F487262

General Info

Members Datasets Scaffolds Average Seq Length
976 346 1952 344

Family's Representative Sequence

Representative Sequence 3300046536|Ga0495587_0040968|Ga0495587_0040968_773_1777
Length 334
Sequence MIKVGIVGGTGYTGVELLRLLAVHPEARVQAITSRSEAGVPVGTMFPSLRDQERLSELQFSDPAGAGLSRCDVVFFATPHGVAMAQARELVGAGVKIIDLAADFRLKDTAEFERWYKMPHACPDLLAESVYGLPEMYRDAIRKARIVGNPGCYPTAIQLGFLPLVEAGIVDVDHLIADAKSGVSGAGRKAELGLLFSEASDNFKAYNLGGHRHHPEVVHGLNGRSRSPVTVVFTPLYARLTDRGVDLQALFEKRYASEPFVDVMPAGSHPETRSVRASNVCRIAVHRPQGGDTAVVVAVIDNLVKGAAGQAIQNMNLMFGLAETTGLTAPPVMP

Samples

Sample ID Description Type Environment
1 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
192 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
198 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
199 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
200 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
201 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
202 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
203 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
204 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
205 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
206 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
207 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
208 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
209 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
210 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
211 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
212 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
213 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
214 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
215 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
216 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
217 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
218 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
219 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
220 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
221 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
222 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
223 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
224 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
225 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
226 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
229 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
230 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
231 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
232 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
233 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
234 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
235 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
236 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
237 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
238 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
239 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
241 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
242 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
243 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
244 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
245 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
247 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
248 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
249 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
250 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
251 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
252 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
253 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
254 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
255 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
256 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
257 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
258 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
259 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
260 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
261 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
262 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
263 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
264 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
265 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
268 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
269 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
270 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
271 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
272 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
273 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
274 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
275 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
276 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
277 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
278 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
279 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
280 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
281 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
282 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
283 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
284 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
285 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
287 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
288 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
289 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
290 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
305 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
306 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
307 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
308 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
309 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
310 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
311 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
312 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
313 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
314 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
315 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
316 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
317 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
320 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
321 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
322 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
323 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
324 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
325 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
326 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
327 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
328 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
329 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
330 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
331 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
332 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
333 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
334 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
335 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
336 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
337 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
338 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
339 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
340 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
341 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
342 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
343 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
344 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
345 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
346 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 0.41
Isolates 0.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.84
Nodule 0
Rhizoplane 3.69
Rhizosphere 93.95
Stem 0
Stem Tuber 0
Unclassified 0.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495587_0040968 3300046536 Bacteria 2765
2 Ga0065715_10172172 3300005293 Bacteria 1538
3 Ga0070658_10062501 3300005327 Bacteria 3035
4 Ga0070658_10244643 3300005327 Bacteria 1521
5 Ga0070676_10002569 3300005328 Bacteria 9333
6 Ga0070676_10016017 3300005328 Bacteria 4140
7 Ga0070676_10028584 3300005328 Bacteria 3167
8 Ga0070676_10051661 3300005328 Bacteria 2414
9 Ga0070683_100085505 3300005329 Bacteria 2957
10 Ga0070683_100105796 3300005329 Bacteria 2652
11 Ga0070683_100140236 3300005329 Bacteria 2290
12 Ga0070690_100000521 3300005330 Bacteria 19293
13 Ga0070670_100044437 3300005331 Bacteria 3820
14 Ga0070670_100078531 3300005331 Bacteria 2835
15 Ga0070670_100110155 3300005331 Bacteria 2372
16 Ga0070670_100192052 3300005331 Bacteria 1774
17 Ga0070670_100196571 3300005331 Bacteria 1752
18 Ga0070670_100455308 3300005331 Bacteria 1134
19 Ga0070677_10000757 3300005333 Bacteria 10776
20 Ga0070677_10010233 3300005333 Bacteria 3202
21 Ga0070677_10034506 3300005333 Bacteria 1955
22 Ga0068869_100000591 3300005334 Bacteria 20345
23 Ga0068869_100051928 3300005334 Bacteria 2976
24 Ga0068869_100097098 3300005334 Bacteria 2224
25 Ga0068869_100152584 3300005334 Bacteria 1793
26 Ga0068869_100162601 3300005334 Bacteria 1739
27 Ga0068869_100214924 3300005334 Bacteria 1522
28 Ga0070666_10000774 3300005335 Bacteria 19349
29 Ga0070666_10001704 3300005335 Bacteria 13402
30 Ga0070666_10005640 3300005335 Bacteria 7678
31 Ga0070680_100086024 3300005336 Bacteria 2598
32 Ga0070680_100170045 3300005336 Bacteria 1833
33 Ga0070682_100054343 3300005337 Bacteria 2512
34 Ga0068868_100001787 3300005338 Bacteria 14747
35 Ga0068868_100044081 3300005338 Bacteria 3487
36 Ga0068868_100081007 3300005338 Bacteria 2602
37 Ga0068868_100136300 3300005338 Bacteria 2012
38 Ga0068868_100189384 3300005338 Bacteria 1710
39 Ga0070660_100008470 3300005339 Bacteria 7194
40 Ga0070660_100010171 3300005339 Bacteria 6640
41 Ga0070660_100015683 3300005339 Bacteria 5478
42 Ga0070660_100031943 3300005339 Bacteria 3959
43 Ga0070660_100096643 3300005339 Bacteria 2336
44 Ga0070660_100219837 3300005339 Bacteria 1544
45 Ga0070660_100280309 3300005339 Bacteria 1364
46 Ga0070660_100280723 3300005339 Bacteria 1363
47 Ga0070689_100001865 3300005340 Bacteria 13584
48 Ga0070689_100064761 3300005340 Bacteria 2846
49 Ga0070689_100108700 3300005340 Bacteria 2203
50 Ga0070687_100074952 3300005343 Bacteria 1828
51 Ga0070661_100000486 3300005344 Bacteria 30405
52 Ga0070661_100002576 3300005344 Bacteria 12431
53 Ga0070661_100004760 3300005344 Bacteria 9341
54 Ga0070661_100008317 3300005344 Bacteria 7167
55 Ga0070661_100023250 3300005344 Bacteria 4441
56 Ga0070661_100064312 3300005344 Bacteria 2696
57 Ga0070661_100090669 3300005344 Bacteria 2264
58 Ga0070668_100001121 3300005347 Bacteria 18870
59 Ga0070668_100001538 3300005347 Bacteria 16641
60 Ga0070668_100001746 3300005347 Bacteria 15817
61 Ga0070668_100006569 3300005347 Bacteria 8613
62 Ga0070668_100007313 3300005347 Bacteria 8190
63 Ga0070668_100071300 3300005347 Bacteria 2706
