300048918 | Ga0496115_0023231 | Ga0496115_0023231_1920_3233 | 392 |
| 302 | 3300048929 | Ga0496126_0111002 | Ga0496126_0111002_549_1787 | 392 |
| 303 | 3300049574 | Ga0501038_0047864 | Ga0501038_0047864_934_2175 | 392 |
| 304 | 3300049589 | Ga0501073_0012737 | Ga0501073_0012737_4390_5631 | 392 |
| 305 | 3300049590 | Ga0501074_0004048 | Ga0501074_0004048_4155_5396 | 392 |
| 306 | 3300049591 | Ga0501075_0120236 | Ga0501075_0120236_558_1799 | 392 |
| 307 | 3300049742 | Ga0501080_0049107 | Ga0501080_0049107_818_2059 | 392 |
| 308 | 3300049824 | Ga0501045_0009389 | Ga0501045_0009389_3686_4927 | 392 |
| 309 | 3300053080 | Ga0500635_0021420 | Ga0500635_0021420_154_1392 | 392 |
| 310 | 3300053087 | Ga0500643_000180 | Ga0500643_000180_48490_49728 | 392 |
| 311 | 3300053094 | Ga0500566_0018358 | Ga0500566_0018358_2050_3285 | 392 |
| 312 | 3300053105 | Ga0500557_000046 | Ga0500557_000046_3627_4862 | 392 |
| 313 | 3300053119 | Ga0500595_020160 | Ga0500595_020160_531_1769 | 392 |
| 314 | 3300053139 | Ga0500568_0021740 | Ga0500568_0021740_1458_2696 | 392 |
| 315 | 3300053153 | Ga0500616_0004532 | Ga0500616_0004532_2976_4214 | 392 |
| 316 | 3300053155 | Ga0500620_001302 | Ga0500620_001302_1008_2246 | 392 |
| 317 | 3300053160 | Ga0500633_0030481 | Ga0500633_0030481_476_1714 | 392 |
| 318 | 3300053162 | Ga0500638_010856 | Ga0500638_010856_2187_3425 | 392 |
| 319 | 3300053177 | Ga0500636_0002084 | Ga0500636_0002084_1276_2514 | 392 |
| 320 | 3300053729 | Ga0500625_017981 | Ga0500625_017981_379_1614 | 392 |
| 321 | 3300060353 | Ga0501082_0082237 | Ga0501082_0082237_480_1721 | 392 |
| 322 | 3300005356 | Ga0070674_100018087 | Ga0070674_1000180873 | 393 |
| 323 | 3300005367 | Ga0070667_100092241 | Ga0070667_1000922411 | 393 |
| 324 | 3300005457 | Ga0070662_100033636 | Ga0070662_1000336362 | 393 |
| 325 | 3300005459 | Ga0068867_100029024 | Ga0068867_1000290242 | 393 |
| 326 | 3300005530 | Ga0070679_100007378 | Ga0070679_1000073783 | 393 |
| 327 | 3300005535 | Ga0070684_100005066 | Ga0070684_1000050665 | 393 |
| 328 | 3300005543 | Ga0070672_100035145 | Ga0070672_1000351453 | 393 |
| 329 | 3300005544 | Ga0070686_100027608 | Ga0070686_1000276082 | 393 |
| 330 | 3300005548 | Ga0070665_100188160 | Ga0070665_1001881602 | 393 |
| 331 | 3300005577 | Ga0068857_100177034 | Ga0068857_1001770342 | 393 |
| 332 | 3300005616 | Ga0068852_100086520 | Ga0068852_1000865202 | 393 |
| 333 | 3300005718 | Ga0068866_10023188 | Ga0068866_100231882 | 393 |
| 334 | 3300005719 | Ga0068861_100064113 | Ga0068861_1000641132 | 393 |
| 335 | 3300005844 | Ga0068862_100048515 | Ga0068862_1000485153 | 393 |
| 336 | 3300005985 | Ga0081539_10000585 | Ga0081539_1000058533 | 393 |
| 337 | 3300005985 | Ga0081539_10030383 | Ga0081539_100303831 | 393 |
| 338 | 3300006038 | Ga0075365_10051990 | Ga0075365_100519902 | 393 |
| 339 | 3300006173 | Ga0070716_100001652 | Ga0070716_1000016523 | 393 |
| 340 | 3300006881 | Ga0068865_100114281 | Ga0068865_1001142812 | 393 |
| 341 | 3300009093 | Ga0105240_10162984 | Ga0105240_101629842 | 393 |
| 342 | 3300009148 | Ga0105243_10085790 | Ga0105243_100857902 | 393 |
| 343 | 3300009545 | Ga0105237_10007238 | Ga0105237_100072389 | 393 |
| 344 | 3300009553 | Ga0105249_10022299 | Ga0105249_100222993 | 393 |
| 345 | 3300010375 | Ga0105239_10142409 | Ga0105239_101424092 | 393 |
| 346 | 3300013105 | Ga0157369_10022283 | Ga0157369_100222837 | 393 |
| 347 | 3300013297 | Ga0157378_10073464 | Ga0157378_100734642 | 393 |
| 348 | 3300013306 | Ga0163162_10153430 | Ga0163162_101534302 | 393 |
| 349 | 3300014326 | Ga0157380_10095888 | Ga0157380_100958882 | 393 |
| 350 | 3300017792 | Ga0163161_10030838 | Ga0163161_100308382 | 393 |
| 351 | 3300025302 | Ga0207426_1012541 | Ga0207426_10125413 | 393 |
| 352 | 3300025912 | Ga0207707_10005305 | Ga0207707_100053053 | 393 |
| 353 | 3300025913 | Ga0207695_10000123 | Ga0207695_10000123156 | 393 |
| 354 | 3300025914 | Ga0207671_10018857 | Ga0207671_100188575 | 393 |
| 355 | 3300025921 | Ga0207652_10014514 | Ga0207652_100145143 | 393 |
| 356 | 3300025928 | Ga0207700_10011618 | Ga0207700_100116182 | 393 |
| 357 | 3300025933 | Ga0207706_10070643 | Ga0207706_100706433 | 393 |
| 358 | 3300025939 | Ga0207665_10001660 | Ga0207665_1000166010 | 393 |
| 359 | 3300025940 | Ga0207691_10037606 | Ga0207691_100376063 | 393 |
| 360 | 3300025944 | Ga0207661_10002678 | Ga0207661_100026783 | 393 |
| 361 | 3300026035 | Ga0207703_10041661 | Ga0207703_100416613 | 393 |
| 362 | 3300026089 | Ga0207648_10033893 | Ga0207648_100338932 | 393 |
| 363 | 3300026116 | Ga0207674_10029815 | Ga0207674_100298153 | 393 |
| 364 | 3300026118 | Ga0207675_100037081 | Ga0207675_1000370812 | 393 |
| 365 | 3300028379 | Ga0268266_10088547 | Ga0268266_100885472 | 393 |
| 366 | 3300028381 | Ga0268264_10157323 | Ga0268264_101573232 | 393 |
| 367 | 3300028786 | Ga0307517_10103031 | Ga0307517_101030311 | 393 |
| 368 | 3300037068 | Ga0373925_0025305 | Ga0373925_0025305_2708_4021 | 393 |
| 369 | 3300037418 | Ga0395900_0001282 | Ga0395900_0001282_8956_10230 | 393 |
| 370 | 3300037466 | Ga0395898_0027294 | Ga0395898_0027294_3041_4315 | 393 |
| 371 | 3300037466 | Ga0395898_0088298 | Ga0395898_0088298_1260_2606 | 393 |
| 372 | 3300044693 | Ga0466961_0000235 | Ga0466961_0000235_27309_28547 | 393 |
| 373 | 3300044694 | Ga0466963_0086943 | Ga0466963_0086943_132_1370 | 393 |
| 374 | 3300045049 | Ga0466959_0006430 | Ga0466959_0006430_6363_7601 | 393 |
| 375 | 3300046477 | Ga0495664_0006419 | Ga0495664_0006419_365_1603 | 393 |
| 376 | 3300046491 | Ga0495584_0070347 | Ga0495584_0070347_82_1320 | 393 |
| 377 | 3300046543 | Ga0495645_0046463 | Ga0495645_0046463_964_2202 | 393 |
| 378 | 3300046674 | Ga0495588_0063922 | Ga0495588_0063922_274_1587 | 393 |
| 379 | 3300046691 | Ga0495670_0051750 | Ga0495670_0051750_527_1810 | 393 |
| 380 | 3300048907 | Ga0496104_0078869 | Ga0496104_0078869_1505_2743 | 393 |
| 381 | 3300048912 | Ga0496109_0238360 | Ga0496109_0238360_182_1420 | 393 |
| 382 | 3300048917 | Ga0496114_0087277 | Ga0496114_0087277_398_1636 | 393 |
| 383 | 3300048924 | Ga0496121_0001173 | Ga0496121_0001173_39562_40800 | 393 |
