F487254

General Info

Members Datasets Scaffolds Average Seq Length
976 567 774 402

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10112091|Ga0105240_101120913
Length 471
Sequence MDDEVCSKRFDRGRSVVAGGAKFFAKQPSTFSRHALEGAKEGGDARVLPQGWRGQSRRVGVDILKIRDAKDVETVVRAAIASEQPLEIIGHGSRRGIGQVMATNAVLDLSALNGVTSYEPNELIITVEAGAPLADVLSLIDSKNQQFAFEPMDTAPLFGTAGLGTIGGMIGTGLAGPRRIKAGGARDHLLGAHAVSGFGDSFKTGGKVVKNVTGYDLCKLLAGSFGTLAVMTEVTLKVMPRPESERTLVLGSLDDLTANRAMTAALGSPFDVSAAAHLPPSTPRPSVGGLDRLGSPDGAVTLVRLEGIPASAAHRAASLAKTLAPFGTAEMLEDAVSAEVWRSIRDVEPFAAKGALGARPVWRIVCPPAAGGALGEGLARETGGEVIYDWGGGLIWAALPPKPDAQAALVRSRVSAAGGHAMLLRASEEVRRNVDVFHPQARGVAALGERVRQSFDPKQILNRGRMIRGAA

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
10 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
11 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
12 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
13 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
14 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
15 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
16 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
17 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
18 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
19 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
20 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
21 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
22 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
23 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
24 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
25 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
26 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
27 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
28 2643221651 Afipia sp. Root123D2 Isolate Unclassified
29 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
30 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
31 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
32 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
33 2791355199
34 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
35 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
36 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
37 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
38 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
39 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
40 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
41 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
42 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
43 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
44 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
45 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
46 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
47 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
48 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
49 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
50 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
51 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
52 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
53 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
54 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
55 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
56 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
57 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
58 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
59 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
60 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
61 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
62 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
63 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
64 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
65 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
66 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
67 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
68 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
69 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
70 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
71 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
72 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
73 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
74 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
75 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
76 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
77 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
78 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
79 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
80 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
81 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
82 2904699407
83 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
84 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
85 2906610324
86 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
87 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
88 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
89 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
90 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
91 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
92 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
93 2922368715
94 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
95 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
96 2922425934
97 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
98 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
99 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
100 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
101 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
102 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
103 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
104 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
105 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
106 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
107 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
108 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
109 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
110 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
111 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
112 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
113 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
114 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
115 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
116 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
117 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
118 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
119 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
120 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
121 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
122 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
123 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
124 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
125 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
126 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
127 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
128 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
129 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
130 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
131 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
132 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
133 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
134 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
135 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
136 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
137 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
138 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
139 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
140 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
141 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
142 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
143 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
144 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
145 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
146 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
147 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
148 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
149 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
150 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
151 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
152 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
153 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
154 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
155 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
156 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
157 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
158 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
159 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
160 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
161 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
162 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
163 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
164 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
165 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
166 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
167 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
168 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
169 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
170 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
171 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
172 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
173 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
174 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
175 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
176 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
177 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
178 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
179 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
180 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
181 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
182 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
183 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
184 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
185 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
186 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
187 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
188 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
189 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
190 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
191 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
192 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
193 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
194 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
195 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
196 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
197 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
198 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
199 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
200 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
201 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
202 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
203 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
204 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
205 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
206 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
207 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
208 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
209 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
210 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
211 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
212 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
213 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
214 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
215 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
216 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
217 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
218 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
219 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
220 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
221 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
222 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
223 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
224 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
225 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
226 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
227 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
228 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
229 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
230 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
231 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
232 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
233 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
234 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
235 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
236 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
237 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
238 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
239 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
240 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
241 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
242 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
243 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
244 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
245 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
246 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
247 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
248 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
249 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
250 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
251 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
252 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
253 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
254 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
255 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
256 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
257 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
258 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
259 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
260 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
261 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
262 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
263 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
264 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
265 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
266 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
267 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
268 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
269 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
270 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
271 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
272 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
273 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