64 Ga0070668_100196338 3300005347 Bacteria 1655
65 Ga0070669_100014524 3300005353 Bacteria 5601
66 Ga0070669_100035008 3300005353 Bacteria 3636
67 Ga0070669_100051179 3300005353 Bacteria 3018
68 Ga0070669_100147678 3300005353 Bacteria 1817
69 Ga0070669_100164569 3300005353 Bacteria 1726
70 Ga0070675_100001675 3300005354 Bacteria 16337
71 Ga0070675_100004036 3300005354 Bacteria 11141
72 Ga0070675_100202401 3300005354 Bacteria 1723
73 Ga0070671_100000564 3300005355 Bacteria 26255
74 Ga0070671_100005329 3300005355 Bacteria 10260
75 Ga0070671_100014880 3300005355 Bacteria 6287
76 Ga0070671_100022630 3300005355 Bacteria 5134
77 Ga0070671_100167950 3300005355 Bacteria 1855
78 Ga0070671_100177322 3300005355 Bacteria 1804
79 Ga0070674_100000536 3300005356 Bacteria 19089
80 Ga0070674_100006377 3300005356 Bacteria 6879
81 Ga0070674_100195196 3300005356 Bacteria 1559
82 Ga0070673_100001471 3300005364 Bacteria 13789
83 Ga0070673_100001499 3300005364 Bacteria 13706
84 Ga0070673_100004988 3300005364 Bacteria 8464
85 Ga0070673_100060747 3300005364 Bacteria 2996
86 Ga0070673_100211976 3300005364 Bacteria 1673
87 Ga0070673_100284724 3300005364 Bacteria 1451
88 Ga0070688_100001931 3300005365 Bacteria 10410
89 Ga0070688_100017316 3300005365 Bacteria 4134
90 Ga0070688_100123425 3300005365 Bacteria 1738
91 Ga0070688_100162213 3300005365 Bacteria 1536
92 Ga0070659_100002814 3300005366 Bacteria 12387
93 Ga0070659_100021771 3300005366 Bacteria 4887
94 Ga0070659_100070700 3300005366 Bacteria 2773
95 Ga0070659_100071020 3300005366 Bacteria 2767
96 Ga0070659_100146538 3300005366 Bacteria 1924
97 Ga0070659_100162190 3300005366 Bacteria 1828
98 Ga0070659_100177741 3300005366 Bacteria 1746
99 Ga0070659_100322161 3300005366 Bacteria 1292
100 Ga0070667_100000863 3300005367 Bacteria 28131
101 Ga0070667_100002948 3300005367 Bacteria 14624
102 Ga0070667_100101410 3300005367 Bacteria 2486
103 Ga0070667_100104911 3300005367 Bacteria 2445
104 Ga0070667_100106245 3300005367 Bacteria 2430
105 Ga0070667_100107754 3300005367 Bacteria 2413
106 Ga0070667_100168479 3300005367 Bacteria 1932
107 Ga0070667_100277606 3300005367 Bacteria 1504
108 Ga0070709_10037095 3300005434 Bacteria 2974
109 Ga0070714_100003499 3300005435 Bacteria 11715
110 Ga0070714_100394505 3300005435 Bacteria 1307
111 Ga0070713_100000853 3300005436 Bacteria 19545
112 Ga0070713_100006960 3300005436 Bacteria 7895
113 Ga0070713_100016724 3300005436 Bacteria 5522
114 Ga0070710_10021886 3300005437 Bacteria 3337
115 Ga0070711_100010124 3300005439 Bacteria 5826
116 Ga0070705_100027467 3300005440 Bacteria 3108
117 Ga0070700_100005754 3300005441 Bacteria 6579
118 Ga0070700_100072465 3300005441 Bacteria 2202
119 Ga0070694_100071367 3300005444 Bacteria 2393
120 Ga0070694_100116447 3300005444 Bacteria 1911
121 Ga0070708_100120336 3300005445 Bacteria 2422
122 Ga0070663_100039170 3300005455 Bacteria 3311
123 Ga0070663_100114377 3300005455 Bacteria 2032
124 Ga0070678_100000428 3300005456 Bacteria 19876
125 Ga0070678_100024746 3300005456 Bacteria 4025
126 Ga0070678_100037493 3300005456 Bacteria 3405
127 Ga0070678_100292715 3300005456 Bacteria 1381
128 Ga0070662_100012355 3300005457 Bacteria 5661
129 Ga0070662_100014943 3300005457 Bacteria 5191
130 Ga0070662_100040507 3300005457 Bacteria 3317
131 Ga0070662_100156813 3300005457 Bacteria 1778
132 Ga0070681_10003494 3300005458 Bacteria 14713
133 Ga0070681_10007813 3300005458 Bacteria 10462
134 Ga0070681_10022742 3300005458 Bacteria 6300
135 Ga0070681_10157812 3300005458 Bacteria 2193
136 Ga0070681_10270679 3300005458 Bacteria 1610
137 Ga0068867_100003381 3300005459 Bacteria 11224
138 Ga0068867_100011744 3300005459 Bacteria 6185
139 Ga0068867_100017233 3300005459 Bacteria 5131
140 Ga0068867_100139599 3300005459 Bacteria 1893
141 Ga0070685_10141158 3300005466 Bacteria 1517
142 Ga0070706_100009375 3300005467 Bacteria 9113
143 Ga0070706_100018225 3300005467 Bacteria 6478
144 Ga0070706_100022655 3300005467 Bacteria 5783
145 Ga0070706_100079995 3300005467 Bacteria 3026
146 Ga0070707_100015911 3300005468 Bacteria 7061
147 Ga0070707_100039220 3300005468 Bacteria 4526
148 Ga0070707_100044145 3300005468 Bacteria 4266
149 Ga0070707_100130285 3300005468 Bacteria 2446
150 Ga0070707_100138387 3300005468 Bacteria 2369
151 Ga0070707_100175192 3300005468 Bacteria 2091
152 Ga0070698_100043258 3300005471 Bacteria 4619
153 Ga0070699_100020295 3300005518 Bacteria 5730
154 Ga0070699_100328116 3300005518 Bacteria 1376
155 Ga0070679_100033388 3300005530 Bacteria 5096
156 Ga0070679_100049459 3300005530 Bacteria 4187
157 Ga0070679_100315167 3300005530 Bacteria 1514
158 Ga0070684_100013991 3300005535 Bacteria 6487
159 Ga0070684_100140760 3300005535 Bacteria 2182
160 Ga0070684_100166102 3300005535 Bacteria 2003
161 Ga0070697_100066453 3300005536 Bacteria 2948
162 Ga0070697_100129359 3300005536 Bacteria 2117
163 Ga0070697_100178686 3300005536 Bacteria 1798
164 Ga0068853_100031441 3300005539 Bacteria 4490
165 Ga0068853_100045026 3300005539 Bacteria 3779
166 Ga0068853_100051879 3300005539 Bacteria 3532
167 Ga0068853_100126441 3300005539 Bacteria 2284
168 Ga0070672_100004110 3300005543 Bacteria 9501
169 Ga0070672_100011327 3300005543 Bacteria 6221
170 Ga0070672_100145533 3300005543 Bacteria 1958
171 Ga0070672_100186266 3300005543 Bacteria 1731
172 Ga0070686_100089558 3300005544 Bacteria 2056
173 Ga0070686_100096000 3300005544 Bacteria 1993
174 Ga0070686_100099309 3300005544 Bacteria 1964
175 Ga0070695_100013699 3300005545 Bacteria 4874
176 Ga0070695_100030795 3300005545 Bacteria 3341
177 Ga0070696_100005910 3300005546 Bacteria 8171
178 Ga0070696_100032438 3300005546 Bacteria 3583
179 Ga0070696_100063601 3300005546 Bacteria 2585
180 Ga0070696_100160214 3300005546 Bacteria 1657
181 Ga0070696_100163669 3300005546 Bacteria 1640
182 Ga0070693_100000378 3300005547 Bacteria 20172
183 Ga0070665_100003863 3300005548 Bacteria 15852
184 Ga0070665_100005926 3300005548 Bacteria 12520
185 Ga0070665_100030720 3300005548 Bacteria 5405
186 Ga0070665_100073966 3300005548 Bacteria 3413
187 Ga0070665_100308078 3300005548 Bacteria 1587
188 Ga0070704_100015536 3300005549 Bacteria 4785
189 Ga0068855_100038385 3300005563 Bacteria 5691
190 Ga0068855_100039133 3300005563 Bacteria 5629
191 Ga0068855_100050332 3300005563 Bacteria 4910
192 Ga0068855_100059170 3300005563 Bacteria 4484
193 Ga0068855_100106814 3300005563 Bacteria 3217
194 Ga0068855_100194206 3300005563 Bacteria 2288
195 Ga0068855_100201114 3300005563 Bacteria 2242
196 Ga0068855_100438595 3300005563 Bacteria 1427
197 Ga0070664_100005958 3300005564 Bacteria 9851
198 Ga0070664_100009645 3300005564 Bacteria 7833
199 Ga0070664_100022299 3300005564 Bacteria 5221
200 Ga0070664_100032335 3300005564 Bacteria 4375
201 Ga0070664_100037072 3300005564 Bacteria 4097
202 Ga0070664_100117042 3300005564 Bacteria 2331
203 Ga0070664_100206990 3300005564 Bacteria 1752
204 Ga0070664_100323360 3300005564 Bacteria 1398
205 Ga0068857_100018143 3300005577 Bacteria 6172
206 Ga0068857_100019755 3300005577 Bacteria 5918
207 Ga0068854_100006946 3300005578 Bacteria 7220
208 Ga0068854_100015337 3300005578 Bacteria 5073
209 Ga0068854_100024845 3300005578 Bacteria 4107
210 Ga0068854_100069798 3300005578 Bacteria 2567
211 Ga0068854_100184510 3300005578 Bacteria 1631
212 Ga0068856_100002081 3300005614 Bacteria 20767
213 Ga0068856_100003025 3300005614 Bacteria 17229
214 Ga0068856_100006440 3300005614 Bacteria 11516
215 Ga0068856_100010386 3300005614 Bacteria 9043
216 Ga0068856_100050306 3300005614 Bacteria 4108
217 Ga0068856_100051117 3300005614 Bacteria 4076
218 Ga0070702_100030449 3300005615 Bacteria 2942
219 Ga0070702_100046528 3300005615 Bacteria 2459
220 Ga0070702_100098242 3300005615 Bacteria 1791
221 Ga0068852_100002732 3300005616 Bacteria 12206
222 Ga0068852_100003279 3300005616 Bacteria 11295
223 Ga0068852_100019123 3300005616 Bacteria 5414
224 Ga0068859_100000594 3300005617 Bacteria 36146
225 Ga0068859_100002773 3300005617 Bacteria 17745
226 Ga0068859_100015281 3300005617 Bacteria 7710
227 Ga0068859_100116149 3300005617 Bacteria 2740
228 Ga0068864_100001433 3300005618 Bacteria 19672
229 Ga0068864_100002465 3300005618 Bacteria 15280
230 Ga0068864_100007105 3300005618 Bacteria 9196
231 Ga0068864_100017132 3300005618 Bacteria 6043
232 Ga0068864_100018403 3300005618 Bacteria 5837
233 Ga0068864_100083623 3300005618 Bacteria 2803
234 Ga0068864_100133674 3300005618 Bacteria 2231
235 Ga0068866_10016847 3300005718 Bacteria 3275
236 Ga0068861_100000705 3300005719 Bacteria 19969
237 Ga0068861_100020915 3300005719 Bacteria 4696
238 Ga0068861_100271443 3300005719 Bacteria 1456
239 Ga0068851_10001640 3300005834 Bacteria 9817
240 Ga0068851_10037711 3300005834 Bacteria 2423
241 Ga0068851_10100016 3300005834 Bacteria 1537
242 Ga0068870_10038881 3300005840 Bacteria 2459
243 Ga0068870_10058606 3300005840 Bacteria 2062
244 Ga0068863_100002710 3300005841 Bacteria 17495
245 Ga0068863_100004302 3300005841 Bacteria 14024
246 Ga0068863_100008973 3300005841 Bacteria 9765
247 Ga0068863_100015542 3300005841 Bacteria 7312
248 Ga0068863_100212633 3300005841 Bacteria 1862
249 Ga0068863_100216006 3300005841 Bacteria 1847
250 Ga0068858_100006368 3300005842 Bacteria 11495
251 Ga0068858_100031566 3300005842 Bacteria 4921
252 Ga0068858_100042025 3300005842 Bacteria 4238
253 Ga0068858_100072444 3300005842 Bacteria 3196
254 Ga0068858_100182551 3300005842 Bacteria 1981
255 Ga0068860_100024779 3300005843 Bacteria 5795
256 Ga0068860_100036963 3300005843 Bacteria 4675
257 Ga0068860_100053257 3300005843 Bacteria 3848
258 Ga0068860_100065334 3300005843 Bacteria 3455
259 Ga0068860_100077094 3300005843 Bacteria 3169
260 Ga0068860_100093577 3300005843 Bacteria 2864
261 Ga0068860_100206852 3300005843 Bacteria 1903
262 Ga0068862_100005456 3300005844 Bacteria 10626
263 Ga0068862_100055523 3300005844 Bacteria 3392
264 Ga0068862_100183721 3300005844 Bacteria 1878
265 Ga0081539_10042797 3300005985 Bacteria 2633
266 Ga0075365_10032640 3300006038 Bacteria 3349
267 Ga0075368_10005372 3300006042 Bacteria 4404
268 Ga0070716_100032117 3300006173 Bacteria 2860
269 Ga0070716_100060768 3300006173 Bacteria 2184
270 Ga0070712_100059884 3300006175 Bacteria 2683
271 Ga0070712_100096413 3300006175 Bacteria 2178
272 Ga0075367_10002132 3300006178 Bacteria 8907
273 Ga0075369_10000546 3300006186 Bacteria 11862
274 Ga0075366_10010257 3300006195 Bacteria 5255
275 Ga0075366_10029099 3300006195 Bacteria 3244
276 Ga0097621_100013194 3300006237 Bacteria 6148
277 Ga0097621_100056010 3300006237 Bacteria 3220
278 Ga0097621_100117195 3300006237 Bacteria 2256
279 Ga0097621_100133217 3300006237 Bacteria 2117
280 Ga0097621_100138178 3300006237 Bacteria 2080
281 Ga0068871_100004698 3300006358 Bacteria 9549
282 Ga0068871_100071275 3300006358 Bacteria 2858
283 Ga0068871_100084361 3300006358 Bacteria 2636
284 Ga0068871_100142392 3300006358 Bacteria 2039
285 Ga0068871_100258476 3300006358 Bacteria 1518
286 Ga0068871_100258510 3300006358 Bacteria 1518
287 Ga0075428_100002887 3300006844 Bacteria 18709
288 Ga0075428_100267822 3300006844 Bacteria 1838
289 Ga0075430_100134415 3300006846 Bacteria 2061
290 Ga0075434_100000306 3300006871 Bacteria 34874
291 Ga0075434_100030898 3300006871 Bacteria 5278
292 Ga0075434_100088450 3300006871 Bacteria 3099
293 Ga0075434_100174691 3300006871 Bacteria 2168
294 Ga0075434_100321121 3300006871 Bacteria 1569