| 384 | 3300049583 | Ga0501067_0039868 | Ga0501067_0039868_282_1520 | 393 |
| 385 | 3300049586 | Ga0501070_0032117 | Ga0501070_0032117_2364_3608 | 393 |
| 386 | 3300049742 | Ga0501080_0028736 | Ga0501080_0028736_2394_3638 | 393 |
| 387 | 3300050491 | nmdc:mga00v17_58338_c1 | nmdc:mga00v17_58338_c1_367_1605 | 393 |
| 388 | 3300050492 | nmdc:mga0yw44_25749_c1 | nmdc:mga0yw44_25749_c1_1269_2525 | 393 |
| 389 | 3300053078 | Ga0495612_0020807 | Ga0495612_0020807_1292_2530 | 393 |
| 390 | 3300053737 | Ga0500601_000862 | Ga0500601_000862_593_1828 | 393 |
| 391 | 3300003215 | JGI25153J46596_10019877 | JGI25153J46596_100198771 | 394 |
| 392 | 3300005262 | Ga0065165_1005651 | Ga0065165_10056512 | 394 |
| 393 | 3300005347 | Ga0070668_100087515 | Ga0070668_1000875153 | 394 |
| 394 | 3300005353 | Ga0070669_100053671 | Ga0070669_1000536712 | 394 |
| 395 | 3300005434 | Ga0070709_10001202 | Ga0070709_100012028 | 394 |
| 396 | 3300005436 | Ga0070713_100016005 | Ga0070713_1000160056 | 394 |
| 397 | 3300005518 | Ga0070699_100076792 | Ga0070699_1000767923 | 394 |
| 398 | 3300005564 | Ga0070664_100210482 | Ga0070664_1002104822 | 394 |
| 399 | 3300005718 | Ga0068866_10080700 | Ga0068866_100807001 | 394 |
| 400 | 3300005843 | Ga0068860_100306905 | Ga0068860_1003069052 | 394 |
| 401 | 3300006042 | Ga0075368_10007787 | Ga0075368_100077872 | 394 |
| 402 | 3300006051 | Ga0075364_10052430 | Ga0075364_100524302 | 394 |
| 403 | 3300006178 | Ga0075367_10049824 | Ga0075367_100498244 | 394 |
| 404 | 3300006186 | Ga0075369_10061748 | Ga0075369_100617482 | 394 |
| 405 | 3300006195 | Ga0075366_10003115 | Ga0075366_100031156 | 394 |
| 406 | 3300006237 | Ga0097621_100308317 | Ga0097621_1003083172 | 394 |
| 407 | 3300009174 | Ga0105241_10167678 | Ga0105241_101676782 | 394 |
| 408 | 3300010375 | Ga0105239_10413418 | Ga0105239_104134182 | 394 |
| 409 | 3300013296 | Ga0157374_10202426 | Ga0157374_102024262 | 394 |
| 410 | 3300013297 | Ga0157378_10123168 | Ga0157378_101231682 | 394 |
| 411 | 3300014325 | Ga0163163_10030032 | Ga0163163_100300323 | 394 |
| 412 | 3300021320 | Ga0214544_1000007 | Ga0214544_1000007294 | 394 |
| 413 | 3300021321 | Ga0214542_1000007 | Ga0214542_100000787 | 394 |
| 414 | 3300021324 | Ga0214545_1000006 | Ga0214545_1000006206 | 394 |
| 415 | 3300021327 | Ga0214543_1000009 | Ga0214543_1000009294 | 394 |
| 416 | 3300025261 | Ga0209233_1015771 | Ga0209233_10157712 | 394 |
| 417 | 3300025297 | Ga0209758_1007055 | Ga0209758_10070558 | 394 |
| 418 | 3300025297 | Ga0209758_1012733 | Ga0209758_10127332 | 394 |
| 419 | 3300025302 | Ga0207426_1004720 | Ga0207426_10047202 | 394 |
| 420 | 3300025909 | Ga0207705_10063283 | Ga0207705_100632831 | 394 |
| 421 | 3300025915 | Ga0207693_10054652 | Ga0207693_100546522 | 394 |
| 422 | 3300025931 | Ga0207644_10058184 | Ga0207644_100581842 | 394 |
| 423 | 3300025933 | Ga0207706_10086337 | Ga0207706_100863373 | 394 |
| 424 | 3300025942 | Ga0207689_10059119 | Ga0207689_100591193 | 394 |
| 425 | 3300025949 | Ga0207667_10215786 | Ga0207667_102157862 | 394 |
| 426 | 3300027512 | Ga0209179_1007032 | Ga0209179_10070321 | 394 |
| 427 | 3300028380 | Ga0268265_10043749 | Ga0268265_100437492 | 394 |
| 428 | 3300028786 | Ga0307517_10000542 | Ga0307517_1000054254 | 394 |
| 429 | 3300031238 | Ga0265332_10009250 | Ga0265332_100092502 | 394 |
| 430 | 3300031247 | Ga0265340_10004701 | Ga0265340_100047012 | 394 |
| 431 | 3300031344 | Ga0265316_10089842 | Ga0265316_100898422 | 394 |
| 432 | 3300033180 | Ga0307510_10115942 | Ga0307510_101159422 | 394 |
| 433 | 3300035086 | Ga0373934_0030873 | Ga0373934_0030873_493_1731 | 394 |
| 434 | 3300035724 | Ga0373933_0000063 | Ga0373933_0000063_58570_59808 | 394 |
| 435 | 3300038443 | Ga0395901_0318392 | Ga0395901_0318392_263_1531 | 394 |
| 436 | 3300044684 | Ga0466966_0000288 | Ga0466966_0000288_23347_24585 | 394 |
| 437 | 3300046474 | Ga0495605_0029156 | Ga0495605_0029156_745_1983 | 394 |
| 438 | 3300046474 | Ga0495605_0056394 | Ga0495605_0056394_490_1728 | 394 |
| 439 | 3300046474 | Ga0495605_0072470 | Ga0495605_0072470_78_1316 | 394 |
| 440 | 3300046506 | Ga0495583_0024173 | Ga0495583_0024173_1538_2776 | 394 |
| 441 | 3300046519 | Ga0495632_0030931 | Ga0495632_0030931_418_1656 | 394 |
| 442 | 3300046524 | Ga0495648_0031693 | Ga0495648_0031693_1159_2397 | 394 |
| 443 | 3300046557 | Ga0495622_0004932 | Ga0495622_0004932_704_1942 | 394 |
| 444 | 3300046660 | Ga0495625_0042665 | Ga0495625_0042665_1467_2705 | 394 |
| 445 | 3300046660 | Ga0495625_0086035 | Ga0495625_0086035_447_1685 | 394 |
| 446 | 3300046674 | Ga0495588_0001769 | Ga0495588_0001769_4266_5504 | 394 |
| 447 | 3300047321 | Ga0495676_0093774 | Ga0495676_0093774_504_1742 | 394 |
| 448 | 3300047443 | Ga0495687_004291 | Ga0495687_004291_726_1964 | 394 |
| 449 | 3300048905 | Ga0496102_0033893 | Ga0496102_0033893_2842_4080 | 394 |
| 450 | 3300048907 | Ga0496104_0015011 | Ga0496104_0015011_1105_2343 | 394 |
| 451 | 3300048909 | Ga0496106_0026469 | Ga0496106_0026469_1638_2876 | 394 |
| 452 | 3300048910 | Ga0496107_0060337 | Ga0496107_0060337_174_1412 | 394 |
| 453 | 3300048915 | Ga0496112_0128734 | Ga0496112_0128734_40_1278 | 394 |
| 454 | 3300048919 | Ga0496116_0040312 | Ga0496116_0040312_1381_2619 | 394 |
| 455 | 3300048922 | Ga0496119_0066698 | Ga0496119_0066698_592_1830 | 394 |
| 456 | 3300048929 | Ga0496126_0048944 | Ga0496126_0048944_1300_2538 | 394 |
| 457 | 3300049569 | Ga0501032_0177644 | Ga0501032_0177644_113_1354 | 394 |
| 458 | 3300049579 | Ga0501043_0270953 | Ga0501043_0270953_11_1252 | 394 |
| 459 | 3300049822 | Ga0501035_0061707 | Ga0501035_0061707_61_1302 | 394 |
| 460 | 3300050493 | nmdc:mga0k408_24734_c1 | nmdc:mga0k408_24734_c1_849_2087 | 394 |
| 461 | 3300050495 | nmdc:mga04h51_3545_c1 | nmdc:mga04h51_3545_c1_1029_2267 | 394 |
| 462 | 3300053086 | Ga0500578_0040949 | Ga0500578_0040949_1477_2718 | 394 |
| 463 | 3300053086 | Ga0500578_0081756 | Ga0500578_0081756_642_1880 | 394 |
| 464 | 3300053093 | Ga0500651_0004278 | Ga0500651_0004278_1306_2547 | 394 |
| 465 | 3300053119 | Ga0500595_013722 | Ga0500595_013722_516_1757 | 394 |