274 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
275 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
276 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
277 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
278 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
279 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
280 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
281 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
282 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
325 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
326 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
327 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
328 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
334 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
335 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
336 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
337 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
338 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
339 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
340 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
341 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
342 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
343 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
344 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
345 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
346 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
347 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
348 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
349 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
350 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
351 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
352 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
353 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
354 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
355 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
356 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
357 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
358 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
359 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
360 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
361 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
362 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
363 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
364 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
365 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
366 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
367 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
368 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
369 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
370 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
371 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
372 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
373 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
374 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
375 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
376 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
377 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
378 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
379 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
380 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
381 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
382 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
383 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
384 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
385 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
386 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
387 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
388 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
389 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
390 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
391 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
392 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
393 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
394 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
395 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
396 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
397 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
398 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
399 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
400 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
401 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
402 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
403 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
404 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
405 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
406 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
407 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
408 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
409 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
410 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
411 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
412 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
413 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
414 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
415 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
416 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
417 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
418 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
419 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
420 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
421 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
422 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
423 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
424 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
425 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
426 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
427 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
428 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
429 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
430 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
431 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
432 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
433 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
434 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
435 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
436 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
437 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
438 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
439 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
440 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
441 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
442 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
443 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
444 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
445 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
446 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
447 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
448 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
449 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
450 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
451 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
452 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
453 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
454 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
455 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
456 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
457 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
458 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
459 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
460 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
461 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
462 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
463 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
465 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
466 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
467 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
468 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
469 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
470 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
471 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
472 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
473 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
474 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
475 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
476 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
477 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
478 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
479 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
480 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
481 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
482 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
483 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
484 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
485 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
486 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
487 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
488 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
489 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
490 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
491 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
492 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
493 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
494 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
495 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
496 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
497 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
498 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
499 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
500 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
501 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
502 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
503 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
504 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
505 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
506 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
507 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
508 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
509 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
510 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
511 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
512 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
513 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
514 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
515 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
516 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
517 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
518 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
519 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
520 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
521 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
522 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
523 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
524 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
525 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
526 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
527 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
528 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
529 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
530 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
531 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
532 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
533 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
534 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
535 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
536 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
537 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
538 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
539 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
540 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
541 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
542 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
543 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
544 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
545 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
546 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
547 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
548 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
549 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
550 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
551 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
552 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
553 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
554 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
555 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
556 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
557 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
558 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
559 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
560 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
561 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
562 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
563 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
564 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
565 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
566 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
567 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.71
Metatranscriptomes 0
Isolates 20.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.48
Nodule 18.03
Rhizoplane 6.76
Rhizosphere 54.51
Stem 0
Stem Tuber 0
Unclassified 9.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10013644 3300001989 Bacteria 2963
2 JGI24735J21928_10025316 3300002067 Bacteria 1791
3 JGI25406J46586_10005786 3300003203 Bacteria 5719
4 JGI25165J46597_1004010 3300003214 Bacteria 3349
5 JGI25165J46597_1004774 3300003214 Bacteria 2786
6 JGI25153J46596_10008980 3300003215 Bacteria 4707
7 JGI25153J46596_10013010 3300003215 Bacteria 3547
8 JGI25153J46596_10016633 3300003215 Bacteria 2934
9 JGI25153J46596_10019877 3300003215 Bacteria 2556
10 JGI25153J46596_10030363 3300003215 Bacteria 1840
11 JGI25160J50197_1002626 3300003354 Bacteria 8277
12 Ga0065165_1004408 3300005262 Bacteria 8766
13 Ga0065165_1005651 3300005262 Bacteria 6913
14 Ga0065165_1008089 3300005262 Bacteria 5014
15 Ga0065704_10070332 3300005289 Bacteria 31943
16 Ga0070658_10055370 3300005327 Bacteria 3223
17 Ga0070683_100144293 3300005329 Bacteria 2256
18 Ga0070683_100206815 3300005329 Bacteria 1864
19 Ga0070670_100129126 3300005331 Bacteria 2182
20 Ga0068869_100011774 3300005334 Bacteria 5753
21 Ga0068869_100024984 3300005334 Bacteria 4143
22 Ga0070680_100049028 3300005336 Bacteria 3442
23 Ga0070680_100089673 3300005336 Bacteria 2544
24 Ga0070680_100101875 3300005336 Bacteria 2384
25 Ga0068868_100061300 3300005338 Bacteria 2980