295 Ga0075429_100033953 3300006880 Bacteria 4433
296 Ga0068865_100061221 3300006881 Bacteria 2638
297 Ga0068865_100079218 3300006881 Bacteria 2352
298 Ga0068865_100130768 3300006881 Bacteria 1880
299 Ga0068865_100162841 3300006881 Bacteria 1703
300 Ga0075436_100152988 3300006914 Bacteria 1624
301 Ga0097620_100000594 3300006931 Bacteria 36146
302 Ga0097620_100002774 3300006931 Bacteria 17745
303 Ga0097620_100015279 3300006931 Bacteria 7710
304 Ga0097620_100116144 3300006931 Bacteria 2740
305 Ga0075435_100039517 3300007076 Bacteria 3765
306 Ga0075435_100040195 3300007076 Bacteria 3734
307 Ga0075435_100148515 3300007076 Bacteria 1970
308 Ga0099794_10122638 3300007265 Bacteria 1308
309 Ga0105240_10018384 3300009093 Bacteria 9386
310 Ga0105240_10020207 3300009093 Bacteria 8890
311 Ga0105240_10028464 3300009093 Bacteria 7299
312 Ga0111539_10000957 3300009094 Bacteria 37861
313 Ga0111539_10039536 3300009094 Bacteria 5684
314 Ga0111539_10057738 3300009094 Bacteria 4608
315 Ga0111539_10060204 3300009094 Bacteria 4500
316 Ga0105245_10010967 3300009098 Bacteria 7886
317 Ga0105245_10032337 3300009098 Bacteria 4632
318 Ga0105245_10050485 3300009098 Bacteria 3728
319 Ga0105245_10335906 3300009098 Bacteria 1493
320 Ga0105247_10007921 3300009101 Bacteria 6496
321 Ga0114129_10232513 3300009147 Bacteria 2482
322 Ga0114129_10240327 3300009147 Bacteria 2434
323 Ga0114129_10444982 3300009147 Bacteria 1700
324 Ga0114129_10726224 3300009147 Bacteria 1274
325 Ga0105241_10220027 3300009174 Bacteria 1595
326 Ga0105242_10024661 3300009176 Bacteria 4751
327 Ga0105242_10213435 3300009176 Bacteria 1721
328 Ga0105242_10309544 3300009176 Bacteria 1445
329 Ga0105248_10001225 3300009177 Bacteria 28644
330 Ga0105248_10135388 3300009177 Bacteria 2779
331 Ga0105248_10265962 3300009177 Bacteria 1930
332 Ga0105237_10105489 3300009545 Bacteria 2809
333 Ga0105237_10220558 3300009545 Bacteria 1896
334 Ga0105237_10252110 3300009545 Bacteria 1767
335 Ga0105238_10008927 3300009551 Bacteria 10033
336 Ga0105238_10039286 3300009551 Bacteria 4798
337 Ga0105238_10196799 3300009551 Bacteria 1991
338 Ga0105238_10303709 3300009551 Bacteria 1580
339 Ga0105249_10066620 3300009553 Bacteria 3316
340 Ga0105249_10092876 3300009553 Bacteria 2826
341 Ga0105249_10231855 3300009553 Bacteria 1821
342 Ga0105239_10070454 3300010375 Bacteria 3841
343 Ga0105239_10113547 3300010375 Bacteria 3004
344 Ga0105239_10152195 3300010375 Bacteria 2582
345 Ga0105239_10527065 3300010375 Bacteria 1344
346 Ga0105246_10040771 3300011119 Bacteria 3135
347 Ga0157373_10001379 3300013100 Bacteria 18633
348 Ga0157373_10015272 3300013100 Bacteria 5613
349 Ga0157373_10019295 3300013100 Bacteria 4966
350 Ga0157373_10189553 3300013100 Bacteria 1449
351 Ga0157371_10005607 3300013102 Bacteria 10554
352 Ga0157371_10106698 3300013102 Bacteria 1988
353 Ga0157371_10179597 3300013102 Bacteria 1514
354 Ga0157370_10002935 3300013104 Bacteria 20300
355 Ga0157370_10013191 3300013104 Bacteria 8522
356 Ga0157370_10014097 3300013104 Bacteria 8199
357 Ga0157370_10020764 3300013104 Bacteria 6554
358 Ga0157370_10032253 3300013104 Bacteria 5116
359 Ga0157370_10056890 3300013104 Bacteria 3721
360 Ga0157370_10143469 3300013104 Bacteria 2224
361 Ga0157370_10266230 3300013104 Bacteria 1584
362 Ga0157369_10005349 3300013105 Bacteria 14960
363 Ga0157369_10040426 3300013105 Bacteria 5091
364 Ga0157369_10213141 3300013105 Bacteria 2024
365 Ga0157369_10461971 3300013105 Bacteria 1314
366 Ga0157374_10000924 3300013296 Bacteria 25554
367 Ga0157374_10005165 3300013296 Bacteria 10949
368 Ga0157374_10021418 3300013296 Bacteria 5752
369 Ga0157374_10080988 3300013296 Bacteria 3081
370 Ga0157374_10179947 3300013296 Bacteria 2065
371 Ga0157374_10184643 3300013296 Bacteria 2038
372 Ga0157378_10004871 3300013297 Bacteria 11773
373 Ga0157378_10052080 3300013297 Bacteria 3642
374 Ga0157378_10191448 3300013297 Bacteria 1929
375 Ga0157378_10208896 3300013297 Bacteria 1850
376 Ga0157378_10379672 3300013297 Bacteria 1387
377 Ga0163162_10004885 3300013306 Bacteria 12926
378 Ga0163162_10041348 3300013306 Bacteria 4612
379 Ga0163162_10059011 3300013306 Bacteria 3868
380 Ga0163162_10115317 3300013306 Bacteria 2786
381 Ga0163162_10136132 3300013306 Bacteria 2567
382 Ga0157372_10001772 3300013307 Bacteria 23417
383 Ga0157372_10015325 3300013307 Bacteria 8214
384 Ga0157372_10018658 3300013307 Bacteria 7462
385 Ga0157372_10139004 3300013307 Bacteria 2797
386 Ga0157372_10194792 3300013307 Bacteria 2348
387 Ga0157372_10349325 3300013307 Bacteria 1723
388 Ga0157375_10004384 3300013308 Bacteria 12257
389 Ga0157375_10106761 3300013308 Bacteria 2892
390 Ga0157375_10385748 3300013308 Bacteria 1568
391 Ga0157375_10455019 3300013308 Bacteria 1445
392 Ga0163163_10229130 3300014325 Bacteria 1907
393 Ga0163163_10229622 3300014325 Bacteria 1905
394 Ga0157380_10085349 3300014326 Bacteria 2591
395 Ga0157380_10095741 3300014326 Bacteria 2460
396 Ga0157380_10399210 3300014326 Bacteria 1304
397 Ga0157377_10009541 3300014745 Bacteria 4767
398 Ga0157377_10251800 3300014745 Bacteria 1145
399 Ga0157379_10001374 3300014968 Bacteria 19913
400 Ga0157379_10011623 3300014968 Bacteria 7686
401 Ga0157379_10012130 3300014968 Bacteria 7526
402 Ga0157379_10017214 3300014968 Bacteria 6367
403 Ga0157379_10059206 3300014968 Bacteria 3425
404 Ga0157379_10093104 3300014968 Bacteria 2704
405 Ga0157379_10115348 3300014968 Bacteria 2415
406 Ga0157376_10021708 3300014969 Bacteria 4990
407 Ga0157376_10028228 3300014969 Bacteria 4458
408 Ga0157376_10047180 3300014969 Bacteria 3555
409 Ga0157376_10273364 3300014969 Bacteria 1588
410 Ga0163161_10053766 3300017792 Bacteria 2921
411 Ga0163161_10057587 3300017792 Bacteria 2823
412 Ga0163161_10091122 3300017792 Bacteria 2256
413 Ga0163161_10120716 3300017792 Bacteria 1969
414 Ga0206356_11461543 3300020070 Bacteria 2998
415 Ga0206353_10236115 3300020082 Bacteria 1445
416 Ga0213872_10000333 3300021361 Bacteria 40014
417 Ga0213872_10002733 3300021361 Bacteria 10128
418 Ga0213872_10004503 3300021361 Bacteria 7382
419 Ga0207697_10001482 3300025315 Bacteria 12807
420 Ga0207697_10007231 3300025315 Bacteria 4961
421 Ga0207697_10020055 3300025315 Bacteria 2738
422 Ga0207682_10000993 3300025893 Bacteria 13099
423 Ga0207682_10001318 3300025893 Bacteria 11412
424 Ga0207682_10007381 3300025893 Bacteria 4382
425 Ga0207692_10041356 3300025898 Bacteria 2281
426 Ga0207642_10008244 3300025899 Bacteria 3563
427 Ga0207688_10006119 3300025901 Bacteria 6549
428 Ga0207688_10041079 3300025901 Bacteria 2571
429 Ga0207680_10004681 3300025903 Bacteria 6499
430 Ga0207680_10078757 3300025903 Bacteria 2065
431 Ga0207680_10142648 3300025903 Bacteria 1589
432 Ga0207645_10000039 3300025907 Bacteria 88205
433 Ga0207645_10000331 3300025907 Bacteria 39499
434 Ga0207645_10007484 3300025907 Bacteria 7707
435 Ga0207645_10020552 3300025907 Bacteria 4321
436 Ga0207645_10059692 3300025907 Bacteria 2436
437 Ga0207643_10001108 3300025908 Bacteria 15982
438 Ga0207643_10003518 3300025908 Bacteria 8424
439 Ga0207643_10111769 3300025908 Bacteria 1610
440 Ga0207705_10114288 3300025909 Bacteria 1997
441 Ga0207705_10128151 3300025909 Bacteria 1887
442 Ga0207705_10190102 3300025909 Bacteria 1552
443 Ga0207705_10190370 3300025909 Bacteria 1551
444 Ga0207684_10046819 3300025910 Bacteria 3669
445 Ga0207684_10102396 3300025910 Bacteria 2448
446 Ga0207654_10060700 3300025911 Bacteria 2210
447 Ga0207654_10145140 3300025911 Bacteria 1518
448 Ga0207707_10008263 3300025912 Bacteria 9037
449 Ga0207707_10046343 3300025912 Bacteria 3786
450 Ga0207707_10058381 3300025912 Bacteria 3358
451 Ga0207707_10069403 3300025912 Bacteria 3071
452 Ga0207707_10139098 3300025912 Bacteria 2123
453 Ga0207707_10144033 3300025912 Bacteria 2083
454 Ga0207695_10074196 3300025913 Bacteria 3464
455 Ga0207695_10167310 3300025913 Bacteria 2126
456 Ga0207693_10000397 3300025915 Bacteria 40037
457 Ga0207693_10027063 3300025915 Bacteria 4535
458 Ga0207693_10091135 3300025915 Bacteria 2390
459 Ga0207663_10028987 3300025916 Bacteria 3246
460 Ga0207660_10022105 3300025917 Bacteria 4283
461 Ga0207660_10095518 3300025917 Bacteria 2212
462 Ga0207660_10176845 3300025917 Bacteria 1655
463 Ga0207662_10065329 3300025918 Bacteria 2191
464 Ga0207662_10096349 3300025918 Bacteria 1828
465 Ga0207657_10000394 3300025919 Bacteria 46090
466 Ga0207657_10001000 3300025919 Bacteria 30068
467 Ga0207657_10014530 3300025919 Bacteria 7677
468 Ga0207657_10032471 3300025919 Bacteria 4716
469 Ga0207657_10119234 3300025919 Bacteria 2171
470 Ga0207657_10125730 3300025919 Bacteria 2106
471 Ga0207649_10006345 3300025920 Bacteria 6427
472 Ga0207652_10009287 3300025921 Bacteria 7905
473 Ga0207652_10018041 3300025921 Bacteria 5785
474 Ga0207646_10018213 3300025922 Bacteria 6555
475 Ga0207646_10037198 3300025922 Bacteria 4389
476 Ga0207681_10002345 3300025923 Bacteria 12049
477 Ga0207681_10011778 3300025923 Bacteria 5379
478 Ga0207681_10049092 3300025923 Bacteria 2851
479 Ga0207694_10014534 3300025924 Bacteria 5936
480 Ga0207694_10021564 3300025924 Bacteria 4881
481 Ga0207650_10001745 3300025925 Bacteria 15450
482 Ga0207650_10026853 3300025925 Bacteria 4114
483 Ga0207650_10034273 3300025925 Bacteria 3681
484 Ga0207650_10044835 3300025925 Bacteria 3251
485 Ga0207650_10056570 3300025925 Bacteria 2915
486 Ga0207650_10057719 3300025925 Bacteria 2888
487 Ga0207650_10061300 3300025925 Bacteria 2808
488 Ga0207650_10274402 3300025925 Bacteria 1371
489 Ga0207659_10014770 3300025926 Bacteria 5046
490 Ga0207659_10026217 3300025926 Bacteria 3930
491 Ga0207659_10084411 3300025926 Bacteria 2356
492 Ga0207659_10161435 3300025926 Bacteria 1760
493 Ga0207687_10000188 3300025927 Bacteria 41329
494 Ga0207687_10007739 3300025927 Bacteria 7050
495 Ga0207700_10000074 3300025928 Bacteria 61772
496 Ga0207700_10010760 3300025928 Bacteria 5796
497 Ga0207700_10029252 3300025928 Bacteria 3885
498 Ga0207700_10037722 3300025928 Bacteria 3502
499 Ga0207664_10001185 3300025929 Bacteria 17338
500 Ga0207664_10049607 3300025929 Bacteria 3306
501 Ga0207664_10072300 3300025929 Bacteria 2780
502 Ga0207644_10003932 3300025931 Bacteria 9638
503 Ga0207644_10008387 3300025931 Bacteria 6762
504 Ga0207644_10011828 3300025931 Bacteria 5780
505 Ga0207644_10038706 3300025931 Bacteria 3361
506 Ga0207644_10143201 3300025931 Bacteria 1843
507 Ga0207690_10017644 3300025932 Bacteria 4364
508 Ga0207690_10158258 3300025932 Bacteria 1686
509 Ga0207690_10265407 3300025932 Bacteria 1332
510 Ga0207706_10000854 3300025933 Bacteria 31369
511 Ga0207706_10002859 3300025933 Bacteria 16752
512 Ga0207706_10007248 3300025933 Bacteria 10252
513 Ga0207706_10015396 3300025933 Bacteria 6909
514 Ga0207706_10048226 3300025933 Bacteria 3767
515 Ga0207706_10184716 3300025933 Bacteria 1831
516 Ga0207706_10294380 3300025933 Bacteria 1415
517 Ga0207706_10332238 3300025933 Bacteria 1322
518 Ga0207686_10000211 3300025934 Bacteria 44316
519 Ga0207686_10149671 3300025934 Bacteria 1623
520 Ga0207709_10031657 3300025935 Bacteria 3092
521 Ga0207670_10129669 3300025936 Bacteria 1845
522 Ga0207670_10136754 3300025936 Bacteria 1802
523 Ga0207669_10002807 3300025937 Bacteria 7460
524 Ga0207669_10055040 3300025937 Bacteria 2407
525 Ga0207669_10111983 3300025937 Bacteria 1831
526 Ga0207669_10186463 3300025937 Bacteria 1492
527 Ga0207704_10019141 3300025938 Bacteria 3590
528 Ga0207704_10064358 3300025938 Bacteria 2291
529 Ga0207665_10054762 3300025939 Bacteria 2691
530 Ga0207665_10126862 3300025939 Bacteria 1808
531 Ga0207691_10000027 3300025940 Bacteria 126502
532 Ga0207691_10000122 3300025940 Bacteria 70474
533 Ga0207691_10000772 3300025940 Bacteria 31685
534 Ga0207691_10100924 3300025940 Bacteria 2575
535 Ga0207711_10000116 3300025941 Bacteria 83390
536 Ga0207711_10036322 3300025941 Bacteria 4181
537 Ga0207711_10138857 3300025941 Bacteria 2185
538 Ga0207689_10000548 3300025942 Bacteria 35796
539 Ga0207689_10001927 3300025942 Bacteria 19632
540 Ga0207689_10006355 3300025942 Bacteria 10463
541 Ga0207689_10008896 3300025942 Bacteria 8710
542 Ga0207689_10040830 3300025942 Bacteria 3839
543 Ga0207689_10085284 3300025942 Bacteria 2596
544 Ga0207661_10010299 3300025944 Bacteria 6725
545 Ga0207661_10178940 3300025944 Bacteria 1851
546 Ga0207679_10015734 3300025945 Bacteria 5009
547 Ga0207679_10078160 3300025945 Bacteria 2520
548 Ga0207679_10251969 3300025945 Bacteria 1501
549 Ga0207679_10268270 3300025945 Bacteria 1459
550 Ga0207679_10279485 3300025945 Bacteria 1431
551 Ga0207679_10324702 3300025945 Bacteria 1334
552 Ga0207667_10002343 3300025949 Bacteria 23727
553 Ga0207667_10094773 3300025949 Bacteria 3082
554 Ga0207667_10204862 3300025949 Bacteria 2023
555 Ga0207667_10214468 3300025949 Bacteria 1973
556 Ga0207651_10044425 3300025960 Bacteria 2973
557 Ga0207651_10161962 3300025960 Bacteria 1755
558 Ga0207651_10329329 3300025960 Bacteria 1279
559 Ga0207712_10085235 3300025961 Bacteria 2311
560 Ga0207712_10192494 3300025961 Bacteria 1611
561 Ga0207668_10002876 3300025972 Bacteria 10102
562 Ga0207668_10005221 3300025972 Bacteria 7644
563 Ga0207668_10018007 3300025972 Bacteria 4436
564 Ga0207640_10008758 3300025981 Bacteria 5631
565 Ga0207640_10049870 3300025981 Bacteria 2713
566 Ga0207640_10072147 3300025981 Bacteria 2328
567 Ga0207640_10182049 3300025981 Bacteria 1576
568 Ga0207658_10012633 3300025986 Bacteria 5766
569 Ga0207658_10013907 3300025986 Bacteria 5507
570 Ga0207658_10013937 3300025986 Bacteria 5501
571 Ga0207658_10019542 3300025986 Bacteria 4686
572 Ga0207658_10071368 3300025986 Bacteria 2629
573 Ga0207658_10181302 3300025986 Bacteria 1743
574 Ga0207658_10437021 3300025986 Bacteria 1156
575 Ga0207677_10000598 3300026023 Bacteria 22232
576 Ga0207677_10018321 3300026023 Bacteria 4199
577 Ga0207677_10036280 3300026023 Bacteria 3212
578 Ga0207677_10058229 3300026023 Bacteria 2659
579 Ga0207677_10065700 3300026023 Bacteria 2532
580 Ga0207677_10072764 3300026023 Bacteria 2431
581 Ga0207677_10231064 3300026023 Bacteria 1490
582 Ga0207703_10000357 3300026035 Bacteria 49166
583 Ga0207703_10000746 3300026035 Bacteria 32065
584 Ga0207703_10024218 3300026035 Bacteria 4776
585 Ga0207703_10043079 3300026035 Bacteria 3621
586 Ga0207703_10128218 3300026035 Bacteria 2187
587 Ga0207639_10009491 3300026041 Bacteria 6716
588 Ga0207639_10029203 3300026041 Bacteria 4035
589 Ga0207678_10007312 3300026067 Bacteria 9785
590 Ga0207678_10011189 3300026067 Bacteria 7881
591 Ga0207678_10015432 3300026067 Bacteria 6716
592 Ga0207678_10082708 3300026067 Bacteria 2747
593 Ga0207678_10207134 3300026067 Bacteria 1678
594 Ga0207678_10208163 3300026067 Bacteria 1673
595 Ga0207708_10004145 3300026075 Bacteria 10665
596 Ga0207708_10007951 3300026075 Bacteria 7859
597 Ga0207708_10234001 3300026075 Bacteria 1476
598 Ga0207702_10003836 3300026078 Bacteria 13562
599 Ga0207702_10014082 3300026078 Bacteria 6641
600 Ga0207702_10029159 3300026078 Bacteria 4590
601 Ga0207702_10045737 3300026078 Bacteria 3682
602 Ga0207702_10049161 3300026078 Bacteria 3558
603 Ga0207702_10088947 3300026078 Bacteria 2700
604 Ga0207702_10146000 3300026078 Bacteria 2147
605 Ga0207641_10007190 3300026088 Bacteria 9281
606 Ga0207641_10009017 3300026088 Bacteria 8237
607 Ga0207641_10072505 3300026088 Bacteria 2966
608 Ga0207641_10125576 3300026088 Bacteria 2296
609 Ga0207641_10304927 3300026088 Bacteria 1505
610 Ga0207648_10000149 3300026089 Bacteria 70199
611 Ga0207648_10007044 3300026089 Bacteria 11113
612 Ga0207648_10014327 3300026089 Bacteria 7329
613 Ga0207648_10014574 3300026089 Bacteria 7260
614 Ga0207648_10017253 3300026089 Bacteria 6578
615 Ga0207648_10019771 3300026089 Bacteria 6077
616 Ga0207648_10023267 3300026089 Bacteria 5556
617 Ga0207648_10048131 3300026089 Bacteria 3734
618 Ga0207676_10000236 3300026095 Bacteria 48498
619 Ga0207676_10006704 3300026095 Bacteria 8145
620 Ga0207676_10012337 3300026095 Bacteria 6120
621 Ga0207674_10000694 3300026116 Bacteria 43838
622 Ga0207674_10001128 3300026116 Bacteria 34654
623 Ga0207674_10006144 3300026116 Bacteria 14184
624 Ga0207674_10022289 3300026116 Bacteria 6803
625 Ga0207674_10022536 3300026116 Bacteria 6761
626 Ga0207674_10026234 3300026116 Bacteria 6194
627 Ga0207674_10210919 3300026116 Bacteria 1891
628 Ga0207675_100000230 3300026118 Bacteria 52816
629 Ga0207675_100000871 3300026118 Bacteria 30087
630 Ga0207675_100002944 3300026118 Bacteria 16745
631 Ga0207675_100004627 3300026118 Bacteria 13261
632 Ga0207675_100030831 3300026118 Bacteria 4994
633 Ga0207683_10000005 3300026121 Bacteria 187889
634 Ga0207683_10000285 3300026121 Bacteria 45347
635 Ga0207683_10000364 3300026121 Bacteria 41505
636 Ga0207683_10004773 3300026121 Bacteria 11668
637 Ga0207683_10006165 3300026121 Bacteria 10276
638 Ga0207683_10015805 3300026121 Bacteria 6425
639 Ga0207683_10084179 3300026121 Bacteria 2827
640 Ga0207683_10321686 3300026121 Bacteria 1417
641 Ga0207698_10001960 3300026142 Bacteria 12097
642 Ga0207698_10021781 3300026142 Bacteria 4440
643 Ga0207698_10025539 3300026142 Bacteria 4164
644 Ga0207698_10341426 3300026142 Bacteria 1411
645 Ga0209969_1000136 3300027360 Bacteria 9537
646 Ga0209996_1002378 3300027395 Bacteria 2330
647 Ga0210000_1000292 3300027462 Bacteria 7188
648 Ga0209995_1011156 3300027471 Bacteria 1461
649 Ga0209983_1002782 3300027665 Bacteria 3788
650 Ga0209971_1007936 3300027682 Bacteria 2519
651 Ga0209813_10001571 3300027866 Bacteria 5126
652 Ga0209974_10000335 3300027876 Bacteria 15422
653 Ga0209974_10002039 3300027876 Bacteria 7374
654 Ga0209974_10007387 3300027876 Bacteria 3788
655 Ga0209974_10040668 3300027876 Bacteria 1548
656 Ga0207428_10011849 3300027907 Bacteria 7683
657 Ga0207428_10098368 3300027907 Bacteria 2264
658 Ga0268266_10008117 3300028379 Bacteria 9374
659 Ga0268266_10034562 3300028379 Bacteria 4299
660 Ga0268266_10213272 3300028379 Bacteria 1771
661 Ga0268266_10402793 3300028379 Bacteria 1294
662 Ga0268265_10005441 3300028380 Bacteria 8703
663 Ga0268265_10018470 3300028380 Bacteria 4833
664 Ga0268265_10047984 3300028380 Bacteria 3203
665 Ga0268264_10002371 3300028381 Bacteria 16625
666 Ga0268264_10013772 3300028381 Bacteria 6653
667 Ga0268264_10039446 3300028381 Bacteria 3902
668 Ga0268264_10044953 3300028381 Bacteria 3666
669 Ga0265324_10000001 3300029957 Bacteria 562975
670 Ga0265324_10004084 3300029957 Bacteria 6703
671 Ga0265330_10011554 3300031235 Bacteria 4138
672 Ga0265332_10083577 3300031238 Bacteria 1353
673 Ga0265328_10000020 3300031239 Bacteria 125715
674 Ga0265328_10003722 3300031239 Bacteria 6724
675 Ga0265328_10009523 3300031239 Bacteria 3951
676 Ga0265325_10000542 3300031241 Bacteria 27351
677 Ga0265325_10039496 3300031241 Bacteria 2485
678 Ga0265331_10000144 3300031250 Bacteria 92791
679 Ga0265331_10004577 3300031250 Bacteria 8610
680 Ga0265331_10012989 3300031250 Bacteria 4489
681 Ga0265331_10021602 3300031250 Bacteria 3291
682 Ga0265331_10028015 3300031250 Bacteria 2819
683 Ga0265331_10038261 3300031250 Bacteria 2346
684 Ga0265331_10062312 3300031250 Bacteria 1759
685 Ga0265331_10065006 3300031250 Bacteria 1716
686 Ga0265327_10000044 3300031251 Bacteria 284808
687 Ga0265327_10000136 3300031251 Bacteria 160868
688 Ga0265327_10000314 3300031251 Bacteria 92783
689 Ga0265327_10000475 3300031251 Bacteria 70831
690 Ga0265327_10000730 3300031251 Bacteria 51310
691 Ga0265327_10001767 3300031251 Bacteria 25537
692 Ga0265327_10006826 3300031251 Bacteria 8995
693 Ga0265327_10008949 3300031251 Bacteria 7339
694 Ga0265327_10013003 3300031251 Bacteria 5564
695 Ga0265327_10015340 3300031251 Bacteria 4953
696 Ga0265327_10071561 3300031251 Bacteria 1734
697 Ga0265316_10016572 3300031344 Bacteria 6388
698 Ga0265316_10224637 3300031344 Bacteria 1384
699 Ga0307408_100002911 3300031548 Bacteria 11869
700 Ga0307408_100057101 3300031548 Bacteria 2832
701 Ga0307408_100106422 3300031548 Bacteria 2146
702 Ga0316575_10000042 3300031665 Bacteria 31213
703 Ga0316579_10003975 3300031691 Bacteria 5828
704 Ga0316579_10010044 3300031691 Bacteria 3992
705 Ga0265314_10007067 3300031711 Bacteria 9799
706 Ga0265314_10111146 3300031711 Bacteria 1741
707 Ga0265314_10157317 3300031711 Bacteria 1386
708 Ga0316576_10048257 3300031727 Bacteria 3087
709 Ga0316578_10010133 3300031728 Bacteria 4878
710 Ga0307405_10003878 3300031731 Bacteria 6974
711 Ga0307405_10017485 3300031731 Bacteria 3935
712 Ga0316577_10003010 3300031733 Bacteria 8441
713 Ga0307413_10001237 3300031824 Bacteria 9496
714 Ga0307410_10009907 3300031852 Bacteria 5373
715 Ga0307410_10014406 3300031852 Bacteria 4651
716 Ga0307410_10137685 3300031852 Bacteria 1802
717 Ga0307406_10004415 3300031901 Bacteria 7650
718 Ga0307406_10034187 3300031901 Bacteria 3116
719 Ga0307407_10064001 3300031903 Bacteria 2159
720 Ga0307407_10112942 3300031903 Bacteria 1709
721 Ga0307412_10028767 3300031911 Bacteria 3481
722 Ga0307409_100029836 3300031995 Bacteria 3909
723 Ga0307409_100117877 3300031995 Bacteria 2241
724 Ga0307416_100035373 3300032002 Bacteria 3813
725 Ga0307414_10261984 3300032004 Bacteria 1443
726 Ga0307411_10000127 3300032005 Bacteria 23867
727 Ga0307411_10042097 3300032005 Bacteria 2911
728 Ga0307411_10358727 3300032005 Bacteria 1191
729 Ga0307415_100003315 3300032126 Bacteria 8174
730 Ga0316583_10008955 3300032133 Bacteria 3608
731 Ga0316583_10030946 3300032133 Bacteria 1905
732 Ga0316583_10048555 3300032133 Bacteria 1494
733 Ga0316585_10016146 3300032137 Bacteria 2246
734 Ga0316580_10018726 3300032139 Bacteria 2131
735 Ga0316593_10030950 3300032168 Bacteria 1740
736 Ga0316596_1002051 3300033541 Bacteria 4243
737 Ga0373928_0014325 3300035084 Bacteria 1602
738 Ga0373928_0052041 3300035084 Bacteria 970
739 Ga0373934_0000450 3300035086 Bacteria 14370
740 Ga0373952_0002096 3300035092 Bacteria 3588
741 Ga0373945_0042501 3300035116 Bacteria 1647
742 Ga0373953_0004449 3300035117 Bacteria 4470
743 Ga0373954_0000090 3300035118 Bacteria 31033
744 Ga0373956_0004386 3300035119 Bacteria 5651
745 Ga0373957_0004734 3300035120 Bacteria 4164
746 Ga0373943_0009829 3300035170 Bacteria 4283
747 Ga0373943_0038768 3300035170 Bacteria 2292
748 Ga0373946_0113841 3300035171 Bacteria 1227
749 Ga0316574_0001261 3300035398 Bacteria 11807
750 Ga0316574_0004450 3300035398 Bacteria 7347
751 Ga0316574_0033809 3300035398 Bacteria 3113
752 Ga0373935_0023065 3300035692 Bacteria 3822
753 Ga0373935_0256356 3300035692 Bacteria 1225
754 Ga0373927_0019318 3300035695 Bacteria 4469
755 Ga0373927_0030999 3300035695 Bacteria 3487
756 Ga0373927_0117713 3300035695 Bacteria 1733
757 Ga0373947_0038846 3300035725 Bacteria 2830
758 Ga0373947_0312313 3300035725 Bacteria 1050
759 Ga0373937_0031264 3300036401 Bacteria 4822
760 Ga0373937_0040788 3300036401 Bacteria 4232
761 Ga0373937_0125613 3300036401 Bacteria 2393
762 Ga0373937_0132013 3300036401 Bacteria 2333
763 Ga0373937_0168682 3300036401 Bacteria 2053
764 Ga0316582_0009509 3300036647 Bacteria 5279
765 Ga0316582_0055880 3300036647 Bacteria 2517
766 Ga0316584_0002039 3300036712 Bacteria 12637
767 Ga0316584_0004127 3300036712 Bacteria 9583
768 Ga0373925_0216161 3300037068 Bacteria 1529
769 Ga0373925_0395196 3300037068 Bacteria 1127
770 Ga0395899_0214769 3300037312 Bacteria 1335
771 Ga0395900_0099978 3300037418 Bacteria 2979
772 Ga0395900_0395256 3300037418 Bacteria 1348
773 Ga0395901_0040793 3300038443 Bacteria 4808
774 Ga0400483_128908 3300039062 Bacteria 1812
775 Ga0436361_0060436 3300039447 Bacteria 2382
776 Ga0436361_0235627 3300039447 Bacteria 11028
777 Ga0436361_0891393 3300039447 Bacteria 99242
778 Ga0451807_0812292 3300041486 Bacteria 4489
779 Ga0451853_2089945 3300041512 Bacteria 2193
780 Ga0439441_001329 3300042001 Bacteria 3190
781 Ga0439455_0050163 3300042012 Bacteria 1089
782 Ga0451577_0000002 3300042876 Bacteria 1731375
783 Ga0451577_0000395 3300042876 Bacteria 80169
784 Ga0451577_0001764 3300042876 Bacteria 27851
785 Ga0451577_0137433 3300042876 Bacteria 2195
786 Ga0451577_0178970 3300042876 Bacteria 1911
787 Ga0451577_0192340 3300042876 Bacteria 1841
788 Ga0451577_0369281 3300042876 Bacteria 1301
789 Ga0453683_0000011 3300044673 Bacteria 412765
790 Ga0453683_0003829 3300044673 Bacteria 10922
791 Ga0453684_0000002 3300044712 Bacteria 1731375
792 Ga0453684_0000694 3300044712 Bacteria 119688
793 Ga0453684_0001529 3300044712 Bacteria 64683
794 Ga0453684_0002108 3300044712 Bacteria 50205
795 Ga0453684_0013161 3300044712 Bacteria 13491
796 Ga0453684_0034047 3300044712 Bacteria 7083
797 Ga0453684_0303582 3300044712 Bacteria 1814
798 Ga0451576_0000004 3300045051 Bacteria 1312238
799 Ga0451576_0000006 3300045051 Bacteria 949698
800 Ga0451576_0001977 3300045051 Bacteria 32557
801 Ga0451576_0002214 3300045051 Bacteria 29931
802 Ga0451576_0002633 3300045051 Bacteria 26264
803 Ga0451576_0006277 3300045051 Bacteria 14626
804 Ga0451576_0018556 3300045051 Bacteria 7621
805 Ga0451576_0069900 3300045051 Bacteria 3654
806 Ga0451576_0082691 3300045051 Bacteria 3340
807 Ga0451576_0138914 3300045051 Bacteria 2535
808 Ga0466967_0480879 3300045976 Bacteria 1217
809 Ga0495629_0072973 3300046459 Bacteria 2396
810 Ga0495629_0122088 3300046459 Bacteria 1815
811 Ga0495629_0373400 3300046459 Bacteria 971
812 Ga0495580_0046345 3300046472 Bacteria 3085
813 Ga0495580_0142954 3300046472 Bacteria 1658
814 Ga0495582_0018395 3300046473 Bacteria 3821
815 Ga0495639_0029001 3300046475 Bacteria 2454
816 Ga0495665_0031115 3300046531 Bacteria 2856
817 Ga0495621_0004496 3300046539 Bacteria 3930
818 Ga0495621_0029257 3300046539 Bacteria 1877
819 Ga0495645_0179809 3300046543 Bacteria 1450
820 Ga0495635_0003129 3300046663 Bacteria 11389
821 Ga0495659_0008400 3300046664 Bacteria 3286
822 Ga0495658_0227644 3300046683 Bacteria 1168
823 Ga0495600_0013499 3300046809 Bacteria 5135
824 Ga0495581_0009908 3300047315 Bacteria 5512
825 Ga0495604_0086299 3300047317 Bacteria 2340
826 Ga0495674_0121424 3300047319 Bacteria 2207
827 Ga0495680_0027794 3300047322 Bacteria 4642
828 Ga0495675_0145128 3300047444 Bacteria 1469
829 Ga0495684_0052242 3300047471 Bacteria 3118
830 Ga0496100_0049877 3300048903 Bacteria 2709
831 Ga0496101_0009759 3300048904 Bacteria 6320
832 Ga0496101_0156327 3300048904 Bacteria 1747
833 Ga0496102_0013642 3300048905 Bacteria 7042
834 Ga0496102_0095561 3300048905 Bacteria 2755
835 Ga0496103_0037694 3300048906 Bacteria 2963
836 Ga0496103_0122994 3300048906 Bacteria 1654
837 Ga0496104_0035404 3300048907 Bacteria 4661
838 Ga0496104_0266122 3300048907 Bacteria 1627
839 Ga0496105_0010312 3300048908 Bacteria 7345
840 Ga0496105_0020268 3300048908 Bacteria 5373
841 Ga0496106_0037450 3300048909 Bacteria 3629
842 Ga0496106_0044631 3300048909 Bacteria 3327
843 Ga0496106_0100662 3300048909 Bacteria 2241
844 Ga0496106_0197689 3300048909 Bacteria 1600
845 Ga0496107_0037001 3300048910 Bacteria 3502
846 Ga0496107_0059285 3300048910 Bacteria 2770
847 Ga0496108_0001943 3300048911 Bacteria 16553
848 Ga0496108_0028099 3300048911 Bacteria 4653
849 Ga0496108_0061510 3300048911 Bacteria 3160
850 Ga0496109_0007082 3300048912 Bacteria 9465
851 Ga0496109_0021461 3300048912 Bacteria 5710
852 Ga0496109_0087616 3300048912 Bacteria 2876
853 Ga0496109_0116251 3300048912 Bacteria 2489
854 Ga0496110_0041351 3300048913 Bacteria 4022
855 Ga0496110_0110755 3300048913 Bacteria 2467
856 Ga0496112_0000540 3300048915 Bacteria 25909
857 Ga0496112_0019957 3300048915 Bacteria 6342
858 Ga0496112_0130501 3300048915 Bacteria 2484
859 Ga0496114_0065630 3300048917 Bacteria 3041
860 Ga0496114_0081151 3300048917 Bacteria 2740
861 Ga0496114_0086431 3300048917 Bacteria 2658
862 Ga0496114_0100347 3300048917 Bacteria 2470
863 Ga0496114_0341069 3300048917 Bacteria 1325
864 Ga0496114_0363031 3300048917 Bacteria 1281
865 Ga0501031_0006233 3300049568 Bacteria 7778
866 Ga0501031_0009246 3300049568 Bacteria 6405
867 Ga0501031_0066973 3300049568 Bacteria 2340
868 Ga0501032_0000403 3300049569 Bacteria 35638
869 Ga0501032_0007680 3300049569 Bacteria 7860
870 Ga0501032_0051359 3300049569 Bacteria 2780
871 Ga0501032_0072552 3300049569 Bacteria 2295
872 Ga0501033_0000709 3300049570 Bacteria 30657
873 Ga0501033_0001808 3300049570 Bacteria 18685
874 Ga0501033_0016892 3300049570 Bacteria 5517
875 Ga0501034_0000759 3300049571 Bacteria 48520
876 Ga0501034_0008103 3300049571 Bacteria 11145
877 Ga0501034_0077421 3300049571 Bacteria 3331
878 Ga0501034_0080850 3300049571 Bacteria 3253
879 Ga0501036_0000268 3300049572 Bacteria 35567
880 Ga0501036_0001606 3300049572 Bacteria 17453
881 Ga0501036_0219371 3300049572 Bacteria 1597
882 Ga0501037_0023208 3300049573 Bacteria 4587
883 Ga0501037_0102228 3300049573 Bacteria 2067
884 Ga0501037_0142279 3300049573 Bacteria 1716
885 Ga0501038_0000280 3300049574 Bacteria 43290
886 Ga0501038_0001255 3300049574 Bacteria 23022
887 Ga0501038_0004118 3300049574 Bacteria 13528
888 Ga0501038_0019910 3300049574 Bacteria 6039
889 Ga0501038_0047069 3300049574 Bacteria 3737
890 Ga0501038_0076106 3300049574 Bacteria 2835
891 Ga0501038_0279571 3300049574 Bacteria 1314
892 Ga0501039_0030324 3300049575 Bacteria 4170
893 Ga0501039_0084871 3300049575 Unclassified 2467
894 Ga0501039_0167569 3300049575 Bacteria 1727
895 Ga0501039_0272400 3300049575 Bacteria 1330
896 Ga0501040_0001121 3300049576 Bacteria 16964
897 Ga0501040_0050934 3300049576 Bacteria 2833
898 Ga0501042_0125352 3300049578 Bacteria 1849
899 Ga0501043_0001507 3300049579 Bacteria 20331
900 Ga0501043_0003838 3300049579 Bacteria 12355
901 Ga0501043_0020315 3300049579 Bacteria 5210
902 Ga0501046_0008472 3300049580 Bacteria 8958
903 Ga0501046_0141840 3300049580 Bacteria 1818
904 Ga0501047_0002525 3300049581 Bacteria 17435
905 Ga0501047_0017182 3300049581 Bacteria 6925
906 Ga0501048_0006099 3300049582 Bacteria 9181
907 Ga0501067_0005678 3300049583 Bacteria 6928
908 Ga0501068_0013549 3300049584 Bacteria 4641
909 Ga0501069_0087657 3300049585 Bacteria 1758
910 Ga0501069_0105584 3300049585 Bacteria 1601
911 Ga0501072_0007494 3300049588 Bacteria 8281
912 Ga0501072_0105355 3300049588 Bacteria 2242
913 Ga0501073_0006424 3300049589 Bacteria 8751
914 Ga0501073_0061438 3300049589 Bacteria 2622
915 Ga0501073_0113961 3300049589 Bacteria 1875
916 Ga0501074_0039704 3300049590 Bacteria 3409
917 Ga0501074_0128000 3300049590 Bacteria 1817
918 Ga0501075_0042183 3300049591 Bacteria 3420
919 Ga0501076_0014178 3300049592 Bacteria 5997
920 Ga0501077_0027329 3300049593 Bacteria 3624
921 Ga0501079_0001860 3300049741 Bacteria 15133
922 Ga0501080_0003681 3300049742 Bacteria 13520
923 Ga0501080_0019259 3300049742 Bacteria 6321
924 Ga0501081_0016868 3300049743 Bacteria 4826
925 Ga0501083_0068897 3300049744 Bacteria 2354
926 Ga0501035_0000270 3300049822 Bacteria 61516
927 Ga0501035_0004552 3300049822 Bacteria 13160
928 Ga0501035_0007685 3300049822 Bacteria 10073
929 Ga0501035_0068178 3300049822 Bacteria 3155
930 Ga0501035_0111503 3300049822 Bacteria 2397
931 Ga0501044_0000261 3300049823 Bacteria 66869
932 Ga0501044_0000482 3300049823 Bacteria 48412
933 Ga0501044_0004065 3300049823 Bacteria 16403
934 Ga0501045_0000564 3300049824 Bacteria 23265
935 Ga0501045_0030960 3300049824 Bacteria 3874
936 nmdc:mga03683_10226_c1 3300050489 Bacteria 3361
937 nmdc:mga03n38_981_c1 3300050490 Bacteria 7780
938 nmdc:mga00v17_5571_c1 3300050491 Bacteria 6638
939 nmdc:mga0yw44_172_c1 3300050492 Bacteria 22648
940 nmdc:mga0k408_12910_c1 3300050493 Bacteria 4574
941 nmdc:mga0k408_35783_c1 3300050493 Bacteria 2848
942 nmdc:mga06z11_1401_c1 3300050494 Bacteria 8957
943 nmdc:mga04h51_1093_c1 3300050495 Bacteria 6254
944 nmdc:mga05p37_240457_c1 3300050507 Bacteria 2177
945 nmdc:mga05p37_300622_c1 3300050507 Bacteria 1907
946 nmdc:mga09592_30954_c1 3300050508 Bacteria 4456
947 nmdc:mga08y16_128607_c1 3300050511 Bacteria 2635
948 nmdc:mga08y16_27570_c1 3300050511 Bacteria 5985
949 nmdc:mga08y16_71407_c1 3300050511 Bacteria 3618
950 nmdc:mga08y16_84834_c1 3300050511 Bacteria 3301
951 nmdc:mga0n895_111670_c1 3300050512 Bacteria 2750
952 nmdc:mga0n895_17716_c1 3300050512 Bacteria 6571
953 nmdc:mga0n895_185344_c1 3300050512 Bacteria 2112
954 nmdc:mga0n895_255694_c1 3300050512 Bacteria 1777
955 nmdc:mga0n895_432_c1 3300050512 Bacteria 28136
956 nmdc:mga0rr50_1318_c1 3300050513 Bacteria 13536
957 nmdc:mga0rr50_49968_c1 3300050513 Bacteria 3097
958 nmdc:mga0rr50_5859_c1 3300050513 Bacteria 7390
959 nmdc:mga0rr50_72129_c1 3300050513 Bacteria 2636
960 nmdc:mga0rr50_97216_c1 3300050513 Bacteria 2305
961 nmdc:mga08x19_60696_c1 3300050514 Bacteria 2449
962 nmdc:mga0sz30_9987_c1 3300050516 Bacteria 3629
963 Ga0495619_0010282 3300053085 Bacteria 5892
964 Ga0500594_0004257 3300053118 Bacteria 3156
965 Ga0500622_0000019 3300053156 Bacteria 275028
966 Ga0501082_0034997 3300060353 Bacteria 4328
967 Ga0501082_0045730 3300060353 Bacteria 3775
968 Ga0530510_0080048 3300061734 Bacteria 2377
969 2547372644 2547132103 Bacteria 5115736
970 2843691647 2843690924 Bacteria 5169057
971 2846037063 2846033681 Bacteria 4377894
972 2846040145 2846037992 Bacteria 4526407
973 2891637714 2891633521 Bacteria 4602265
974 2894514810 2894510363 Bacteria 5121143
975 2989396658 2989392574 Bacteria 4554005
976 8001524634 8001522603 Bacteria 4726425
977 Ga0495587_0040968
978 Ga0065715_10172172
979 Ga0070658_10062501
980 Ga0070658_10244643
981 Ga0070676_10002569
982 Ga0070676_10016017
983 Ga0070676_10028584
984 Ga0070676_10051661
985 Ga0070683_100085505
986 Ga0070683_100105796
987 Ga0070683_100140236
988 Ga0070690_100000521
989 Ga0070670_100044437
990 Ga0070670_100078531
991 Ga0070670_100110155
992 Ga0070670_100192052
993 Ga0070670_100196571
994 Ga0070670_100455308
995 Ga0070677_10000757
996 Ga0070677_10010233
997 Ga0070677_10034506
998 Ga0068869_100000591
999 Ga0068869_100051928
1000 Ga0068869_100097098
1001 Ga0068869_100152584
1002 Ga0068869_100162601
1003 Ga0068869_100214924
1004 Ga0070666_10000774
1005 Ga0070666_10001704
1006 Ga0070666_10005640
1007 Ga0070680_100086024
1008 Ga0070680_100170045
1009 Ga0070682_100054343
1010 Ga0068868_100001787
1011 Ga0068868_100044081
1012 Ga0068868_100081007
1013 Ga0068868_100136300
1014 Ga0068868_100189384
1015 Ga0070660_100008470
1016 Ga0070660_100010171
1017 Ga0070660_100015683
1018 Ga0070660_100031943
1019 Ga0070660_100096643
1020 Ga0070660_100219837
1021 Ga0070660_100280309
1022 Ga0070660_100280723
1023 Ga0070689_100001865
1024 Ga0070689_100064761
1025 Ga0070689_100108700
1026 Ga0070687_100074952
1027 Ga0070661_100000486
1028 Ga0070661_100002576
1029 Ga0070661_100004760
1030 Ga0070661_100008317
1031 Ga0070661_100023250
1032 Ga0070661_100064312
1033 Ga0070661_100090669
1034 Ga0070668_100001121
1035 Ga0070668_100001538
1036 Ga0070668_100001746
1037 Ga0070668_100006569
1038 Ga0070668_100007313
1039 Ga0070668_100071300
1040 Ga0070668_100196338
1041 Ga0070669_100014524
1042 Ga0070669_100035008
1043 Ga0070669_100051179
1044 Ga0070669_100147678
1045 Ga0070669_100164569
1046 Ga0070675_100001675
1047 Ga0070675_100004036
1048 Ga0070675_100202401
1049 Ga0070671_100000564
1050 Ga0070671_100005329
1051 Ga0070671_100014880
1052 Ga0070671_100022630
1053 Ga0070671_100167950
1054 Ga0070671_100177322
1055 Ga0070674_100000536
1056 Ga0070674_100006377
1057 Ga0070674_100195196
1058 Ga0070673_100001471
1059 Ga0070673_100001499
1060 Ga0070673_100004988
1061 Ga0070673_100060747
1062 Ga0070673_100211976
1063 Ga0070673_100284724
1064 Ga0070688_100001931
1065 Ga0070688_100017316
1066 Ga0070688_100123425
1067 Ga0070688_100162213
1068 Ga0070659_100002814
1069 Ga0070659_100021771
1070 Ga0070659_100070700
1071 Ga0070659_100071020
1072 Ga0070659_100146538
1073 Ga0070659_100162190
1074 Ga0070659_100177741
1075 Ga0070659_100322161
1076 Ga0070667_100000863
1077 Ga0070667_100002948
1078 Ga0070667_100101410
1079 Ga0070667_100104911
1080 Ga0070667_100106245
1081 Ga0070667_100107754
1082 Ga0070667_100168479
1083 Ga0070667_100277606
1084 Ga0070709_10037095
1085 Ga0070714_100003499
1086 Ga0070714_100394505
1087 Ga0070713_100000853
1088 Ga0070713_100006960
1089 Ga0070713_100016724
1090 Ga0070710_10021886
1091 Ga0070711_100010124
1092 Ga0070705_100027467
1093 Ga0070700_100005754
1094 Ga0070700_100072465
1095 Ga0070694_100071367
1096 Ga0070694_100116447
1097 Ga0070708_100120336
1098 Ga0070663_100039170
1099 Ga0070663_100114377
1100 Ga0070678_100000428
1101 Ga0070678_100024746
1102 Ga0070678_100037493
1103 Ga0070678_100292715
1104 Ga0070662_100012355
1105 Ga0070662_100014943
1106 Ga0070662_100040507
1107 Ga0070662_100156813
1108 Ga0070681_10003494
1109 Ga0070681_10007813
1110 Ga0070681_10022742
1111 Ga0070681_10157812
1112 Ga0070681_10270679
1113 Ga0068867_100003381
1114 Ga0068867_100011744
1115 Ga0068867_100017233
1116 Ga0068867_100139599
1117 Ga0070685_10141158
1118 Ga0070706_100009375
1119 Ga0070706_100018225
1120 Ga0070706_100022655
1121 Ga0070706_100079995
1122 Ga0070707_100015911
1123 Ga0070707_100039220
1124 Ga0070707_100044145
1125 Ga0070707_100130285
1126 Ga0070707_100138387
1127 Ga0070707_100175192
1128 Ga0070698_100043258
1129 Ga0070699_100020295
1130 Ga0070699_100328116
1131 Ga0070679_100033388
1132 Ga0070679_100049459
1133 Ga0070679_100315167
1134 Ga0070684_100013991
1135 Ga0070684_100140760
1136 Ga0070684_100166102
1137 Ga0070697_100066453
1138 Ga0070697_100129359
1139 Ga0070697_100178686
1140 Ga0068853_100031441
1141 Ga0068853_100045026
1142 Ga0068853_100051879
1143 Ga0068853_100126441
1144 Ga0070672_100004110
1145 Ga0070672_100011327
1146 Ga0070672_100145533
1147 Ga0070672_100186266
1148 Ga0070686_100089558
1149 Ga0070686_100096000
1150 Ga0070686_100099309
1151 Ga0070695_100013699
1152 Ga0070695_100030795
1153 Ga0070696_100005910
1154 Ga0070696_100032438
1155 Ga0070696_100063601
1156 Ga0070696_100160214
1157 Ga0070696_100163669
1158 Ga0070693_100000378
1159 Ga0070665_100003863
1160 Ga0070665_100005926
1161 Ga0070665_100030720
1162 Ga0070665_100073966
1163 Ga0070665_100308078
1164 Ga0070704_100015536
1165 Ga0068855_100038385
1166 Ga0068855_100039133
1167 Ga0068855_100050332
1168 Ga0068855_100059170
1169 Ga0068855_100106814
1170 Ga0068855_100194206
1171 Ga0068855_100201114
1172 Ga0068855_100438595
1173 Ga0070664_100005958
1174 Ga0070664_100009645
1175 Ga0070664_100022299
1176 Ga0070664_100032335
1177 Ga0070664_100037072
1178 Ga0070664_100117042
1179 Ga0070664_100206990
1180 Ga0070664_100323360
1181 Ga0068857_100018143
1182 Ga0068857_100019755
1183 Ga0068854_100006946
1184 Ga0068854_100015337
1185 Ga0068854_100024845
1186 Ga0068854_100069798
1187 Ga0068854_100184510
1188 Ga0068856_100002081
1189 Ga0068856_100003025
1190 Ga0068856_100006440
1191 Ga0068856_100010386
1192 Ga0068856_100050306
1193 Ga0068856_100051117
1194 Ga0070702_100030449
1195 Ga0070702_100046528
1196 Ga0070702_100098242
1197 Ga0068852_100002732
1198 Ga0068852_100003279
1199 Ga0068852_100019123
1200 Ga0068859_100000594
1201 Ga0068859_100002773
1202 Ga0068859_100015281
1203 Ga0068859_100116149
1204 Ga0068864_100001433
1205 Ga0068864_100002465
1206 Ga0068864_100007105
1207 Ga0068864_100017132
1208 Ga0068864_100018403
1209 Ga0068864_100083623
1210 Ga0068864_100133674
1211 Ga0068866_10016847
1212 Ga0068861_100000705
1213 Ga0068861_100020915
1214 Ga0068861_100271443
1215 Ga0068851_10001640
1216 Ga0068851_10037711
1217 Ga0068851_10100016
1218 Ga0068870_10038881
1219 Ga0068870_10058606
1220 Ga0068863_100002710
1221 Ga0068863_100004302
1222 Ga0068863_100008973
1223 Ga0068863_100015542
1224 Ga0068863_100212633
1225 Ga0068863_100216006
1226 Ga0068858_100006368
1227 Ga0068858_100031566
1228 Ga0068858_100042025
1229 Ga0068858_100072444
1230 Ga0068858_100182551
1231 Ga0068860_100024779
1232 Ga0068860_100036963
1233 Ga0068860_100053257
1234 Ga0068860_100065334
1235 Ga0068860_100077094
1236 Ga0068860_100093577
1237 Ga0068860_100206852
1238 Ga0068862_100005456
1239 Ga0068862_100055523
1240 Ga0068862_100183721
1241 Ga0081539_10042797
1242 Ga0075365_10032640
1243 Ga0075368_10005372
1244 Ga0070716_100032117
1245 Ga0070716_100060768
1246 Ga0070712_100059884
1247 Ga0070712_100096413
1248 Ga0075367_10002132
1249 Ga0075369_10000546
1250 Ga0075366_10010257
1251 Ga0075366_10029099
1252 Ga0097621_100013194
1253 Ga0097621_100056010
1254 Ga0097621_100117195
1255 Ga0097621_100133217
1256 Ga0097621_100138178
1257 Ga0068871_100004698
1258 Ga0068871_100071275
1259 Ga0068871_100084361
1260 Ga0068871_100142392
1261 Ga0068871_100258476
1262 Ga0068871_100258510
1263 Ga0075428_100002887
1264 Ga0075428_100267822
1265 Ga0075430_100134415
1266 Ga0075434_100000306
1267 Ga0075434_100030898
1268 Ga0075434_100088450
1269 Ga0075434_100174691
1270 Ga0075434_100321121
1271 Ga0075429_100033953
1272 Ga0068865_100061221
1273 Ga0068865_100079218
1274 Ga0068865_100130768
1275 Ga0068865_100162841
1276 Ga0075436_100152988
1277 Ga0097620_100000594
1278 Ga0097620_100002774
1279 Ga0097620_100015279
1280 Ga0097620_100116144
1281 Ga0075435_100039517
1282 Ga0075435_100040195
1283 Ga0075435_100148515
1284 Ga0099794_10122638
1285 Ga0105240_10018384
1286 Ga0105240_10020207
1287 Ga0105240_10028464
1288 Ga0111539_10000957
1289 Ga0111539_10039536
1290 Ga0111539_10057738
1291 Ga0111539_10060204
1292 Ga0105245_10010967
1293 Ga0105245_10032337
1294 Ga0105245_10050485
1295 Ga0105245_10335906
1296 Ga0105247_10007921
1297 Ga0114129_10232513
1298 Ga0114129_10240327
1299 Ga0114129_10444982
1300 Ga0114129_10726224
1301 Ga0105241_10220027
1302 Ga0105242_10024661
1303 Ga0105242_10213435
1304 Ga0105242_10309544
1305 Ga0105248_10001225
1306 Ga0105248_10135388
1307 Ga0105248_10265962
1308 Ga0105237_10105489
1309 Ga0105237_10220558
1310 Ga0105237_10252110
1311 Ga0105238_10008927
1312 Ga0105238_10039286
1313 Ga0105238_10196799
1314 Ga0105238_10303709
1315 Ga0105249_10066620
1316 Ga0105249_10092876
1317 Ga0105249_10231855
1318 Ga0105239_10070454
1319 Ga0105239_10113547
1320 Ga0105239_10152195
1321 Ga0105239_10527065
1322 Ga0105246_10040771
1323 Ga0157373_10001379
1324 Ga0157373_10015272
1325 Ga0157373_10019295
1326 Ga0157373_10189553
1327 Ga0157371_10005607
1328 Ga0157371_10106698
1329 Ga0157371_10179597
1330 Ga0157370_10002935
1331 Ga0157370_10013191
1332 Ga0157370_10014097
1333 Ga0157370_10020764
1334 Ga0157370_10032253
1335 Ga0157370_10056890
1336 Ga0157370_10143469
1337 Ga0157370_10266230
1338 Ga0157369_10005349
1339 Ga0157369_10040426
1340 Ga0157369_10213141
1341 Ga0157369_10461971
1342 Ga0157374_10000924
1343 Ga0157374_10005165
1344 Ga0157374_10021418
1345 Ga0157374_10080988
1346 Ga0157374_10179947
1347 Ga0157374_10184643
1348 Ga0157378_10004871
1349 Ga0157378_10052080
1350 Ga0157378_10191448
1351 Ga0157378_10208896
1352 Ga0157378_10379672
1353 Ga0163162_10004885
1354 Ga0163162_10041348
1355 Ga0163162_10059011
1356 Ga0163162_10115317
1357 Ga0163162_10136132
1358 Ga0157372_10001772
1359 Ga0157372_10015325
1360 Ga0157372_10018658
1361 Ga0157372_10139004
1362 Ga0157372_10194792
1363 Ga0157372_10349325
1364 Ga0157375_10004384
1365 Ga0157375_10106761
1366 Ga0157375_10385748
1367 Ga0157375_10455019
1368 Ga0163163_10229130
1369 Ga0163163_10229622
1370 Ga0157380_10085349
1371 Ga0157380_10095741
1372 Ga0157380_10399210
1373 Ga0157377_10009541
1374 Ga0157377_10251800
1375 Ga0157379_10001374
1376 Ga0157379_10011623
1377 Ga0157379_10012130
1378 Ga0157379_10017214
1379 Ga0157379_10059206
1380 Ga0157379_10093104
1381 Ga0157379_10115348
1382 Ga0157376_10021708
1383 Ga0157376_10028228
1384 Ga0157376_10047180
1385 Ga0157376_10273364
1386 Ga0163161_10053766
1387 Ga0163161_10057587
1388 Ga0163161_10091122
1389 Ga0163161_10120716
1390 Ga0206356_11461543
1391 Ga0206353_10236115
1392 Ga0213872_10000333
1393 Ga0213872_10002733
1394 Ga0213872_10004503
1395 Ga0207697_10001482
1396 Ga0207697_10007231
1397 Ga0207697_10020055
1398 Ga0207682_10000993
1399 Ga0207682_10001318
1400 Ga0207682_10007381
1401 Ga0207692_10041356
1402 Ga0207642_10008244
1403 Ga0207688_10006119
1404 Ga0207688_10041079
1405 Ga0207680_10004681
1406 Ga0207680_10078757
1407 Ga0207680_10142648
1408 Ga0207645_10000039
1409 Ga0207645_10000331
1410 Ga0207645_10007484
1411 Ga0207645_10020552
1412 Ga0207645_10059692
1413 Ga0207643_10001108
1414 Ga0207643_10003518
1415 Ga0207643_10111769
1416 Ga0207705_10114288
1417 Ga0207705_10128151
1418 Ga0207705_10190102
1419 Ga0207705_10190370
1420 Ga0207684_10046819
1421 Ga0207684_10102396
1422 Ga0207654_10060700
1423 Ga0207654_10145140
1424 Ga0207707_10008263
1425 Ga0207707_10046343
1426 Ga0207707_10058381
1427 Ga0207707_10069403
1428 Ga0207707_10139098
1429 Ga0207707_10144033
1430 Ga0207695_10074196
1431 Ga0207695_10167310
1432 Ga0207693_10000397
1433 Ga0207693_10027063
1434 Ga0207693_10091135
1435 Ga0207663_10028987
1436 Ga0207660_10022105
1437 Ga0207660_10095518
1438 Ga0207660_10176845
1439 Ga0207662_10065329
1440 Ga0207662_10096349
1441 Ga0207657_10000394
1442 Ga0207657_10001000
1443 Ga0207657_10014530
1444 Ga0207657_10032471
1445 Ga0207657_10119234
1446 Ga0207657_10125730
1447 Ga0207649_10006345
1448 Ga0207652_10009287
1449 Ga0207652_10018041
1450 Ga0207646_10018213
1451 Ga0207646_10037198
1452 Ga0207681_10002345
1453 Ga0207681_10011778
1454 Ga0207681_10049092
1455 Ga0207694_10014534
1456 Ga0207694_10021564
1457 Ga0207650_10001745
1458 Ga0207650_10026853
1459 Ga0207650_10034273
1460 Ga0207650_10044835
1461 Ga0207650_10056570
1462 Ga0207650_10057719
1463 Ga0207650_10061300
1464 Ga0207650_10274402
1465 Ga0207659_10014770
1466 Ga0207659_10026217
1467 Ga0207659_10084411
1468 Ga0207659_10161435
1469 Ga0207687_10000188
1470 Ga0207687_10007739
1471 Ga0207700_10000074
1472 Ga0207700_10010760
1473 Ga0207700_10029252
1474 Ga0207700_10037722
1475 Ga0207664_10001185
1476 Ga0207664_10049607
1477 Ga0207664_10072300
1478 Ga0207644_10003932
1479 Ga0207644_10008387
1480 Ga0207644_10011828
1481 Ga0207644_10038706
1482 Ga0207644_10143201
1483 Ga0207690_10017644
1484 Ga0207690_10158258
1485 Ga0207690_10265407
1486 Ga0207706_10000854
1487 Ga0207706_10002859
1488 Ga0207706_10007248
1489 Ga0207706_10015396
1490 Ga0207706_10048226
1491 Ga0207706_10184716
1492 Ga0207706_10294380
1493 Ga0207706_10332238
1494 Ga0207686_10000211
1495 Ga0207686_10149671
1496 Ga0207709_10031657
1497 Ga0207670_10129669
1498 Ga0207670_10136754
1499 Ga0207669_10002807
1500 Ga0207669_10055040
1501 Ga0207669_10111983
1502 Ga0207669_10186463
1503 Ga0207704_10019141
1504 Ga0207704_10064358
1505 Ga0207665_10054762
1506 Ga0207665_10126862
1507 Ga0207691_10000027
1508 Ga0207691_10000122
1509 Ga0207691_10000772
1510 Ga0207691_10100924
1511 Ga0207711_10000116
1512 Ga0207711_10036322
1513 Ga0207711_10138857
1514 Ga0207689_10000548
1515 Ga0207689_10001927
1516 Ga0207689_10006355
1517 Ga0207689_10008896
1518 Ga0207689_10040830
1519 Ga0207689_10085284
1520 Ga0207661_10010299
1521 Ga0207661_10178940
1522 Ga0207679_10015734
1523 Ga0207679_10078160
1524 Ga0207679_10251969
1525 Ga0207679_10268270
1526 Ga0207679_10279485
1527 Ga0207679_10324702
1528 Ga0207667_10002343
1529 Ga0207667_10094773
1530 Ga0207667_10204862
1531 Ga0207667_10214468
1532 Ga0207651_10044425
1533 Ga0207651_10161962
1534 Ga0207651_10329329
1535 Ga0207712_10085235
1536 Ga0207712_10192494
1537 Ga0207668_10002876
1538 Ga0207668_10005221
1539 Ga0207668_10018007
1540 Ga0207640_10008758
1541 Ga0207640_10049870
1542 Ga0207640_10072147
1543 Ga0207640_10182049
1544 Ga0207658_10012633
1545 Ga0207658_10013907
1546 Ga0207658_10013937
1547 Ga0207658_10019542
1548 Ga0207658_10071368
1549 Ga0207658_10181302
1550 Ga0207658_10437021
1551 Ga0207677_10000598
1552 Ga0207677_10018321
1553 Ga0207677_10036280
1554 Ga0207677_10058229
1555 Ga0207677_10065700
1556 Ga0207677_10072764
1557 Ga0207677_10231064
1558 Ga0207703_10000357
1559 Ga0207703_10000746
1560 Ga0207703_10024218
1561 Ga0207703_10043079
1562 Ga0207703_10128218
1563 Ga0207639_10009491
1564 Ga0207639_10029203
1565 Ga0207678_10007312
1566 Ga0207678_10011189
1567 Ga0207678_10015432
1568 Ga0207678_10082708
1569 Ga0207678_10207134
1570 Ga0207678_10208163
1571 Ga0207708_10004145
1572 Ga0207708_10007951
1573 Ga0207708_10234001
1574 Ga0207702_10003836
1575 Ga0207702_10014082
1576 Ga0207702_10029159
1577 Ga0207702_10045737
1578 Ga0207702_10049161
1579 Ga0207702_10088947
1580 Ga0207702_10146000
1581 Ga0207641_10007190
1582 Ga0207641_10009017
1583 Ga0207641_10072505
1584 Ga0207641_10125576
1585 Ga0207641_10304927
1586 Ga0207648_10000149
1587 Ga0207648_10007044
1588 Ga0207648_10014327
1589 Ga0207648_10014574
1590 Ga0207648_10017253
1591 Ga0207648_10019771
1592 Ga0207648_10023267
1593 Ga0207648_10048131
1594 Ga0207676_10000236
1595 Ga0207676_10006704
1596 Ga0207676_10012337
1597 Ga0207674_10000694
1598 Ga0207674_10001128
1599 Ga0207674_10006144
1600 Ga0207674_10022289
1601 Ga0207674_10022536
1602 Ga0207674_10026234
1603 Ga0207674_10210919
1604 Ga0207675_100000230
1605 Ga0207675_100000871
1606 Ga0207675_100002944
1607 Ga0207675_100004627
1608 Ga0207675_100030831
1609 Ga0207683_10000005
1610 Ga0207683_10000285
1611 Ga0207683_10000364
1612 Ga0207683_10004773
1613 Ga0207683_10006165
1614 Ga0207683_10015805
1615 Ga0207683_10084179
1616 Ga0207683_10321686
1617 Ga0207698_10001960
1618 Ga0207698_10021781
1619 Ga0207698_10025539
1620 Ga0207698_10341426
1621 Ga0209969_1000136
1622 Ga0209996_1002378
1623 Ga0210000_1000292
1624 Ga0209995_1011156
1625 Ga0209983_1002782
1626 Ga0209971_1007936
1627 Ga0209813_10001571
1628 Ga0209974_10000335
1629 Ga0209974_10002039
1630 Ga0209974_10007387
1631 Ga0209974_10040668
1632 Ga0207428_10011849
1633 Ga0207428_10098368
1634 Ga0268266_10008117
1635 Ga0268266_10034562
1636 Ga0268266_10213272
1637 Ga0268266_10402793
1638 Ga0268265_10005441
1639 Ga0268265_10018470
1640 Ga0268265_10047984
1641 Ga0268264_10002371
1642 Ga0268264_10013772
1643 Ga0268264_10039446
1644 Ga0268264_10044953
1645 Ga0265324_10000001
1646 Ga0265324_10004084
1647 Ga0265330_10011554
1648 Ga0265332_10083577
1649 Ga0265328_10000020
1650 Ga0265328_10003722
1651 Ga0265328_10009523
1652 Ga0265325_10000542
1653 Ga0265325_10039496
1654 Ga0265331_10000144
1655 Ga0265331_10004577
1656 Ga0265331_10012989
1657 Ga0265331_10021602
1658 Ga0265331_10028015
1659 Ga0265331_10038261
1660 Ga0265331_10062312
1661 Ga0265331_10065006
1662 Ga0265327_10000044
1663 Ga0265327_10000136
1664 Ga0265327_10000314
1665 Ga0265327_10000475
1666 Ga0265327_10000730
1667 Ga0265327_10001767
1668 Ga0265327_10006826
1669 Ga0265327_10008949
1670 Ga0265327_10013003
1671 Ga0265327_10015340
1672 Ga0265327_10071561
1673 Ga0265316_10016572
1674 Ga0265316_10224637
1675 Ga0307408_100002911
1676 Ga0307408_100057101
1677 Ga0307408_100106422
1678 Ga0316575_10000042
1679 Ga0316579_10003975
1680 Ga0316579_10010044
1681 Ga0265314_10007067
1682 Ga0265314_10111146
1683 Ga0265314_10157317
1684 Ga0316576_10048257
1685 Ga0316578_10010133
1686 Ga0307405_10003878
1687 Ga0307405_10017485
1688 Ga0316577_10003010
1689 Ga0307413_10001237
1690 Ga0307410_10009907
1691 Ga0307410_10014406
1692 Ga0307410_10137685
1693 Ga0307406_10004415
1694 Ga0307406_10034187
1695 Ga0307407_10064001
1696 Ga0307407_10112942
1697 Ga0307412_10028767
1698 Ga0307409_100029836
1699 Ga0307409_100117877
1700 Ga0307416_100035373
1701 Ga0307414_10261984
1702 Ga0307411_10000127
1703 Ga0307411_10042097
1704 Ga0307411_10358727
1705 Ga0307415_100003315
1706 Ga0316583_10008955
1707 Ga0316583_10030946
1708 Ga0316583_10048555
1709 Ga0316585_10016146
1710 Ga0316580_10018726
1711 Ga0316593_10030950
1712 Ga0316596_1002051
1713 Ga0373928_0014325
1714 Ga0373928_0052041
1715 Ga0373934_0000450
1716 Ga0373952_0002096
1717 Ga0373945_0042501
1718 Ga0373953_0004449
1719 Ga0373954_0000090
1720 Ga0373956_0004386
1721 Ga0373957_0004734
1722 Ga0373943_0009829
1723 Ga0373943_0038768
1724 Ga0373946_0113841
1725 Ga0316574_0001261
1726 Ga0316574_0004450
1727 Ga0316574_0033809
1728 Ga0373935_0023065
1729 Ga0373935_0256356
1730 Ga0373927_0019318
1731 Ga0373927_0030999
1732 Ga0373927_0117713
1733 Ga0373947_0038846
1734 Ga0373947_0312313
1735 Ga0373937_0031264
1736 Ga0373937_0040788
1737 Ga0373937_0125613
1738 Ga0373937_0132013
1739 Ga0373937_0168682
1740 Ga0316582_0009509
1741 Ga0316582_0055880
1742 Ga0316584_0002039
1743 Ga0316584_0004127
1744 Ga0373925_0216161
1745 Ga0373925_0395196
1746 Ga0395899_0214769
1747 Ga0395900_0099978
1748 Ga0395900_0395256
1749 Ga0395901_0040793
1750 Ga0400483_128908
1751 Ga0436361_0060436
1752 Ga0436361_0235627
1753 Ga0436361_0891393
1754 Ga0451807_0812292
1755 Ga0451853_2089945
1756 Ga0439441_001329
1757 Ga0439455_0050163
1758 Ga0451577_0000002
1759 Ga0451577_0000395
1760 Ga0451577_0001764
1761 Ga0451577_0137433
1762 Ga0451577_0178970
1763 Ga0451577_0192340
1764 Ga0451577_0369281
1765 Ga0453683_0000011
1766 Ga0453683_0003829
1767 Ga0453684_0000002
1768 Ga0453684_0000694
1769 Ga0453684_0001529
1770 Ga0453684_0002108
1771 Ga0453684_0013161
1772 Ga0453684_0034047
1773 Ga0453684_0303582
1774 Ga0451576_0000004
1775 Ga0451576_0000006
1776 Ga0451576_0001977
1777 Ga0451576_0002214
1778 Ga0451576_0002633
1779 Ga0451576_0006277
1780 Ga0451576_0018556
1781 Ga0451576_0069900
1782 Ga0451576_0082691
1783 Ga0451576_0138914
1784 Ga0466967_0480879
1785 Ga0495629_0072973
1786 Ga0495629_0122088
1787 Ga0495629_0373400
1788 Ga0495580_0046345
1789 Ga0495580_0142954
1790 Ga0495582_0018395
1791 Ga0495639_0029001
1792 Ga0495665_0031115
1793 Ga0495621_0004496
1794 Ga0495621_0029257
1795 Ga0495645_0179809
1796 Ga0495635_0003129
1797 Ga0495659_0008400
1798 Ga0495658_0227644
1799 Ga0495600_0013499
1800 Ga0495581_0009908
1801 Ga0495604_0086299
1802 Ga0495674_0121424
1803 Ga0495680_0027794
1804 Ga0495675_0145128
1805 Ga0495684_0052242
1806 Ga0496100_0049877
1807 Ga0496101_0009759
1808 Ga0496101_0156327
1809 Ga0496102_0013642
1810 Ga0496102_0095561
1811 Ga0496103_0037694
1812 Ga0496103_0122994
1813 Ga0496104_0035404
1814 Ga0496104_0266122
1815 Ga0496105_0010312
1816 Ga0496105_0020268
1817 Ga0496106_0037450
1818 Ga0496106_0044631
1819 Ga0496106_0100662
1820 Ga0496106_0197689
1821 Ga0496107_0037001
1822 Ga0496107_0059285
1823 Ga0496108_0001943
1824 Ga0496108_0028099
1825 Ga0496108_0061510
1826 Ga0496109_0007082
1827 Ga0496109_0021461
1828 Ga0496109_0087616
1829 Ga0496109_0116251
1830 Ga0496110_0041351
1831 Ga0496110_0110755
1832 Ga0496112_0000540
1833 Ga0496112_0019957
1834 Ga0496112_0130501
1835 Ga0496114_0065630
1836 Ga0496114_0081151
1837 Ga0496114_0086431
1838 Ga0496114_0100347
1839 Ga0496114_0341069
1840 Ga0496114_0363031
1841 Ga0501031_0006233
1842 Ga0501031_0009246
1843 Ga0501031_0066973
1844 Ga0501032_0000403
1845 Ga0501032_0007680
1846 Ga0501032_0051359
1847 Ga0501032_0072552
1848 Ga0501033_0000709
1849 Ga0501033_0001808
1850 Ga0501033_0016892
1851 Ga0501034_0000759
1852 Ga0501034_0008103
1853 Ga0501034_0077421
1854 Ga0501034_0080850
1855 Ga0501036_0000268
1856 Ga0501036_0001606
1857 Ga0501036_0219371
1858 Ga0501037_0023208
1859 Ga0501037_0102228
1860 Ga0501037_0142279
1861 Ga0501038_0000280
1862 Ga0501038_0001255
1863 Ga0501038_0004118
1864 Ga0501038_0019910
1865 Ga0501038_0047069
1866 Ga0501038_0076106
1867 Ga0501038_0279571
1868 Ga0501039_0030324
1869 Ga0501039_0084871
1870 Ga0501039_0167569
1871 Ga0501039_0272400
1872 Ga0501040_0001121
1873 Ga0501040_0050934
1874 Ga0501042_0125352
1875 Ga0501043_0001507
1876 Ga0501043_0003838
1877 Ga0501043_0020315
1878 Ga0501046_0008472
1879 Ga0501046_0141840
1880 Ga0501047_0002525
1881 Ga0501047_0017182
1882 Ga0501048_0006099
1883 Ga0501067_0005678
1884 Ga0501068_0013549
1885 Ga0501069_0087657
1886 Ga0501069_0105584
1887 Ga0501072_0007494
1888 Ga0501072_0105355
1889 Ga0501073_0006424
1890 Ga0501073_0061438
1891 Ga0501073_0113961
1892 Ga0501074_0039704
1893 Ga0501074_0128000
1894 Ga0501075_0042183
1895 Ga0501076_0014178
1896 Ga0501077_0027329
1897 Ga0501079_0001860
1898 Ga0501080_0003681
1899 Ga0501080_0019259
1900 Ga0501081_0016868
1901 Ga0501083_0068897
1902 Ga0501035_0000270
1903 Ga0501035_0004552
1904 Ga0501035_0007685
1905 Ga0501035_0068178
1906 Ga0501035_0111503
1907 Ga0501044_0000261
1908 Ga0501044_0000482
1909 Ga0501044_0004065
1910 Ga0501045_0000564
1911 Ga0501045_0030960
1912 nmdc:mga03683_10226_c1
1913 nmdc:mga03n38_981_c1
1914 nmdc:mga00v17_5571_c1
1915 nmdc:mga0yw44_172_c1
1916 nmdc:mga0k408_12910_c1
1917 nmdc:mga0k408_35783_c1
1918 nmdc:mga06z11_1401_c1
1919 nmdc:mga04h51_1093_c1
1920 nmdc:mga05p37_240457_c1
1921 nmdc:mga05p37_300622_c1
1922 nmdc:mga09592_30954_c1
1923 nmdc:mga08y16_128607_c1
1924 nmdc:mga08y16_27570_c1
1925 nmdc:mga08y16_71407_c1
1926 nmdc:mga08y16_84834_c1
1927 nmdc:mga0n895_111670_c1
1928 nmdc:mga0n895_17716_c1
1929 nmdc:mga0n895_185344_c1
1930 nmdc:mga0n895_255694_c1
1931 nmdc:mga0n895_432_c1
1932 nmdc:mga0rr50_1318_c1
1933 nmdc:mga0rr50_49968_c1
1934 nmdc:mga0rr50_5859_c1
1935 nmdc:mga0rr50_72129_c1
1936 nmdc:mga0rr50_97216_c1
1937 nmdc:mga08x19_60696_c1
1938 nmdc:mga0sz30_9987_c1
1939 Ga0495619_0010282
1940 Ga0500594_0004257
1941 Ga0500622_0000019
1942 Ga0501082_0034997
1943 Ga0501082_0045730
1944 Ga0530510_0080048
1945 2547372644
1946 2843691647
1947 2846037063
1948 2846040145
1949 2891637714
1950 2894514810
1951 2989396658
1952 8001524634

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01118

Semialdhyde_dh

Semialdehyde dehydrogenase, NAD binding domain

3

144

0.98

PF02774

Semialdhyde_dhC

Semialdehyde dehydrogenase, dimerisation domain

161

305

0.96

PF22698

Semialdhyde_dhC_1

Semialdehyde dehydrogenase, dimerisation domain

152

302

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cvo-assembly1.cif.gz_C crystal structure of putative n-acetyl-gamma-glutamyl-phosphate reductase (ak071544) from rice (oryza sativa) 0.9234 2 334
2cvo-assembly1.cif.gz_C crystal structure of putative n-acetyl-gamma-glutamyl-phosphate reductase (ak071544) from rice (oryza sativa) 0.9181 2 334
1xyg-assembly1.cif.gz_D x-ray structure of gene product from arabidopsis thaliana at2g19940 0.9093 2 334
8afv-assembly1.cif.gz_A daargc3 - engineered formyl phosphate reductase with 3 substitutions (s178v, g182v, l233i) 0.9061 3 327
8afu-assembly2.cif.gz_A-2 daargc - n-acetyl-gamma-glutamyl-phosphate reductase of denitrovibrio acetiphilus 0.9058 1 327
ID Description Score Start End Superfamily
af_Q2G1H4_146_311_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9063 139 302 3.30.360.10
af_Q2G1H4_146_311_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8908 139 302 3.30.360.10
2i3gB02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8907 138 302 3.30.360.10
af_I1KL32_193_359_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.887 138 302 3.30.360.10
2i3gB02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8857 138 302 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A5E6N168-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase (EC) (EC 1.2.1.38) 0.9866 233 334 GO:0003942
AF-A0A455UKX9-F1-model_v4 Uncharacterized protein 0.9843 228 334
AF-A0A455UKX9-F1-model_v4 Uncharacterized protein 0.9753 228 334
AF-A0A5E6N168-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase (EC) (EC 1.2.1.38) 0.9678 233 334 GO:0003942
AF-A0A849TEG7-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38) 0.9619 1 171 GO:0003942
GO:0006526
GO:0051287

Map