| 466 | 3300005329 | Ga0070683_100206815 | Ga0070683_1002068152 | 395 |
| 467 | 3300005535 | Ga0070684_100022108 | Ga0070684_1000221085 | 395 |
| 468 | 3300010375 | Ga0105239_10129001 | Ga0105239_101290012 | 395 |
| 469 | 3300021441 | Ga0213871_10032557 | Ga0213871_100325571 | 395 |
| 470 | 3300025944 | Ga0207661_10000727 | Ga0207661_1000072714 | 395 |
| 471 | 3300031507 | Ga0307509_10083085 | Ga0307509_100830852 | 395 |
| 472 | 3300046506 | Ga0495583_0063342 | Ga0495583_0063342_329_1567 | 395 |
| 473 | 3300046507 | Ga0495606_0029482 | Ga0495606_0029482_1591_2829 | 395 |
| 474 | 3300046809 | Ga0495600_0070118 | Ga0495600_0070118_490_1728 | 395 |
| 475 | iso_pu_bacteria | 2828305725 | 2828308148 | 395 |
| 476 | 3300009176 | Ga0105242_10112498 | Ga0105242_101124981 | 396 |
| 477 | 3300009545 | Ga0105237_10024463 | Ga0105237_100244634 | 396 |
| 478 | 3300010375 | Ga0105239_10022535 | Ga0105239_100225354 | 396 |
| 479 | 3300025934 | Ga0207686_10033506 | Ga0207686_100335062 | 396 |
| 480 | 3300026035 | Ga0207703_10046636 | Ga0207703_100466365 | 396 |
| 481 | 3300028381 | Ga0268264_10106463 | Ga0268264_101064632 | 396 |
| 482 | 3300046475 | Ga0495639_0009404 | Ga0495639_0009404_2431_3666 | 396 |
| 483 | 3300046524 | Ga0495648_0000649 | Ga0495648_0000649_5346_6584 | 396 |
| 484 | 3300048904 | Ga0496101_0010847 | Ga0496101_0010847_2700_3938 | 396 |
| 485 | 3300048905 | Ga0496102_0028540 | Ga0496102_0028540_2857_4095 | 396 |
| 486 | 3300048907 | Ga0496104_0018893 | Ga0496104_0018893_4345_5583 | 396 |
| 487 | 3300048908 | Ga0496105_0001894 | Ga0496105_0001894_8728_9966 | 396 |
| 488 | 3300048911 | Ga0496108_0052648 | Ga0496108_0052648_1132_2370 | 396 |
| 489 | 3300048912 | Ga0496109_0055952 | Ga0496109_0055952_1042_2280 | 396 |
| 490 | 3300048914 | Ga0496111_0006836 | Ga0496111_0006836_4925_6163 | 396 |
| 491 | 3300048915 | Ga0496112_0006065 | Ga0496112_0006065_4133_5371 | 396 |
| 492 | 3300048916 | Ga0496113_0028154 | Ga0496113_0028154_1201_2439 | 396 |
| 493 | 3300048917 | Ga0496114_0011949 | Ga0496114_0011949_2295_3533 | 396 |
| 494 | 3300048918 | Ga0496115_0040356 | Ga0496115_0040356_135_1373 | 396 |
| 495 | 3300049588 | Ga0501072_0210770 | Ga0501072_0210770_261_1502 | 396 |
| 496 | 3300013308 | Ga0157375_10029256 | Ga0157375_100292563 | 397 |
| 497 | 3300014325 | Ga0163163_10197585 | Ga0163163_101975852 | 397 |
| 498 | 3300026121 | Ga0207683_10034454 | Ga0207683_100344544 | 397 |
| 499 | 3300035089 | Ga0373944_0018534 | Ga0373944_0018534_33_1268 | 397 |
| 500 | 3300035111 | Ga0373923_0004450 | Ga0373923_0004450_501_1736 | 397 |
| 501 | 3300035113 | Ga0373936_0016236 | Ga0373936_0016236_946_2181 | 397 |
| 502 | 3300035118 | Ga0373954_0008487 | Ga0373954_0008487_1667_2905 | 397 |
| 503 | 3300035171 | Ga0373946_0010355 | Ga0373946_0010355_120_1355 | 397 |
| 504 | 3300035410 | Ga0373924_0043449 | Ga0373924_0043449_44_1279 | 397 |
| 505 | 3300035725 | Ga0373947_0085843 | Ga0373947_0085843_513_1748 | 397 |
| 506 | 3300036401 | Ga0373937_0053044 | Ga0373937_0053044_724_1959 | 397 |
| 507 | 3300037068 | Ga0373925_0022023 | Ga0373925_0022023_1853_3088 | 397 |
| 508 | 3300046454 | Ga0495592_0081475 | Ga0495592_0081475_871_2106 | 397 |
| 509 | 3300046459 | Ga0495629_0038364 | Ga0495629_0038364_1630_2868 | 397 |
| 510 | 3300046459 | Ga0495629_0160184 | Ga0495629_0160184_34_1269 | 397 |
| 511 | 3300046473 | Ga0495582_0019551 | Ga0495582_0019551_327_1562 | 397 |
| 512 | 3300046477 | Ga0495664_0065981 | Ga0495664_0065981_679_1914 | 397 |
| 513 | 3300046516 | Ga0495628_0049043 | Ga0495628_0049043_106_1341 | 397 |
| 514 | 3300046533 | Ga0495640_0045017 | Ga0495640_0045017_1559_2794 | 397 |
| 515 | 3300046543 | Ga0495645_0196283 | Ga0495645_0196283_82_1317 | 397 |
| 516 | 3300046642 | Ga0495634_0029266 | Ga0495634_0029266_1836_3071 | 397 |
| 517 | 3300046642 | Ga0495634_0038466 | Ga0495634_0038466_151_1389 | 397 |
| 518 | 3300046683 | Ga0495658_0022933 | Ga0495658_0022933_341_1576 | 397 |
| 519 | 3300046690 | Ga0495624_0091617 | Ga0495624_0091617_337_1572 | 397 |
| 520 | 3300047319 | Ga0495674_0041940 | Ga0495674_0041940_1872_3107 | 397 |
| 521 | 3300047471 | Ga0495684_0022805 | Ga0495684_0022805_368_1606 | 397 |
| 522 | 3300047471 | Ga0495684_0038906 | Ga0495684_0038906_1857_3092 | 397 |
| 523 | 3300047673 | Ga0495593_0025657 | Ga0495593_0025657_468_1703 | 397 |
| 524 | 3300047673 | Ga0495593_0042238 | Ga0495593_0042238_784_2022 | 397 |
| 525 | 3300053085 | Ga0495619_0165255 | Ga0495619_0165255_180_1418 | 397 |
| 526 | 3300005436 | Ga0070713_100003811 | Ga0070713_10000381110 | 398 |
| 527 | 3300006028 | Ga0070717_10051648 | Ga0070717_100516482 | 398 |
| 528 | 3300046511 | Ga0495608_0043419 | Ga0495608_0043419_1602_2840 | 398 |
| 529 | 3300048928 | Ga0496125_0140610 | Ga0496125_0140610_188_1387 | 398 |
| 530 | 3300049569 | Ga0501032_0054044 | Ga0501032_0054044_1035_2276 | 398 |
| 531 | 3300049572 | Ga0501036_0081623 | Ga0501036_0081623_1161_2402 | 398 |
| 532 | 3300049574 | Ga0501038_0003992 | Ga0501038_0003992_5228_6469 | 398 |
| 533 | 3300049581 | Ga0501047_0067439 | Ga0501047_0067439_931_2172 | 398 |
| 534 | 3300049742 | Ga0501080_0069251 | Ga0501080_0069251_1124_2365 | 398 |
| 535 | 3300049822 | Ga0501035_0150994 | Ga0501035_0150994_41_1282 | 398 |
| 536 | 3300049823 | Ga0501044_0228834 | Ga0501044_0228834_244_1485 | 398 |
| 537 | 3300049823 | Ga0501044_0333733 | Ga0501044_0333733_55_1296 | 398 |
| 538 | 3300003354 | JGI25160J50197_1002626 | JGI25160J50197_10026263 | 399 |
| 539 | 3300005983 | Ga0081540_1002366 | Ga0081540_10023664 | 399 |
| 540 | 3300025302 | Ga0207426_1000819 | Ga0207426_100081935 | 399 |
| 541 | 3300025302 | Ga0207426_1012642 | Ga0207426_10126422 | 399 |
| 542 | 3300048928 | Ga0496125_0030954 | Ga0496125_0030954_1310_2548 | 399 |
| 543 | 3300049579 | Ga0501043_0088389 | Ga0501043_0088389_383_1627 | 399 |
| 544 | 3300049581 | Ga0501047_0028277 | Ga0501047_0028277_3111_4355 | 399 |
| 545 | 3300049823 | Ga0501044_0298157 | Ga0501044_0298157_141_1385 | 399 |
| 546 | 3300053109 | Ga0500569_001091 | Ga0500569_001091_667_1905 | 399 |