26 Ga0068868_100070715 3300005338 Bacteria 2782
27 Ga0070660_100015960 3300005339 Bacteria 5440
28 Ga0070660_100174624 3300005339 Bacteria 1737
29 Ga0070691_10013655 3300005341 Bacteria 3723
30 Ga0070668_100056424 3300005347 Bacteria 3033
31 Ga0070668_100087515 3300005347 Bacteria 2451
32 Ga0070668_100146050 3300005347 Bacteria 1909
33 Ga0070668_100223338 3300005347 Bacteria 1554
34 Ga0070669_100053671 3300005353 Bacteria 2950
35 Ga0070671_100124208 3300005355 Bacteria 2172
36 Ga0070674_100018087 3300005356 Bacteria 4448
37 Ga0070659_100035956 3300005366 Bacteria 3859
38 Ga0070667_100092241 3300005367 Bacteria 2605
39 Ga0070709_10001202 3300005434 Bacteria 14225
40 Ga0070709_10010701 3300005434 Bacteria 5089
41 Ga0070709_10063877 3300005434 Bacteria 2353
42 Ga0070709_10095195 3300005434 Bacteria 1972
43 Ga0070714_100043807 3300005435 Bacteria 3787
44 Ga0070714_100054175 3300005435 Bacteria 3426
45 Ga0070714_100211245 3300005435 Bacteria 1779
46 Ga0070713_100003811 3300005436 Bacteria 9975
47 Ga0070713_100016005 3300005436 Bacteria 5628
48 Ga0070713_100048160 3300005436 Bacteria 3508
49 Ga0070710_10003163 3300005437 Bacteria 7808
50 Ga0070710_10023913 3300005437 Bacteria 3217
51 Ga0070711_100021396 3300005439 Bacteria 4182
52 Ga0070711_100057793 3300005439 Bacteria 2687
53 Ga0070663_100038640 3300005455 Bacteria 3330
54 Ga0070678_100066627 3300005456 Bacteria 2677
55 Ga0070662_100033636 3300005457 Bacteria 3611
56 Ga0070662_100040915 3300005457 Bacteria 3303
57 Ga0068867_100029024 3300005459 Bacteria 3985
58 Ga0070685_10007116 3300005466 Bacteria 5713
59 Ga0070706_100132226 3300005467 Bacteria 2329
60 Ga0070698_100114551 3300005471 Bacteria 2661
61 Ga0070699_100076792 3300005518 Bacteria 2908
62 Ga0070679_100007378 3300005530 Bacteria 10275
63 Ga0070679_100015717 3300005530 Bacteria 7278
64 Ga0070679_100330849 3300005530 Bacteria 1472
65 Ga0070684_100005066 3300005535 Bacteria 10062
66 Ga0070684_100022108 3300005535 Bacteria 5301
67 Ga0068853_100017422 3300005539 Bacteria 5930
68 Ga0068853_100023427 3300005539 Bacteria 5168
69 Ga0068853_100178962 3300005539 Bacteria 1922
70 Ga0070672_100035145 3300005543 Bacteria 3807
71 Ga0070686_100027608 3300005544 Bacteria 3436
72 Ga0070665_100030612 3300005548 Bacteria 5414
73 Ga0070665_100188160 3300005548 Bacteria 2065
74 Ga0068855_100011878 3300005563 Bacteria 10529
75 Ga0068855_100012917 3300005563 Bacteria 10077
76 Ga0068855_100024679 3300005563 Bacteria 7191
77 Ga0070664_100210482 3300005564 Bacteria 1737
78 Ga0068857_100004377 3300005577 Bacteria 11936
79 Ga0068857_100018829 3300005577 Bacteria 6060
80 Ga0068857_100177034 3300005577 Bacteria 1940
81 Ga0068854_100007607 3300005578 Bacteria 6929
82 Ga0068854_100066695 3300005578 Bacteria 2620
83 Ga0068854_100093480 3300005578 Bacteria 2241
84 Ga0068854_100107665 3300005578 Bacteria 2098
85 Ga0068854_100211574 3300005578 Bacteria 1530
86 Ga0068856_100000046 3300005614 Bacteria 109174
87 Ga0068856_100026401 3300005614 Bacteria 5664
88 Ga0068852_100040881 3300005616 Bacteria 3916
89 Ga0068852_100086520 3300005616 Bacteria 2794
90 Ga0068852_100090609 3300005616 Bacteria 2735
91 Ga0068852_100190743 3300005616 Bacteria 1934
92 Ga0068859_100089615 3300005617 Bacteria 3126
93 Ga0068859_100376721 3300005617 Bacteria 1515
94 Ga0068864_100043041 3300005618 Bacteria 3865
95 Ga0068864_100103201 3300005618 Bacteria 2531
96 Ga0068866_10023188 3300005718 Bacteria 2883
97 Ga0068866_10080700 3300005718 Bacteria 1746
98 Ga0068861_100064113 3300005719 Bacteria 2826
99 Ga0068851_10005968 3300005834 Bacteria 5546
100 Ga0068851_10060065 3300005834 Bacteria 1946
101 Ga0068863_100039597 3300005841 Bacteria 4484
102 Ga0068858_100032070 3300005842 Bacteria 4880
103 Ga0068860_100001738 3300005843 Bacteria 23223
104 Ga0068860_100127814 3300005843 Bacteria 2436
105 Ga0068860_100306905 3300005843 Bacteria 1556
106 Ga0068862_100048515 3300005844 Bacteria 3625
107 Ga0068862_100070598 3300005844 Bacteria 3015
108 Ga0081455_10005256 3300005937 Bacteria 14228
109 Ga0081455_10017866 3300005937 Bacteria 6780
110 Ga0081455_10061213 3300005937 Bacteria 3169
111 Ga0081540_1001673 3300005983 Bacteria 18856
112 Ga0081540_1002366 3300005983 Bacteria 15399
113 Ga0081540_1002776 3300005983 Bacteria 14204
114 Ga0081540_1003496 3300005983 Bacteria 12400
115 Ga0081540_1021133 3300005983 Bacteria 3888
116 Ga0081539_10000585 3300005985 Bacteria 74791
117 Ga0081539_10001606 3300005985 Bacteria 37203
118 Ga0081539_10030383 3300005985 Bacteria 3355
119 Ga0070717_10005166 3300006028 Bacteria 9518
120 Ga0070717_10032987 3300006028 Bacteria 4175
121 Ga0070717_10051648 3300006028 Bacteria 3385
122 Ga0075365_10019222 3300006038 Bacteria 4213
123 Ga0075365_10022691 3300006038 Bacteria 3937
124 Ga0075365_10051990 3300006038 Bacteria 2708
125 Ga0075368_10007787 3300006042 Bacteria 3795
126 Ga0075368_10021410 3300006042 Bacteria 2456
127 Ga0075363_100007732 3300006048 Bacteria 4964
128 Ga0075364_10028214 3300006051 Bacteria 3592
129 Ga0075364_10052430 3300006051 Bacteria 2665
130 Ga0075364_10211068 3300006051 Bacteria 1317
131 Ga0070715_10004200 3300006163 Bacteria 4692
132 Ga0070716_100001652 3300006173 Bacteria 10064
133 Ga0070712_100020630 3300006175 Bacteria 4314
134 Ga0070712_100023949 3300006175 Bacteria 4039
135 Ga0075367_10014420 3300006178 Bacteria 4279
136 Ga0075367_10049824 3300006178 Bacteria 2470
137 Ga0075367_10084476 3300006178 Bacteria 1925
138 Ga0075367_10098252 3300006178 Bacteria 1787
139 Ga0075367_10123619 3300006178 Bacteria 1596
140 Ga0075369_10061748 3300006186 Bacteria 1636
141 Ga0075366_10003115 3300006195 Bacteria 8673
142 Ga0097621_100308317 3300006237 Bacteria 1400
143 Ga0068871_100018443 3300006358 Bacteria 5304
144 Ga0075434_100082073 3300006871 Bacteria 3221
145 Ga0068865_100114281 3300006881 Bacteria 1996
146 Ga0097620_100089618 3300006931 Bacteria 3126
147 Ga0097620_100376717 3300006931 Bacteria 1515
148 Ga0099824_1003256 3300006942 Bacteria 23739
149 Ga0099824_1018316 3300006942 Bacteria 5785
150 Ga0099822_1004597 3300006943 Bacteria 17990
151 Ga0099823_1026917 3300006944 Bacteria 5045
152 Ga0099794_10044796 3300007265 Bacteria 2115
153 Ga0105240_10013102 3300009093 Bacteria 11411
154 Ga0105240_10030379 3300009093 Bacteria 7023
155 Ga0105240_10072778 3300009093 Bacteria 4247
156 Ga0105240_10099112 3300009093 Bacteria 3547
157 Ga0105240_10112091 3300009093 Bacteria 3298
158 Ga0105240_10162984 3300009093 Bacteria 2647
159 Ga0105240_10167449 3300009093 Bacteria 2605
160 Ga0105245_10007957 3300009098 Bacteria 9269
161 Ga0105245_10231046 3300009098 Bacteria 1789
162 Ga0105243_10085790 3300009148 Bacteria 2581
163 Ga0105241_10008432 3300009174 Bacteria 7578
164 Ga0105241_10015297 3300009174 Bacteria 5618
165 Ga0105241_10167678 3300009174 Bacteria 1811
166 Ga0105242_10112498 3300009176 Bacteria 2323
167 Ga0105237_10007238 3300009545 Bacteria 12171
168 Ga0105237_10024463 3300009545 Bacteria 6177
169 Ga0105237_10029665 3300009545 Bacteria 5558
170 Ga0105237_10049111 3300009545 Bacteria 4243
171 Ga0105237_10312233 3300009545 Bacteria 1575
172 Ga0105238_10002788 3300009551 Bacteria 17442
173 Ga0105238_10019066 3300009551 Bacteria 6989
174 Ga0105238_10019125 3300009551 Bacteria 6978
175 Ga0105238_10030290 3300009551 Bacteria 5508
176 Ga0105238_10071778 3300009551 Bacteria 3459
177 Ga0105249_10022299 3300009553 Bacteria 5672
178 Ga0105239_10022535 3300010375 Bacteria 6944
179 Ga0105239_10027593 3300010375 Bacteria 6248
180 Ga0105239_10054445 3300010375 Bacteria 4388
181 Ga0105239_10060216 3300010375 Bacteria 4167
182 Ga0105239_10070576 3300010375 Bacteria 3838
183 Ga0105239_10073800 3300010375 Bacteria 3751
184 Ga0105239_10119042 3300010375 Bacteria 2931
185 Ga0105239_10129001 3300010375 Bacteria 2811
186 Ga0105239_10142409 3300010375 Bacteria 2672
187 Ga0105239_10413418 3300010375 Bacteria 1527
188 Ga0105246_10105134 3300011119 Bacteria 2063
189 Ga0157370_10007873 3300013104 Bacteria 11550
190 Ga0157370_10106780 3300013104 Bacteria 2620
191 Ga0157370_10273247 3300013104 Bacteria 1561
192 Ga0157369_10007217 3300013105 Bacteria 12807
193 Ga0157369_10017046 3300013105 Bacteria 8162
194 Ga0157369_10022283 3300013105 Bacteria 7072
195 Ga0157374_10026351 3300013296 Bacteria 5231
196 Ga0157374_10202426 3300013296 Bacteria 1944
197 Ga0157374_10206425 3300013296 Bacteria 1925
198 Ga0157378_10003222 3300013297 Bacteria 14517
199 Ga0157378_10073464 3300013297 Bacteria 3075
200 Ga0157378_10123168 3300013297 Bacteria 2392
201 Ga0163162_10153430 3300013306 Bacteria 2422
202 Ga0163162_10274148 3300013306 Bacteria 1819
203 Ga0157375_10029256 3300013308 Bacteria 5178
204 Ga0157375_10145312 3300013308 Bacteria 2502
205 Ga0163163_10030032 3300014325 Bacteria 5232
206 Ga0163163_10190091 3300014325 Bacteria 2102
207 Ga0163163_10197585 3300014325 Bacteria 2059
208 Ga0157380_10070533 3300014326 Bacteria 2824
209 Ga0157380_10095888 3300014326 Bacteria 2459
210 Ga0157379_10169060 3300014968 Bacteria 1973
211 Ga0157376_10034960 3300014969 Bacteria 4061
212 Ga0163161_10030838 3300017792 Bacteria 3817
213 Ga0214544_1000007 3300021320 Bacteria 379989
214 Ga0214542_1000007 3300021321 Bacteria 291816
215 Ga0214545_1000006 3300021324 Bacteria 291693
216 Ga0214543_1000009 3300021327 Bacteria 384302
217 Ga0213871_10032557 3300021441 Bacteria 1366
218 Ga0209148_1000335 3300025254 Bacteria 63754
219 Ga0209233_1001244 3300025261 Bacteria 10240
220 Ga0209233_1015771 3300025261 Bacteria 2095
221 Ga0209455_1001768 3300025272 Bacteria 9156
222 Ga0209564_1000971 3300025295 Bacteria 36259
223 Ga0209564_1005380 3300025295 Bacteria 7336
224 Ga0209564_1007038 3300025295 Bacteria 5896
225 Ga0209564_1019099 3300025295 Bacteria 2578
226 Ga0209758_1000106 3300025297 Bacteria 218450
227 Ga0209758_1000344 3300025297 Bacteria 85133
228 Ga0209758_1001622 3300025297 Bacteria 25624
229 Ga0209758_1002973 3300025297 Bacteria 16248
230 Ga0209758_1007055 3300025297 Bacteria 7794
231 Ga0209758_1012733 3300025297 Bacteria 4667
232 Ga0209758_1016727 3300025297 Bacteria 3705
233 Ga0209256_1014971 3300025299 Bacteria 2745
234 Ga0207426_1000819 3300025302 Bacteria 33379
235 Ga0207426_1004720 3300025302 Bacteria 6519
236 Ga0207426_1012541 3300025302 Bacteria 3178
237 Ga0207426_1012642 3300025302 Bacteria 3163
238 Ga0209051_1021162 3300025303 Bacteria 2779
239 Ga0209257_1012480 3300025304 Bacteria 3916
240 Ga0207696_1000560 3300025711 Bacteria 29472
241 Ga0207692_10000264 3300025898 Bacteria 17986
242 Ga0207692_10053897 3300025898 Bacteria 2050
243 Ga0207688_10040757 3300025901 Bacteria 2581
244 Ga0207688_10054206 3300025901 Bacteria 2249
245 Ga0207647_10003678 3300025904 Bacteria 11473
246 Ga0207699_10014138 3300025906 Bacteria 4105
247 Ga0207699_10037075 3300025906 Bacteria 2784
248 Ga0207699_10057243 3300025906 Bacteria 2327
249 Ga0207699_10075669 3300025906 Bacteria 2071
250 Ga0207643_10077208 3300025908 Bacteria 1925
251 Ga0207705_10063283 3300025909 Bacteria 2673
252 Ga0207707_10000575 3300025912 Bacteria 37261
253 Ga0207707_10005305 3300025912 Bacteria 11268
254 Ga0207695_10000123 3300025913 Bacteria 232059
255 Ga0207695_10006774 3300025913 Bacteria 14771
256 Ga0207695_10037000 3300025913 Bacteria 5269
257 Ga0207695_10235647 3300025913 Bacteria 1733
258 Ga0207695_10251545 3300025913 Bacteria 1666
259 Ga0207671_10005835 3300025914 Bacteria 11190
260 Ga0207671_10014011 3300025914 Bacteria 6360
261 Ga0207671_10018857 3300025914 Bacteria 5287
262 Ga0207671_10067553 3300025914 Bacteria 2662
263 Ga0207693_10001910 3300025915 Bacteria 18229
264 Ga0207693_10002004 3300025915 Bacteria 17879
265 Ga0207693_10023244 3300025915 Bacteria 4923
266 Ga0207693_10029960 3300025915 Bacteria 4295
267 Ga0207693_10054652 3300025915 Bacteria 3132
268 Ga0207663_10000684 3300025916 Bacteria 15034
269 Ga0207660_10008892 3300025917 Bacteria 6493
270 Ga0207660_10032853 3300025917 Bacteria 3584
271 Ga0207657_10011680 3300025919 Bacteria 8704
272 Ga0207657_10027023 3300025919 Bacteria 5261
273 Ga0207652_10005891 3300025921 Bacteria 9919
274 Ga0207652_10014514 3300025921 Bacteria 6382
275 Ga0207652_10081825 3300025921 Bacteria 2824
276 Ga0207694_10006382 3300025924 Bacteria 8990
277 Ga0207694_10012632 3300025924 Bacteria 6364
278 Ga0207694_10019123 3300025924 Bacteria 5178
279 Ga0207659_10056798 3300025926 Bacteria 2804
280 Ga0207687_10032786 3300025927 Bacteria 3520
281 Ga0207687_10056601 3300025927 Bacteria 2751
282 Ga0207687_10239914 3300025927 Bacteria 1436
283 Ga0207700_10006661 3300025928 Bacteria 7004
284 Ga0207700_10011618 3300025928 Bacteria 5626
285 Ga0207700_10017252 3300025928 Bacteria 4818
286 Ga0207700_10115569 3300025928 Bacteria 2167
287 Ga0207664_10008459 3300025929 Bacteria 7179
288 Ga0207664_10052199 3300025929 Bacteria 3233
289 Ga0207644_10058184 3300025931 Bacteria 2793
290 Ga0207644_10083738 3300025931 Bacteria 2363
291 Ga0207690_10056649 3300025932 Bacteria 2645
292 Ga0207706_10070643 3300025933 Bacteria 3071
293 Ga0207706_10086337 3300025933 Bacteria 2758
294 Ga0207686_10033506 3300025934 Bacteria 3067
295 Ga0207665_10001660 3300025939 Bacteria 14973
296 Ga0207665_10033566 3300025939 Bacteria 3403
297 Ga0207691_10037606 3300025940 Bacteria 4481
298 Ga0207689_10019363 3300025942 Bacteria 5737
299 Ga0207689_10048121 3300025942 Bacteria 3517
300 Ga0207689_10059119 3300025942 Bacteria 3153
301 Ga0207661_10000727 3300025944 Bacteria 21473
302 Ga0207661_10002678 3300025944 Bacteria 12262
303 Ga0207667_10003446 3300025949 Bacteria 19521
304 Ga0207667_10022727 3300025949 Bacteria 6918
305 Ga0207667_10050466 3300025949 Bacteria 4389
306 Ga0207667_10080586 3300025949 Bacteria 3373
307 Ga0207667_10195800 3300025949 Bacteria 2073
308 Ga0207667_10215786 3300025949 Bacteria 1966
309 Ga0207668_10024248 3300025972 Bacteria 3912
310 Ga0207668_10101009 3300025972 Bacteria 2143
311 Ga0207668_10203213 3300025972 Bacteria 1579
312 Ga0207640_10023994 3300025981 Bacteria 3673
313 Ga0207640_10046213 3300025981 Bacteria 2800
314 Ga0207640_10261182 3300025981 Bacteria 1349
315 Ga0207677_10028853 3300026023 Bacteria 3517
316 Ga0207677_10032157 3300026023 Bacteria 3370
317 Ga0207703_10014373 3300026035 Bacteria 6173
318 Ga0207703_10036684 3300026035 Bacteria 3903
319 Ga0207703_10041661 3300026035 Bacteria 3681
320 Ga0207703_10046636 3300026035 Bacteria 3491
321 Ga0207639_10008373 3300026041 Bacteria 7088
322 Ga0207639_10048136 3300026041 Bacteria 3225
323 Ga0207639_10080896 3300026041 Bacteria 2572
324 Ga0207678_10015465 3300026067 Bacteria 6708
325 Ga0207678_10092405 3300026067 Bacteria 2586
326 Ga0207678_10108112 3300026067 Bacteria 2372
327 Ga0207678_10135176 3300026067 Bacteria 2104
328 Ga0207678_10194201 3300026067 Bacteria 1735
329 Ga0207702_10000003 3300026078 Bacteria 434196
330 Ga0207702_10000014 3300026078 Bacteria 253304
331 Ga0207702_10106163 3300026078 Bacteria 2488
332 Ga0207648_10033893 3300026089 Bacteria 4503
333 Ga0207676_10119667 3300026095 Bacteria 2218
334 Ga0207676_10144666 3300026095 Bacteria 2040
335 Ga0207674_10003672 3300026116 Bacteria 18726
336 Ga0207674_10013223 3300026116 Bacteria 9176
337 Ga0207674_10017295 3300026116 Bacteria 7867
338 Ga0207674_10029815 3300026116 Bacteria 5740
339 Ga0207675_100025081 3300026118 Bacteria 5549
340 Ga0207675_100037081 3300026118 Bacteria 4548
341 Ga0207675_100189164 3300026118 Bacteria 1974
342 Ga0207683_10016200 3300026121 Bacteria 6345
343 Ga0207683_10034454 3300026121 Bacteria 4400
344 Ga0207683_10138572 3300026121 Bacteria 2191
345 Ga0207698_10041783 3300026142 Bacteria 3420
346 Ga0207698_10119439 3300026142 Bacteria 2228
347 Ga0209389_1000016 3300027296 Bacteria 184844
348 Ga0209389_1006299 3300027296 Bacteria 10277
349 Ga0209589_1000005 3300027357 Bacteria 530958
350 Ga0209589_1000031 3300027357 Bacteria 147054
351 Ga0209489_100005 3300027361 Bacteria 530958