| 547 | 3300005331 | Ga0070670_100129126 | Ga0070670_1001291262 | 400 |
| 548 | 3300005347 | Ga0070668_100146050 | Ga0070668_1001460502 | 400 |
| 549 | 3300014326 | Ga0157380_10070533 | Ga0157380_100705332 | 400 |
| 550 | 3300025901 | Ga0207688_10054206 | Ga0207688_100542062 | 400 |
| 551 | 3300025926 | Ga0207659_10056798 | Ga0207659_100567982 | 400 |
| 552 | 3300047322 | Ga0495680_0109034 | Ga0495680_0109034_473_1738 | 400 |
| 553 | 3300048915 | Ga0496112_0086930 | Ga0496112_0086930_1730_2968 | 400 |
| 554 | 3300049570 | Ga0501033_0095080 | Ga0501033_0095080_29_1270 | 400 |
| 555 | 3300049571 | Ga0501034_0014203 | Ga0501034_0014203_6045_7289 | 400 |
| 556 | 3300049579 | Ga0501043_0057581 | Ga0501043_0057581_1746_2990 | 400 |
| 557 | 3300006178 | Ga0075367_10123619 | Ga0075367_101236191 | 403 |
| 558 | 3300037418 | Ga0395900_0067613 | Ga0395900_0067613_589_1833 | 403 |
| 559 | 3300038443 | Ga0395901_0014860 | Ga0395901_0014860_2146_3390 | 403 |
| 560 | iso_pu_bacteria | 2667528175 | 2671120924 | 404 |
| 561 | 3300027296 | Ga0209389_1000016 | Ga0209389_1000016169 | 405 |
| 562 | 3300027361 | Ga0209489_100063 | Ga0209489_100063127 | 405 |
| 563 | 3300027363 | Ga0209700_100012 | Ga0209700_100012170 | 405 |
| 564 | 3300048929 | Ga0496126_0236451 | Ga0496126_0236451_84_1325 | 405 |
| 565 | iso_pu_bacteria | 2507262055 | 2507512013 | 406 |
| 566 | iso_pu_bacteria | 2508501128 | 2509151215 | 406 |
| 567 | iso_pu_bacteria | 2513237092 | 2513627522 | 406 |
| 568 | iso_pu_bacteria | 2513237104 | 2513720219 | 406 |
| 569 | iso_pu_bacteria | 2513237137 | 2513859745 | 406 |
| 570 | iso_pu_bacteria | 2517572143 | 2517890036 | 406 |
| 571 | iso_pu_bacteria | 2844315083 | 2844321234 | 406 |
| 572 | iso_pu_bacteria | 2881665667 | 2881669226 | 406 |
| 573 | iso_pu_bacteria | 2903727486 | 2903728657 | 406 |
| 574 | iso_pu_bacteria | 2906602504 | 2906607849 | 406 |
| 575 | iso_pu_bacteria | 2941531003 | 2941531812 | 406 |
| 576 | iso_pu_bacteria | 3005483717 | 3005490328 | 406 |
| 577 | iso_pu_bacteria | 8056967851 | 8056976035 | 406 |
| 578 | iso_pu_bacteria | 2508501009 | 2508545672 | 407 |
| 579 | iso_pu_bacteria | 2508501042 | 2508694495 | 407 |
| 580 | iso_pu_bacteria | 2511231028 | 2511393604 | 407 |
| 581 | iso_pu_bacteria | 2513237094 | 2513643170 | 407 |
| 582 | iso_pu_bacteria | 2513237095 | 2513650958 | 407 |
| 583 | iso_pu_bacteria | 2513237096 | 2513655571 | 407 |
| 584 | iso_pu_bacteria | 2513237098 | 2513677178 | 407 |
| 585 | iso_pu_bacteria | 2513237101 | 2513698845 | 407 |
| 586 | iso_pu_bacteria | 2513237102 | 2513705981 | 407 |
| 587 | iso_pu_bacteria | 2513237139 | 2513874357 | 407 |
| 588 | iso_pu_bacteria | 2513237145 | 2513916351 | 407 |
| 589 | iso_pu_bacteria | 2513237161 | 2514017191 | 407 |
| 590 | iso_pu_bacteria | 2515154112 | 2515624575 | 407 |
| 591 | iso_pu_bacteria | 2517093001 | 2517104489 | 407 |
| 592 | iso_pu_bacteria | 2524023205 | 2524438459 | 407 |
| 593 | iso_pu_bacteria | 2524023210 | 2524466338 | 407 |
| 594 | iso_pu_bacteria | 2524023228 | 2524534885 | 407 |
| 595 | iso_pu_bacteria | 2528768022 | 2528850254 | 407 |
| 596 | iso_pu_bacteria | 2617270735 | 2617349767 | 407 |
| 597 | iso_pu_bacteria | 2617270741 | 2617376947 | 407 |
| 598 | iso_pu_bacteria | 2643221651 | 2644289892 | 407 |
| 599 | iso_pu_bacteria | 2791355196 | 2793059495 | 407 |
| 600 | iso_pu_bacteria | 2791355197 | 2793067988 | 407 |
| 601 | iso_pu_bacteria | 2802429603 | 2805920955 | 407 |
| 602 | iso_pu_bacteria | 2816332527 | 2818242324 | 407 |
| 603 | iso_pu_bacteria | 2824626560 | 2824633008 | 407 |
| 604 | iso_pu_bacteria | 2824687955 | 2824695918 | 407 |
| 605 | iso_pu_bacteria | 2824773399 | 2824781363 | 407 |
| 606 | iso_pu_bacteria | 2838122688 | 2838128528 | 407 |
| 607 | iso_pu_bacteria | 2841941048 | 2841942386 | 407 |
| 608 | iso_pu_bacteria | 2841949485 | 2841955485 | 407 |
| 609 | iso_pu_bacteria | 2841957949 | 2841960816 | 407 |
| 610 | iso_pu_bacteria | 2841966195 | 2841971091 | 407 |
| 611 | iso_pu_bacteria | 2841974524 | 2841982210 | 407 |
| 612 | iso_pu_bacteria | 2841983080 | 2841984402 | 407 |
| 613 | iso_pu_bacteria | 2842038055 | 2842041872 | 407 |
| 614 | iso_pu_bacteria | 2842045827 | 2842049915 | 407 |
| 615 | iso_pu_bacteria | 2847930680 | 2847932170 | 407 |
| 616 | iso_pu_bacteria | 2847939898 | 2847943405 | 407 |
| 617 | iso_pu_bacteria | 2849076700 | 2849077125 | 407 |
| 618 | iso_pu_bacteria | 2857509624 | 2857514579 | 407 |
| 619 | iso_pu_bacteria | 2874590934 | 2874595814 | 407 |
| 620 | iso_pu_bacteria | 2874604998 | 2874606655 | 407 |
| 621 | iso_pu_bacteria | 2874620515 | 2874624144 | 407 |
| 622 | iso_pu_bacteria | 2874628541 | 2874630422 | 407 |
| 623 | iso_pu_bacteria | 2874645413 | 2874651554 | 407 |
| 624 | iso_pu_bacteria | 2876761206 | 2876767567 | 407 |
| 625 | iso_pu_bacteria | 2876771140 | 2876776011 | 407 |
| 626 | iso_pu_bacteria | 2876818435 | 2876821219 | 407 |
| 627 | iso_pu_bacteria | 2879074833 | 2879080100 | 407 |
| 628 | iso_pu_bacteria | 2879083081 | 2879089423 | 407 |
| 629 | iso_pu_bacteria | 2879099564 | 2879106423 | 407 |
| 630 | iso_pu_bacteria | 2879110137 | 2879112009 | 407 |
| 631 | iso_pu_bacteria | 2879127579 | 2879132669 | 407 |
| 632 | iso_pu_bacteria | 2879142872 | 2879146454 | 407 |
| 633 | iso_pu_bacteria | 2885366525 | 2885371556 | 407 |
| 634 | iso_pu_bacteria | 2885409591 | 2885414056 | 407 |
| 635 | iso_pu_bacteria | 2888378607 | 2888387521 | 407 |
| 636 | iso_pu_bacteria | 2888388044 | 2888391665 | 407 |
| 637 | iso_pu_bacteria | 2888419890 | 2888426753 | 407 |
| 638 | iso_pu_bacteria | 2889033259 | 2889034033 | 407 |
| 639 | iso_pu_bacteria | 2903748898 | 2903754515 | 407 |
| 640 | iso_pu_bacteria | 2903768456 | 2903772508 | 407 |
| 641 | iso_pu_bacteria | 2904666416 | 2904670855 | 407 |
| 642 | iso_pu_bacteria | 2904690495 | 2904697623 | 407 |
| 643 | iso_pu_bacteria | 2904699407 | 2904710755 | 407 |
| 644 | iso_pu_bacteria | 2904711408 | 2904713817 | 407 |
| 645 | iso_pu_bacteria | 2906610324 | 2906612202 | 407 |
| 646 | iso_pu_bacteria | 2906626472 | 2906634848 | 407 |
| 647 | iso_pu_bacteria | 2908756301 | 2908757730 | 407 |
| 648 | iso_pu_bacteria | 2908775508 | 2908782842 | 407 |
| 649 | iso_pu_bacteria | 2922361189 | 2922367435 | 407 |
| 650 | iso_pu_bacteria | 2922368715 | 2922376501 | 407 |
| 651 | iso_pu_bacteria | 2922386360 | 2922389868 | 407 |
| 652 | iso_pu_bacteria | 2922425934 | 2922427096 | 407 |
| 653 | iso_pu_bacteria | 2929615660 | 2929619990 | 407 |
| 654 | iso_pu_bacteria | 2929624759 | 2929629302 | 407 |
| 655 | iso_pu_bacteria | 2932784394 | 2932789569 | 407 |
| 656 | iso_pu_bacteria | 2932794094 | 2932796756 | 407 |
| 657 | iso_pu_bacteria | 2932801729 | 2932802464 | 407 |
| 658 | iso_pu_bacteria | 2932809354 | 2932814925 | 407 |
| 659 | iso_pu_bacteria | 2932818245 | 2932824218 | 407 |
| 660 | iso_pu_bacteria | 2932828146 | 2932834053 | 407 |
| 661 | iso_pu_bacteria | 2933577622 | 2933581908 | 407 |
| 662 | iso_pu_bacteria | 2935608549 | 2935613342 | 407 |
| 663 | iso_pu_bacteria | 2935616580 | 2935623557 | 407 |
| 664 | iso_pu_bacteria | 2935630451 | 2935633248 | 407 |
| 665 | iso_pu_bacteria | 2935638405 | 2935644944 | 407 |
| 666 | iso_pu_bacteria | 2935648319 | 2935653782 | 407 |
| 667 | iso_pu_bacteria | 2935656913 | 2935662531 | 407 |
| 668 | iso_pu_bacteria | 2935665750 | 2935671993 | 407 |
| 669 | iso_pu_bacteria | 2935675223 | 2935683079 | 407 |
| 670 | iso_pu_bacteria | 2935684952 | 2935689249 | 407 |
| 671 | iso_pu_bacteria | 2935694250 | 2935697492 | 407 |
| 672 | iso_pu_bacteria | 2935703347 | 2935711068 | 407 |
| 673 | iso_pu_bacteria | 2935713505 | 2935720195 | 407 |
| 674 | iso_pu_bacteria | 2935722832 | 2935728188 | 407 |
| 675 | iso_pu_bacteria | 2935732158 | 2935737215 | 407 |
| 676 | iso_pu_bacteria | 2935741537 | 2935746724 | 407 |
| 677 | iso_pu_bacteria | 2935750917 | 2935757691 | 407 |
| 678 | iso_pu_bacteria | 2935760218 | 2935764068 | 407 |
| 679 | iso_pu_bacteria | 2935769743 | 2935776357 | 407 |
| 680 | iso_pu_bacteria | 2935777560 | 2935784382 | 407 |
| 681 | iso_pu_bacteria | 2935785616 | 2935792418 | 407 |
| 682 | iso_pu_bacteria | 2935793552 | 2935800581 | 407 |
| 683 | iso_pu_bacteria | 2935801545 | 2935808657 | 407 |
| 684 | iso_pu_bacteria | 2935810662 | 2935817453 | 407 |
| 685 | iso_pu_bacteria | 2935819856 | 2935824804 | 407 |
| 686 | iso_pu_bacteria | 2935827899 | 2935834210 | 407 |
| 687 | iso_pu_bacteria | 2935837841 | 2935844812 | 407 |
| 688 | iso_pu_bacteria | 2935847175 | 2935852024 | 407 |
| 689 | iso_pu_bacteria | 2935855204 | 2935861836 | 407 |
| 690 | iso_pu_bacteria | 2935864058 | 2935868528 | 407 |
| 691 | iso_pu_bacteria | 2935873716 | 2935879302 | 407 |
| 692 | iso_pu_bacteria | 2935883170 | 2935887094 | 407 |
| 693 | iso_pu_bacteria | 2935908558 | 2935911371 | 407 |
| 694 | iso_pu_bacteria | 2935916978 | 2935920904 | 407 |
| 695 | iso_pu_bacteria | 2935926038 | 2935928400 | 407 |
| 696 | iso_pu_bacteria | 2935934488 | 2935938045 | 407 |
| 697 | iso_pu_bacteria | 2935942939 | 2935945327 | 407 |
| 698 | iso_pu_bacteria | 2935951376 | 2935954167 | 407 |
| 699 | iso_pu_bacteria | 2935959822 | 2935965993 | 407 |
| 700 | iso_pu_bacteria | 2935967501 | 2935971565 | 407 |
| 701 | iso_pu_bacteria | 2935975950 | 2935979962 | 407 |
| 702 | iso_pu_bacteria | 2935984226 | 2935989392 | 407 |
| 703 | iso_pu_bacteria | 2935992306 | 2935998531 | 407 |
| 704 | iso_pu_bacteria | 2936002035 | 2936009009 | 407 |
| 705 | iso_pu_bacteria | 2936011229 | 2936016821 | 407 |
| 706 | iso_pu_bacteria | 2936019824 | 2936025454 | 407 |
| 707 | iso_pu_bacteria | 2936028420 | 2936034308 | 407 |
| 708 | iso_pu_bacteria | 2936037263 | 2936044250 | 407 |
| 709 | iso_pu_bacteria | 2936046547 | 2936052365 | 407 |
| 710 | iso_pu_bacteria | 2936055302 | 2936060645 | 407 |
| 711 | iso_pu_bacteria | 2940556831 | 2940563487 | 407 |
| 712 | iso_pu_bacteria | 2941507105 | 2941509450 | 407 |
| 713 | iso_pu_bacteria | 2941515067 | 2941517279 | 407 |
| 714 | iso_pu_bacteria | 2941523033 | 2941526768 | 407 |
| 715 | iso_pu_bacteria | 2941538514 | 2941545293 | 407 |
| 716 | iso_pu_bacteria | 3005474847 | 3005476268 | 407 |
| 717 | iso_pu_bacteria | 3005506211 | 3005506767 | 407 |
| 718 | iso_pu_bacteria | 3005587118 | 3005591296 | 407 |
| 719 | iso_pu_bacteria | 3005594810 | 3005601572 | 407 |
| 720 | iso_pu_bacteria | 3005710791 | 3005717301 | 407 |
| 721 | iso_pu_bacteria | 3005718088 | 3005724265 | 407 |
| 722 | iso_pu_bacteria | 8006933436 | 8006937593 | 407 |
| 723 | iso_pu_bacteria | 8006964411 | 8006965976 | 407 |
| 724 | iso_pu_bacteria | 8006973647 | 8006977623 | 407 |
| 725 | iso_pu_bacteria | 8006984368 | 8006989894 | 407 |
| 726 | iso_pu_bacteria | 8006994254 | 8006998252 | 407 |
| 727 | iso_pu_bacteria | 8016511872 | 8016519336 | 407 |
| 728 | iso_pu_bacteria | 8016522445 | 8016525008 | 407 |
| 729 | iso_pu_bacteria | 8016548790 | 8016550417 | 407 |
| 730 | iso_pu_bacteria | 8016566248 | 8016568263 | 407 |
| 731 | iso_pu_bacteria | 8016575299 | 8016580929 | 407 |
| 732 | iso_pu_bacteria | 8016595262 | 8016596798 | 407 |
| 733 | iso_pu_bacteria | 8016630954 | 8016637042 | 407 |
| 734 | iso_pu_bacteria | 8017057580 | 8017066181 | 407 |
| 735 | iso_pu_bacteria | 8019555841 | 8019561026 | 407 |
| 736 | iso_pu_bacteria | 8019565922 | 8019571113 | 407 |
| 737 | iso_pu_bacteria | 8019576017 | 8019578446 | 407 |
| 738 | iso_pu_bacteria | 8019586578 | 8019596488 | 407 |
| 739 | iso_pu_bacteria | 8019597564 | 8019605214 | 407 |
| 740 | iso_pu_bacteria | 8019608314 | 8019613332 | 407 |
| 741 | iso_pu_bacteria | 8019619141 | 8019624001 | 407 |
| 742 | iso_pu_bacteria | 8019629233 | 8019638034 | 407 |
| 743 | iso_pu_bacteria | 8019638758 | 8019641601 | 407 |
| 744 | iso_pu_bacteria | 8019648815 | 8019653525 | 407 |
| 745 | iso_pu_bacteria | 8019678201 | 8019680624 | 407 |
| 746 | iso_pu_bacteria | 8019687851 | 8019695137 | 407 |
| 747 | iso_pu_bacteria | 8055742211 | 8055750258 | 407 |
| 748 | iso_pu_bacteria | 8056673599 | 8056677876 | 407 |
| 749 | iso_pu_bacteria | 8056681323 | 8056686070 | 407 |
| 750 | iso_pu_bacteria | 8056689827 | 8056695373 | 407 |
| 751 | 3300005434 | Ga0070709_10010701 | Ga0070709_100107012 | 408 |