352 Ga0209489_100057 3300027361 Bacteria 147398
353 Ga0209489_100063 3300027361 Bacteria 144408
354 Ga0209700_100006 3300027363 Bacteria 530958
355 Ga0209700_100012 3300027363 Bacteria 357892
356 Ga0209179_1007032 3300027512 Bacteria 1842
357 Ga0209588_1004507 3300027671 Bacteria 3934
358 Ga0268266_10002572 3300028379 Bacteria 19242
359 Ga0268266_10006470 3300028379 Bacteria 10721
360 Ga0268266_10088547 3300028379 Bacteria 2709
361 Ga0268265_10043749 3300028380 Bacteria 3330
362 Ga0268265_10058502 3300028380 Bacteria 2943
363 Ga0268264_10000042 3300028381 Bacteria 372069
364 Ga0268264_10106463 3300028381 Bacteria 2448
365 Ga0268264_10157323 3300028381 Bacteria 2043
366 Ga0268264_10203776 3300028381 Bacteria 1812
367 Ga0265323_10002731 3300028653 Bacteria 7956
368 Ga0265336_10006513 3300028666 Bacteria 4205
369 Ga0307517_10000542 3300028786 Bacteria 64617
370 Ga0307517_10103031 3300028786 Bacteria 2233
371 Ga0307515_10011730 3300028794 Bacteria 16583
372 Ga0265338_10001876 3300028800 Bacteria 32924
373 Ga0265330_10017807 3300031235 Bacteria 3269
374 Ga0265332_10009250 3300031238 Bacteria 4402
375 Ga0265328_10000019 3300031239 Bacteria 130536
376 Ga0265328_10003191 3300031239 Bacteria 7276
377 Ga0265328_10004115 3300031239 Bacteria 6350
378 Ga0265325_10023765 3300031241 Bacteria 3341
379 Ga0265340_10004701 3300031247 Bacteria 7593
380 Ga0265340_10012973 3300031247 Bacteria 4391
381 Ga0265339_10002202 3300031249 Bacteria 14147
382 Ga0265339_10016301 3300031249 Bacteria 4433
383 Ga0265331_10000057 3300031250 Bacteria 175827
384 Ga0265331_10006010 3300031250 Bacteria 7241
385 Ga0265316_10089842 3300031344 Bacteria 2344
386 Ga0307513_10266762 3300031456 Bacteria 1498
387 Ga0307509_10083085 3300031507 Bacteria 3302
388 Ga0307508_10000019 3300031616 Bacteria 197575
389 Ga0307508_10071751 3300031616 Bacteria 3037
390 Ga0265314_10020295 3300031711 Bacteria 5129
391 Ga0265314_10030455 3300031711 Bacteria 3994
392 Ga0265342_10012767 3300031712 Bacteria 5673
393 Ga0307405_10048853 3300031731 Bacteria 2612
394 Ga0307415_100063976 3300032126 Bacteria 2558
395 Ga0307510_10115942 3300033180 Bacteria 2402
396 Ga0307510_10145585 3300033180 Bacteria 2002
397 Ga0315911_1000012 3300033442 Bacteria 248988
398 Ga0373934_0030873 3300035086 Bacteria 2097
399 Ga0373944_0018534 3300035089 Bacteria 1989
400 Ga0373923_0004450 3300035111 Bacteria 4649
401 Ga0373936_0016236 3300035113 Bacteria 2863
402 Ga0373936_0030237 3300035113 Bacteria 2136
403 Ga0373954_0008297 3300035118 Bacteria 4557
404 Ga0373954_0008487 3300035118 Bacteria 4511
405 Ga0373946_0010355 3300035171 Bacteria 3449
406 Ga0373946_0022473 3300035171 Bacteria 2456
407 Ga0373955_0006973 3300035172 Bacteria 5171
408 Ga0373924_0024123 3300035410 Bacteria 2394
409 Ga0373924_0043449 3300035410 Bacteria 1845
410 Ga0373927_0007379 3300035695 Bacteria 7440
411 Ga0373933_0000063 3300035724 Bacteria 64367
412 Ga0373933_0003606 3300035724 Bacteria 8588
413 Ga0373947_0028315 3300035725 Bacteria 3284
414 Ga0373947_0085843 3300035725 Bacteria 1955
415 Ga0373937_0053044 3300036401 Bacteria 3719
416 Ga0373937_0057792 3300036401 Bacteria 3564
417 Ga0373937_0087029 3300036401 Bacteria 2891
418 Ga0373925_0019502 3300037068 Bacteria 4934
419 Ga0373925_0022023 3300037068 Bacteria 4644
420 Ga0373925_0025305 3300037068 Bacteria 4336
421 Ga0373925_0038739 3300037068 Bacteria 3525
422 Ga0395900_0001282 3300037418 Bacteria 30694
423 Ga0395900_0067613 3300037418 Bacteria 3671
424 Ga0395900_0341655 3300037418 Bacteria 1472
425 Ga0395898_0027294 3300037466 Bacteria 5734
426 Ga0395898_0085381 3300037466 Bacteria 3042
427 Ga0395898_0087149 3300037466 Bacteria 3008
428 Ga0395898_0088298 3300037466 Bacteria 2985
429 Ga0395898_0096861 3300037466 Bacteria 2834
430 Ga0395901_0014860 3300038443 Bacteria 7909
431 Ga0395901_0224459 3300038443 Bacteria 1963
432 Ga0395901_0318392 3300038443 Bacteria 1610
433 Ga0436365_1202634 3300039437 Bacteria 25883
434 Ga0436365_1288625 3300039437 Bacteria 2516
435 Ga0436363_0080461 3300039450 Bacteria 4222
436 Ga0436362_0204850 3300039453 Bacteria 1764
437 Ga0466972_0000236 3300044658 Bacteria 38201
438 Ga0466972_0063454 3300044658 Bacteria 1769
439 Ga0466966_0000288 3300044684 Bacteria 33104
440 Ga0466966_0035051 3300044684 Bacteria 3244
441 Ga0466961_0000235 3300044693 Bacteria 37337
442 Ga0466963_0086943 3300044694 Bacteria 2125
443 Ga0466964_0031049 3300044706 Bacteria 2117
444 Ga0466964_0079553 3300044706 Bacteria 1404
445 Ga0466968_0016360 3300044735 Bacteria 2952
446 Ga0466960_0019224 3300044901 Bacteria 3006
447 Ga0466959_0006430 3300045049 Bacteria 8136
448 Ga0466959_0009264 3300045049 Bacteria 6997
449 Ga0466959_0027342 3300045049 Bacteria 4232
450 Ga0495617_039677 3300046452 Bacteria 1575
451 Ga0495592_0050471 3300046454 Bacteria 3091
452 Ga0495592_0081475 3300046454 Bacteria 2340
453 Ga0495603_0023144 3300046455 Bacteria 3761
454 Ga0495629_0002515 3300046459 Bacteria 14070
455 Ga0495629_0008117 3300046459 Bacteria 7727
456 Ga0495629_0038364 3300046459 Bacteria 3374
457 Ga0495629_0160184 3300046459 Bacteria 1563
458 Ga0495638_0026917 3300046460 Bacteria 3725
459 Ga0495651_0045854 3300046462 Bacteria 3385
460 Ga0495651_0067067 3300046462 Bacteria 2738
461 Ga0495653_0003036 3300046463 Bacteria 13460
462 Ga0495582_0019551 3300046473 Bacteria 3704
463 Ga0495605_0029156 3300046474 Bacteria 2844
464 Ga0495605_0056394 3300046474 Bacteria 1895
465 Ga0495605_0072470 3300046474 Bacteria 1624
466 Ga0495639_0009404 3300046475 Bacteria 4191
467 Ga0495664_0006419 3300046477 Bacteria 6493
468 Ga0495664_0042090 3300046477 Bacteria 2704
469 Ga0495664_0065981 3300046477 Bacteria 2158
470 Ga0495584_0070347 3300046491 Bacteria 1759
471 Ga0495583_0024173 3300046506 Bacteria 3059
472 Ga0495583_0063342 3300046506 Bacteria 1644
473 Ga0495606_0003865 3300046507 Bacteria 15462
474 Ga0495606_0029482 3300046507 Bacteria 3851
475 Ga0495608_0043419 3300046511 Bacteria 3003
476 Ga0495608_0130491 3300046511 Bacteria 1608
477 Ga0495616_0088388 3300046513 Bacteria 1471
478 Ga0495618_0052160 3300046514 Bacteria 2585
479 Ga0495628_0049043 3300046516 Bacteria 3344
480 Ga0495628_0094609 3300046516 Bacteria 2309
481 Ga0495631_0017099 3300046518 Bacteria 3437
482 Ga0495632_0030931 3300046519 Bacteria 2773
483 Ga0495648_0000649 3300046524 Bacteria 37131
484 Ga0495648_0031693 3300046524 Bacteria 3478
485 Ga0495648_0044319 3300046524 Bacteria 2778
486 Ga0495666_0053983 3300046526 Bacteria 1928
487 Ga0495652_0016058 3300046529 Bacteria 6699
488 Ga0495652_0033935 3300046529 Bacteria 4450
489 Ga0495640_0042704 3300046533 Bacteria 3161
490 Ga0495640_0045017 3300046533 Bacteria 3064
491 Ga0495640_0080903 3300046533 Bacteria 2160
492 Ga0495598_0014360 3300046537 Bacteria 1980
493 Ga0495645_0046463 3300046543 Bacteria 3164
494 Ga0495645_0196283 3300046543 Bacteria 1372
495 Ga0495622_0004932 3300046557 Bacteria 6178
496 Ga0495622_0015822 3300046557 Bacteria 3507
497 Ga0495622_0038758 3300046557 Bacteria 2219
498 Ga0495667_0012133 3300046559 Bacteria 5839
499 Ga0495656_0019770 3300046615 Bacteria 2603
500 Ga0495656_0030282 3300046615 Bacteria 2186
501 Ga0495634_0007549 3300046642 Bacteria 8155
502 Ga0495634_0029266 3300046642 Bacteria 3814
503 Ga0495634_0038466 3300046642 Bacteria 3262
504 Ga0495634_0057304 3300046642 Bacteria 2601
505 Ga0495611_0080621 3300046648 Bacteria 1496
506 Ga0495625_0042665 3300046660 Bacteria 3295
507 Ga0495625_0086035 3300046660 Bacteria 2181
508 Ga0495625_0175878 3300046660 Bacteria 1426
509 Ga0495635_0004510 3300046663 Bacteria 9646
510 Ga0495635_0004984 3300046663 Bacteria 9242
511 Ga0495588_0001769 3300046674 Bacteria 9196
512 Ga0495588_0023947 3300046674 Bacteria 3028
513 Ga0495588_0063922 3300046674 Bacteria 1909
514 Ga0495657_0038140 3300046675 Bacteria 3308
515 Ga0495599_0017414 3300046678 Bacteria 4468
516 Ga0495623_0014742 3300046679 Bacteria 5053
517 Ga0495646_0028816 3300046680 Bacteria 3474
518 Ga0495646_0066578 3300046680 Bacteria 2130
519 Ga0495658_0022933 3300046683 Bacteria 3308
520 Ga0495669_0080887 3300046684 Bacteria 1491
521 Ga0495613_0070562 3300046689 Bacteria 2547
522 Ga0495624_0091617 3300046690 Bacteria 1875
523 Ga0495670_0051750 3300046691 Bacteria 2056
524 Ga0495670_0100066 3300046691 Bacteria 1492
525 Ga0495600_0001327 3300046809 Bacteria 13654
526 Ga0495600_0037631 3300046809 Bacteria 3146
527 Ga0495600_0038744 3300046809 Bacteria 3102
528 Ga0495600_0070118 3300046809 Bacteria 2290
529 Ga0495604_0005219 3300047317 Bacteria 10290
530 Ga0495604_0024477 3300047317 Bacteria 4817
531 Ga0495636_0063400 3300047318 Bacteria 1566
532 Ga0495674_0041940 3300047319 Bacteria 4084
533 Ga0495674_0097029 3300047319 Bacteria 2511
534 Ga0495672_0008799 3300047320 Bacteria 7394
535 Ga0495672_0056956 3300047320 Bacteria 2272
536 Ga0495676_0093774 3300047321 Bacteria 2238
537 Ga0495680_0003661 3300047322 Bacteria 15002
538 Ga0495680_0109034 3300047322 Bacteria 2054
539 Ga0495687_004291 3300047443 Bacteria 9730
540 Ga0495675_0015773 3300047444 Bacteria 4778
541 Ga0495684_0022805 3300047471 Bacteria 4814
542 Ga0495684_0038906 3300047471 Bacteria 3646
543 Ga0495686_0018546 3300047472 Bacteria 4667
544 Ga0495593_0025657 3300047673 Bacteria 3262
545 Ga0495593_0029204 3300047673 Bacteria 3025
546 Ga0495593_0042238 3300047673 Bacteria 2448
547 Ga0495602_0014364 3300048088 Bacteria 8042
548 Ga0495602_0105763 3300048088 Bacteria 2299
549 Ga0496100_0031049 3300048903 Bacteria 3318
550 Ga0496101_0010847 3300048904 Bacteria 6028
551 Ga0496101_0112309 3300048904 Bacteria 2052
552 Ga0496101_0192403 3300048904 Bacteria 1575
553 Ga0496102_0001565 3300048905 Bacteria 20210
554 Ga0496102_0028540 3300048905 Bacteria 4985
555 Ga0496102_0033893 3300048905 Bacteria 4591
556 Ga0496102_0299683 3300048905 Bacteria 1515
557 Ga0496103_0000216 3300048906 Bacteria 57167
558 Ga0496103_0101270 3300048906 Bacteria 1823
559 Ga0496104_0004865 3300048907 Bacteria 11707
560 Ga0496104_0015011 3300048907 Bacteria 7006
561 Ga0496104_0018893 3300048907 Bacteria 6295
562 Ga0496104_0021345 3300048907 Bacteria 5945
563 Ga0496104_0078869 3300048907 Bacteria 3138
564 Ga0496104_0143714 3300048907 Bacteria 2292
565 Ga0496105_0001894 3300048908 Bacteria 15008
566 Ga0496105_0038908 3300048908 Bacteria 3919
567 Ga0496105_0094256 3300048908 Bacteria 2472
568 Ga0496105_0164707 3300048908 Bacteria 1819
569 Ga0496106_0001950 3300048909 Bacteria 15496
570 Ga0496106_0002951 3300048909 Bacteria 12659
571 Ga0496106_0026469 3300048909 Bacteria 4319
572 Ga0496106_0028587 3300048909 Bacteria 4153
573 Ga0496106_0147303 3300048909 Bacteria 1855
574 Ga0496107_0015001 3300048910 Bacteria 5426
575 Ga0496107_0035613 3300048910 Bacteria 3568
576 Ga0496107_0060337 3300048910 Bacteria 2745
577 Ga0496108_0000392 3300048911 Bacteria 36249
578 Ga0496108_0005832 3300048911 Bacteria 9985
579 Ga0496108_0022594 3300048911 Bacteria 5172
580 Ga0496108_0052648 3300048911 Bacteria 3412
581 Ga0496109_0000509 3300048912 Bacteria 33001
582 Ga0496109_0055952 3300048912 Bacteria 3599
583 Ga0496109_0238360 3300048912 Bacteria 1712
584 Ga0496109_0262283 3300048912 Bacteria 1627
585 Ga0496110_0029205 3300048913 Bacteria 4743
586 Ga0496110_0170341 3300048913 Bacteria 1975
587 Ga0496111_0006836 3300048914 Bacteria 7440
588 Ga0496111_0035754 3300048914 Bacteria 3552
589 Ga0496111_0049333 3300048914 Bacteria 3035
590 Ga0496111_0083074 3300048914 Bacteria 2340
591 Ga0496112_0000040 3300048915 Bacteria 89057
592 Ga0496112_0006065 3300048915 Bacteria 10559
593 Ga0496112_0007813 3300048915 Bacteria 9521
594 Ga0496112_0008690 3300048915 Bacteria 9107
595 Ga0496112_0032434 3300048915 Bacteria 5072
596 Ga0496112_0052096 3300048915 Bacteria 4016
597 Ga0496112_0086930 3300048915 Bacteria 3093
598 Ga0496112_0091397 3300048915 Bacteria 3013
599 Ga0496112_0128734 3300048915 Bacteria 2502
600 Ga0496113_0017331 3300048916 Bacteria 4997
601 Ga0496113_0028154 3300048916 Bacteria 4038
602 Ga0496113_0099655 3300048916 Bacteria 2250
603 Ga0496113_0169806 3300048916 Bacteria 1727
604 Ga0496114_0011949 3300048917 Bacteria 6946
605 Ga0496114_0027083 3300048917 Bacteria 4696
606 Ga0496114_0050645 3300048917 Bacteria 3457
607 Ga0496114_0087277 3300048917 Bacteria 2645
608 Ga0496115_0000756 3300048918 Bacteria 23793
609 Ga0496115_0023231 3300048918 Bacteria 4811
610 Ga0496115_0039367 3300048918 Bacteria 3754
611 Ga0496115_0040356 3300048918 Bacteria 3710
612 Ga0496115_0048024 3300048918 Bacteria 3414
613 Ga0496115_0073616 3300048918 Bacteria 2773
614 Ga0496116_0040312 3300048919 Bacteria 3217
615 Ga0496117_0003371 3300048920 Bacteria 18615
616 Ga0496117_0038536 3300048920 Bacteria 3540
617 Ga0496117_0069258 3300048920 Bacteria 2377
618 Ga0496119_0043022 3300048922 Bacteria 2858
619 Ga0496119_0043984 3300048922 Bacteria 2817
620 Ga0496119_0066698 3300048922 Bacteria 2125
621 Ga0496121_0001173 3300048924 Bacteria 45935
622 Ga0496121_0002762 3300048924 Bacteria 26052
623 Ga0496121_0003837 3300048924 Bacteria 20905
624 Ga0496121_0018985 3300048924 Bacteria 6899
625 Ga0496121_0043710 3300048924 Bacteria 3875
626 Ga0496121_0081260 3300048924 Bacteria 2566
627 Ga0496121_0099240 3300048924 Bacteria 2251
628 Ga0496121_0193722 3300048924 Bacteria 1455
629 Ga0496122_0035139 3300048925 Bacteria 4086
630 Ga0496123_0113378 3300048926 Bacteria 1544
631 Ga0496124_0004260 3300048927 Bacteria 16834
632 Ga0496124_0071010 3300048927 Bacteria 2888
633 Ga0496125_0000839 3300048928 Bacteria 49399
634 Ga0496125_0001026 3300048928 Bacteria 43365
635 Ga0496125_0030954 3300048928 Bacteria 4778
636 Ga0496125_0140610 3300048928 Bacteria 1679
637 Ga0496126_0010612 3300048929 Bacteria 9633
638 Ga0496126_0015628 3300048929 Bacteria 7626
639 Ga0496126_0029109 3300048929 Bacteria 5250
640 Ga0496126_0032627 3300048929 Bacteria 4904
641 Ga0496126_0044597 3300048929 Bacteria 4082
642 Ga0496126_0048944 3300048929 Bacteria 3860
643 Ga0496126_0050767 3300048929 Bacteria 3779
644 Ga0496126_0072813 3300048929 Bacteria 3056
645 Ga0496126_0100535 3300048929 Bacteria 2531
646 Ga0496126_0111002 3300048929 Bacteria 2388
647 Ga0496126_0111385 3300048929 Bacteria 2384
648 Ga0496126_0170151 3300048929 Bacteria 1856
649 Ga0496126_0236451 3300048929 Bacteria 1528
650 Ga0501032_0012150 3300049569 Bacteria 6164
651 Ga0501032_0054044 3300049569 Bacteria 2703
652 Ga0501032_0177644 3300049569 Bacteria 1394
653 Ga0501033_0002602 3300049570 Bacteria 15216
654 Ga0501033_0095080 3300049570 Bacteria 2178
655 Ga0501033_0109417 3300049570 Bacteria 2012
656 Ga0501034_0014203 3300049571 Bacteria 8207
657 Ga0501034_0065672 3300049571 Bacteria 3641
658 Ga0501036_0052145 3300049572 Bacteria 3464
659 Ga0501036_0081623 3300049572 Bacteria 2732
660 Ga0501036_0082533 3300049572 Bacteria 2717
661 Ga0501037_0000360 3300049573 Bacteria 38185
662 Ga0501037_0027235 3300049573 Bacteria 4222
663 Ga0501037_0061883 3300049573 Bacteria 2730
664 Ga0501038_0003992 3300049574 Bacteria 13699
665 Ga0501038_0047864 3300049574 Bacteria 3702
666 Ga0501038_0089226 3300049574 Bacteria 2586
667 Ga0501038_0128060 3300049574 Bacteria 2087
668 Ga0501043_0011214 3300049579 Bacteria 7020
669 Ga0501043_0044164 3300049579 Bacteria 3504
670 Ga0501043_0057581 3300049579 Bacteria 3051
671 Ga0501043_0088389 3300049579 Bacteria 2435
672 Ga0501043_0270953 3300049579 Bacteria 1303
673 Ga0501046_0080362 3300049580 Bacteria 2519
674 Ga0501046_0088741 3300049580 Bacteria 2381
675 Ga0501047_0028277 3300049581 Bacteria 5404
676 Ga0501047_0067439 3300049581 Bacteria 3448
677 Ga0501047_0117071 3300049581 Bacteria 2546
678 Ga0501048_0070694 3300049582 Bacteria 2465
679 Ga0501067_0039868 3300049583 Bacteria 2608
680 Ga0501068_0008490 3300049584 Bacteria 5719
681 Ga0501070_0021051 3300049586 Bacteria 5472
682 Ga0501070_0032117 3300049586 Bacteria 4395
683 Ga0501071_0010315 3300049587 Bacteria 6257
684 Ga0501072_0210770 3300049588 Bacteria 1548
685 Ga0501073_0012737 3300049589 Bacteria 6135
686 Ga0501074_0004048 3300049590 Bacteria 10458
687 Ga0501075_0120236 3300049591 Bacteria 1999
688 Ga0501079_0148750 3300049741 Bacteria 1826
689 Ga0501080_0028736 3300049742 Bacteria 5176
690 Ga0501080_0049107 3300049742 Bacteria 3927
691 Ga0501080_0069251 3300049742 Bacteria 3281
692 Ga0501081_0115517 3300049743 Bacteria 1908
693 Ga0501035_0009962 3300049822 Bacteria 8821
694 Ga0501035_0028696 3300049822 Bacteria 5078
695 Ga0501035_0061707 3300049822 Bacteria 3336
696 Ga0501035_0150994 3300049822 Bacteria 2016
697 Ga0501044_0019074 3300049823 Bacteria 7342
698 Ga0501044_0053817 3300049823 Bacteria 4139
699 Ga0501044_0228834 3300049823 Bacteria 1807
700 Ga0501044_0298157 3300049823 Bacteria 1541
701 Ga0501044_0333733 3300049823 Bacteria 1438
702 Ga0501045_0009389 3300049824 Bacteria 6840
703 nmdc:mga03n38_1224_c1 3300050490 Bacteria 7213
704 nmdc:mga00v17_165644_c1 3300050491 Bacteria 1424
705 nmdc:mga00v17_22736_c1 3300050491 Bacteria 3621
706 nmdc:mga00v17_58338_c1 3300050491 Bacteria 2364
707 nmdc:mga0yw44_25749_c1 3300050492 Bacteria 3351
708 nmdc:mga0yw44_3932_c1 3300050492 Bacteria 6708
709 nmdc:mga0k408_24734_c1 3300050493 Bacteria 3397
710 nmdc:mga0k408_62514_c1 3300050493 Bacteria 2165
711 nmdc:mga06z11_14893_c1 3300050494 Bacteria 3456
712 nmdc:mga06z11_3608_c1 3300050494 Bacteria 6000
713 nmdc:mga06z11_76486_c1 3300050494 Bacteria 1785
714 nmdc:mga04h51_3545_c1 3300050495 Bacteria 3800
715 nmdc:mga05p37_155473_c1 3300050507 Bacteria 2795
716 Ga0495601_0127614 3300053077 Bacteria 1655
717 Ga0495612_0020807 3300053078 Bacteria 2630
718 Ga0500635_0021420 3300053080 Bacteria 1992
719 Ga0495619_0005038 3300053085 Bacteria 8390
720 Ga0495619_0040076 3300053085 Bacteria 3061
721 Ga0495619_0040908 3300053085 Bacteria 3030
722 Ga0495619_0165255 3300053085 Bacteria 1529
723 Ga0500578_0040949 3300053086 Bacteria 2977
724 Ga0500578_0081756 3300053086 Bacteria 2054
725 Ga0500643_000180 3300053087 Bacteria 61907
726 Ga0500647_0040501 3300053091 Bacteria 2235
727 Ga0500651_0004278 3300053093 Bacteria 7975
728 Ga0500566_0000128 3300053094 Bacteria 38564
729 Ga0500566_0004762 3300053094 Bacteria 8085
730 Ga0500566_0018358 3300053094 Bacteria 4107
731 Ga0500566_0035916 3300053094 Bacteria 2878
732 Ga0500640_000843 3300053095 Bacteria 8465
733 Ga0500648_062773 3300053097 Bacteria 2105
734 Ga0500554_002044 3300053102 Bacteria 3911
735 Ga0500557_000046 3300053105 Bacteria 59508
736 Ga0500569_001091 3300053109 Bacteria 4962
737 Ga0500572_001063 3300053111 Bacteria 8139
738 Ga0500572_001245 3300053111 Bacteria 7178
739 Ga0500595_000398 3300053119 Bacteria 27905
740 Ga0500595_013722 3300053119 Bacteria 3098
741 Ga0500595_015261 3300053119 Bacteria 2887
742 Ga0500595_020160 3300053119 Bacteria 2405
743 Ga0500595_025514 3300053119 Bacteria 2047
744 Ga0500607_077495 3300053121 Bacteria 1701
745 Ga0500614_000326 3300053123 Bacteria 12307
746 Ga0500642_0000038 3300053130 Bacteria 98299
747 Ga0500559_0000487 3300053136 Bacteria 28032
748 Ga0500559_0001215 3300053136 Bacteria 15283
749 Ga0500559_0009416 3300053136 Bacteria 4228
750 Ga0500568_0021740 3300053139 Bacteria 2756
751 Ga0500568_0022636 3300053139 Bacteria 2685
752 Ga0500573_0003111 3300053140 Bacteria 8508
753 Ga0500590_100662 3300053148 Bacteria 1388
754 Ga0500603_000386 3300053150 Bacteria 11545
755 Ga0500603_003082 3300053150 Bacteria 3597
756 Ga0500603_003906 3300053150 Bacteria 3189
757 Ga0500616_0004532 3300053153 Bacteria 9853
758 Ga0500620_001302 3300053155 Bacteria 4520
759 Ga0500630_000855 3300053159 Bacteria 14148
760 Ga0500633_0030481 3300053160 Bacteria 1735
761 Ga0500638_010856 3300053162 Bacteria 4011
762 Ga0500638_018643 3300053162 Bacteria 3240
763 Ga0500639_000125 3300053163 Bacteria 36885
764 Ga0500639_122397 3300053163 Bacteria 1247
765 Ga0500636_0002084 3300053177 Bacteria 11042
766 Ga0500637_0000118 3300053178 Bacteria 28882
767 Ga0500637_0022252 3300053178 Bacteria 3451
768 Ga0500576_054585 3300053725 Bacteria 1763
769 Ga0500625_017981 3300053729 Bacteria 3305
770 Ga0500596_006889 3300053735 Bacteria 1889
771 Ga0500601_000862 3300053737 Bacteria 3683
772 Ga0500661_000042 3300055283 Bacteria 19485
773 Ga0501082_0082237 3300060353 Bacteria 2778
774 Ga0466962_0057626 3300061719 Bacteria 1855

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053163 Ga0500639_122397 Ga0500639_122397_41_1159 342
2 3300005289 Ga0065704_10070332 Ga0065704_1007033227 370
3 3300025711 Ga0207696_1000560 Ga0207696_10005608 370
4 3300048905 Ga0496102_0001565 Ga0496102_0001565_4239_5375 370
5 3300048906 Ga0496103_0000216 Ga0496103_0000216_5285_6421 370
6 3300048920 Ga0496117_0003371 Ga0496117_0003371_13241_14377 370
7 3300036401 Ga0373937_0087029 Ga0373937_0087029_407_1705 371
8 3300031247 Ga0265340_10012973 Ga0265340_100129732 373
9 3300031249 Ga0265339_10002202 Ga0265339_1000220210 373
10 3300039437 Ga0436365_1288625 Ga0436365_1288625_638_1792 374
11 3300039453 Ga0436362_0204850 Ga0436362_0204850_428_1648 375
12 3300005262 Ga0065165_1004408 Ga0065165_100440810 376
13 3300031731 Ga0307405_10048853 Ga0307405_100488532 378
14 3300046452 Ga0495617_039677 Ga0495617_039677_248_1486 378
15 3300048926 Ga0496123_0113378 Ga0496123_0113378_64_1317 378
16 3300053121 Ga0500607_077495 Ga0500607_077495_32_1228 378
17 3300005334 Ga0068869_100011774 Ga0068869_1000117746 379
18 3300005336 Ga0070680_100049028 Ga0070680_1000490283 379
19 3300005338 Ga0068868_100070715 Ga0068868_1000707152 379
20 3300005339 Ga0070660_100015960 Ga0070660_1000159603 379
21 3300005341 Ga0070691_10013655 Ga0070691_100136553 379
22 3300005355 Ga0070671_100124208 Ga0070671_1001242082 379
23 3300005539 Ga0068853_100017422 Ga0068853_1000174223 379
24 3300005563 Ga0068855_100012917 Ga0068855_1000129176 379
25 3300005577 Ga0068857_100004377 Ga0068857_1000043776 379
26 3300005578 Ga0068854_100107665 Ga0068854_1001076652 379
27 3300005618 Ga0068864_100043041 Ga0068864_1000430412 379
28 3300005834 Ga0068851_10005968 Ga0068851_100059685 379
29 3300009093 Ga0105240_10030379 Ga0105240_100303792 379
30 3300009174 Ga0105241_10015297 Ga0105241_100152971 379
31 3300009545 Ga0105237_10029665 Ga0105237_100296653 379
32 3300009545 Ga0105237_10049111 Ga0105237_100491114 379
33 3300009551 Ga0105238_10002788 Ga0105238_100027889 379
34 3300010375 Ga0105239_10027593 Ga0105239_100275935 379
35 3300010375 Ga0105239_10060216 Ga0105239_100602164 379
36 3300013104 Ga0157370_10007873 Ga0157370_100078733 379
37 3300013105 Ga0157369_10017046 Ga0157369_100170465 379
38 3300013296 Ga0157374_10026351 Ga0157374_100263515 379
39 3300025906 Ga0207699_10037075 Ga0207699_100370752 379
40 3300025908 Ga0207643_10077208 Ga0207643_100772082 379
41 3300025912 Ga0207707_10000575 Ga0207707_1000057536 379
42 3300025913 Ga0207695_10006774 Ga0207695_100067748 379
43 3300025914 Ga0207671_10005835 Ga0207671_100058354 379
44 3300025917 Ga0207660_10008892 Ga0207660_100088927 379
45 3300025919 Ga0207657_10027023 Ga0207657_100270233 379
46 3300025921 Ga0207652_10005891 Ga0207652_100058915 379
47 3300025924 Ga0207694_10012632 Ga0207694_100126322 379
48 3300025927 Ga0207687_10032786 Ga0207687_100327863 379
49 3300025928 Ga0207700_10115569 Ga0207700_101155692 379
50 3300025931 Ga0207644_10083738 Ga0207644_100837382 379
51 3300025942 Ga0207689_10019363 Ga0207689_100193632 379
52 3300025949 Ga0207667_10003446 Ga0207667_1000344613 379
53 3300025949 Ga0207667_10195800 Ga0207667_101958002 379
54 3300025972 Ga0207668_10024248 Ga0207668_100242484 379
55 3300025981 Ga0207640_10261182 Ga0207640_102611821 379
56 3300026023 Ga0207677_10032157 Ga0207677_100321574 379
57 3300026035 Ga0207703_10014373 Ga0207703_100143732 379
58 3300026041 Ga0207639_10008373 Ga0207639_100083737 379
59 3300026095 Ga0207676_10144666 Ga0207676_101446662 379
60 3300026116 Ga0207674_10003672 Ga0207674_1000367210 379
61 3300026118 Ga0207675_100025081 Ga0207675_1000250812 379
62 3300028379 Ga0268266_10006470 Ga0268266_1000647012 379
63 3300047320 Ga0495672_0056956 Ga0495672_0056956_1095_2261 379
64 3300048904 Ga0496101_0192403 Ga0496101_0192403_61_1299 379
65 3300048905 Ga0496102_0299683 Ga0496102_0299683_196_1434 379
66 3300048916 Ga0496113_0169806 Ga0496113_0169806_71_1309 379
67 3300048929 Ga0496126_0015628 Ga0496126_0015628_1530_2738 379
68 3300025915 Ga0207693_10023244 Ga0207693_100232442 380
69 3300025915 Ga0207693_10029960 Ga0207693_100299605 380
70 3300026142 Ga0207698_10041783 Ga0207698_100417832 380
71 3300048906 Ga0496103_0101270 Ga0496103_0101270_501_1697 380
72 3300048909 Ga0496106_0001950 Ga0496106_0001950_2189_3427 380
73 3300048916 Ga0496113_0017331 Ga0496113_0017331_3527_4723 380
74 3300048920 Ga0496117_0038536 Ga0496117_0038536_440_1678 380
75 3300048922 Ga0496119_0043022 Ga0496119_0043022_407_1603 380
76 3300048924 Ga0496121_0002762 Ga0496121_0002762_8111_9349 380
77 3300048927 Ga0496124_0004260 Ga0496124_0004260_9953_11191 380
78 3300048929 Ga0496126_0010612 Ga0496126_0010612_8122_9360 380
79 3300053119 Ga0500595_015261 Ga0500595_015261_1140_2381 380
80 3300005437 Ga0070710_10003163 Ga0070710_100031631 381
81 3300005439 Ga0070711_100057793 Ga0070711_1000577932 381
82 3300005455 Ga0070663_100038640 Ga0070663_1000386402 381
83 3300005456 Ga0070678_100066627 Ga0070678_1000666272 381
84 3300005466 Ga0070685_10007116 Ga0070685_100071163 381
85 3300005548 Ga0070665_100030612 Ga0070665_1000306125 381
86 3300006048 Ga0075363_100007732 Ga0075363_1000077324 381
87 3300013297 Ga0157378_10003222 Ga0157378_1000322212 381
88 3300026067 Ga0207678_10092405 Ga0207678_100924052 381
89 3300026121 Ga0207683_10138572 Ga0207683_101385722 381
90 3300028379 Ga0268266_10002572 Ga0268266_100025728 381
91 3300046459 Ga0495629_0008117 Ga0495629_0008117_770_2005 381
92 3300046462 Ga0495651_0045854 Ga0495651_0045854_833_2068 381
93 3300046513 Ga0495616_0088388 Ga0495616_0088388_79_1362 381
94 3300046514 Ga0495618_0052160 Ga0495618_0052160_151_1386 381
95 3300046529 Ga0495652_0033935 Ga0495652_0033935_2605_3840 381
96 3300046533 Ga0495640_0042704 Ga0495640_0042704_897_2132 381
97 3300046537 Ga0495598_0014360 Ga0495598_0014360_283_1521 381
98 3300046557 Ga0495622_0015822 Ga0495622_0015822_2239_3474 381
99 3300046615 Ga0495656_0019770 Ga0495656_0019770_263_1501 381
100 3300046642 Ga0495634_0057304 Ga0495634_0057304_80_1315 381
101 3300046663 Ga0495635_0004984 Ga0495635_0004984_1564_2799 381
102 3300046675 Ga0495657_0038140 Ga0495657_0038140_1828_3063 381
103 3300046691 Ga0495670_0100066 Ga0495670_0100066_106_1344 381
104 3300046809 Ga0495600_0038744 Ga0495600_0038744_770_2005 381
105 3300047317 Ga0495604_0024477 Ga0495604_0024477_1546_2781 381
106 3300047318 Ga0495636_0063400 Ga0495636_0063400_42_1280 381
107 3300047673 Ga0495593_0029204 Ga0495593_0029204_1554_2789 381
108 3300048903 Ga0496100_0031049 Ga0496100_0031049_1434_2672 381
109 3300048907 Ga0496104_0004865 Ga0496104_0004865_594_1829 381
110 3300048909 Ga0496106_0147303 Ga0496106_0147303_137_1375 381
111 3300048918 Ga0496115_0048024 Ga0496115_0048024_10_1245 381
112 3300048918 Ga0496115_0073616 Ga0496115_0073616_354_1592 381
113 3300048924 Ga0496121_0099240 Ga0496121_0099240_407_1642 381
114 3300048929 Ga0496126_0170151 Ga0496126_0170151_189_1424 381
115 3300050490 nmdc:mga03n38_1224_c1 nmdc:mga03n38_1224_c1_4196_5434 381
116 3300050494 nmdc:mga06z11_3608_c1 nmdc:mga06z11_3608_c1_2423_3661 381
117 3300053085 Ga0495619_0040908 Ga0495619_0040908_1526_2761 381
118 3300005841 Ga0068863_100039597 Ga0068863_1000395973 382
119 3300005937 Ga0081455_10017866 Ga0081455_100178664 382
120 3300006038 Ga0075365_10022691 Ga0075365_100226912 382
121 3300025913 Ga0207695_10251545 Ga0207695_102515452 382
122 3300035171 Ga0373946_0022473 Ga0373946_0022473_691_1929 382
123 3300035725 Ga0373947_0028315 Ga0373947_0028315_659_1897 382
124 3300037068 Ga0373925_0038739 Ga0373925_0038739_899_2137 382
125 3300037466 Ga0395898_0096861 Ga0395898_0096861_66_1292 382
126 3300046689 Ga0495613_0070562 Ga0495613_0070562_365_1603 382
127 3300050507 nmdc:mga05p37_155473_c1 nmdc:mga05p37_155473_c1_852_2090 382
128 3300053094 Ga0500566_0035916 Ga0500566_0035916_1029_2267 382
129 3300053097 Ga0500648_062773 Ga0500648_062773_750_1988 382
130 3300053119 Ga0500595_025514 Ga0500595_025514_145_1383 382
131 3300053136 Ga0500559_0009416 Ga0500559_0009416_2977_4215 382
132 3300053140 Ga0500573_0003111 Ga0500573_0003111_6929_8167 382
133 3300053178 Ga0500637_0022252 Ga0500637_0022252_2178_3416 382
134 3300005983 Ga0081540_1002776 Ga0081540_10027765 383
135 3300005983 Ga0081540_1003496 Ga0081540_10034964 383
136 3300046460 Ga0495638_0026917 Ga0495638_0026917_1844_3082 383
137 3300046518 Ga0495631_0017099 Ga0495631_0017099_2110_3348 383
138 3300046524 Ga0495648_0044319 Ga0495648_0044319_825_2063 383
139 3300046615 Ga0495656_0030282 Ga0495656_0030282_283_1521 383
140 3300046660 Ga0495625_0175878 Ga0495625_0175878_177_1415 383
141 3300048929 Ga0496126_0050767 Ga0496126_0050767_2403_3641 383
142 3300005336 Ga0070680_100089673 Ga0070680_1000896732 384
143 3300031616 Ga0307508_10000019 Ga0307508_1000001996 384
144 3300033442 Ga0315911_1000012 Ga0315911_100001219 384
145 3300005843 Ga0068860_100001738 Ga0068860_10000173810 387
146 3300025297 Ga0209758_1016727 Ga0209758_10167273 387
147 3300028381 Ga0268264_10000042 Ga0268264_10000042243 387
148 3300031239 Ga0265328_10004115 Ga0265328_100041154 387
149 3300031250 Ga0265331_10006010 Ga0265331_100060106 387
150 3300005327 Ga0070658_10055370 Ga0070658_100553703 388
151 3300005336 Ga0070680_100101875 Ga0070680_1001018752 388
152 3300005435 Ga0070714_100211245 Ga0070714_1002112452 388
153 3300005563 Ga0068855_100011878 Ga0068855_1000118781 388
154 3300025928 Ga0207700_10017252 Ga0207700_100172522 388
155 3300025929 Ga0207664_10008459 Ga0207664_100084594 388
156 3300025949 Ga0207667_10022727 Ga0207667_100227274 388
157 3300031239 Ga0265328_10000019 Ga0265328_10000019112 388
158 3300031241 Ga0265325_10023765 Ga0265325_100237652 388
159 3300031616 Ga0307508_10071751 Ga0307508_100717513 388
160 3300048908 Ga0496105_0164707 Ga0496105_0164707_403_1641 388
161 3300048925 Ga0496122_0035139 Ga0496122_0035139_1220_2488 388
162 3300048929 Ga0496126_0032627 Ga0496126_0032627_1453_2721 388
163 iso_pu_bacteria 8002060224 8002062440 388
164 3300005467 Ga0070706_100132226 Ga0070706_1001322261 389
165 3300005471 Ga0070698_100114551 Ga0070698_1001145512 389
166 3300006178 Ga0075367_10084476 Ga0075367_100844762 389
167 3300032126 Ga0307415_100063976 Ga0307415_1000639762 389
168 3300046526 Ga0495666_0053983 Ga0495666_0053983_384_1835 389
169 3300046557 Ga0495622_0038758 Ga0495622_0038758_717_2168 389
170 3300046674 Ga0495588_0023947 Ga0495588_0023947_461_1795 389
171 3300048924 Ga0496121_0018985 Ga0496121_0018985_792_2057 389
172 3300050493 nmdc:mga0k408_62514_c1 nmdc:mga0k408_62514_c1_421_1659 389
173 iso_pu_bacteria 2908739725 2908740257 389
174 3300005338 Ga0068868_100061300 Ga0068868_1000613002 390
175 3300005578 Ga0068854_100093480 Ga0068854_1000934802 390
176 3300005614 Ga0068856_100000046 Ga0068856_10000004660 390
177 3300005616 Ga0068852_100190743 Ga0068852_1001907432 390
178 3300005618 Ga0068864_100103201 Ga0068864_1001032013 390
179 3300005937 Ga0081455_10005256 Ga0081455_1000525612 390
180 3300005937 Ga0081455_10061213 Ga0081455_100612132 390
181 3300005983 Ga0081540_1001673 Ga0081540_100167311 390
182 3300007265 Ga0099794_10044796 Ga0099794_100447962 390
183 3300009098 Ga0105245_10007957 Ga0105245_1000795711 390
184 3300010375 Ga0105239_10070576 Ga0105239_100705762 390
185 3300013296 Ga0157374_10206425 Ga0157374_102064252 390
186 3300013306 Ga0163162_10274148 Ga0163162_102741482 390
187 3300013308 Ga0157375_10145312 Ga0157375_101453122 390
188 3300014325 Ga0163163_10190091 Ga0163163_101900913 390
189 3300014969 Ga0157376_10034960 Ga0157376_100349602 390
190 3300025901 Ga0207688_10040757 Ga0207688_100407572 390
191 3300025927 Ga0207687_10056601 Ga0207687_100566012 390
192 3300026023 Ga0207677_10028853 Ga0207677_100288533 390
193 3300026035 Ga0207703_10036684 Ga0207703_100366844 390
194 3300026067 Ga0207678_10015465 Ga0207678_100154655 390
195 3300026067 Ga0207678_10194201 Ga0207678_101942012 390
196 3300026078 Ga0207702_10000014 Ga0207702_10000014114 390
197 3300026095 Ga0207676_10119667 Ga0207676_101196672 390
198 3300026121 Ga0207683_10016200 Ga0207683_100162005 390
199 3300026142 Ga0207698_10119439 Ga0207698_101194392 390
200 3300027671 Ga0209588_1004507 Ga0209588_10045074 390
201 3300031239 Ga0265328_10003191 Ga0265328_100031912 390
202 3300031250 Ga0265331_10000057 Ga0265331_1000005776 390
203 3300031711 Ga0265314_10020295 Ga0265314_100202953 390
204 3300035118 Ga0373954_0008297 Ga0373954_0008297_3231_4469 390
205 3300035172 Ga0373955_0006973 Ga0373955_0006973_3608_4846 390
206 3300035410 Ga0373924_0024123 Ga0373924_0024123_798_2036 390
207 3300035724 Ga0373933_0003606 Ga0373933_0003606_6155_7393 390
208 3300044658 Ga0466972_0000236 Ga0466972_0000236_5527_6762 390
209 3300044658 Ga0466972_0063454 Ga0466972_0063454_241_1521 390
210 3300044735 Ga0466968_0016360 Ga0466968_0016360_1359_2594 390
211 3300046459 Ga0495629_0002515 Ga0495629_0002515_4465_5703 390
212 3300046463 Ga0495653_0003036 Ga0495653_0003036_4052_5290 390
213 3300046642 Ga0495634_0007549 Ga0495634_0007549_1516_2754 390
214 3300046663 Ga0495635_0004510 Ga0495635_0004510_1470_2708 390
215 3300046809 Ga0495600_0037631 Ga0495600_0037631_877_2115 390
216 3300047319 Ga0495674_0097029 Ga0495674_0097029_142_1380 390
217 3300048904 Ga0496101_0112309 Ga0496101_0112309_68_1333 390
218 3300048908 Ga0496105_0094256 Ga0496105_0094256_96_1334 390
219 3300048909 Ga0496106_0028587 Ga0496106_0028587_565_1830 390
220 3300048910 Ga0496107_0015001 Ga0496107_0015001_2366_3631 390
221 3300048911 Ga0496108_0022594 Ga0496108_0022594_3491_4756 390
222 3300048912 Ga0496109_0262283 Ga0496109_0262283_41_1306 390
223 3300048913 Ga0496110_0170341 Ga0496110_0170341_126_1391 390
224 3300048914 Ga0496111_0049333 Ga0496111_0049333_1101_2366 390
225 3300048915 Ga0496112_0008690 Ga0496112_0008690_3961_5226 390
226 3300048915 Ga0496112_0091397 Ga0496112_0091397_1573_2862 390
227 3300048916 Ga0496113_0099655 Ga0496113_0099655_236_1501 390
228 3300048917 Ga0496114_0027083 Ga0496114_0027083_2928_4193 390
229 3300048918 Ga0496115_0000756 Ga0496115_0000756_13672_14937 390
230 3300049572 Ga0501036_0082533 Ga0501036_0082533_707_1948 390
231 3300053077 Ga0495601_0127614 Ga0495601_0127614_142_1380 390
232 3300053085 Ga0495619_0005038 Ga0495619_0005038_4544_5782 390
233 3300003214 JGI25165J46597_1004010 JGI25165J46597_10040103 391
234 3300003214 JGI25165J46597_1004774 JGI25165J46597_10047742 391
235 3300003215 JGI25153J46596_10030363 JGI25153J46596_100303632 391
236 3300005262 Ga0065165_1008089 Ga0065165_10080893 391
237 3300005439 Ga0070711_100021396 Ga0070711_1000213961 391
238 3300006028 Ga0070717_10032987 Ga0070717_100329874 391
239 3300006051 Ga0075364_10028214 Ga0075364_100282144 391
240 3300006178 Ga0075367_10014420 Ga0075367_100144203 391
241 3300006942 Ga0099824_1018316 Ga0099824_10183163 391
242 3300009093 Ga0105240_10167449 Ga0105240_101674492 391
243 3300010375 Ga0105239_10119042 Ga0105239_101190422 391
244 3300025261 Ga0209233_1001244 Ga0209233_10012444 391
245 3300025295 Ga0209564_1005380 Ga0209564_10053806 391
246 3300025297 Ga0209758_1000106 Ga0209758_100010637 391
247 3300025299 Ga0209256_1014971 Ga0209256_10149712 391
248 3300025303 Ga0209051_1021162 Ga0209051_10211621 391
249 3300025304 Ga0209257_1012480 Ga0209257_10124803 391
250 3300025914 Ga0207671_10014011 Ga0207671_100140114 391
251 3300027296 Ga0209389_1006299 Ga0209389_10062999 391
252 3300027357 Ga0209589_1000031 Ga0209589_10000314 391
253 3300027361 Ga0209489_100057 Ga0209489_100057143 391
254 3300035113 Ga0373936_0030237 Ga0373936_0030237_149_1405 391
255 3300039437 Ga0436365_1202634 Ga0436365_1202634_8242_9477 391
256 3300044706 Ga0466964_0031049 Ga0466964_0031049_352_1632 391
257 3300046462 Ga0495651_0067067 Ga0495651_0067067_678_1916 391
258 3300046680 Ga0495646_0028816 Ga0495646_0028816_577_1812 391
259 3300047472 Ga0495686_0018546 Ga0495686_0018546_59_1297 391
260 3300049587 Ga0501071_0010315 Ga0501071_0010315_4583_5824 391
261 3300050491 nmdc:mga00v17_22736_c1 nmdc:mga00v17_22736_c1_821_2071 391
262 3300050494 nmdc:mga06z11_14893_c1 nmdc:mga06z11_14893_c1_375_1625 391
263 3300053091 Ga0500647_0040501 Ga0500647_0040501_299_1555 391
264 3300053094 Ga0500566_0000128 Ga0500566_0000128_12419_13675 391
265 3300053095 Ga0500640_000843 Ga0500640_000843_6509_7765 391
266 3300053111 Ga0500572_001063 Ga0500572_001063_6788_8044 391
267 3300053123 Ga0500614_000326 Ga0500614_000326_6755_8011 391
268 3300053136 Ga0500559_0001215 Ga0500559_0001215_6872_8128 391
269 3300053148 Ga0500590_100662 Ga0500590_100662_44_1300 391
270 3300053150 Ga0500603_003082 Ga0500603_003082_1857_3113 391
271 3300053159 Ga0500630_000855 Ga0500630_000855_10025_11281 391
272 3300053163 Ga0500639_000125 Ga0500639_000125_19876_21132 391
273 iso_pu_bacteria 2513237141 2513887874 391
274 3300003203 JGI25406J46586_10005786 JGI25406J46586_100057861 392
275 3300003215 JGI25153J46596_10008980 JGI25153J46596_100089804 392
276 3300003215 JGI25153J46596_10013010 JGI25153J46596_100130103 392
277 3300005339 Ga0070660_100174624 Ga0070660_1001746242 392
278 3300005347 Ga0070668_100223338 Ga0070668_1002233381 392
279 3300005530 Ga0070679_100015717 Ga0070679_1000157176 392
280 3300005983 Ga0081540_1021133 Ga0081540_10211332 392
281 3300005985 Ga0081539_10001606 Ga0081539_1000160626 392
282 3300006028 Ga0070717_10005166 Ga0070717_100051665 392
283 3300006042 Ga0075368_10021410 Ga0075368_100214102 392
284 3300009551 Ga0105238_10019066 Ga0105238_100190664 392
285 3300025295 Ga0209564_1007038 Ga0209564_10070385 392
286 3300025295 Ga0209564_1019099 Ga0209564_10190992 392
287 3300025297 Ga0209758_1000344 Ga0209758_100034410 392
288 3300025297 Ga0209758_1001622 Ga0209758_100162222 392
289 3300025921 Ga0207652_10081825 Ga0207652_100818252 392
290 3300025928 Ga0207700_10006661 Ga0207700_100066614 392
291 3300025972 Ga0207668_10203213 Ga0207668_102032132 392
292 3300026118 Ga0207675_100189164 Ga0207675_1001891642 392
293 3300028794 Ga0307515_10011730 Ga0307515_100117304 392
294 3300031456 Ga0307513_10266762 Ga0307513_102667622 392
295 3300035695 Ga0373927_0007379 Ga0373927_0007379_2044_3339 392
296 3300046455 Ga0495603_0023144 Ga0495603_0023144_861_2099 392
297 3300046507 Ga0495606_0003865 Ga0495606_0003865_8615_9958 392
298 3300046648 Ga0495611_0080621 Ga0495611_0080621_97_1335 392
299 3300048915 Ga0496112_0000040 Ga0496112_0000040_41073_42311 392
300 3300048917 Ga0496114_0050645 Ga0496114_0050645_1193_2431 392
301 3300048918 Ga0496115_0023231 Ga0496115_0023231_1920_3233 392
302 3300048929 Ga0496126_0111002 Ga0496126_0111002_549_1787 392
303 3300049574 Ga0501038_0047864 Ga0501038_0047864_934_2175 392
304 3300049589 Ga0501073_0012737 Ga0501073_0012737_4390_5631 392
305 3300049590 Ga0501074_0004048 Ga0501074_0004048_4155_5396 392
306 3300049591 Ga0501075_0120236 Ga0501075_0120236_558_1799 392
307 3300049742 Ga0501080_0049107 Ga0501080_0049107_818_2059 392
308 3300049824 Ga0501045_0009389 Ga0501045_0009389_3686_4927 392
309 3300053080 Ga0500635_0021420 Ga0500635_0021420_154_1392 392
310 3300053087 Ga0500643_000180 Ga0500643_000180_48490_49728 392
311 3300053094 Ga0500566_0018358 Ga0500566_0018358_2050_3285 392
312 3300053105 Ga0500557_000046 Ga0500557_000046_3627_4862 392
313 3300053119 Ga0500595_020160 Ga0500595_020160_531_1769 392
314 3300053139 Ga0500568_0021740 Ga0500568_0021740_1458_2696 392
315 3300053153 Ga0500616_0004532 Ga0500616_0004532_2976_4214 392
316 3300053155 Ga0500620_001302 Ga0500620_001302_1008_2246 392
317 3300053160 Ga0500633_0030481 Ga0500633_0030481_476_1714 392
318 3300053162 Ga0500638_010856 Ga0500638_010856_2187_3425 392
319 3300053177 Ga0500636_0002084 Ga0500636_0002084_1276_2514 392
320 3300053729 Ga0500625_017981 Ga0500625_017981_379_1614 392
321 3300060353 Ga0501082_0082237 Ga0501082_0082237_480_1721 392
322 3300005356 Ga0070674_100018087 Ga0070674_1000180873 393
323 3300005367 Ga0070667_100092241 Ga0070667_1000922411 393
324 3300005457 Ga0070662_100033636 Ga0070662_1000336362 393
325 3300005459 Ga0068867_100029024 Ga0068867_1000290242 393
326 3300005530 Ga0070679_100007378 Ga0070679_1000073783 393
327 3300005535 Ga0070684_100005066 Ga0070684_1000050665 393
328 3300005543 Ga0070672_100035145 Ga0070672_1000351453 393
329 3300005544 Ga0070686_100027608 Ga0070686_1000276082 393
330 3300005548 Ga0070665_100188160 Ga0070665_1001881602 393
331 3300005577 Ga0068857_100177034 Ga0068857_1001770342 393
332 3300005616 Ga0068852_100086520 Ga0068852_1000865202 393
333 3300005718 Ga0068866_10023188 Ga0068866_100231882 393
334 3300005719 Ga0068861_100064113 Ga0068861_1000641132 393
335 3300005844 Ga0068862_100048515 Ga0068862_1000485153 393
336 3300005985 Ga0081539_10000585 Ga0081539_1000058533 393
337 3300005985 Ga0081539_10030383 Ga0081539_100303831 393
338 3300006038 Ga0075365_10051990 Ga0075365_100519902 393
339 3300006173 Ga0070716_100001652 Ga0070716_1000016523 393
340 3300006881 Ga0068865_100114281 Ga0068865_1001142812 393
341 3300009093 Ga0105240_10162984 Ga0105240_101629842 393
342 3300009148 Ga0105243_10085790 Ga0105243_100857902 393
343 3300009545 Ga0105237_10007238 Ga0105237_100072389 393
344 3300009553 Ga0105249_10022299 Ga0105249_100222993 393
345 3300010375 Ga0105239_10142409 Ga0105239_101424092 393
346 3300013105 Ga0157369_10022283 Ga0157369_100222837 393
347 3300013297 Ga0157378_10073464 Ga0157378_100734642 393
348 3300013306 Ga0163162_10153430 Ga0163162_101534302 393
349 3300014326 Ga0157380_10095888 Ga0157380_100958882 393
350 3300017792 Ga0163161_10030838 Ga0163161_100308382 393
351 3300025302 Ga0207426_1012541 Ga0207426_10125413 393
352 3300025912 Ga0207707_10005305 Ga0207707_100053053 393
353 3300025913 Ga0207695_10000123 Ga0207695_10000123156 393
354 3300025914 Ga0207671_10018857 Ga0207671_100188575 393
355 3300025921 Ga0207652_10014514 Ga0207652_100145143 393
356 3300025928 Ga0207700_10011618 Ga0207700_100116182 393
357 3300025933 Ga0207706_10070643 Ga0207706_100706433 393
358 3300025939 Ga0207665_10001660 Ga0207665_1000166010 393
359 3300025940 Ga0207691_10037606 Ga0207691_100376063 393
360 3300025944 Ga0207661_10002678 Ga0207661_100026783 393
361 3300026035 Ga0207703_10041661 Ga0207703_100416613 393
362 3300026089 Ga0207648_10033893 Ga0207648_100338932 393
363 3300026116 Ga0207674_10029815 Ga0207674_100298153 393
364 3300026118 Ga0207675_100037081 Ga0207675_1000370812 393
365 3300028379 Ga0268266_10088547 Ga0268266_100885472 393
366 3300028381 Ga0268264_10157323 Ga0268264_101573232 393
367 3300028786 Ga0307517_10103031 Ga0307517_101030311 393
368 3300037068 Ga0373925_0025305 Ga0373925_0025305_2708_4021 393
369 3300037418 Ga0395900_0001282 Ga0395900_0001282_8956_10230 393
370 3300037466 Ga0395898_0027294 Ga0395898_0027294_3041_4315 393
371 3300037466 Ga0395898_0088298 Ga0395898_0088298_1260_2606 393
372 3300044693 Ga0466961_0000235 Ga0466961_0000235_27309_28547 393
373 3300044694 Ga0466963_0086943 Ga0466963_0086943_132_1370 393
374 3300045049 Ga0466959_0006430 Ga0466959_0006430_6363_7601 393
375 3300046477 Ga0495664_0006419 Ga0495664_0006419_365_1603 393
376 3300046491 Ga0495584_0070347 Ga0495584_0070347_82_1320 393
377 3300046543 Ga0495645_0046463 Ga0495645_0046463_964_2202 393
378 3300046674 Ga0495588_0063922 Ga0495588_0063922_274_1587 393
379 3300046691 Ga0495670_0051750 Ga0495670_0051750_527_1810 393
380 3300048907 Ga0496104_0078869 Ga0496104_0078869_1505_2743 393
381 3300048912 Ga0496109_0238360 Ga0496109_0238360_182_1420 393
382 3300048917 Ga0496114_0087277 Ga0496114_0087277_398_1636 393
383 3300048924 Ga0496121_0001173 Ga0496121_0001173_39562_40800 393
384 3300049583 Ga0501067_0039868 Ga0501067_0039868_282_1520 393
385 3300049586 Ga0501070_0032117 Ga0501070_0032117_2364_3608 393
386 3300049742 Ga0501080_0028736 Ga0501080_0028736_2394_3638 393
387 3300050491 nmdc:mga00v17_58338_c1 nmdc:mga00v17_58338_c1_367_1605 393
388 3300050492 nmdc:mga0yw44_25749_c1 nmdc:mga0yw44_25749_c1_1269_2525 393
389 3300053078 Ga0495612_0020807 Ga0495612_0020807_1292_2530 393
390 3300053737 Ga0500601_000862 Ga0500601_000862_593_1828 393
391 3300003215 JGI25153J46596_10019877 JGI25153J46596_100198771 394
392 3300005262 Ga0065165_1005651 Ga0065165_10056512 394
393 3300005347 Ga0070668_100087515 Ga0070668_1000875153 394
394 3300005353 Ga0070669_100053671 Ga0070669_1000536712 394
395 3300005434 Ga0070709_10001202 Ga0070709_100012028 394
396 3300005436 Ga0070713_100016005 Ga0070713_1000160056 394
397 3300005518 Ga0070699_100076792 Ga0070699_1000767923 394
398 3300005564 Ga0070664_100210482 Ga0070664_1002104822 394
399 3300005718 Ga0068866_10080700 Ga0068866_100807001 394
400 3300005843 Ga0068860_100306905 Ga0068860_1003069052 394
401 3300006042 Ga0075368_10007787 Ga0075368_100077872 394
402 3300006051 Ga0075364_10052430 Ga0075364_100524302 394
403 3300006178 Ga0075367_10049824 Ga0075367_100498244 394
404 3300006186 Ga0075369_10061748 Ga0075369_100617482 394
405 3300006195 Ga0075366_10003115 Ga0075366_100031156 394
406 3300006237 Ga0097621_100308317 Ga0097621_1003083172 394
407 3300009174 Ga0105241_10167678 Ga0105241_101676782 394
408 3300010375 Ga0105239_10413418 Ga0105239_104134182 394
409 3300013296 Ga0157374_10202426 Ga0157374_102024262 394
410 3300013297 Ga0157378_10123168 Ga0157378_101231682 394
411 3300014325 Ga0163163_10030032 Ga0163163_100300323 394
412 3300021320 Ga0214544_1000007 Ga0214544_1000007294 394
413 3300021321 Ga0214542_1000007 Ga0214542_100000787 394
414 3300021324 Ga0214545_1000006 Ga0214545_1000006206 394
415 3300021327 Ga0214543_1000009 Ga0214543_1000009294 394
416 3300025261 Ga0209233_1015771 Ga0209233_10157712 394
417 3300025297 Ga0209758_1007055 Ga0209758_10070558 394
418 3300025297 Ga0209758_1012733 Ga0209758_10127332 394
419 3300025302 Ga0207426_1004720 Ga0207426_10047202 394
420 3300025909 Ga0207705_10063283 Ga0207705_100632831 394
421 3300025915 Ga0207693_10054652 Ga0207693_100546522 394
422 3300025931 Ga0207644_10058184 Ga0207644_100581842 394
423 3300025933 Ga0207706_10086337 Ga0207706_100863373 394
424 3300025942 Ga0207689_10059119 Ga0207689_100591193 394
425 3300025949 Ga0207667_10215786 Ga0207667_102157862 394
426 3300027512 Ga0209179_1007032 Ga0209179_10070321 394
427 3300028380 Ga0268265_10043749 Ga0268265_100437492 394
428 3300028786 Ga0307517_10000542 Ga0307517_1000054254 394
429 3300031238 Ga0265332_10009250 Ga0265332_100092502 394
430 3300031247 Ga0265340_10004701 Ga0265340_100047012 394
431 3300031344 Ga0265316_10089842 Ga0265316_100898422 394
432 3300033180 Ga0307510_10115942 Ga0307510_101159422 394
433 3300035086 Ga0373934_0030873 Ga0373934_0030873_493_1731 394
434 3300035724 Ga0373933_0000063 Ga0373933_0000063_58570_59808 394
435 3300038443 Ga0395901_0318392 Ga0395901_0318392_263_1531 394
436 3300044684 Ga0466966_0000288 Ga0466966_0000288_23347_24585 394
437 3300046474 Ga0495605_0029156 Ga0495605_0029156_745_1983 394
438 3300046474 Ga0495605_0056394 Ga0495605_0056394_490_1728 394
439 3300046474 Ga0495605_0072470 Ga0495605_0072470_78_1316 394
440 3300046506 Ga0495583_0024173 Ga0495583_0024173_1538_2776 394
441 3300046519 Ga0495632_0030931 Ga0495632_0030931_418_1656 394
442 3300046524 Ga0495648_0031693 Ga0495648_0031693_1159_2397 394
443 3300046557 Ga0495622_0004932 Ga0495622_0004932_704_1942 394
444 3300046660 Ga0495625_0042665 Ga0495625_0042665_1467_2705 394
445 3300046660 Ga0495625_0086035 Ga0495625_0086035_447_1685 394
446 3300046674 Ga0495588_0001769 Ga0495588_0001769_4266_5504 394
447 3300047321 Ga0495676_0093774 Ga0495676_0093774_504_1742 394
448 3300047443 Ga0495687_004291 Ga0495687_004291_726_1964 394
449 3300048905 Ga0496102_0033893 Ga0496102_0033893_2842_4080 394
450 3300048907 Ga0496104_0015011 Ga0496104_0015011_1105_2343 394
451 3300048909 Ga0496106_0026469 Ga0496106_0026469_1638_2876 394
452 3300048910 Ga0496107_0060337 Ga0496107_0060337_174_1412 394
453 3300048915 Ga0496112_0128734 Ga0496112_0128734_40_1278 394
454 3300048919 Ga0496116_0040312 Ga0496116_0040312_1381_2619 394
455 3300048922 Ga0496119_0066698 Ga0496119_0066698_592_1830 394
456 3300048929 Ga0496126_0048944 Ga0496126_0048944_1300_2538 394
457 3300049569 Ga0501032_0177644 Ga0501032_0177644_113_1354 394
458 3300049579 Ga0501043_0270953 Ga0501043_0270953_11_1252 394
459 3300049822 Ga0501035_0061707 Ga0501035_0061707_61_1302 394
460 3300050493 nmdc:mga0k408_24734_c1 nmdc:mga0k408_24734_c1_849_2087 394
461 3300050495 nmdc:mga04h51_3545_c1 nmdc:mga04h51_3545_c1_1029_2267 394
462 3300053086 Ga0500578_0040949 Ga0500578_0040949_1477_2718 394
463 3300053086 Ga0500578_0081756 Ga0500578_0081756_642_1880 394
464 3300053093 Ga0500651_0004278 Ga0500651_0004278_1306_2547 394
465 3300053119 Ga0500595_013722 Ga0500595_013722_516_1757 394
466 3300005329 Ga0070683_100206815 Ga0070683_1002068152 395
467 3300005535 Ga0070684_100022108 Ga0070684_1000221085 395
468 3300010375 Ga0105239_10129001 Ga0105239_101290012 395
469 3300021441 Ga0213871_10032557 Ga0213871_100325571 395
470 3300025944 Ga0207661_10000727 Ga0207661_1000072714 395
471 3300031507 Ga0307509_10083085 Ga0307509_100830852 395
472 3300046506 Ga0495583_0063342 Ga0495583_0063342_329_1567 395
473 3300046507 Ga0495606_0029482 Ga0495606_0029482_1591_2829 395
474 3300046809 Ga0495600_0070118 Ga0495600_0070118_490_1728 395
475 iso_pu_bacteria 2828305725 2828308148 395
476 3300009176 Ga0105242_10112498 Ga0105242_101124981 396
477 3300009545 Ga0105237_10024463 Ga0105237_100244634 396
478 3300010375 Ga0105239_10022535 Ga0105239_100225354 396
479 3300025934 Ga0207686_10033506 Ga0207686_100335062 396
480 3300026035 Ga0207703_10046636 Ga0207703_100466365 396
481 3300028381 Ga0268264_10106463 Ga0268264_101064632 396
482 3300046475 Ga0495639_0009404 Ga0495639_0009404_2431_3666 396
483 3300046524 Ga0495648_0000649 Ga0495648_0000649_5346_6584 396
484 3300048904 Ga0496101_0010847 Ga0496101_0010847_2700_3938 396
485 3300048905 Ga0496102_0028540 Ga0496102_0028540_2857_4095 396
486 3300048907 Ga0496104_0018893 Ga0496104_0018893_4345_5583 396
487 3300048908 Ga0496105_0001894 Ga0496105_0001894_8728_9966 396
488 3300048911 Ga0496108_0052648 Ga0496108_0052648_1132_2370 396
489 3300048912 Ga0496109_0055952 Ga0496109_0055952_1042_2280 396
490 3300048914 Ga0496111_0006836 Ga0496111_0006836_4925_6163 396
491 3300048915 Ga0496112_0006065 Ga0496112_0006065_4133_5371 396
492 3300048916 Ga0496113_0028154 Ga0496113_0028154_1201_2439 396
493 3300048917 Ga0496114_0011949 Ga0496114_0011949_2295_3533 396
494 3300048918 Ga0496115_0040356 Ga0496115_0040356_135_1373 396
495 3300049588 Ga0501072_0210770 Ga0501072_0210770_261_1502 396
496 3300013308 Ga0157375_10029256 Ga0157375_100292563 397
497 3300014325 Ga0163163_10197585 Ga0163163_101975852 397
498 3300026121 Ga0207683_10034454 Ga0207683_100344544 397
499 3300035089 Ga0373944_0018534 Ga0373944_0018534_33_1268 397
500 3300035111 Ga0373923_0004450 Ga0373923_0004450_501_1736 397
501 3300035113 Ga0373936_0016236 Ga0373936_0016236_946_2181 397
502 3300035118 Ga0373954_0008487 Ga0373954_0008487_1667_2905 397
503 3300035171 Ga0373946_0010355 Ga0373946_0010355_120_1355 397
504 3300035410 Ga0373924_0043449 Ga0373924_0043449_44_1279 397
505 3300035725 Ga0373947_0085843 Ga0373947_0085843_513_1748 397
506 3300036401 Ga0373937_0053044 Ga0373937_0053044_724_1959 397
507 3300037068 Ga0373925_0022023 Ga0373925_0022023_1853_3088 397
508 3300046454 Ga0495592_0081475 Ga0495592_0081475_871_2106 397
509 3300046459 Ga0495629_0038364 Ga0495629_0038364_1630_2868 397
510 3300046459 Ga0495629_0160184 Ga0495629_0160184_34_1269 397
511 3300046473 Ga0495582_0019551 Ga0495582_0019551_327_1562 397
512 3300046477 Ga0495664_0065981 Ga0495664_0065981_679_1914 397
513 3300046516 Ga0495628_0049043 Ga0495628_0049043_106_1341 397
514 3300046533 Ga0495640_0045017 Ga0495640_0045017_1559_2794 397
515 3300046543 Ga0495645_0196283 Ga0495645_0196283_82_1317 397
516 3300046642 Ga0495634_0029266 Ga0495634_0029266_1836_3071 397
517 3300046642 Ga0495634_0038466 Ga0495634_0038466_151_1389 397
518 3300046683 Ga0495658_0022933 Ga0495658_0022933_341_1576 397
519 3300046690 Ga0495624_0091617 Ga0495624_0091617_337_1572 397
520 3300047319 Ga0495674_0041940 Ga0495674_0041940_1872_3107 397
521 3300047471 Ga0495684_0022805 Ga0495684_0022805_368_1606 397
522 3300047471 Ga0495684_0038906 Ga0495684_0038906_1857_3092 397
523 3300047673 Ga0495593_0025657 Ga0495593_0025657_468_1703 397
524 3300047673 Ga0495593_0042238 Ga0495593_0042238_784_2022 397
525 3300053085 Ga0495619_0165255 Ga0495619_0165255_180_1418 397
526 3300005436 Ga0070713_100003811 Ga0070713_10000381110 398
527 3300006028 Ga0070717_10051648 Ga0070717_100516482 398
528 3300046511 Ga0495608_0043419 Ga0495608_0043419_1602_2840 398
529 3300048928 Ga0496125_0140610 Ga0496125_0140610_188_1387 398
530 3300049569 Ga0501032_0054044 Ga0501032_0054044_1035_2276 398
531 3300049572 Ga0501036_0081623 Ga0501036_0081623_1161_2402 398
532 3300049574 Ga0501038_0003992 Ga0501038_0003992_5228_6469 398
533 3300049581 Ga0501047_0067439 Ga0501047_0067439_931_2172 398
534 3300049742 Ga0501080_0069251 Ga0501080_0069251_1124_2365 398
535 3300049822 Ga0501035_0150994 Ga0501035_0150994_41_1282 398
536 3300049823 Ga0501044_0228834 Ga0501044_0228834_244_1485 398
537 3300049823 Ga0501044_0333733 Ga0501044_0333733_55_1296 398
538 3300003354 JGI25160J50197_1002626 JGI25160J50197_10026263 399
539 3300005983 Ga0081540_1002366 Ga0081540_10023664 399
540 3300025302 Ga0207426_1000819 Ga0207426_100081935 399
541 3300025302 Ga0207426_1012642 Ga0207426_10126422 399
542 3300048928 Ga0496125_0030954 Ga0496125_0030954_1310_2548 399
543 3300049579 Ga0501043_0088389 Ga0501043_0088389_383_1627 399
544 3300049581 Ga0501047_0028277 Ga0501047_0028277_3111_4355 399
545 3300049823 Ga0501044_0298157 Ga0501044_0298157_141_1385 399
546 3300053109 Ga0500569_001091 Ga0500569_001091_667_1905 399
547 3300005331 Ga0070670_100129126 Ga0070670_1001291262 400
548 3300005347 Ga0070668_100146050 Ga0070668_1001460502 400
549 3300014326 Ga0157380_10070533 Ga0157380_100705332 400
550 3300025901 Ga0207688_10054206 Ga0207688_100542062 400
551 3300025926 Ga0207659_10056798 Ga0207659_100567982 400
552 3300047322 Ga0495680_0109034 Ga0495680_0109034_473_1738 400
553 3300048915 Ga0496112_0086930 Ga0496112_0086930_1730_2968 400
554 3300049570 Ga0501033_0095080 Ga0501033_0095080_29_1270 400
555 3300049571 Ga0501034_0014203 Ga0501034_0014203_6045_7289 400
556 3300049579 Ga0501043_0057581 Ga0501043_0057581_1746_2990 400
557 3300006178 Ga0075367_10123619 Ga0075367_101236191 403
558 3300037418 Ga0395900_0067613 Ga0395900_0067613_589_1833 403
559 3300038443 Ga0395901_0014860 Ga0395901_0014860_2146_3390 403
560 iso_pu_bacteria 2667528175 2671120924 404
561 3300027296 Ga0209389_1000016 Ga0209389_1000016169 405
562 3300027361 Ga0209489_100063 Ga0209489_100063127 405
563 3300027363 Ga0209700_100012 Ga0209700_100012170 405
564 3300048929 Ga0496126_0236451 Ga0496126_0236451_84_1325 405
565 iso_pu_bacteria 2507262055 2507512013 406
566 iso_pu_bacteria 2508501128 2509151215 406
567 iso_pu_bacteria 2513237092 2513627522 406
568 iso_pu_bacteria 2513237104 2513720219 406
569 iso_pu_bacteria 2513237137 2513859745 406
570 iso_pu_bacteria 2517572143 2517890036 406
571 iso_pu_bacteria 2844315083 2844321234 406
572 iso_pu_bacteria 2881665667 2881669226 406
573 iso_pu_bacteria 2903727486 2903728657 406
574 iso_pu_bacteria 2906602504 2906607849 406
575 iso_pu_bacteria 2941531003 2941531812 406
576 iso_pu_bacteria 3005483717 3005490328 406
577 iso_pu_bacteria 8056967851 8056976035 406
578 iso_pu_bacteria 2508501009 2508545672 407
579 iso_pu_bacteria 2508501042 2508694495 407
580 iso_pu_bacteria 2511231028 2511393604 407
581 iso_pu_bacteria 2513237094 2513643170 407
582 iso_pu_bacteria 2513237095 2513650958 407
583 iso_pu_bacteria 2513237096 2513655571 407
584 iso_pu_bacteria 2513237098 2513677178 407
585 iso_pu_bacteria 2513237101 2513698845 407
586 iso_pu_bacteria 2513237102 2513705981 407
587 iso_pu_bacteria 2513237139 2513874357 407
588 iso_pu_bacteria 2513237145 2513916351 407
589 iso_pu_bacteria 2513237161 2514017191 407
590 iso_pu_bacteria 2515154112 2515624575 407
591 iso_pu_bacteria 2517093001 2517104489 407
592 iso_pu_bacteria 2524023205 2524438459 407
593 iso_pu_bacteria 2524023210 2524466338 407
594 iso_pu_bacteria 2524023228 2524534885 407
595 iso_pu_bacteria 2528768022 2528850254 407
596 iso_pu_bacteria 2617270735 2617349767 407
597 iso_pu_bacteria 2617270741 2617376947 407
598 iso_pu_bacteria 2643221651 2644289892 407
599 iso_pu_bacteria 2791355196 2793059495 407
600 iso_pu_bacteria 2791355197 2793067988 407
601 iso_pu_bacteria 2802429603 2805920955 407
602 iso_pu_bacteria 2816332527 2818242324 407
603 iso_pu_bacteria 2824626560 2824633008 407
604 iso_pu_bacteria 2824687955 2824695918 407
605 iso_pu_bacteria 2824773399 2824781363 407
606 iso_pu_bacteria 2838122688 2838128528 407
607 iso_pu_bacteria 2841941048 2841942386 407
608 iso_pu_bacteria 2841949485 2841955485 407
609 iso_pu_bacteria 2841957949 2841960816 407
610 iso_pu_bacteria 2841966195 2841971091 407
611 iso_pu_bacteria 2841974524 2841982210 407
612 iso_pu_bacteria 2841983080 2841984402 407
613 iso_pu_bacteria 2842038055 2842041872 407
614 iso_pu_bacteria 2842045827 2842049915 407
615 iso_pu_bacteria 2847930680 2847932170 407
616 iso_pu_bacteria 2847939898 2847943405 407
617 iso_pu_bacteria 2849076700 2849077125 407
618 iso_pu_bacteria 2857509624 2857514579 407
619 iso_pu_bacteria 2874590934 2874595814 407
620 iso_pu_bacteria 2874604998 2874606655 407
621 iso_pu_bacteria 2874620515 2874624144 407
622 iso_pu_bacteria 2874628541 2874630422 407
623 iso_pu_bacteria 2874645413 2874651554 407
624 iso_pu_bacteria 2876761206 2876767567 407
625 iso_pu_bacteria 2876771140 2876776011 407
626 iso_pu_bacteria 2876818435 2876821219 407
627 iso_pu_bacteria 2879074833 2879080100 407
628 iso_pu_bacteria 2879083081 2879089423 407
629 iso_pu_bacteria 2879099564 2879106423 407
630 iso_pu_bacteria 2879110137 2879112009 407
631 iso_pu_bacteria 2879127579 2879132669 407
632 iso_pu_bacteria 2879142872 2879146454 407
633 iso_pu_bacteria 2885366525 2885371556 407
634 iso_pu_bacteria 2885409591 2885414056 407
635 iso_pu_bacteria 2888378607 2888387521 407
636 iso_pu_bacteria 2888388044 2888391665 407
637 iso_pu_bacteria 2888419890 2888426753 407
638 iso_pu_bacteria 2889033259 2889034033 407
639 iso_pu_bacteria 2903748898 2903754515 407
640 iso_pu_bacteria 2903768456 2903772508 407
641 iso_pu_bacteria 2904666416 2904670855 407
642 iso_pu_bacteria 2904690495 2904697623 407
643 iso_pu_bacteria 2904699407 2904710755 407
644 iso_pu_bacteria 2904711408 2904713817 407
645 iso_pu_bacteria 2906610324 2906612202 407
646 iso_pu_bacteria 2906626472 2906634848 407
647 iso_pu_bacteria 2908756301 2908757730 407
648 iso_pu_bacteria 2908775508 2908782842 407
649 iso_pu_bacteria 2922361189 2922367435 407
650 iso_pu_bacteria 2922368715 2922376501 407
651 iso_pu_bacteria 2922386360 2922389868 407
652 iso_pu_bacteria 2922425934 2922427096 407
653 iso_pu_bacteria 2929615660 2929619990 407
654 iso_pu_bacteria 2929624759 2929629302 407
655 iso_pu_bacteria 2932784394 2932789569 407
656 iso_pu_bacteria 2932794094 2932796756 407
657 iso_pu_bacteria 2932801729 2932802464 407
658 iso_pu_bacteria 2932809354 2932814925 407
659 iso_pu_bacteria 2932818245 2932824218 407
660 iso_pu_bacteria 2932828146 2932834053 407
661 iso_pu_bacteria 2933577622 2933581908 407
662 iso_pu_bacteria 2935608549 2935613342 407
663 iso_pu_bacteria 2935616580 2935623557 407
664 iso_pu_bacteria 2935630451 2935633248 407
665 iso_pu_bacteria 2935638405 2935644944 407
666 iso_pu_bacteria 2935648319 2935653782 407
667 iso_pu_bacteria 2935656913 2935662531 407
668 iso_pu_bacteria 2935665750 2935671993 407
669 iso_pu_bacteria 2935675223 2935683079 407
670 iso_pu_bacteria 2935684952 2935689249 407
671 iso_pu_bacteria 2935694250 2935697492 407
672 iso_pu_bacteria 2935703347 2935711068 407
673 iso_pu_bacteria 2935713505 2935720195 407
674 iso_pu_bacteria 2935722832 2935728188 407
675 iso_pu_bacteria 2935732158 2935737215 407
676 iso_pu_bacteria 2935741537 2935746724 407
677 iso_pu_bacteria 2935750917 2935757691 407
678 iso_pu_bacteria 2935760218 2935764068 407
679 iso_pu_bacteria 2935769743 2935776357 407
680 iso_pu_bacteria 2935777560 2935784382 407
681 iso_pu_bacteria 2935785616 2935792418 407
682 iso_pu_bacteria 2935793552 2935800581 407
683 iso_pu_bacteria 2935801545 2935808657 407
684 iso_pu_bacteria 2935810662 2935817453 407
685 iso_pu_bacteria 2935819856 2935824804 407
686 iso_pu_bacteria 2935827899 2935834210 407
687 iso_pu_bacteria 2935837841 2935844812 407
688 iso_pu_bacteria 2935847175 2935852024 407
689 iso_pu_bacteria 2935855204 2935861836 407
690 iso_pu_bacteria 2935864058 2935868528 407
691 iso_pu_bacteria 2935873716 2935879302 407
692 iso_pu_bacteria 2935883170 2935887094 407
693 iso_pu_bacteria 2935908558 2935911371 407
694 iso_pu_bacteria 2935916978 2935920904 407
695 iso_pu_bacteria 2935926038 2935928400 407
696 iso_pu_bacteria 2935934488 2935938045 407
697 iso_pu_bacteria 2935942939 2935945327 407
698 iso_pu_bacteria 2935951376 2935954167 407
699 iso_pu_bacteria 2935959822 2935965993 407
700 iso_pu_bacteria 2935967501 2935971565 407
701 iso_pu_bacteria 2935975950 2935979962 407
702 iso_pu_bacteria 2935984226 2935989392 407
703 iso_pu_bacteria 2935992306 2935998531 407
704 iso_pu_bacteria 2936002035 2936009009 407
705 iso_pu_bacteria 2936011229 2936016821 407
706 iso_pu_bacteria 2936019824 2936025454 407
707 iso_pu_bacteria 2936028420 2936034308 407
708 iso_pu_bacteria 2936037263 2936044250 407
709 iso_pu_bacteria 2936046547 2936052365 407
710 iso_pu_bacteria 2936055302 2936060645 407
711 iso_pu_bacteria 2940556831 2940563487 407
712 iso_pu_bacteria 2941507105 2941509450 407
713 iso_pu_bacteria 2941515067 2941517279 407
714 iso_pu_bacteria 2941523033 2941526768 407
715 iso_pu_bacteria 2941538514 2941545293 407
716 iso_pu_bacteria 3005474847 3005476268 407
717 iso_pu_bacteria 3005506211 3005506767 407
718 iso_pu_bacteria 3005587118 3005591296 407
719 iso_pu_bacteria 3005594810 3005601572 407
720 iso_pu_bacteria 3005710791 3005717301 407
721 iso_pu_bacteria 3005718088 3005724265 407
722 iso_pu_bacteria 8006933436 8006937593 407
723 iso_pu_bacteria 8006964411 8006965976 407
724 iso_pu_bacteria 8006973647 8006977623 407
725 iso_pu_bacteria 8006984368 8006989894 407
726 iso_pu_bacteria 8006994254 8006998252 407
727 iso_pu_bacteria 8016511872 8016519336 407
728 iso_pu_bacteria 8016522445 8016525008 407
729 iso_pu_bacteria 8016548790 8016550417 407
730 iso_pu_bacteria 8016566248 8016568263 407
731 iso_pu_bacteria 8016575299 8016580929 407
732 iso_pu_bacteria 8016595262 8016596798 407
733 iso_pu_bacteria 8016630954 8016637042 407
734 iso_pu_bacteria 8017057580 8017066181 407
735 iso_pu_bacteria 8019555841 8019561026 407
736 iso_pu_bacteria 8019565922 8019571113 407
737 iso_pu_bacteria 8019576017 8019578446 407
738 iso_pu_bacteria 8019586578 8019596488 407
739 iso_pu_bacteria 8019597564 8019605214 407
740 iso_pu_bacteria 8019608314 8019613332 407
741 iso_pu_bacteria 8019619141 8019624001 407
742 iso_pu_bacteria 8019629233 8019638034 407
743 iso_pu_bacteria 8019638758 8019641601 407
744 iso_pu_bacteria 8019648815 8019653525 407
745 iso_pu_bacteria 8019678201 8019680624 407
746 iso_pu_bacteria 8019687851 8019695137 407
747 iso_pu_bacteria 8055742211 8055750258 407
748 iso_pu_bacteria 8056673599 8056677876 407
749 iso_pu_bacteria 8056681323 8056686070 407
750 iso_pu_bacteria 8056689827 8056695373 407
751 3300005434 Ga0070709_10010701 Ga0070709_100107012 408
752 3300005434 Ga0070709_10095195 Ga0070709_100951952 408
753 3300005435 Ga0070714_100054175 Ga0070714_1000541753 408
754 3300006163 Ga0070715_10004200 Ga0070715_100042002 408
755 3300006175 Ga0070712_100023949 Ga0070712_1000239494 408
756 3300009551 Ga0105238_10071778 Ga0105238_100717782 408
757 3300025898 Ga0207692_10000264 Ga0207692_1000026420 408
758 3300025906 Ga0207699_10014138 Ga0207699_100141384 408
759 3300025906 Ga0207699_10075669 Ga0207699_100756692 408
760 3300025915 Ga0207693_10001910 Ga0207693_100019107 408
761 3300025916 Ga0207663_10000684 Ga0207663_1000068411 408
762 3300025924 Ga0207694_10019123 Ga0207694_100191234 408
763 3300036401 Ga0373937_0057792 Ga0373937_0057792_1527_2756 408
764 3300048915 Ga0496112_0032434 Ga0496112_0032434_1316_2545 408
765 iso_pu_bacteria 2881364244 2881367515 408
766 3300006038 Ga0075365_10019222 Ga0075365_100192222 409
767 3300006178 Ga0075367_10098252 Ga0075367_100982522 409
768 3300031249 Ga0265339_10016301 Ga0265339_100163012 409
769 3300031711 Ga0265314_10030455 Ga0265314_100304553 409
770 3300031712 Ga0265342_10012767 Ga0265342_100127674 409
771 3300050492 nmdc:mga0yw44_3932_c1 nmdc:mga0yw44_3932_c1_3543_4775 409
772 3300050494 nmdc:mga06z11_76486_c1 nmdc:mga06z11_76486_c1_174_1406 409
773 3300053139 Ga0500568_0022636 Ga0500568_0022636_1302_2534 409
774 3300005616 Ga0068852_100090609 Ga0068852_1000906092 410
775 3300009093 Ga0105240_10112091 Ga0105240_101120913 410
776 3300025917 Ga0207660_10032853 Ga0207660_100328534 410
777 3300037466 Ga0395898_0085381 Ga0395898_0085381_1577_2818 410
778 3300044684 Ga0466966_0035051 Ga0466966_0035051_230_1465 410
779 3300044706 Ga0466964_0079553 Ga0466964_0079553_82_1317 410
780 3300044901 Ga0466960_0019224 Ga0466960_0019224_645_1880 410
781 3300046684 Ga0495669_0080887 Ga0495669_0080887_78_1313 410
782 3300048924 Ga0496121_0003837 Ga0496121_0003837_3085_4323 410
783 3300048929 Ga0496126_0029109 Ga0496126_0029109_711_1949 410
784 3300049569 Ga0501032_0012150 Ga0501032_0012150_849_2087 410
785 3300049570 Ga0501033_0002602 Ga0501033_0002602_12347_13585 410
786 3300049570 Ga0501033_0109417 Ga0501033_0109417_160_1401 410
787 3300049571 Ga0501034_0065672 Ga0501034_0065672_1098_2375 410
788 3300049572 Ga0501036_0052145 Ga0501036_0052145_2213_3451 410
789 3300049573 Ga0501037_0000360 Ga0501037_0000360_8594_9832 410
790 3300049573 Ga0501037_0061883 Ga0501037_0061883_701_1942 410
791 3300049574 Ga0501038_0128060 Ga0501038_0128060_12_1253 410
792 3300049579 Ga0501043_0011214 Ga0501043_0011214_5088_6329 410
793 3300049579 Ga0501043_0044164 Ga0501043_0044164_900_2138 410
794 3300049580 Ga0501046_0080362 Ga0501046_0080362_861_2099 410
795 3300049580 Ga0501046_0088741 Ga0501046_0088741_648_1889 410
796 3300049581 Ga0501047_0117071 Ga0501047_0117071_988_2229 410
797 3300049582 Ga0501048_0070694 Ga0501048_0070694_168_1406 410
798 3300049584 Ga0501068_0008490 Ga0501068_0008490_2412_3650 410
799 3300049586 Ga0501070_0021051 Ga0501070_0021051_1241_2482 410
800 3300049741 Ga0501079_0148750 Ga0501079_0148750_420_1658 410
801 3300049743 Ga0501081_0115517 Ga0501081_0115517_530_1768 410
802 3300049822 Ga0501035_0009962 Ga0501035_0009962_4600_5841 410
803 3300049823 Ga0501044_0019074 Ga0501044_0019074_4352_5629 410
804 3300049823 Ga0501044_0053817 Ga0501044_0053817_2155_3396 410
805 3300053130 Ga0500642_0000038 Ga0500642_0000038_79070_80305 410
806 iso_pu_bacteria 2874612657 2874614908 410
807 3300003215 JGI25153J46596_10016633 JGI25153J46596_100166332 411
808 3300005334 Ga0068869_100024984 Ga0068869_1000249842 411
809 3300005347 Ga0070668_100056424 Ga0070668_1000564243 411
810 3300005366 Ga0070659_100035956 Ga0070659_1000359564 411
811 3300005434 Ga0070709_10063877 Ga0070709_100638772 411
812 3300005435 Ga0070714_100043807 Ga0070714_1000438072 411
813 3300005436 Ga0070713_100048160 Ga0070713_1000481603 411
814 3300005437 Ga0070710_10023913 Ga0070710_100239133 411
815 3300005530 Ga0070679_100330849 Ga0070679_1003308492 411
816 3300005578 Ga0068854_100007607 Ga0068854_1000076074 411
817 3300005578 Ga0068854_100211574 Ga0068854_1002115742 411
818 3300005617 Ga0068859_100089615 Ga0068859_1000896153 411
819 3300005617 Ga0068859_100376721 Ga0068859_1003767212 411
820 3300005842 Ga0068858_100032070 Ga0068858_1000320703 411
821 3300005843 Ga0068860_100127814 Ga0068860_1001278142 411
822 3300005844 Ga0068862_100070598 Ga0068862_1000705982 411
823 3300006051 Ga0075364_10211068 Ga0075364_102110681 411
824 3300006175 Ga0070712_100020630 Ga0070712_1000206302 411
825 3300006358 Ga0068871_100018443 Ga0068871_1000184432 411
826 3300006871 Ga0075434_100082073 Ga0075434_1000820732 411
827 3300006931 Ga0097620_100089618 Ga0097620_1000896183 411
828 3300006931 Ga0097620_100376717 Ga0097620_1003767172 411
829 3300006942 Ga0099824_1003256 Ga0099824_10032569 411
830 3300006943 Ga0099822_1004597 Ga0099822_100459717 411
831 3300006944 Ga0099823_1026917 Ga0099823_10269174 411
832 3300009093 Ga0105240_10013102 Ga0105240_100131026 411
833 3300009093 Ga0105240_10099112 Ga0105240_100991121 411
834 3300009098 Ga0105245_10231046 Ga0105245_102310462 411
835 3300009174 Ga0105241_10008432 Ga0105241_100084324 411
836 3300009545 Ga0105237_10312233 Ga0105237_103122332 411
837 3300009551 Ga0105238_10030290 Ga0105238_100302905 411
838 3300010375 Ga0105239_10073800 Ga0105239_100738002 411
839 3300011119 Ga0105246_10105134 Ga0105246_101051341 411
840 3300013104 Ga0157370_10106780 Ga0157370_101067802 411
841 3300013104 Ga0157370_10273247 Ga0157370_102732472 411
842 3300013105 Ga0157369_10007217 Ga0157369_1000721713 411
843 3300014968 Ga0157379_10169060 Ga0157379_101690602 411
844 3300025254 Ga0209148_1000335 Ga0209148_100033544 411
845 3300025272 Ga0209455_1001768 Ga0209455_10017686 411
846 3300025295 Ga0209564_1000971 Ga0209564_100097121 411
847 3300025297 Ga0209758_1002973 Ga0209758_100297310 411
848 3300025898 Ga0207692_10053897 Ga0207692_100538972 411
849 3300025906 Ga0207699_10057243 Ga0207699_100572432 411
850 3300025914 Ga0207671_10067553 Ga0207671_100675533 411
851 3300025915 Ga0207693_10002004 Ga0207693_100020046 411
852 3300025919 Ga0207657_10011680 Ga0207657_100116802 411
853 3300025924 Ga0207694_10006382 Ga0207694_100063827 411
854 3300025927 Ga0207687_10239914 Ga0207687_102399141 411
855 3300025929 Ga0207664_10052199 Ga0207664_100521993 411
856 3300025932 Ga0207690_10056649 Ga0207690_100566492 411
857 3300025939 Ga0207665_10033566 Ga0207665_100335662 411
858 3300025942 Ga0207689_10048121 Ga0207689_100481212 411
859 3300025949 Ga0207667_10080586 Ga0207667_100805863 411
860 3300025972 Ga0207668_10101009 Ga0207668_101010092 411
861 3300025981 Ga0207640_10046213 Ga0207640_100462131 411
862 3300026041 Ga0207639_10048136 Ga0207639_100481362 411
863 3300026078 Ga0207702_10000003 Ga0207702_10000003102 411
864 3300026116 Ga0207674_10013223 Ga0207674_100132238 411
865 3300027357 Ga0209589_1000005 Ga0209589_1000005437 411
866 3300027361 Ga0209489_100005 Ga0209489_100005437 411
867 3300027363 Ga0209700_100006 Ga0209700_100006437 411
868 3300028380 Ga0268265_10058502 Ga0268265_100585022 411
869 3300028381 Ga0268264_10203776 Ga0268264_102037762 411
870 3300028653 Ga0265323_10002731 Ga0265323_100027312 411
871 3300028666 Ga0265336_10006513 Ga0265336_100065132 411
872 3300028800 Ga0265338_10001876 Ga0265338_100018767 411
873 3300031235 Ga0265330_10017807 Ga0265330_100178073 411
874 3300033180 Ga0307510_10145585 Ga0307510_101455852 411
875 3300037068 Ga0373925_0019502 Ga0373925_0019502_328_1566 411
876 3300037418 Ga0395900_0341655 Ga0395900_0341655_188_1426 411
877 3300037466 Ga0395898_0087149 Ga0395898_0087149_516_1754 411
878 3300039450 Ga0436363_0080461 Ga0436363_0080461_525_1763 411
879 3300045049 Ga0466959_0009264 Ga0466959_0009264_5303_6541 411
880 3300045049 Ga0466959_0027342 Ga0466959_0027342_1962_3215 411
881 3300046454 Ga0495592_0050471 Ga0495592_0050471_534_1772 411
882 3300046477 Ga0495664_0042090 Ga0495664_0042090_724_1962 411
883 3300046511 Ga0495608_0130491 Ga0495608_0130491_133_1371 411
884 3300046516 Ga0495628_0094609 Ga0495628_0094609_466_1704 411
885 3300046529 Ga0495652_0016058 Ga0495652_0016058_4066_5304 411
886 3300046533 Ga0495640_0080903 Ga0495640_0080903_655_1893 411
887 3300046559 Ga0495667_0012133 Ga0495667_0012133_2664_3902 411
888 3300046678 Ga0495599_0017414 Ga0495599_0017414_3168_4406 411
889 3300046679 Ga0495623_0014742 Ga0495623_0014742_2137_3375 411
890 3300046680 Ga0495646_0066578 Ga0495646_0066578_647_1885 411
891 3300046809 Ga0495600_0001327 Ga0495600_0001327_5594_6832 411
892 3300047317 Ga0495604_0005219 Ga0495604_0005219_4558_5796 411
893 3300047320 Ga0495672_0008799 Ga0495672_0008799_1019_2257 411
894 3300047322 Ga0495680_0003661 Ga0495680_0003661_5905_7143 411
895 3300047444 Ga0495675_0015773 Ga0495675_0015773_241_1479 411
896 3300048088 Ga0495602_0014364 Ga0495602_0014364_4645_5883 411
897 3300048088 Ga0495602_0105763 Ga0495602_0105763_774_2039 411
898 3300048907 Ga0496104_0143714 Ga0496104_0143714_170_1405 411
899 3300048909 Ga0496106_0002951 Ga0496106_0002951_3902_5137 411
900 3300048910 Ga0496107_0035613 Ga0496107_0035613_247_1482 411
901 3300048911 Ga0496108_0000392 Ga0496108_0000392_43_1278 411
902 3300048911 Ga0496108_0005832 Ga0496108_0005832_7936_9174 411
903 3300048912 Ga0496109_0000509 Ga0496109_0000509_22996_24231 411
904 3300048913 Ga0496110_0029205 Ga0496110_0029205_2589_3824 411
905 3300048914 Ga0496111_0083074 Ga0496111_0083074_56_1291 411
906 3300048915 Ga0496112_0007813 Ga0496112_0007813_7194_8429 411
907 3300048920 Ga0496117_0069258 Ga0496117_0069258_81_1322 411
908 3300048922 Ga0496119_0043984 Ga0496119_0043984_853_2109 411
909 3300048924 Ga0496121_0043710 Ga0496121_0043710_812_2068 411
910 3300048924 Ga0496121_0081260 Ga0496121_0081260_169_1419 411
911 3300048924 Ga0496121_0193722 Ga0496121_0193722_38_1276 411
912 3300048927 Ga0496124_0071010 Ga0496124_0071010_333_1577 411
913 3300048928 Ga0496125_0000839 Ga0496125_0000839_40152_41390 411
914 3300048928 Ga0496125_0001026 Ga0496125_0001026_37322_38560 411
915 3300048929 Ga0496126_0044597 Ga0496126_0044597_667_1923 411
916 3300048929 Ga0496126_0072813 Ga0496126_0072813_689_1927 411
917 3300048929 Ga0496126_0111385 Ga0496126_0111385_969_2207 411
918 3300049573 Ga0501037_0027235 Ga0501037_0027235_1381_2622 411
919 3300049574 Ga0501038_0089226 Ga0501038_0089226_67_1308 411
920 3300049822 Ga0501035_0028696 Ga0501035_0028696_190_1431 411
921 3300050491 nmdc:mga00v17_165644_c1 nmdc:mga00v17_165644_c1_151_1389 411
922 3300053085 Ga0495619_0040076 Ga0495619_0040076_358_1596 411
923 3300053094 Ga0500566_0004762 Ga0500566_0004762_6733_7971 411
924 3300053102 Ga0500554_002044 Ga0500554_002044_731_2005 411
925 3300053111 Ga0500572_001245 Ga0500572_001245_155_1393 411
926 3300053119 Ga0500595_000398 Ga0500595_000398_10857_12095 411
927 3300053136 Ga0500559_0000487 Ga0500559_0000487_9959_11197 411
928 3300053150 Ga0500603_000386 Ga0500603_000386_1948_3222 411
929 3300053150 Ga0500603_003906 Ga0500603_003906_1853_3091 411
930 3300053162 Ga0500638_018643 Ga0500638_018643_422_1660 411
931 3300053178 Ga0500637_0000118 Ga0500637_0000118_11345_12583 411
932 3300053725 Ga0500576_054585 Ga0500576_054585_491_1729 411
933 3300053735 Ga0500596_006889 Ga0500596_006889_165_1403 411
934 3300055283 Ga0500661_000042 Ga0500661_000042_1724_2962 411
935 3300061719 Ga0466962_0057626 Ga0466962_0057626_416_1690 411
936 iso_pu_bacteria 2721755755 2723842669 411
937 iso_pu_bacteria 2791355199 2793080458 411
938 iso_pu_bacteria 2906635258 2906638449 411
939 iso_pu_bacteria 2906660503 2906663266 411
940 iso_pu_bacteria 2922393267 2922393440 411
941 iso_pu_bacteria 8006926726 8006931678 411
942 iso_pu_bacteria 8016583857 8016587818 411
943 iso_pu_bacteria 8016603502 8016607691 411
944 iso_pu_bacteria 8019547302 8019549062 411
945 3300005329 Ga0070683_100144293 Ga0070683_1001442932 412
946 3300026067 Ga0207678_10135176 Ga0207678_101351762 412
947 3300038443 Ga0395901_0224459 Ga0395901_0224459_435_1703 412
948 3300048907 Ga0496104_0021345 Ga0496104_0021345_1325_2563 412
949 3300048908 Ga0496105_0038908 Ga0496105_0038908_792_2030 412
950 3300048914 Ga0496111_0035754 Ga0496111_0035754_2271_3509 412
951 3300048915 Ga0496112_0052096 Ga0496112_0052096_2705_3943 412
952 3300048918 Ga0496115_0039367 Ga0496115_0039367_597_1835 412
953 3300048929 Ga0496126_0100535 Ga0496126_0100535_11_1252 412
954 3300001989 JGI24739J22299_10013644 JGI24739J22299_100136442 413
955 3300002067 JGI24735J21928_10025316 JGI24735J21928_100253162 413
956 3300005457 Ga0070662_100040915 Ga0070662_1000409152 413
957 3300005539 Ga0068853_100023427 Ga0068853_1000234274 413
958 3300005539 Ga0068853_100178962 Ga0068853_1001789621 413
959 3300005563 Ga0068855_100024679 Ga0068855_1000246792 413
960 3300005577 Ga0068857_100018829 Ga0068857_1000188294 413
961 3300005578 Ga0068854_100066695 Ga0068854_1000666952 413
962 3300005614 Ga0068856_100026401 Ga0068856_1000264014 413
963 3300005616 Ga0068852_100040881 Ga0068852_1000408813 413
964 3300005834 Ga0068851_10060065 Ga0068851_100600652 413
965 3300009093 Ga0105240_10072778 Ga0105240_100727784 413
966 3300009551 Ga0105238_10019125 Ga0105238_100191254 413
967 3300010375 Ga0105239_10054445 Ga0105239_100544452 413
968 3300025904 Ga0207647_10003678 Ga0207647_100036782 413
969 3300025913 Ga0207695_10037000 Ga0207695_100370003 413
970 3300025913 Ga0207695_10235647 Ga0207695_102356471 413
971 3300025949 Ga0207667_10050466 Ga0207667_100504662 413
972 3300025981 Ga0207640_10023994 Ga0207640_100239942 413
973 3300026041 Ga0207639_10080896 Ga0207639_100808962 413
974 3300026067 Ga0207678_10108112 Ga0207678_101081122 413
975 3300026078 Ga0207702_10106163 Ga0207702_101061632 413
976 3300026116 Ga0207674_10017295 Ga0207674_100172953 413

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01565

FAD_binding_4

FAD binding domain

63

205

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lpq-assembly1.cif.gz_A crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) 0.804 3 410
7qh2-assembly1.cif.gz_F cryo-em structure of ldh-etfab complex from acetobacterium woodii 0.7999 3 407
6lpq-assembly1.cif.gz_A crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) 0.7937 3 410
8jde-assembly1.cif.gz_A crystal structure of mldhd in complex with d-lactate 0.787 3 407
8jdc-assembly1.cif.gz_A crystal structure of mldhd in apo form 0.7863 3 407
ID Description Score Start End Superfamily
af_P52073_9_189_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9369 12 183 3.30.465.10
af_A0A368ULS0_107_341_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.8742 3 183 3.30.465.10
af_Q5ADT6_76_298_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.8736 3 184 3.30.465.10
af_K7K4A7_263_384_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.8729 53 181 3.30.465.10
af_Q11061_15_234_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.8717 3 180 3.30.465.10
ID Description Score Start End GO Terms
AF-A0A1Q5R3U4-F1-model_v4 2-hydroxy-acid oxidase 0.9669 1 325 GO:0003824
GO:0071949
AF-A0A1W9KFP3-F1-model_v4 deleted 0.9666 1 408
AF-A0A1Q5R3U4-F1-model_v4 2-hydroxy-acid oxidase 0.964 1 325 GO:0003824
GO:0071949
AF-A0A844AAP0-F1-model_v4 Glycolate oxidase subunit GlcE (EC 1.1.99.14) 0.9608 1 411 GO:0016491
GO:0071949
AF-A0A0D6PJ58-F1-model_v4 Glycolate oxidase subunit GlcE 0.9598 1 413 GO:0003824
GO:0071949

Feature Viewer

pLDDT pTM Quality
89.77 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map