| 752 | 3300005434 | Ga0070709_10095195 | Ga0070709_100951952 | 408 |
| 753 | 3300005435 | Ga0070714_100054175 | Ga0070714_1000541753 | 408 |
| 754 | 3300006163 | Ga0070715_10004200 | Ga0070715_100042002 | 408 |
| 755 | 3300006175 | Ga0070712_100023949 | Ga0070712_1000239494 | 408 |
| 756 | 3300009551 | Ga0105238_10071778 | Ga0105238_100717782 | 408 |
| 757 | 3300025898 | Ga0207692_10000264 | Ga0207692_1000026420 | 408 |
| 758 | 3300025906 | Ga0207699_10014138 | Ga0207699_100141384 | 408 |
| 759 | 3300025906 | Ga0207699_10075669 | Ga0207699_100756692 | 408 |
| 760 | 3300025915 | Ga0207693_10001910 | Ga0207693_100019107 | 408 |
| 761 | 3300025916 | Ga0207663_10000684 | Ga0207663_1000068411 | 408 |
| 762 | 3300025924 | Ga0207694_10019123 | Ga0207694_100191234 | 408 |
| 763 | 3300036401 | Ga0373937_0057792 | Ga0373937_0057792_1527_2756 | 408 |
| 764 | 3300048915 | Ga0496112_0032434 | Ga0496112_0032434_1316_2545 | 408 |
| 765 | iso_pu_bacteria | 2881364244 | 2881367515 | 408 |
| 766 | 3300006038 | Ga0075365_10019222 | Ga0075365_100192222 | 409 |
| 767 | 3300006178 | Ga0075367_10098252 | Ga0075367_100982522 | 409 |
| 768 | 3300031249 | Ga0265339_10016301 | Ga0265339_100163012 | 409 |
| 769 | 3300031711 | Ga0265314_10030455 | Ga0265314_100304553 | 409 |
| 770 | 3300031712 | Ga0265342_10012767 | Ga0265342_100127674 | 409 |
| 771 | 3300050492 | nmdc:mga0yw44_3932_c1 | nmdc:mga0yw44_3932_c1_3543_4775 | 409 |
| 772 | 3300050494 | nmdc:mga06z11_76486_c1 | nmdc:mga06z11_76486_c1_174_1406 | 409 |
| 773 | 3300053139 | Ga0500568_0022636 | Ga0500568_0022636_1302_2534 | 409 |
| 774 | 3300005616 | Ga0068852_100090609 | Ga0068852_1000906092 | 410 |
| 775 | 3300009093 | Ga0105240_10112091 | Ga0105240_101120913 | 410 |
| 776 | 3300025917 | Ga0207660_10032853 | Ga0207660_100328534 | 410 |
| 777 | 3300037466 | Ga0395898_0085381 | Ga0395898_0085381_1577_2818 | 410 |
| 778 | 3300044684 | Ga0466966_0035051 | Ga0466966_0035051_230_1465 | 410 |
| 779 | 3300044706 | Ga0466964_0079553 | Ga0466964_0079553_82_1317 | 410 |
| 780 | 3300044901 | Ga0466960_0019224 | Ga0466960_0019224_645_1880 | 410 |
| 781 | 3300046684 | Ga0495669_0080887 | Ga0495669_0080887_78_1313 | 410 |
| 782 | 3300048924 | Ga0496121_0003837 | Ga0496121_0003837_3085_4323 | 410 |
| 783 | 3300048929 | Ga0496126_0029109 | Ga0496126_0029109_711_1949 | 410 |
| 784 | 3300049569 | Ga0501032_0012150 | Ga0501032_0012150_849_2087 | 410 |
| 785 | 3300049570 | Ga0501033_0002602 | Ga0501033_0002602_12347_13585 | 410 |
| 786 | 3300049570 | Ga0501033_0109417 | Ga0501033_0109417_160_1401 | 410 |
| 787 | 3300049571 | Ga0501034_0065672 | Ga0501034_0065672_1098_2375 | 410 |
| 788 | 3300049572 | Ga0501036_0052145 | Ga0501036_0052145_2213_3451 | 410 |
| 789 | 3300049573 | Ga0501037_0000360 | Ga0501037_0000360_8594_9832 | 410 |
| 790 | 3300049573 | Ga0501037_0061883 | Ga0501037_0061883_701_1942 | 410 |
| 791 | 3300049574 | Ga0501038_0128060 | Ga0501038_0128060_12_1253 | 410 |
| 792 | 3300049579 | Ga0501043_0011214 | Ga0501043_0011214_5088_6329 | 410 |
| 793 | 3300049579 | Ga0501043_0044164 | Ga0501043_0044164_900_2138 | 410 |
| 794 | 3300049580 | Ga0501046_0080362 | Ga0501046_0080362_861_2099 | 410 |
| 795 | 3300049580 | Ga0501046_0088741 | Ga0501046_0088741_648_1889 | 410 |
| 796 | 3300049581 | Ga0501047_0117071 | Ga0501047_0117071_988_2229 | 410 |
| 797 | 3300049582 | Ga0501048_0070694 | Ga0501048_0070694_168_1406 | 410 |
| 798 | 3300049584 | Ga0501068_0008490 | Ga0501068_0008490_2412_3650 | 410 |
| 799 | 3300049586 | Ga0501070_0021051 | Ga0501070_0021051_1241_2482 | 410 |
| 800 | 3300049741 | Ga0501079_0148750 | Ga0501079_0148750_420_1658 | 410 |
| 801 | 3300049743 | Ga0501081_0115517 | Ga0501081_0115517_530_1768 | 410 |
| 802 | 3300049822 | Ga0501035_0009962 | Ga0501035_0009962_4600_5841 | 410 |
| 803 | 3300049823 | Ga0501044_0019074 | Ga0501044_0019074_4352_5629 | 410 |
| 804 | 3300049823 | Ga0501044_0053817 | Ga0501044_0053817_2155_3396 | 410 |
| 805 | 3300053130 | Ga0500642_0000038 | Ga0500642_0000038_79070_80305 | 410 |
| 806 | iso_pu_bacteria | 2874612657 | 2874614908 | 410 |
| 807 | 3300003215 | JGI25153J46596_10016633 | JGI25153J46596_100166332 | 411 |
| 808 | 3300005334 | Ga0068869_100024984 | Ga0068869_1000249842 | 411 |
| 809 | 3300005347 | Ga0070668_100056424 | Ga0070668_1000564243 | 411 |
| 810 | 3300005366 | Ga0070659_100035956 | Ga0070659_1000359564 | 411 |
| 811 | 3300005434 | Ga0070709_10063877 | Ga0070709_100638772 | 411 |
| 812 | 3300005435 | Ga0070714_100043807 | Ga0070714_1000438072 | 411 |
| 813 | 3300005436 | Ga0070713_100048160 | Ga0070713_1000481603 | 411 |
| 814 | 3300005437 | Ga0070710_10023913 | Ga0070710_100239133 | 411 |
| 815 | 3300005530 | Ga0070679_100330849 | Ga0070679_1003308492 | 411 |
| 816 | 3300005578 | Ga0068854_100007607 | Ga0068854_1000076074 | 411 |
| 817 | 3300005578 | Ga0068854_100211574 | Ga0068854_1002115742 | 411 |
| 818 | 3300005617 | Ga0068859_100089615 | Ga0068859_1000896153 | 411 |
| 819 | 3300005617 | Ga0068859_100376721 | Ga0068859_1003767212 | 411 |
| 820 | 3300005842 | Ga0068858_100032070 | Ga0068858_1000320703 | 411 |
| 821 | 3300005843 | Ga0068860_100127814 | Ga0068860_1001278142 | 411 |
| 822 | 3300005844 | Ga0068862_100070598 | Ga0068862_1000705982 | 411 |
| 823 | 3300006051 | Ga0075364_10211068 | Ga0075364_102110681 | 411 |
| 824 | 3300006175 | Ga0070712_100020630 | Ga0070712_1000206302 | 411 |
| 825 | 3300006358 | Ga0068871_100018443 | Ga0068871_1000184432 | 411 |
| 826 | 3300006871 | Ga0075434_100082073 | Ga0075434_1000820732 | 411 |
| 827 | 3300006931 | Ga0097620_100089618 | Ga0097620_1000896183 | 411 |
| 828 | 3300006931 | Ga0097620_100376717 | Ga0097620_1003767172 | 411 |
| 829 | 3300006942 | Ga0099824_1003256 | Ga0099824_10032569 | 411 |
| 830 | 3300006943 | Ga0099822_1004597 | Ga0099822_100459717 | 411 |
| 831 | 3300006944 | Ga0099823_1026917 | Ga0099823_10269174 | 411 |
| 832 | 3300009093 | Ga0105240_10013102 | Ga0105240_100131026 | 411 |
| 833 | 3300009093 | Ga0105240_10099112 | Ga0105240_100991121 | 411 |
| 834 | 3300009098 | Ga0105245_10231046 | Ga0105245_102310462 | 411 |
| 835 | 3300009174 | Ga0105241_10008432 | Ga0105241_100084324 | 411 |
| 836 | 3300009545 | Ga0105237_10312233 | Ga0105237_103122332 | 411 |
| 837 | 3300009551 | Ga0105238_10030290 | Ga0105238_100302905 | 411 |
| 838 | 3300010375 | Ga0105239_10073800 | Ga0105239_100738002 | 411 |
| 839 | 3300011119 | Ga0105246_10105134 | Ga0105246_101051341 | 411 |
| 840 | 3300013104 | Ga0157370_10106780 | Ga0157370_101067802 | 411 |
| 841 | 3300013104 | Ga0157370_10273247 | Ga0157370_102732472 | 411 |
| 842 | 3300013105 | Ga0157369_10007217 | Ga0157369_1000721713 | 411 |
| 843 | 3300014968 | Ga0157379_10169060 | Ga0157379_101690602 | 411 |
| 844 | 3300025254 | Ga0209148_1000335 | Ga0209148_100033544 | 411 |
| 845 | 3300025272 | Ga0209455_1001768 | Ga0209455_10017686 | 411 |
| 846 | 3300025295 | Ga0209564_1000971 | Ga0209564_100097121 | 411 |
| 847 | 3300025297 | Ga0209758_1002973 | Ga0209758_100297310 | 411 |
| 848 | 3300025898 | Ga0207692_10053897 | Ga0207692_100538972 | 411 |
| 849 | 3300025906 | Ga0207699_10057243 | Ga0207699_100572432 | 411 |
| 850 | 3300025914 | Ga0207671_10067553 | Ga0207671_100675533 | 411 |
| 851 | 3300025915 | Ga0207693_10002004 | Ga0207693_100020046 | 411 |
| 852 | 3300025919 | Ga0207657_10011680 | Ga0207657_100116802 | 411 |
| 853 | 3300025924 | Ga0207694_10006382 | Ga0207694_100063827 | 411 |
| 854 | 3300025927 | Ga0207687_10239914 | Ga0207687_102399141 | 411 |
| 855 | 3300025929 | Ga0207664_10052199 | Ga0207664_100521993 | 411 |
| 856 | 3300025932 | Ga0207690_10056649 | Ga0207690_100566492 | 411 |
| 857 | 3300025939 | Ga0207665_10033566 | Ga0207665_100335662 | 411 |
| 858 | 3300025942 | Ga0207689_10048121 | Ga0207689_100481212 | 411 |
| 859 | 3300025949 | Ga0207667_10080586 | Ga0207667_100805863 | 411 |
| 860 | 3300025972 | Ga0207668_10101009 | Ga0207668_101010092 | 411 |
| 861 | 3300025981 | Ga0207640_10046213 | Ga0207640_100462131 | 411 |
| 862 | 3300026041 | Ga0207639_10048136 | Ga0207639_100481362 | 411 |
| 863 | 3300026078 | Ga0207702_10000003 | Ga0207702_10000003102 | 411 |
| 864 | 3300026116 | Ga0207674_10013223 | Ga0207674_100132238 | 411 |
| 865 | 3300027357 | Ga0209589_1000005 | Ga0209589_1000005437 | 411 |
| 866 | 3300027361 | Ga0209489_100005 | Ga0209489_100005437 | 411 |
| 867 | 3300027363 | Ga0209700_100006 | Ga0209700_100006437 | 411 |
| 868 | 3300028380 | Ga0268265_10058502 | Ga0268265_100585022 | 411 |
| 869 | 3300028381 | Ga0268264_10203776 | Ga0268264_102037762 | 411 |
| 870 | 3300028653 | Ga0265323_10002731 | Ga0265323_100027312 | 411 |
| 871 | 3300028666 | Ga0265336_10006513 | Ga0265336_100065132 | 411 |
| 872 | 3300028800 | Ga0265338_10001876 | Ga0265338_100018767 | 411 |
| 873 | 3300031235 | Ga0265330_10017807 | Ga0265330_100178073 | 411 |
| 874 | 3300033180 | Ga0307510_10145585 | Ga0307510_101455852 | 411 |
| 875 | 3300037068 | Ga0373925_0019502 | Ga0373925_0019502_328_1566 | 411 |
| 876 | 3300037418 | Ga0395900_0341655 | Ga0395900_0341655_188_1426 | 411 |
| 877 | 3300037466 | Ga0395898_0087149 | Ga0395898_0087149_516_1754 | 411 |
| 878 | 3300039450 | Ga0436363_0080461 | Ga0436363_0080461_525_1763 | 411 |
| 879 | 3300045049 | Ga0466959_0009264 | Ga0466959_0009264_5303_6541 | 411 |
| 880 | 3300045049 | Ga0466959_0027342 | Ga0466959_0027342_1962_3215 | 411 |
| 881 | 3300046454 | Ga0495592_0050471 | Ga0495592_0050471_534_1772 | 411 |
| 882 | 3300046477 | Ga0495664_0042090 | Ga0495664_0042090_724_1962 | 411 |
| 883 | 3300046511 | Ga0495608_0130491 | Ga0495608_0130491_133_1371 | 411 |
| 884 | 3300046516 | Ga0495628_0094609 | Ga0495628_0094609_466_1704 | 411 |
| 885 | 3300046529 | Ga0495652_0016058 | Ga0495652_0016058_4066_5304 | 411 |
| 886 | 3300046533 | Ga0495640_0080903 | Ga0495640_0080903_655_1893 | 411 |
| 887 | 3300046559 | Ga0495667_0012133 | Ga0495667_0012133_2664_3902 | 411 |
| 888 | 3300046678 | Ga0495599_0017414 | Ga0495599_0017414_3168_4406 | 411 |
| 889 | 3300046679 | Ga0495623_0014742 | Ga0495623_0014742_2137_3375 | 411 |
| 890 | 3300046680 | Ga0495646_0066578 | Ga0495646_0066578_647_1885 | 411 |
| 891 | 3300046809 | Ga0495600_0001327 | Ga0495600_0001327_5594_6832 | 411 |
| 892 | 3300047317 | Ga0495604_0005219 | Ga0495604_0005219_4558_5796 | 411 |
| 893 | 3300047320 | Ga0495672_0008799 | Ga0495672_0008799_1019_2257 | 411 |
| 894 | 3300047322 | Ga0495680_0003661 | Ga0495680_0003661_5905_7143 | 411 |
| 895 | 3300047444 | Ga0495675_0015773 | Ga0495675_0015773_241_1479 | 411 |
| 896 | 3300048088 | Ga0495602_0014364 | Ga0495602_0014364_4645_5883 | 411 |
| 897 | 3300048088 | Ga0495602_0105763 | Ga0495602_0105763_774_2039 | 411 |
| 898 | 3300048907 | Ga0496104_0143714 | Ga0496104_0143714_170_1405 | 411 |
| 899 | 3300048909 | Ga0496106_0002951 | Ga0496106_0002951_3902_5137 | 411 |
| 900 | 3300048910 | Ga0496107_0035613 | Ga0496107_0035613_247_1482 | 411 |
| 901 | 3300048911 | Ga0496108_0000392 | Ga0496108_0000392_43_1278 | 411 |
| 902 | 3300048911 | Ga0496108_0005832 | Ga0496108_0005832_7936_9174 | 411 |
| 903 | 3300048912 | Ga0496109_0000509 | Ga0496109_0000509_22996_24231 | 411 |
| 904 | 3300048913 | Ga0496110_0029205 | Ga0496110_0029205_2589_3824 | 411 |
| 905 | 3300048914 | Ga0496111_0083074 | Ga0496111_0083074_56_1291 | 411 |
| 906 | 3300048915 | Ga0496112_0007813 | Ga0496112_0007813_7194_8429 | 411 |
| 907 | 3300048920 | Ga0496117_0069258 | Ga0496117_0069258_81_1322 | 411 |
| 908 | 3300048922 | Ga0496119_0043984 | Ga0496119_0043984_853_2109 | 411 |
| 909 | 3300048924 | Ga0496121_0043710 | Ga0496121_0043710_812_2068 | 411 |
| 910 | 3300048924 | Ga0496121_0081260 | Ga0496121_0081260_169_1419 | 411 |
| 911 | 3300048924 | Ga0496121_0193722 | Ga0496121_0193722_38_1276 | 411 |
| 912 | 3300048927 | Ga0496124_0071010 | Ga0496124_0071010_333_1577 | 411 |
| 913 | 3300048928 | Ga0496125_0000839 | Ga0496125_0000839_40152_41390 | 411 |
| 914 | 3300048928 | Ga0496125_0001026 | Ga0496125_0001026_37322_38560 | 411 |
| 915 | 3300048929 | Ga0496126_0044597 | Ga0496126_0044597_667_1923 | 411 |
| 916 | 3300048929 | Ga0496126_0072813 | Ga0496126_0072813_689_1927 | 411 |
| 917 | 3300048929 | Ga0496126_0111385 | Ga0496126_0111385_969_2207 | 411 |
| 918 | 3300049573 | Ga0501037_0027235 | Ga0501037_0027235_1381_2622 | 411 |
| 919 | 3300049574 | Ga0501038_0089226 | Ga0501038_0089226_67_1308 | 411 |
| 920 | 3300049822 | Ga0501035_0028696 | Ga0501035_0028696_190_1431 | 411 |
| 921 | 3300050491 | nmdc:mga00v17_165644_c1 | nmdc:mga00v17_165644_c1_151_1389 | 411 |
| 922 | 3300053085 | Ga0495619_0040076 | Ga0495619_0040076_358_1596 | 411 |
| 923 | 3300053094 | Ga0500566_0004762 | Ga0500566_0004762_6733_7971 | 411 |
| 924 | 3300053102 | Ga0500554_002044 | Ga0500554_002044_731_2005 | 411 |
| 925 | 3300053111 | Ga0500572_001245 | Ga0500572_001245_155_1393 | 411 |
| 926 | 3300053119 | Ga0500595_000398 | Ga0500595_000398_10857_12095 | 411 |
| 927 | 3300053136 | Ga0500559_0000487 | Ga0500559_0000487_9959_11197 | 411 |
| 928 | 3300053150 | Ga0500603_000386 | Ga0500603_000386_1948_3222 | 411 |
| 929 | 3300053150 | Ga0500603_003906 | Ga0500603_003906_1853_3091 | 411 |
| 930 | 3300053162 | Ga0500638_018643 | Ga0500638_018643_422_1660 | 411 |
| 931 | 3300053178 | Ga0500637_0000118 | Ga0500637_0000118_11345_12583 | 411 |
| 932 | 3300053725 | Ga0500576_054585 | Ga0500576_054585_491_1729 | 411 |
| 933 | 3300053735 | Ga0500596_006889 | Ga0500596_006889_165_1403 | 411 |
| 934 | 3300055283 | Ga0500661_000042 | Ga0500661_000042_1724_2962 | 411 |
| 935 | 3300061719 | Ga0466962_0057626 | Ga0466962_0057626_416_1690 | 411 |
| 936 | iso_pu_bacteria | 2721755755 | 2723842669 | 411 |
| 937 | iso_pu_bacteria | 2791355199 | 2793080458 | 411 |
| 938 | iso_pu_bacteria | 2906635258 | 2906638449 | 411 |
| 939 | iso_pu_bacteria | 2906660503 | 2906663266 | 411 |
| 940 | iso_pu_bacteria | 2922393267 | 2922393440 | 411 |
| 941 | iso_pu_bacteria | 8006926726 | 8006931678 | 411 |
| 942 | iso_pu_bacteria | 8016583857 | 8016587818 | 411 |
| 943 | iso_pu_bacteria | 8016603502 | 8016607691 | 411 |
| 944 | iso_pu_bacteria | 8019547302 | 8019549062 | 411 |
| 945 | 3300005329 | Ga0070683_100144293 | Ga0070683_1001442932 | 412 |
| 946 | 3300026067 | Ga0207678_10135176 | Ga0207678_101351762 | 412 |
| 947 | 3300038443 | Ga0395901_0224459 | Ga0395901_0224459_435_1703 | 412 |
| 948 | 3300048907 | Ga0496104_0021345 | Ga0496104_0021345_1325_2563 | 412 |
| 949 | 3300048908 | Ga0496105_0038908 | Ga0496105_0038908_792_2030 | 412 |
| 950 | 3300048914 | Ga0496111_0035754 | Ga0496111_0035754_2271_3509 | 412 |
| 951 | 3300048915 | Ga0496112_0052096 | Ga0496112_0052096_2705_3943 | 412 |
| 952 | 3300048918 | Ga0496115_0039367 | Ga0496115_0039367_597_1835 | 412 |
| 953 | 3300048929 | Ga0496126_0100535 | Ga0496126_0100535_11_1252 | 412 |
| 954 | 3300001989 | JGI24739J22299_10013644 | JGI24739J22299_100136442 | 413 |
| 955 | 3300002067 | JGI24735J21928_10025316 | JGI24735J21928_100253162 | 413 |
| 956 | 3300005457 | Ga0070662_100040915 | Ga0070662_1000409152 | 413 |
| 957 | 3300005539 | Ga0068853_100023427 | Ga0068853_1000234274 | 413 |
| 958 | 3300005539 | Ga0068853_100178962 | Ga0068853_1001789621 | 413 |
| 959 | 3300005563 | Ga0068855_100024679 | Ga0068855_1000246792 | 413 |
| 960 | 3300005577 | Ga0068857_100018829 | Ga0068857_1000188294 | 413 |
| 961 | 3300005578 | Ga0068854_100066695 | Ga0068854_1000666952 | 413 |
| 962 | 3300005614 | Ga0068856_100026401 | Ga0068856_1000264014 | 413 |
| 963 | 3300005616 | Ga0068852_100040881 | Ga0068852_1000408813 | 413 |
| 964 | 3300005834 | Ga0068851_10060065 | Ga0068851_100600652 | 413 |
| 965 | 3300009093 | Ga0105240_10072778 | Ga0105240_100727784 | 413 |
| 966 | 3300009551 | Ga0105238_10019125 | Ga0105238_100191254 | 413 |
| 967 | 3300010375 | Ga0105239_10054445 | Ga0105239_100544452 | 413 |
| 968 | 3300025904 | Ga0207647_10003678 | Ga0207647_100036782 | 413 |
| 969 | 3300025913 | Ga0207695_10037000 | Ga0207695_100370003 | 413 |
| 970 | 3300025913 | Ga0207695_10235647 | Ga0207695_102356471 | 413 |
| 971 | 3300025949 | Ga0207667_10050466 | Ga0207667_100504662 | 413 |
| 972 | 3300025981 | Ga0207640_10023994 | Ga0207640_100239942 | 413 |
| 973 | 3300026041 | Ga0207639_10080896 | Ga0207639_100808962 | 413 |
| 974 | 3300026067 | Ga0207678_10108112 | Ga0207678_101081122 | 413 |
| 975 | 3300026078 | Ga0207702_10106163 | Ga0207702_101061632 | 413 |
| 976 | 3300026116 | Ga0207674_10017295 | Ga0207674_100172953 | 413 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6lpq-assembly1.cif.gz_A | crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) | 0.804 | 3 | 410 |
| 7qh2-assembly1.cif.gz_F | cryo-em structure of ldh-etfab complex from acetobacterium woodii | 0.7999 | 3 | 407 |
| 6lpq-assembly1.cif.gz_A | crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) | 0.7937 | 3 | 410 |
| 8jde-assembly1.cif.gz_A | crystal structure of mldhd in complex with d-lactate | 0.787 | 3 | 407 |
| 8jdc-assembly1.cif.gz_A | crystal structure of mldhd in apo form | 0.7863 | 3 | 407 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P52073_9_189_3.30.465.10 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9369 | 12 | 183 | 3.30.465.10 |
| af_A0A368ULS0_107_341_3.30.465.10 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.8742 | 3 | 183 | 3.30.465.10 |
| af_Q5ADT6_76_298_3.30.465.10 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.8736 | 3 | 184 | 3.30.465.10 |
| af_K7K4A7_263_384_3.30.465.10 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.8729 | 53 | 181 | 3.30.465.10 |
| af_Q11061_15_234_3.30.465.10 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.8717 | 3 | 180 | 3.30.465.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q5R3U4-F1-model_v4 | 2-hydroxy-acid oxidase | 0.9669 | 1 | 325 |
GO:0003824
GO:0071949 |
| AF-A0A1W9KFP3-F1-model_v4 | deleted | 0.9666 | 1 | 408 |
|
| AF-A0A1Q5R3U4-F1-model_v4 | 2-hydroxy-acid oxidase | 0.964 | 1 | 325 |
GO:0003824
GO:0071949 |
| AF-A0A844AAP0-F1-model_v4 | Glycolate oxidase subunit GlcE (EC 1.1.99.14) | 0.9608 | 1 | 411 |
GO:0016491
GO:0071949 |
| AF-A0A0D6PJ58-F1-model_v4 | Glycolate oxidase subunit GlcE | 0.9598 | 1 | 413 |
GO:0003824
GO:0071949 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar