F487273

General Info

Members Datasets Scaffolds Average Seq Length
977 454 1954 321

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100281237|Ga0070708_1002812371
Length 371
Sequence MLTRLVLAALLAAAALAHAQTQNYPAKSIRIVLPLAEGGLDASSEQGSRLRDANVRESAAATWMIAQATISREQYPTRAIRIILPFAPGGGADIIARMLGQKMTDSWGQQVVVDNRAGASGNIGAEIVAKSAPDGYTLLITSSALAINPSVFRSVPYDLNRDFAPITQPGLLPNILVVHPSLPVKTVKDLIALARSQPGKLAYASAGXXXXTHLAAEMFKLLAGIDMVHVPYKGGGALISDLLGGQVALTFATLPSVMPYVKVGRLRAVAMTTTKRWPGLPAVPTIAESGFPGFEMSTWIGLLAPAGTPKDVIGKLHQEVVRILHLSDVRERFDGLGIEPVGDTPEQFAQYIKSELVKYAKVVKQSGARAE

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
59 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
86 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
87 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
93 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
94 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
95 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
96 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
100 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
101 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
102 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
103 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
108 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
109 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
114 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
132 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
137 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
138 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
142 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
144 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
147 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
150 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
152 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
155 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
215 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
217 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
219 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
222 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
223 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
224 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
225 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
226 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
227 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
228 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
229 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
230 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
231 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
232 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
233 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
234 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
235 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
236 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
237 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
238 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
239 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
240 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
241 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
242 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
243 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
244 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
245 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
246 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
247 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
248 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
249 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
250 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
251 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
252 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
253 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
254 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
255 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
256 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
257 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
258 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
259 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
260 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
261 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
262 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
263 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
264 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
265 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
266 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
267 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
268 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
269 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
270 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
271 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
272 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
273 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
274 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
275 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
276 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
277 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
278 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
279 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
280 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
281 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
282 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
283 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
284 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
285 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
286 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
287 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
288 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
289 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
290 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
291 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
292 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
293 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
294 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
295 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
296 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
297 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
298 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
299 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
300 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
301 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
302 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
303 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
304 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
305 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
306 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
307 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
308 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
309 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
310 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
311 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
312 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
313 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
314 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
315 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
316 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
317 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
318 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
319 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
320 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
321 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
322 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
323 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
324 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
325 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
326 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
327 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
328 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
329 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
330 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
331 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
332 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
333 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
334 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
335 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
336 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
337 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
338 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
339 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
340 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
341 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
342 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
343 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
344 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
345 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
346 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
347 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
348 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
349 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
350 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
351 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
352 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
353 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
354 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
355 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
356 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
357 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
358 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
359 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
360 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
361 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
362 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
363 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
364 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
365 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
366 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
367 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
368 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
369 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
370 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
371 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
372 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
373 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
374 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
375 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
376 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
377 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
378 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
379 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
380 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
381 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
382 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
383 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
384 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
385 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
386 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
387 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
388 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
389 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
390 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
393 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
397 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
398 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
399 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
400 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
401 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
402 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
404 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
405 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
406 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
407 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
408 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
409 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
410 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
411 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
412 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
413 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
414 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
415 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
416 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
417 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
418 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
419 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
420 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
421 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
422 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
423 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
424 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
425 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
426 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
427 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
428 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
429 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
430 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
431 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
432 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
433 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
434 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
435 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
436 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
437 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
438 2643221569 Achromobacter sp. Root565 Isolate Unclassified
439 2643221594 Achromobacter sp. Root170 Isolate Unclassified
440 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
441 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
442 2818991446 Variovorax sp. 1180 Isolate Unclassified
443 2855730933 Achromobacter sp. HZ28 Isolate Nodule
444 2855767633 Achromobacter sp. HZ34 Isolate Nodule
445 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
446 2858950400 Achromobacter sp. K91 Isolate Unclassified
447 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
448 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
449 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
450 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
451 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
452 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
453 2941479691
454 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.65
Metatranscriptomes 0
Isolates 2.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.59
Nodule 0.61
Rhizoplane 5.94
Rhizosphere 75.44
Stem 0
Stem Tuber 0
Unclassified 0.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100281237 3300005445 Bacteria 1566
2 JGI24743J22301_10023389 3300001991 Bacteria 1189
3 JGI24738J21930_10022534 3300002075 Bacteria 1302
4 JGI24749J21850_1012853 3300002076 Bacteria 1176
5 JGI25152J39213_1000010 3300002773 Bacteria 134529
6 JGI25150J39212_1000490 3300002774 Bacteria 16621
7 JGI25159J45721_1000381 3300002987 Bacteria 20524
8 JGI25151J46595_10000262 3300003187 Bacteria 61170
9 JGI25151J46595_10001355 3300003187 Bacteria 16973
10 JGI25151J46595_10002847 3300003187 Bacteria 9962
11 JGI25406J46586_10000542 3300003203 Bacteria 17685
12 JGI25153J46596_10002775 3300003215 Bacteria 9962
13 JGI25160J50197_1000583 3300003354 Bacteria 20524
14 JGI25161J50226_1000654 3300003374 Bacteria 13897
15 JGI25161J50226_1000922 3300003374 Bacteria 10544
16 Ga0055535_1000241 3300003761 Bacteria 57946
17 Ga0055542_1000126 3300003762 Bacteria 100388
18 Ga0055526_1001018 3300003771 Bacteria 20524
19 Ga0055526_1001146 3300003771 Bacteria 19207
20 Ga0055526_1005040 3300003771 Bacteria 7716
21 Ga0055526_1012011 3300003771 Bacteria 3828
22 Ga0055526_1019127 3300003771 Bacteria 2510
23 Ga0055537_1000873 3300003773 Bacteria 14427
24 Ga0055537_1001439 3300003773 Bacteria 9286
25 Ga0055524_1000248 3300003775 Bacteria 56071
26 Ga0055524_1000823 3300003775 Bacteria 20524
27 Ga0055536_1034912 3300003781 Bacteria 1264
28 Ga0055534_1000341 3300003784 Bacteria 30179
29 Ga0055534_1000531 3300003784 Bacteria 20524
30 Ga0055534_1000661 3300003784 Bacteria 17379
31 Ga0055528_1000865 3300003790 Bacteria 20524
32 Ga0055540_1015526 3300003792 Bacteria 2211
33 Ga0055540_1015703 3300003792 Bacteria 2188
34 Ga0055531_10004697 3300003794 Bacteria 8176
35 Ga0055543_1000539 3300004625 Bacteria 21302
36 Ga0065165_1001314 3300005262 Bacteria 27751
37 Ga0070676_10220100 3300005328 Bacteria 1253
38 Ga0070683_100018484 3300005329 Bacteria 6176
39 Ga0070690_100019584 3300005330 Bacteria 4111
40 Ga0070690_100056022 3300005330 Bacteria 2526
41 Ga0070690_100238515 3300005330 Bacteria 1281
42 Ga0070670_100042837 3300005331 Bacteria 3892
43 Ga0070670_100123402 3300005331 Bacteria 2235
44 Ga0070670_100277701 3300005331 Bacteria 1463
45 Ga0070677_10047287 3300005333 Bacteria 1724
46 Ga0068869_100017953 3300005334 Bacteria 4808
47 Ga0068869_100102400 3300005334 Bacteria 2167
48 Ga0068869_100192724 3300005334 Bacteria 1603
49 Ga0070666_10285834 3300005335 Bacteria 1173
50 Ga0070680_100011245 3300005336 Bacteria 6920
51 Ga0070680_100227620 3300005336 Bacteria 1574
52 Ga0070682_100046709 3300005337 Bacteria 2688
53 Ga0068868_100001010 3300005338 Bacteria 19254
54 Ga0068868_100139607 3300005338 Bacteria 1988
55 Ga0068868_100291653 3300005338 Bacteria 1383
56 Ga0070689_100008032 3300005340 Bacteria 7408
57 Ga0070689_100055638 3300005340 Bacteria 3066
58 Ga0070689_100114513 3300005340 Bacteria 2148
59 Ga0070689_100210663 3300005340 Bacteria 1590
60 Ga0070689_100230355 3300005340 Bacteria 1523
61 Ga0070687_100000472 3300005343 Bacteria 13540
62 Ga0070687_100079239 3300005343 Bacteria 1787
63 Ga0070692_10012681 3300005345 Bacteria 3911
64 Ga0070668_100019524 3300005347 Bacteria 5101
65 Ga0070668_100067479 3300005347 Bacteria 2779
66 Ga0070669_100073390 3300005353 Bacteria 2535
67 Ga0070669_100146514 3300005353 Bacteria 1825
68 Ga0070675_100045107 3300005354 Bacteria 3606
69 Ga0070675_100071179 3300005354 Bacteria 2884
70 Ga0070675_100081169 3300005354 Bacteria 2704
71 Ga0070671_100037790 3300005355 Bacteria 4006
72 Ga0070671_100084181 3300005355 Bacteria 2660
73 Ga0070671_100116982 3300005355 Bacteria 2241
74 Ga0070671_100167541 3300005355 Bacteria 1858
75 Ga0070674_100105194 3300005356 Bacteria 2063
76 Ga0070674_100127626 3300005356 Bacteria 1892
77 Ga0070673_100060127 3300005364 Bacteria 3010
78 Ga0070673_100163593 3300005364 Bacteria 1894
79 Ga0070673_100209369 3300005364 Bacteria 1683
80 Ga0070688_100007930 3300005365 Bacteria 5743
81 Ga0070688_100061466 3300005365 Bacteria 2375
82 Ga0070667_100041279 3300005367 Bacteria 3871
83 Ga0070667_100141322 3300005367 Bacteria 2108
84 Ga0070667_100165424 3300005367 Bacteria 1951
85 Ga0070667_100210054 3300005367 Bacteria 1730
86 Ga0070667_100345258 3300005367 Bacteria 1347
87 Ga0070714_100155983 3300005435 Bacteria 2061
88 Ga0070713_100000019 3300005436 Bacteria 110100
89 Ga0070713_100013794 3300005436 Bacteria 5980
90 Ga0070713_100067932 3300005436 Bacteria 3003
91 Ga0070710_10072573 3300005437 Bacteria 1988
92 Ga0070701_10010189 3300005438 Bacteria 4146
93 Ga0070705_100000043 3300005440 Bacteria 63978
94 Ga0070705_100090944 3300005440 Bacteria 1901
95 Ga0070705_100155137 3300005440 Bacteria 1524
96 Ga0070700_100003779 3300005441 Bacteria 7837
97 Ga0070700_100138422 3300005441 Bacteria 1651
98 Ga0070694_100006344 3300005444 Bacteria 7174
99 Ga0070694_100084540 3300005444 Bacteria 2214
100 Ga0070678_100014403 3300005456 Bacteria 4989
101 Ga0070662_100240262 3300005457 Bacteria 1452
102 Ga0070681_10000685 3300005458 Bacteria 28045
103 Ga0070681_10047234 3300005458 Bacteria 4303
104 Ga0068867_100000225 3300005459 Bacteria 37110
105 Ga0068867_100214314 3300005459 Bacteria 1549
106 Ga0070685_10015443 3300005466 Bacteria 4056
107 Ga0070706_100006414 3300005467 Bacteria 11119
108 Ga0070706_100292218 3300005467 Bacteria 1521
109 Ga0070707_100179645 3300005468 Bacteria 2063
110 Ga0070679_100050267 3300005530 Bacteria 4153
111 Ga0070684_100267382 3300005535 Bacteria 1565
112 Ga0070684_100351647 3300005535 Bacteria 1355
113 Ga0068853_100021309 3300005539 Bacteria 5402
114 Ga0068853_100038292 3300005539 Bacteria 4084
115 Ga0068853_100049105 3300005539 Bacteria 3625
116 Ga0070672_100033355 3300005543 Bacteria 3898
117 Ga0070672_100036428 3300005543 Bacteria 3748
118 Ga0070672_100230977 3300005543 Bacteria 1554
119 Ga0070686_100064113 3300005544 Bacteria 2382
120 Ga0070686_100098164 3300005544 Bacteria 1973
121 Ga0070686_100098988 3300005544 Bacteria 1966
122 Ga0070686_100112039 3300005544 Bacteria 1860
123 Ga0070686_100175083 3300005544 Bacteria 1520
124 Ga0070686_100201730 3300005544 Bacteria 1426
125 Ga0070695_100033205 3300005545 Bacteria 3228
126 Ga0070695_100055626 3300005545 Bacteria 2551
127 Ga0070696_100003112 3300005546 Bacteria 11038
128 Ga0070696_100020591 3300005546 Bacteria 4468
129 Ga0070693_100000016 3300005547 Bacteria 63019
130 Ga0070704_100000837 3300005549 Bacteria 15281
131 Ga0070704_100065286 3300005549 Bacteria 2619
132 Ga0070704_100072778 3300005549 Bacteria 2501
133 Ga0070704_100141823 3300005549 Bacteria 1877
134 Ga0068855_100012963 3300005563 Bacteria 10058
135 Ga0070664_100139169 3300005564 Bacteria 2136
136 Ga0070664_100311573 3300005564 Bacteria 1424
137 Ga0070664_100347762 3300005564 Bacteria 1348
138 Ga0068857_100464610 3300005577 Bacteria 1185
139 Ga0068856_100683449 3300005614 Bacteria 1047
140 Ga0070702_100000017 3300005615 Bacteria 47208
141 Ga0070702_100094968 3300005615 Bacteria 1816
142 Ga0070702_100161664 3300005615 Bacteria 1448
143 Ga0070702_100186014 3300005615 Bacteria 1363
144 Ga0068852_100016862 3300005616 Bacteria 5712
145 Ga0068852_100224587 3300005616 Bacteria 1787
146 Ga0068852_100334792 3300005616 Bacteria 1474
147 Ga0068852_100494472 3300005616 Bacteria 1217
148 Ga0068859_100018784 3300005617 Bacteria 6947
149 Ga0068859_100138373 3300005617 Bacteria 2509
150 Ga0068859_100163787 3300005617 Bacteria 2303
151 Ga0068864_100018789 3300005618 Bacteria 5777
152 Ga0068864_100029246 3300005618 Bacteria 4663
153 Ga0068864_100037951 3300005618 Bacteria 4112
154 Ga0068864_100088907 3300005618 Bacteria 2721
155 Ga0068864_100283198 3300005618 Bacteria 1548
156 Ga0068866_10016800 3300005718 Bacteria 3278
157 Ga0068861_100000496 3300005719 Bacteria 22901
158 Ga0068861_100019728 3300005719 Bacteria 4817
159 Ga0068861_100061114 3300005719 Bacteria 2890
160 Ga0068861_100267540 3300005719 Bacteria 1466
161 Ga0068861_100373273 3300005719 Bacteria 1258
162 Ga0068870_10003235 3300005840 Bacteria 6876
163 Ga0068870_10089499 3300005840 Bacteria 1718
164 Ga0068863_100145229 3300005841 Bacteria 2269
165 Ga0068863_100177149 3300005841 Bacteria 2046
166 Ga0068858_100001011 3300005842 Bacteria 28980
167 Ga0068858_100002315 3300005842 Bacteria 19249
168 Ga0068858_100107316 3300005842 Bacteria 2606
169 Ga0068858_100184476 3300005842 Bacteria 1971
170 Ga0068858_100291891 3300005842 Bacteria 1555
171 Ga0068858_100330901 3300005842 Bacteria 1457
172 Ga0068860_100017045 3300005843 Bacteria 7081
173 Ga0068860_100023020 3300005843 Bacteria 6025
174 Ga0068860_100074316 3300005843 Bacteria 3232
175 Ga0068860_100285616 3300005843 Bacteria 1613
176 Ga0068862_100119071 3300005844 Bacteria 2325
177 Ga0081455_10014492 3300005937 Bacteria 7723
178 Ga0081455_10028957 3300005937 Bacteria 5055
179 Ga0081455_10041286 3300005937 Bacteria 4059
180 Ga0081539_10000847 3300005985 Bacteria 58528
181 Ga0070717_10093279 3300006028 Bacteria 2545
182 Ga0075365_10045375 3300006038 Bacteria 2883
183 Ga0075365_10086763 3300006038 Bacteria 2127
184 Ga0075365_10157232 3300006038 Bacteria 1582
185 Ga0075363_100005216 3300006048 Bacteria 5756
186 Ga0075363_100063798 3300006048 Bacteria 1989
187 Ga0075364_10011199 3300006051 Bacteria 5445
188 Ga0075364_10032938 3300006051 Bacteria 3334
189 Ga0075364_10100238 3300006051 Bacteria 1928
190 Ga0075364_10115861 3300006051 Bacteria 1791
191 Ga0075364_10231932 3300006051 Bacteria 1253
192 Ga0070716_100084483 3300006173 Bacteria 1904
193 Ga0070716_100109793 3300006173 Bacteria 1707
194 Ga0070716_100208567 3300006173 Unclassified 1304
195 Ga0070712_100034989 3300006175 Bacteria 3407
196 Ga0075362_10024056 3300006177 Bacteria 2581
197 Ga0075362_10090042 3300006177 Bacteria 1423
198 Ga0075367_10070103 3300006178 Bacteria 2106
199 Ga0075367_10084814 3300006178 Bacteria 1921
200 Ga0075367_10108334 3300006178 Bacteria 1703
201 Ga0075369_10004234 3300006186 Bacteria 5287
202 Ga0075366_10001589 3300006195 Bacteria 11365
203 Ga0075366_10025588 3300006195 Bacteria 3449
204 Ga0075366_10095398 3300006195 Bacteria 1783
205 Ga0097621_100001049 3300006237 Bacteria 19393
206 Ga0097621_100007640 3300006237 Bacteria 7749
207 Ga0097621_100205373 3300006237 Bacteria 1712
208 Ga0068871_100004173 3300006358 Bacteria 10001
209 Ga0068871_100031226 3300006358 Bacteria 4199
210 Ga0068871_100152558 3300006358 Bacteria 1971
211 Ga0075428_100004582 3300006844 Bacteria 15289
212 Ga0075428_100013933 3300006844 Bacteria 8953
213 Ga0075428_100023614 3300006844 Bacteria 6807
214 Ga0075428_100028423 3300006844 Bacteria 6186
215 Ga0075430_100068042 3300006846 Bacteria 2988
216 Ga0075431_100004337 3300006847 Bacteria 13900
217 Ga0075431_100107621 3300006847 Bacteria 2877
218 Ga0075431_100216103 3300006847 Unclassified 1957
219 Ga0075431_100236014 3300006847 Bacteria 1862
220 Ga0075433_10001240 3300006852 Bacteria 18606
221 Ga0075433_10016219 3300006852 Bacteria 6129
222 Ga0075433_10069944 3300006852 Bacteria 3083
223 Ga0075433_10511373 3300006852 Bacteria 1057
224 Ga0075434_100000017 3300006871 Bacteria 74154
225 Ga0075434_100000549 3300006871 Bacteria 28671
226 Ga0075434_100005820 3300006871 Bacteria 11258
227 Ga0075434_100034296 3300006871 Bacteria 5011
228 Ga0075434_100037443 3300006871 Bacteria 4802
229 Ga0075434_100132341 3300006871 Bacteria 2514
230 Ga0075434_100390409 3300006871 Bacteria 1413
231 Ga0075429_100000506 3300006880 Bacteria 29418
232 Ga0075429_100007303 3300006880 Bacteria 9589
233 Ga0075429_100166865 3300006880 Bacteria 1929
234 Ga0068865_100016551 3300006881 Bacteria 4721
235 Ga0075436_100000896 3300006914 Bacteria 19786
236 Ga0075436_100001337 3300006914 Bacteria 16769
237 Ga0075436_100009262 3300006914 Bacteria 6737
238 Ga0075436_100015208 3300006914 Bacteria 5271
239 Ga0075436_100036090 3300006914 Bacteria 3411
240 Ga0075436_100130099 3300006914 Bacteria 1765
241 Ga0097620_100018783 3300006931 Bacteria 6947
242 Ga0097620_100138368 3300006931 Bacteria 2509
243 Ga0097620_100163771 3300006931 Bacteria 2303
244 Ga0099826_10000019 3300006948 Bacteria 188386
245 Ga0075435_100000241 3300007076 Bacteria 33718
246 Ga0075435_100001546 3300007076 Bacteria 14830
247 Ga0075435_100075757 3300007076 Bacteria 2756
248 Ga0075435_100119638 3300007076 Bacteria 2197
249 Ga0099795_10042805 3300007788 Bacteria 1618
250 Ga0105240_10007572 3300009093 Bacteria 15732
251 Ga0111539_10020771 3300009094 Bacteria 8083
252 Ga0111539_10026228 3300009094 Bacteria 7130
253 Ga0111539_10035923 3300009094 Bacteria 5998
254 Ga0111539_10048183 3300009094 Bacteria 5089
255 Ga0111539_10139578 3300009094 Bacteria 2838
256 Ga0111539_10669351 3300009094 Bacteria 1209
257 Ga0105245_10085899 3300009098 Bacteria 2885
258 Ga0105245_10102244 3300009098 Bacteria 2654
259 Ga0105245_10250114 3300009098 Bacteria 1722
260 Ga0105245_10798775 3300009098 Bacteria 981
261 Ga0105247_10012451 3300009101 Bacteria 5108
262 Ga0114129_10000534 3300009147 Bacteria 46594
263 Ga0114129_10001202 3300009147 Bacteria 34348
264 Ga0114129_10024407 3300009147 Bacteria 8567
265 Ga0114129_10042156 3300009147 Bacteria 6427
266 Ga0105243_10000743 3300009148 Bacteria 31200
267 Ga0105243_10036148 3300009148 Bacteria 3832
268 Ga0105243_10172997 3300009148 Bacteria 1872
269 Ga0105243_10188739 3300009148 Bacteria 1798
270 Ga0105243_10191090 3300009148 Bacteria 1788
271 Ga0105243_10201300 3300009148 Bacteria 1746
272 Ga0105241_10133962 3300009174 Bacteria 2009
273 Ga0105242_10337902 3300009176 Bacteria 1387
274 Ga0105248_10251964 3300009177 Bacteria 1987
275 Ga0105248_10300618 3300009177 Bacteria 1807
276 Ga0105248_10543404 3300009177 Bacteria 1311
277 Ga0105237_10405381 3300009545 Bacteria 1368
278 Ga0105238_10138160 3300009551 Bacteria 2414
279 Ga0105238_10476566 3300009551 Bacteria 1247
280 Ga0105249_10057924 3300009553 Bacteria 3550
281 Ga0105246_10123763 3300011119 Bacteria 1921
282 Ga0105246_10197654 3300011119 Bacteria 1561
283 Ga0157371_10109606 3300013102 Bacteria 1960
284 Ga0157374_10085143 3300013296 Bacteria 3005
285 Ga0157374_10102708 3300013296 Bacteria 2742
286 Ga0157374_10217492 3300013296 Bacteria 1874
287 Ga0157378_10046757 3300013297 Bacteria 3847
288 Ga0157378_10058354 3300013297 Bacteria 3442
289 Ga0157378_10285305 3300013297 Bacteria 1593
290 Ga0163162_10099076 3300013306 Bacteria 3005
291 Ga0163162_10387645 3300013306 Bacteria 1530
292 Ga0157372_10262757 3300013307 Bacteria 2004
293 Ga0157375_10471632 3300013308 Bacteria 1420
294 Ga0157375_10604962 3300013308 Bacteria 1255
295 Ga0163163_10027646 3300014325 Bacteria 5436
296 Ga0163163_10030887 3300014325 Bacteria 5165
297 Ga0163163_10051329 3300014325 Bacteria 4067
298 Ga0163163_10172110 3300014325 Bacteria 2212
299 Ga0163163_10251300 3300014325 Bacteria 1819
300 Ga0163163_10309182 3300014325 Bacteria 1633
301 Ga0157380_10069201 3300014326 Bacteria 2847
302 Ga0182008_10042415 3300014497 Bacteria 2266
303 Ga0157377_10007048 3300014745 Bacteria 5399
304 Ga0157377_10240015 3300014745 Bacteria 1169
305 Ga0157379_10006399 3300014968 Bacteria 10146
306 Ga0157379_10146350 3300014968 Bacteria 2131
307 Ga0157379_10239821 3300014968 Bacteria 1644
308 Ga0157376_10050117 3300014969 Bacteria 3462
309 Ga0163161_10088396 3300017792 Bacteria 2290
310 Ga0213876_10003512 3300021384 Bacteria 8949
311 Ga0213876_10004235 3300021384 Bacteria 8049
312 Ga0209436_101676 3300025208 Bacteria 7350
313 Ga0209672_100550 3300025228 Bacteria 20292
314 Ga0209147_100805 3300025229 Bacteria 15154
315 Ga0209258_100018 3300025242 Bacteria 567561
316 Ga0207425_1000057 3300025245 Bacteria 149738
317 Ga0209148_1000030 3300025254 Bacteria 567582
318 Ga0209129_1000030 3300025258 Bacteria 391958
319 Ga0209565_1000019 3300025263 Bacteria 438920
320 Ga0209565_1000255 3300025263 Bacteria 56576
321 Ga0209565_1018952 3300025263 Bacteria 1477
322 Ga0209673_1000155 3300025273 Bacteria 145667
323 Ga0209673_1009186 3300025273 Bacteria 4313
324 Ga0209130_1000011 3300025284 Bacteria 431723
325 Ga0209675_1000031 3300025291 Bacteria 273599
326 Ga0209675_1000457 3300025291 Bacteria 31374
327 Ga0209675_1000510 3300025291 Bacteria 28831
328 Ga0209675_1002115 3300025291 Bacteria 10517
329 Ga0209676_1004622 3300025292 Bacteria 7582
330 Ga0209676_1006264 3300025292 Bacteria 5921
331 Ga0209676_1009204 3300025292 Bacteria 4295
332 Ga0209025_1000057 3300025294 Bacteria 314601
333 Ga0209025_1000078 3300025294 Bacteria 271683
334 Ga0209025_1002582 3300025294 Bacteria 18768
335 Ga0209025_1028513 3300025294 Bacteria 2732
336 Ga0209564_1000056 3300025295 Bacteria 340873
337 Ga0209564_1000546 3300025295 Bacteria 60886
338 Ga0209564_1000600 3300025295 Bacteria 56188
339 Ga0209564_1002095 3300025295 Bacteria 17070
340 Ga0209758_1000037 3300025297 Bacteria 439101
341 Ga0209758_1019878 3300025297 Bacteria 3210
342 Ga0209050_1001259 3300025298 Bacteria 29240
343 Ga0209050_1007505 3300025298 Bacteria 6089
344 Ga0209256_1000043 3300025299 Bacteria 340873
345 Ga0209256_1000518 3300025299 Bacteria 56459
346 Ga0209256_1000661 3300025299 Bacteria 46620
347 Ga0207426_1000029 3300025302 Bacteria 473835
348 Ga0209051_1000804 3300025303 Bacteria 32919
349 Ga0209051_1006197 3300025303 Bacteria 6781
350 Ga0209257_1001647 3300025304 Bacteria 25488
351 Ga0207682_10068119 3300025893 Bacteria 1503
352 Ga0207682_10079540 3300025893 Bacteria 1402
353 Ga0207692_10113619 3300025898 Bacteria 1505
354 Ga0207642_10034515 3300025899 Bacteria 2152
355 Ga0207710_10032070 3300025900 Bacteria 2301
356 Ga0207688_10000077 3300025901 Bacteria 37350
357 Ga0207688_10009054 3300025901 Bacteria 5420
358 Ga0207688_10078236 3300025901 Bacteria 1885
359 Ga0207688_10116738 3300025901 Bacteria 1554
360 Ga0207680_10070700 3300025903 Bacteria 2161
361 Ga0207647_10014714 3300025904 Bacteria 5388
362 Ga0207647_10030672 3300025904 Bacteria 3466
363 Ga0207645_10012169 3300025907 Bacteria 5843
364 Ga0207645_10020137 3300025907 Bacteria 4368
365 Ga0207643_10060781 3300025908 Bacteria 2158
366 Ga0207643_10106289 3300025908 Bacteria 1650
367 Ga0207643_10124687 3300025908 Bacteria 1528
368 Ga0207684_10000788 3300025910 Bacteria 36846
369 Ga0207684_10252761 3300025910 Bacteria 1521
370 Ga0207707_10096778 3300025912 Bacteria 2579
371 Ga0207695_10016654 3300025913 Bacteria 8591
372 Ga0207671_10113150 3300025914 Bacteria 2067
373 Ga0207671_10417824 3300025914 Bacteria 1067
374 Ga0207693_10010472 3300025915 Bacteria 7525
375 Ga0207693_10015493 3300025915 Bacteria 6116
376 Ga0207663_10044643 3300025916 Bacteria 2722
377 Ga0207663_10316611 3300025916 Bacteria 1171
378 Ga0207660_10173589 3300025917 Bacteria 1670
379 Ga0207662_10002112 3300025918 Bacteria 9875
380 Ga0207662_10004898 3300025918 Bacteria 7082
381 Ga0207662_10027735 3300025918 Bacteria 3270
382 Ga0207662_10131049 3300025918 Bacteria 1581
383 Ga0207657_10158746 3300025919 Bacteria 1838
384 Ga0207657_10206919 3300025919 Bacteria 1576
385 Ga0207652_10035230 3300025921 Bacteria 4223
386 Ga0207646_10055525 3300025922 Bacteria 3541
387 Ga0207646_10063874 3300025922 Bacteria 3286
388 Ga0207681_10042080 3300025923 Bacteria 3049
389 Ga0207694_10124355 3300025924 Bacteria 2062
390 Ga0207650_10041764 3300025925 Bacteria 3362
391 Ga0207650_10085284 3300025925 Bacteria 2402
392 Ga0207650_10114738 3300025925 Bacteria 2090
393 Ga0207659_10011421 3300025926 Bacteria 5610
394 Ga0207659_10103002 3300025926 Bacteria 2156
395 Ga0207687_10071957 3300025927 Bacteria 2472
396 Ga0207687_10101226 3300025927 Bacteria 2121
397 Ga0207687_10152212 3300025927 Bacteria 1766
398 Ga0207700_10000035 3300025928 Bacteria 119648
399 Ga0207644_10051645 3300025931 Bacteria 2952
400 Ga0207644_10079951 3300025931 Bacteria 2413
401 Ga0207706_10001566 3300025933 Bacteria 22667
402 Ga0207706_10034208 3300025933 Bacteria 4521
403 Ga0207709_10000085 3300025935 Bacteria 160514
404 Ga0207709_10030284 3300025935 Bacteria 3147
405 Ga0207709_10170271 3300025935 Bacteria 1528
406 Ga0207709_10355480 3300025935 Bacteria 1107
407 Ga0207670_10019546 3300025936 Bacteria 4139
408 Ga0207670_10109838 3300025936 Bacteria 1985
409 Ga0207670_10111609 3300025936 Bacteria 1971
410 Ga0207670_10197380 3300025936 Bacteria 1526
411 Ga0207704_10006104 3300025938 Bacteria 5588
412 Ga0207704_10224899 3300025938 Bacteria 1391
413 Ga0207665_10088026 3300025939 Bacteria 2148
414 Ga0207665_10155183 3300025939 Bacteria 1642
415 Ga0207691_10019431 3300025940 Bacteria 6428
416 Ga0207691_10050211 3300025940 Bacteria 3820
417 Ga0207691_10104303 3300025940 Bacteria 2527
418 Ga0207711_10069681 3300025941 Bacteria 3049
419 Ga0207711_10118617 3300025941 Bacteria 2361
420 Ga0207689_10000079 3300025942 Bacteria 78891
421 Ga0207689_10093130 3300025942 Bacteria 2475
422 Ga0207689_10105965 3300025942 Bacteria 2309
423 Ga0207661_10247906 3300025944 Bacteria 1582
424 Ga0207679_10016937 3300025945 Bacteria 4847
425 Ga0207679_10062953 3300025945 Bacteria 2767
426 Ga0207679_10108065 3300025945 Bacteria 2190
427 Ga0207679_10317385 3300025945 Bacteria 1348
428 Ga0207667_10277003 3300025949 Bacteria 1715
429 Ga0207667_10284195 3300025949 Bacteria 1691
430 Ga0207651_10021125 3300025960 Bacteria 3948
431 Ga0207651_10143638 3300025960 Bacteria 1847
432 Ga0207651_10312147 3300025960 Bacteria 1311
433 Ga0207712_10075917 3300025961 Bacteria 2431
434 Ga0207668_10033345 3300025972 Bacteria 3410
435 Ga0207668_10075903 3300025972 Bacteria 2418
436 Ga0207668_10204983 3300025972 Bacteria 1573
437 Ga0207658_10079628 3300025986 Bacteria 2507
438 Ga0207658_10113890 3300025986 Bacteria 2144
439 Ga0207658_10133023 3300025986 Bacteria 2001
440 Ga0207677_10008782 3300026023 Bacteria 5661
441 Ga0207703_10015337 3300026035 Bacteria 5977
442 Ga0207703_10027651 3300026035 Bacteria 4466
443 Ga0207703_10077644 3300026035 Bacteria 2757
444 Ga0207703_10127140 3300026035 Bacteria 2196
445 Ga0207703_10199565 3300026035 Bacteria 1777
446 Ga0207639_10067489 3300026041 Bacteria 2783
447 Ga0207708_10000155 3300026075 Bacteria 54651
448 Ga0207708_10005791 3300026075 Bacteria 9136
449 Ga0207708_10181617 3300026075 Bacteria 1671
450 Ga0207702_10281415 3300026078 Bacteria 1573
451 Ga0207641_10011199 3300026088 Bacteria 7358
452 Ga0207648_10000018 3300026089 Bacteria 148157
453 Ga0207648_10000071 3300026089 Bacteria 95176
454 Ga0207648_10027150 3300026089 Bacteria 5084
455 Ga0207648_10063126 3300026089 Bacteria 3229
456 Ga0207648_10136026 3300026089 Bacteria 2165
457 Ga0207676_10009920 3300026095 Bacteria 6773
458 Ga0207676_10024356 3300026095 Bacteria 4478
459 Ga0207676_10078295 3300026095 Bacteria 2677
460 Ga0207676_10218588 3300026095 Bacteria 1695
461 Ga0207674_10241548 3300026116 Bacteria 1753
462 Ga0207675_100036493 3300026118 Bacteria 4585
463 Ga0207675_100047119 3300026118 Bacteria 4025
464 Ga0207675_100050720 3300026118 Bacteria 3872
465 Ga0207675_100065835 3300026118 Bacteria 3387
466 Ga0207675_100314024 3300026118 Bacteria 1529
467 Ga0207675_100372204 3300026118 Bacteria 1403
468 Ga0207683_10008847 3300026121 Bacteria 8590
469 Ga0207683_10017801 3300026121 Bacteria 6060
470 Ga0207698_10165456 3300026142 Bacteria 1940
471 Ga0207698_10228424 3300026142 Bacteria 1688
472 Ga0207698_10242347 3300026142 Bacteria 1644
473 Ga0207698_10370702 3300026142 Bacteria 1359
474 Ga0209371_1006207 3300027312 Bacteria 4491
475 Ga0209969_1010345 3300027360 Bacteria 1334
476 Ga0209179_1005804 3300027512 Bacteria 1953
477 Ga0209282_1000148 3300027666 Bacteria 41213
478 Ga0209971_1021659 3300027682 Bacteria 1529
479 Ga0209813_10019746 3300027866 Bacteria 1877
480 Ga0209974_10021683 3300027876 Bacteria 2129
481 Ga0207428_10000758 3300027907 Bacteria 36770
482 Ga0207428_10011171 3300027907 Bacteria 7964
483 Ga0207428_10066049 3300027907 Bacteria 2851
484 Ga0268265_10010174 3300028380 Bacteria 6348
485 Ga0268265_10045598 3300028380 Bacteria 3272
486 Ga0268265_10090411 3300028380 Bacteria 2445
487 Ga0268264_10004862 3300028381 Bacteria 11383
488 Ga0268264_10082221 3300028381 Bacteria 2755
489 Ga0268264_10222351 3300028381 Bacteria 1739
490 Ga0265334_10004160 3300028573 Bacteria 6480
491 Ga0265318_10010718 3300028577 Bacteria 3981
492 Ga0307515_10036166 3300028794 Bacteria 8000
493 Ga0307515_10044146 3300028794 Bacteria 6898
494 Ga0268256_1006209 3300030500 Bacteria 4491
495 Ga0307511_10000003 3300030521 Bacteria 193269
496 Ga0307511_10000291 3300030521 Bacteria 52887
497 Ga0307511_10004074 3300030521 Bacteria 14943
498 Ga0265330_10036161 3300031235 Bacteria 2201
499 Ga0265332_10000918 3300031238 Bacteria 17669
500 Ga0265328_10005428 3300031239 Bacteria 5458
501 Ga0265325_10001565 3300031241 Bacteria 15956
502 Ga0265340_10018193 3300031247 Bacteria 3627
503 Ga0265340_10019823 3300031247 Bacteria 3461
504 Ga0265339_10039003 3300031249 Bacteria 2646
505 Ga0265331_10013032 3300031250 Bacteria 4480
506 Ga0265327_10032700 3300031251 Bacteria 2908
507 Ga0265327_10033246 3300031251 Bacteria 2877
508 Ga0265327_10050585 3300031251 Bacteria 2173
509 Ga0265327_10079765 3300031251 Bacteria 1620
510 Ga0307513_10017907 3300031456 Bacteria 8482
511 Ga0307408_100032375 3300031548 Bacteria 3645
512 Ga0265314_10039949 3300031711 Bacteria 3373
513 Ga0265314_10158732 3300031711 Bacteria 1379
514 Ga0265342_10013002 3300031712 Bacteria 5611
515 Ga0265342_10038213 3300031712 Bacteria 2924
516 Ga0307405_10078016 3300031731 Bacteria 2154
517 Ga0307407_10156295 3300031903 Bacteria 1488
518 Ga0307412_10000837 3300031911 Bacteria 17678
519 Ga0307412_10096622 3300031911 Bacteria 2080
520 Ga0307412_10207387 3300031911 Bacteria 1493
521 Ga0307416_100061953 3300032002 Bacteria 3056
522 Ga0307416_100081311 3300032002 Bacteria 2739
523 Ga0307416_100309314 3300032002 Bacteria 1576
524 Ga0307411_10062082 3300032005 Bacteria 2491
525 Ga0307411_10120657 3300032005 Bacteria 1896
526 Ga0307507_10033219 3300033179 Bacteria 5361
527 Ga0307507_10170294 3300033179 Bacteria 1584
528 Ga0373948_0003025 3300034817 Bacteria 2546
529 Ga0373950_0010391 3300034818 Bacteria 1503
530 Ga0373959_0008868 3300034820 Bacteria 1722
531 Ga0373959_0020155 3300034820 Bacteria 1270
532 Ga0373926_0002597 3300035083 Bacteria 5737
533 Ga0373926_0023408 3300035083 Bacteria 2145
534 Ga0373928_0001062 3300035084 Bacteria 5431
535 Ga0373928_0008849 3300035084 Bacteria 1961
536 Ga0373929_0012240 3300035085 Unclassified 1628
537 Ga0373949_0003293 3300035090 Bacteria 3882
538 Ga0373949_0018958 3300035090 Unclassified 1563
539 Ga0373951_0011292 3300035091 Bacteria 2005
540 Ga0373951_0013523 3300035091 Unclassified 1835
541 Ga0373923_0000495 3300035111 Bacteria 9476
542 Ga0373923_0072545 3300035111 Bacteria 1481
543 Ga0373932_0001314 3300035112 Bacteria 6996
544 Ga0373932_0003182 3300035112 Bacteria 3991
545 Ga0373936_0002892 3300035113 Bacteria 6411
546 Ga0373936_0004697 3300035113 Bacteria 5162
547 Ga0373936_0010042 3300035113 Bacteria 3574
548 Ga0373936_0012815 3300035113 Bacteria 3195
549 Ga0373939_0012698 3300035114 Bacteria 2152
550 Ga0373939_0014135 3300035114 Bacteria 2066
551 Ga0373941_0001753 3300035115 Bacteria 4661
552 Ga0373941_0019039 3300035115 Bacteria 1905
553 Ga0373945_0012190 3300035116 Bacteria 2851
554 Ga0373953_0001502 3300035117 Bacteria 6766
555 Ga0373953_0002531 3300035117 Bacteria 5521
556 Ga0373954_0002119 3300035118 Bacteria 8234
557 Ga0373956_0007806 3300035119 Bacteria 4316
558 Ga0373960_0003865 3300035121 Bacteria 3410
559 Ga0373960_0009403 3300035121 Bacteria 2367
560 Ga0373943_0008697 3300035170 Bacteria 4552
561 Ga0373946_0006665 3300035171 Bacteria 4195
562 Ga0373946_0024813 3300035171 Bacteria 2353
563 Ga0373946_0027439 3300035171 Bacteria 2252
564 Ga0373955_0000114 3300035172 Bacteria 32465
565 Ga0373955_0183533 3300035172 Bacteria 1242
566 Ga0373942_0001366 3300035207 Bacteria 6305
567 Ga0373942_0006353 3300035207 Bacteria 2729
568 Ga0373961_0007738 3300035241 Bacteria 2603
569 Ga0373962_0008076 3300035242 Bacteria 2586
570 Ga0373962_0012009 3300035242 Bacteria 2178
571 Ga0373962_0057273 3300035242 Bacteria 1137
572 Ga0373962_0057477 3300035242 Bacteria 1135
573 Ga0373962_0059180 3300035242 Bacteria 1122
574 Ga0373924_0078273 3300035410 Bacteria 1403
575 Ga0373931_0000248 3300035691 Bacteria 22945
576 Ga0373931_0007632 3300035691 Bacteria 5100
577 Ga0373931_0021328 3300035691 Bacteria 3249
578 Ga0373931_0021482 3300035691 Bacteria 3239
579 Ga0373931_0051166 3300035691 Bacteria 2199
580 Ga0373931_0058671 3300035691 Bacteria 2068
581 Ga0373935_0000367 3300035692 Bacteria 23034
582 Ga0373935_0011448 3300035692 Bacteria 5325
583 Ga0373935_0038632 3300035692 Bacteria 2989
584 Ga0373935_0117403 3300035692 Bacteria 1773
585 Ga0373935_0178847 3300035692 Unclassified 1455
586 Ga0373927_0004943 3300035695 Bacteria 9248
587 Ga0373927_0016071 3300035695 Bacteria 4938
588 Ga0373927_0017712 3300035695 Bacteria 4686
589 Ga0373927_0018530 3300035695 Bacteria 4571
590 Ga0373927_0027947 3300035695 Bacteria 3681
591 Ga0373927_0042945 3300035695 Bacteria 2929
592 Ga0373933_0010246 3300035724 Bacteria 5135
593 Ga0373933_0099356 3300035724 Bacteria 1804
594 Ga0373947_0009271 3300035725 Bacteria 5655
595 Ga0373947_0017478 3300035725 Bacteria 4125
596 Ga0373947_0027599 3300035725 Bacteria 3323
597 Ga0373947_0193206 3300035725 Bacteria 1329
598 Ga0373937_0000079 3300036401 Bacteria 88626
599 Ga0373937_0098638 3300036401 Bacteria 2710
600 Ga0373937_0106150 3300036401 Bacteria 2611
601 Ga0373925_0000007 3300037068 Bacteria 257023
602 Ga0373925_0020792 3300037068 Bacteria 4782
603 Ga0373925_0023218 3300037068 Bacteria 4526
604 Ga0373925_0034905 3300037068 Bacteria 3708
605 Ga0373925_0384308 3300037068 Bacteria 1143
606 Ga0395899_0001158 3300037312 Bacteria 23306
607 Ga0395900_0156171 3300037418 Bacteria 2330
608 Ga0395900_0250587 3300037418 Bacteria 1772
609 Ga0395898_0005496 3300037466 Bacteria 13687
610 Ga0395898_0069032 3300037466 Bacteria 3420
611 Ga0395905_0139539 3300037471 Bacteria 2281
612 Ga0395905_0184678 3300037471 Bacteria 1957
613 Ga0395905_0236122 3300037471 Bacteria 1709
614 Ga0436365_1136772 3300039437 Bacteria 28283
615 Ga0436365_1284888 3300039437 Bacteria 16521
616 Ga0439436_0018312 3300041404 Bacteria 2094
617 Ga0450898_003691 3300042134 Bacteria 2212
618 Ga0439446_0031484 3300042156 Bacteria 1535
619 Ga0439435_0029294 3300042436 Bacteria 1485
620 Ga0451577_0178788 3300042876 Bacteria 1912
621 Ga0466963_0166135 3300044694 Bacteria 1537
622 Ga0466964_0078674 3300044706 Bacteria 1410
623 Ga0453684_0382226 3300044712 Bacteria 1581
624 Ga0466960_0003041 3300044901 Bacteria 6408
625 Ga0451576_0017934 3300045051 Bacteria 7770
626 Ga0451576_0018069 3300045051 Bacteria 7738
627 Ga0451576_0114121 3300045051 Bacteria 2812
628 Ga0451576_0119336 3300045051 Bacteria 2745
629 Ga0451576_0392362 3300045051 Bacteria 1455
630 Ga0466967_0007807 3300045976 Bacteria 7773
631 Ga0466967_0010524 3300045976 Bacteria 6946
632 Ga0466967_0376915 3300045976 Bacteria 1377
633 Ga0495592_0000254 3300046454 Bacteria 45710
634 Ga0495592_0054761 3300046454 Bacteria 2953
635 Ga0495592_0067041 3300046454 Bacteria 2624
636 Ga0495592_0107961 3300046454 Bacteria 1973
637 Ga0495603_0002597 3300046455 Bacteria 10664
638 Ga0495629_0004780 3300046459 Bacteria 10153
639 Ga0495629_0024258 3300046459 Bacteria 4319
640 Ga0495629_0157421 3300046459 Bacteria 1578
641 Ga0495629_0194134 3300046459 Bacteria 1404
642 Ga0495641_0025893 3300046461 Bacteria 2872
643 Ga0495641_0065905 3300046461 Bacteria 1630
644 Ga0495651_0000796 3300046462 Bacteria 24460
645 Ga0495651_0217757 3300046462 Bacteria 1324
646 Ga0495653_0000034 3300046463 Bacteria 131084
647 Ga0495653_0048552 3300046463 Bacteria 3275
648 Ga0495580_0004635 3300046472 Bacteria 11547
649 Ga0495580_0080896 3300046472 Bacteria 2264
650 Ga0495582_0008869 3300046473 Bacteria 5548
651 Ga0495582_0134511 3300046473 Bacteria 1398
652 Ga0495605_0005057 3300046474 Bacteria 7697
653 Ga0495639_0042446 3300046475 Bacteria 2051
654 Ga0495639_0047771 3300046475 Bacteria 1940
655 Ga0495662_0025763 3300046476 Bacteria 2840
656 Ga0495664_0000003 3300046477 Bacteria 551602
657 Ga0495664_0222677 3300046477 Bacteria 1142
658 Ga0495594_0020833 3300046499 Bacteria 3495
659 Ga0495594_0036814 3300046499 Bacteria 2670
660 Ga0495596_0001648 3300046500 Bacteria 12690
661 Ga0495607_0027444 3300046501 Bacteria 3520
662 Ga0495608_0000319 3300046511 Bacteria 33877
663 Ga0495608_0030250 3300046511 Bacteria 3667
664 Ga0495610_0002348 3300046512 Bacteria 15988
665 Ga0495616_0001459 3300046513 Bacteria 16445
666 Ga0495616_0006405 3300046513 Bacteria 7124
667 Ga0495618_0000018 3300046514 Bacteria 139407
668 Ga0495618_0042574 3300046514 Bacteria 2862
669 Ga0495628_0000001 3300046516 Bacteria 917742
670 Ga0495628_0043315 3300046516 Bacteria 3586
671 Ga0495628_0043898 3300046516 Bacteria 3558
672 Ga0495628_0128494 3300046516 Bacteria 1940
673 Ga0495630_0001309 3300046517 Bacteria 17126
674 Ga0495630_0003154 3300046517 Bacteria 11440
675 Ga0495631_0074624 3300046518 Bacteria 1464
676 Ga0495643_0000328 3300046522 Bacteria 65181
677 Ga0495643_0008336 3300046522 Bacteria 6574
678 Ga0495663_0017577 3300046525 Bacteria 2031
679 Ga0495666_0019454 3300046526 Bacteria 3369
680 Ga0495666_0045628 3300046526 Bacteria 2114
681 Ga0495642_0004946 3300046528 Bacteria 5139
682 Ga0495652_0000006 3300046529 Bacteria 459709
683 Ga0495652_0007326 3300046529 Bacteria 10175
684 Ga0495652_0219774 3300046529 Bacteria 1428
685 Ga0495652_0242698 3300046529 Bacteria 1339
686 Ga0495665_0035527 3300046531 Bacteria 2662
687 Ga0495640_0000002 3300046533 Bacteria 646434
688 Ga0495640_0038231 3300046533 Bacteria 3376
689 Ga0495640_0191522 3300046533 Bacteria 1300
690 Ga0495586_0012666 3300046535 Bacteria 4472
691 Ga0495586_0018239 3300046535 Bacteria 3736
692 Ga0495586_0144930 3300046535 Bacteria 1334
693 Ga0495587_0000001 3300046536 Bacteria 724132
694 Ga0495598_0026265 3300046537 Bacteria 1595
695 Ga0495598_0040998 3300046537 Bacteria 1353
696 Ga0495609_0003430 3300046538 Bacteria 9084
697 Ga0495609_0084838 3300046538 Bacteria 1382
698 Ga0495621_0008649 3300046539 Bacteria 3062
699 Ga0495621_0060168 3300046539 Bacteria 1377
700 Ga0495597_0028452 3300046542 Archaea 2558
701 Ga0495645_0000009 3300046543 Bacteria 239632
702 Ga0495645_0001560 3300046543 Bacteria 15521
703 Ga0495667_0000004 3300046559 Bacteria 295297
704 Ga0495656_0001315 3300046615 Bacteria 8082
705 Ga0495656_0085415 3300046615 Bacteria 1433
706 Ga0495668_0096430 3300046616 Unclassified 1618
707 Ga0495668_0123130 3300046616 Bacteria 1419
708 Ga0495634_0000014 3300046642 Bacteria 128091
709 Ga0495634_0019822 3300046642 Bacteria 4774
710 Ga0495634_0038522 3300046642 Bacteria 3259
711 Ga0495634_0103732 3300046642 Bacteria 1835
712 Ga0495635_0000001 3300046663 Bacteria 704901
713 Ga0495635_0336099 3300046663 Bacteria 1009
714 Ga0495661_0007293 3300046665 Bacteria 7709
715 Ga0495661_0175849 3300046665 Bacteria 1138
716 Ga0495661_0188946 3300046665 Bacteria 1086
717 Ga0495657_0000336 3300046675 Bacteria 43164
718 Ga0495657_0011703 3300046675 Bacteria 6544
719 Ga0495599_0000053 3300046678 Bacteria 80559
720 Ga0495599_0003895 3300046678 Bacteria 8780
721 Ga0495599_0174424 3300046678 Bacteria 1326
722 Ga0495623_0000091 3300046679 Bacteria 53677
723 Ga0495646_0000020 3300046680 Bacteria 117021
724 Ga0495646_0116993 3300046680 Bacteria 1512
725 Ga0495647_0000477 3300046681 Bacteria 11635
726 Ga0495647_0011475 3300046681 Bacteria 3037
727 Ga0495647_0069174 3300046681 Bacteria 1409
728 Ga0495658_0014860 3300046683 Bacteria 3985
729 Ga0495658_0119044 3300046683 Bacteria 1595
730 Ga0495613_0009581 3300046689 Bacteria 7196
731 Ga0495613_0132118 3300046689 Bacteria 1787
732 Ga0495613_0219694 3300046689 Bacteria 1334
733 Ga0495624_0081084 3300046690 Bacteria 2010
734 Ga0495670_0139606 3300046691 Bacteria 1267
735 Ga0495671_0019692 3300046692 Bacteria 3562
736 Ga0495649_0012031 3300046694 Bacteria 5054
737 Ga0495600_0000123 3300046809 Bacteria 43494
738 Ga0495600_0014825 3300046809 Bacteria 4916
739 Ga0495581_0111908 3300047315 Bacteria 1588
740 Ga0495604_0000008 3300047317 Bacteria 341160
741 Ga0495604_0121878 3300047317 Bacteria 1886
742 Ga0495636_0108300 3300047318 Bacteria 1221
743 Ga0495674_0000016 3300047319 Bacteria 216763
744 Ga0495674_0026636 3300047319 Bacteria 5290
745 Ga0495674_0092029 3300047319 Bacteria 2590
746 Ga0495674_0180261 3300047319 Bacteria 1759
747 Ga0495672_0013747 3300047320 Bacteria 5570
748 Ga0495672_0054522 3300047320 Bacteria 2336
749 Ga0495676_0007711 3300047321 Bacteria 9874
750 Ga0495676_0021776 3300047321 Bacteria 5590
751 Ga0495680_0024757 3300047322 Bacteria 4974
752 Ga0495680_0203478 3300047322 Bacteria 1419
753 Ga0495687_029483 3300047443 Bacteria 2538
754 Ga0495675_0014865 3300047444 Bacteria 4922
755 Ga0495675_0024425 3300047444 Bacteria 3852
756 Ga0495679_042683 3300047446 Bacteria 1398
757 Ga0495681_0114367 3300047470 Bacteria 1165
758 Ga0495684_0000002 3300047471 Bacteria 341216
759 Ga0495684_0028395 3300047471 Bacteria 4295
760 Ga0495684_0101229 3300047471 Bacteria 2178
761 Ga0495684_0329526 3300047471 Bacteria 1089
762 Ga0495593_0001468 3300047673 Bacteria 13846
763 Ga0495602_0000022 3300048088 Bacteria 163672
764 Ga0495602_0098310 3300048088 Bacteria 2409
765 Ga0495602_0103211 3300048088 Bacteria 2334
766 Ga0495602_0217112 3300048088 Bacteria 1446
767 Ga0495626_0000652 3300048091 Bacteria 33405
768 Ga0495626_0014553 3300048091 Bacteria 4053
769 Ga0496100_0088053 3300048903 Bacteria 2112
770 Ga0496100_0237526 3300048903 Bacteria 1343
771 Ga0496101_0004652 3300048904 Bacteria 8678
772 Ga0496101_0013711 3300048904 Bacteria 5436
773 Ga0496101_0072282 3300048904 Bacteria 2531
774 Ga0496102_0006819 3300048905 Bacteria 9746
775 Ga0496102_0019179 3300048905 Bacteria 6021
776 Ga0496102_0028178 3300048905 Bacteria 5017
777 Ga0496102_0621472 3300048905 Bacteria 1003
778 Ga0496103_0015056 3300048906 Bacteria 4598
779 Ga0496103_0020735 3300048906 Bacteria 3951
780 Ga0496103_0240574 3300048906 Bacteria 1164
781 Ga0496104_0000833 3300048907 Bacteria 26625
782 Ga0496104_0001498 3300048907 Bacteria 20143
783 Ga0496104_0014338 3300048907 Bacteria 7158
784 Ga0496105_0000355 3300048908 Bacteria 30230
785 Ga0496105_0006679 3300048908 Bacteria 8880
786 Ga0496105_0026794 3300048908 Bacteria 4705
787 Ga0496105_0045267 3300048908 Bacteria 3630
788 Ga0496105_0074093 3300048908 Bacteria 2812
789 Ga0496105_0084557 3300048908 Bacteria 2621
790 Ga0496106_0003706 3300048909 Bacteria 11402
791 Ga0496106_0050670 3300048909 Bacteria 3129
792 Ga0496106_0066422 3300048909 Bacteria 2747
793 Ga0496107_0017060 3300048910 Bacteria 5105
794 Ga0496107_0035525 3300048910 Bacteria 3572
795 Ga0496107_0071406 3300048910 Bacteria 2522
796 Ga0496108_0049181 3300048911 Bacteria 3526
797 Ga0496108_0109059 3300048911 Bacteria 2365
798 Ga0496109_0006773 3300048912 Bacteria 9650
799 Ga0496109_0014145 3300048912 Bacteria 6937
800 Ga0496109_0124796 3300048912 Bacteria 2400
801 Ga0496109_0184285 3300048912 Bacteria 1961
802 Ga0496109_0377269 3300048912 Bacteria 1340
803 Ga0496110_0006467 3300048913 Bacteria 9285
804 Ga0496110_0060655 3300048913 Bacteria 3337
805 Ga0496110_0151410 3300048913 Bacteria 2100
806 Ga0496110_0406882 3300048913 Bacteria 1240
807 Ga0496110_0492800 3300048913 Bacteria 1116
808 Ga0496111_0004396 3300048914 Bacteria 8901
809 Ga0496111_0014603 3300048914 Bacteria 5371
810 Ga0496111_0069916 3300048914 Bacteria 2553
811 Ga0496112_0001747 3300048915 Bacteria 17023
812 Ga0496112_0011575 3300048915 Bacteria 8064
813 Ga0496112_0015894 3300048915 Bacteria 7033
814 Ga0496112_0073985 3300048915 Bacteria 3368
815 Ga0496113_0000322 3300048916 Bacteria 22806
816 Ga0496113_0000645 3300048916 Bacteria 17565
817 Ga0496113_0086728 3300048916 Bacteria 2405
818 Ga0496114_0020754 3300048917 Bacteria 5333
819 Ga0496114_0021866 3300048917 Bacteria 5206
820 Ga0496114_0050710 3300048917 Bacteria 3455
821 Ga0496114_0137361 3300048917 Bacteria 2114
822 Ga0496114_0157570 3300048917 Bacteria 1972
823 Ga0496115_0003546 3300048918 Bacteria 11224
824 Ga0496115_0081022 3300048918 Bacteria 2643
825 Ga0496116_0001838 3300048919 Bacteria 22937
826 Ga0496117_0019813 3300048920 Bacteria 5511
827 Ga0496117_0213509 3300048920 Bacteria 1080
828 Ga0496118_0010842 3300048921 Bacteria 8975
829 Ga0496118_0016901 3300048921 Bacteria 6665
830 Ga0496119_0012107 3300048922 Bacteria 7045
831 Ga0496119_0210570 3300048922 Bacteria 1000
832 Ga0496120_0106325 3300048923 Bacteria 1473
833 Ga0496121_0000127 3300048924 Bacteria 168545
834 Ga0496121_0026802 3300048924 Bacteria 5415
835 Ga0496121_0032233 3300048924 Bacteria 4768
836 Ga0496122_0000601 3300048925 Bacteria 74140
837 Ga0496122_0076019 3300048925 Bacteria 2365
838 Ga0496122_0082403 3300048925 Bacteria 2234
839 Ga0496123_0001435 3300048926 Bacteria 33260
840 Ga0496123_0002704 3300048926 Bacteria 21311
841 Ga0496123_0035472 3300048926 Bacteria 3553
842 Ga0496124_0000346 3300048927 Bacteria 84852
843 Ga0496124_0090623 3300048927 Bacteria 2493
844 Ga0496124_0107594 3300048927 Bacteria 2249
845 Ga0496124_0165800 3300048927 Bacteria 1717
846 Ga0496124_0168399 3300048927 Bacteria 1700
847 Ga0496125_0000011 3300048928 Bacteria 655895
848 Ga0496125_0002692 3300048928 Bacteria 22621
849 Ga0496125_0022861 3300048928 Bacteria 5792
850 Ga0496125_0045932 3300048928 Bacteria 3670
851 Ga0496126_0010507 3300048929 Bacteria 9695
852 Ga0501299_011371 3300049522 Bacteria 1503
853 Ga0501033_0045454 3300049570 Bacteria 3268
854 Ga0501034_0146215 3300049571 Bacteria 2341
855 Ga0501037_0367392 3300049573 Bacteria 990
856 Ga0501039_0177799 3300049575 Bacteria 1673
857 Ga0501042_0117158 3300049578 Bacteria 1918
858 Ga0501042_0262798 3300049578 Bacteria 1246
859 Ga0501043_0036204 3300049579 Bacteria 3882
860 Ga0501043_0180118 3300049579 Bacteria 1647
861 Ga0501047_0006619 3300049581 Bacteria 10900
862 Ga0501067_0012561 3300049583 Bacteria 4700
863 Ga0501071_0257645 3300049587 Bacteria 1317
864 Ga0501076_0073575 3300049592 Bacteria 2736
865 Ga0501077_0028385 3300049593 Bacteria 3557
866 Ga0501079_0012449 3300049741 Bacteria 6492
867 Ga0501080_0066635 3300049742 Bacteria 3349
868 Ga0501035_0010453 3300049822 Bacteria 8602
869 Ga0501044_0004409 3300049823 Bacteria 15749
870 Ga0501044_0256039 3300049823 Bacteria 1690
871 nmdc:mga03683_28381_c1 3300050489 Bacteria 2225
872 nmdc:mga03683_31875_c1 3300050489 Unclassified 2117
873 nmdc:mga03683_7685_c1 3300050489 Bacteria 3754
874 nmdc:mga00v17_43570_c1 3300050491 Bacteria 2703
875 nmdc:mga00v17_97219_c1 3300050491 Bacteria 1856
876 nmdc:mga0yw44_11367_c1 3300050492 Bacteria 4590
877 nmdc:mga0yw44_175562_c1 3300050492 Bacteria 1408
878 nmdc:mga0yw44_190996_c1 3300050492 Bacteria 1351
879 nmdc:mga0yw44_21483_c1 3300050492 Bacteria 3601
880 nmdc:mga0yw44_296007_c1 3300050492 Bacteria 1084
881 nmdc:mga0k408_15449_c1 3300050493 Bacteria 4223
882 nmdc:mga0k408_83582_c1 3300050493 Bacteria 1872
883 nmdc:mga06z11_35069_c1 3300050494 Bacteria 2467
884 nmdc:mga06z11_35616_c1 3300050494 Bacteria 2452
885 nmdc:mga07m45_10183_c1 3300050496 Bacteria 4903
886 nmdc:mga05p37_453_c1 3300050507 Bacteria 44606
887 nmdc:mga05p37_5672_c1 3300050507 Bacteria 14675
888 nmdc:mga09592_2036_c1 3300050508 Bacteria 16307
889 nmdc:mga09592_2477_c1 3300050508 Bacteria 14910
890 nmdc:mga0qj67_102839_c1 3300050509 Bacteria 2304
891 nmdc:mga06r32_101596_c1 3300050510 Bacteria 2822
892 nmdc:mga06r32_268879_c1 3300050510 Bacteria 1692
893 nmdc:mga06r32_58494_c1 3300050510 Bacteria 3704
894 nmdc:mga08y16_10655_c1 3300050511 Bacteria 9649
895 nmdc:mga08y16_11404_c1 3300050511 Bacteria 9339
896 nmdc:mga08y16_13184_c1 3300050511 Bacteria 8694
897 nmdc:mga08y16_168649_c1 3300050511 Bacteria 2274
898 nmdc:mga08y16_30147_c1 3300050511 Bacteria 5710
899 nmdc:mga08y16_51079_c1 3300050511 Bacteria 4325
900 nmdc:mga08y16_532970_c1 3300050511 Bacteria 1190
901 nmdc:mga08y16_81141_c1 3300050511 Bacteria 3381
902 nmdc:mga0n895_151_c1 3300050512 Bacteria 42739
903 nmdc:mga0n895_16155_c1 3300050512 Bacteria 6842
904 nmdc:mga0n895_2741_c1 3300050512 Bacteria 13912
905 nmdc:mga0n895_276122_c1 3300050512 Bacteria 1704
906 nmdc:mga0n895_287519_c1 3300050512 Bacteria 1667
907 nmdc:mga0n895_80247_c1 3300050512 Bacteria 3250
908 nmdc:mga0rr50_104989_c1 3300050513 Bacteria 2227
909 nmdc:mga0rr50_1131_c1 3300050513 Bacteria 14513
910 nmdc:mga0rr50_147293_c1 3300050513 Bacteria 1899
911 nmdc:mga0rr50_2318_c1 3300050513 Bacteria 10677
912 nmdc:mga0rr50_262381_c1 3300050513 Bacteria 1437
913 nmdc:mga08x19_11499_c1 3300050514 Bacteria 5326
914 nmdc:mga08x19_125760_c1 3300050514 Bacteria 1721
915 nmdc:mga08x19_37114_c1 3300050514 Bacteria 3091
916 nmdc:mga08x19_3775_c1 3300050514 Bacteria 9016
917 nmdc:mga08x19_548_c1 3300050514 Bacteria 24677
918 nmdc:mga08x19_7499_c1 3300050514 Bacteria 6480
919 nmdc:mga0a205_1935_c1 3300050515 Bacteria 17991
920 nmdc:mga0a205_284_c1 3300050515 Bacteria 37182
921 nmdc:mga0a205_39962_c1 3300050515 Bacteria 4516
922 nmdc:mga0sz30_20660_c1 3300050516 Bacteria 2657
923 nmdc:mga0sz30_62920_c1 3300050516 Bacteria 1588
924 nmdc:mga0sz30_85365_c1 3300050516 Bacteria 1370
925 Ga0495601_0000001 3300053077 Bacteria 549454
926 Ga0495601_0011988 3300053077 Bacteria 5194
927 Ga0495601_0030384 3300053077 Bacteria 3354
928 Ga0495601_0037851 3300053077 Bacteria 3015
929 Ga0495601_0097252 3300053077 Bacteria 1899
930 Ga0495601_0247841 3300053077 Bacteria 1163
931 Ga0495612_0000003 3300053078 Bacteria 303629
932 Ga0495612_0102124 3300053078 Bacteria 1221
933 Ga0495612_0176068 3300053078 Bacteria 938
934 Ga0500610_0000022 3300053079 Bacteria 60344
935 Ga0495595_0000082 3300053084 Bacteria 45698
936 Ga0495595_0005771 3300053084 Bacteria 5012
937 Ga0495619_0000004 3300053085 Bacteria 500068
938 Ga0495619_0015254 3300053085 Bacteria 4859
939 Ga0495619_0071972 3300053085 Bacteria 2314
940 Ga0500644_0047593 3300053088 Bacteria 1455
941 Ga0500646_0002103 3300053090 Bacteria 5191
942 Ga0500646_0007545 3300053090 Bacteria 2782
943 Ga0500646_0007754 3300053090 Bacteria 2743
944 Ga0500651_0081671 3300053093 Bacteria 2001
945 Ga0500566_0181016 3300053094 Bacteria 1081
946 Ga0500555_015627 3300053103 Bacteria 2189
947 Ga0500658_0025225 3300053134 Bacteria 2284
948 Ga0500568_0018098 3300053139 Bacteria 3093
949 Ga0500568_0074291 3300053139 Bacteria 1297
950 Ga0500604_0002634 3300053151 Bacteria 4883
951 Ga0500604_0008950 3300053151 Bacteria 2662
952 Ga0500616_0002390 3300053153 Bacteria 15675
953 Ga0500552_000160 3300053733 Bacteria 5869
954 Ga0530510_0171579 3300061734 Bacteria 1607
955 2514042729 2513237165 Bacteria 6771773
956 2599905993 2599185292 Bacteria 6290804
957 2599906170 2599185292 Bacteria 6290804
958 2643859001 2643221569 Bacteria 6064337
959 2643861952 2643221569 Bacteria 6064337
960 2643981004 2643221594 Bacteria 5811388
961 2643981822 2643221594 Bacteria 5811388
962 2776265189 2775506901 Bacteria 9631051
963 2809031670 2808606395 Bacteria 6020352
964 2809033882 2808606395 Bacteria 6020352
965 2819600868 2818991446 Bacteria 7757362
966 2855732517 2855730933 Bacteria 7047938
967 2855769225 2855767633 Bacteria 7049357
968 2857546780 2857542790 Bacteria 5326616
969 2858956490 2858950400 Bacteria 6783797
970 2881414891 2881412998 Bacteria 6492157
971 2883577154 2883577096 Bacteria 4709178
972 2894023573 2894023352 Bacteria 5167372
973 2894773894 2894772417 Bacteria 5305674
974 2929201930 2929199973 Bacteria 7260745
975 2939635059 2939631187 Bacteria 6118131
976 2941482330
977 8055910918 8055909800 Bacteria 7278581
978 Ga0070708_100281237
979 JGI24743J22301_10023389
980 JGI24738J21930_10022534
981 JGI24749J21850_1012853
982 JGI25152J39213_1000010
983 JGI25150J39212_1000490
984 JGI25159J45721_1000381
985 JGI25151J46595_10000262
986 JGI25151J46595_10001355
987 JGI25151J46595_10002847
988 JGI25406J46586_10000542
989 JGI25153J46596_10002775
990 JGI25160J50197_1000583
991 JGI25161J50226_1000654
992 JGI25161J50226_1000922
993 Ga0055535_1000241
994 Ga0055542_1000126
995 Ga0055526_1001018
996 Ga0055526_1001146
997 Ga0055526_1005040
998 Ga0055526_1012011
999 Ga0055526_1019127
1000 Ga0055537_1000873
1001 Ga0055537_1001439
1002 Ga0055524_1000248
1003 Ga0055524_1000823
1004 Ga0055536_1034912
1005 Ga0055534_1000341
1006 Ga0055534_1000531
1007 Ga0055534_1000661
1008 Ga0055528_1000865
1009 Ga0055540_1015526
1010 Ga0055540_1015703
1011 Ga0055531_10004697
1012 Ga0055543_1000539
1013 Ga0065165_1001314
1014 Ga0070676_10220100
1015 Ga0070683_100018484
1016 Ga0070690_100019584
1017 Ga0070690_100056022
1018 Ga0070690_100238515
1019 Ga0070670_100042837
1020 Ga0070670_100123402
1021 Ga0070670_100277701
1022 Ga0070677_10047287
1023 Ga0068869_100017953
1024 Ga0068869_100102400
1025 Ga0068869_100192724
1026 Ga0070666_10285834
1027 Ga0070680_100011245
1028 Ga0070680_100227620
1029 Ga0070682_100046709
1030 Ga0068868_100001010
1031 Ga0068868_100139607
1032 Ga0068868_100291653
1033 Ga0070689_100008032
1034 Ga0070689_100055638
1035 Ga0070689_100114513
1036 Ga0070689_100210663
1037 Ga0070689_100230355
1038 Ga0070687_100000472
1039 Ga0070687_100079239
1040 Ga0070692_10012681
1041 Ga0070668_100019524
1042 Ga0070668_100067479
1043 Ga0070669_100073390
1044 Ga0070669_100146514
1045 Ga0070675_100045107
1046 Ga0070675_100071179
1047 Ga0070675_100081169
1048 Ga0070671_100037790
1049 Ga0070671_100084181
1050 Ga0070671_100116982
1051 Ga0070671_100167541
1052 Ga0070674_100105194
1053 Ga0070674_100127626
1054 Ga0070673_100060127
1055 Ga0070673_100163593
1056 Ga0070673_100209369
1057 Ga0070688_100007930
1058 Ga0070688_100061466
1059 Ga0070667_100041279
1060 Ga0070667_100141322
1061 Ga0070667_100165424
1062 Ga0070667_100210054
1063 Ga0070667_100345258
1064 Ga0070714_100155983
1065 Ga0070713_100000019
1066 Ga0070713_100013794
1067 Ga0070713_100067932
1068 Ga0070710_10072573
1069 Ga0070701_10010189
1070 Ga0070705_100000043
1071 Ga0070705_100090944
1072 Ga0070705_100155137
1073 Ga0070700_100003779
1074 Ga0070700_100138422
1075 Ga0070694_100006344
1076 Ga0070694_100084540
1077 Ga0070678_100014403
1078 Ga0070662_100240262
1079 Ga0070681_10000685
1080 Ga0070681_10047234
1081 Ga0068867_100000225
1082 Ga0068867_100214314
1083 Ga0070685_10015443
1084 Ga0070706_100006414
1085 Ga0070706_100292218
1086 Ga0070707_100179645
1087 Ga0070679_100050267
1088 Ga0070684_100267382
1089 Ga0070684_100351647
1090 Ga0068853_100021309
1091 Ga0068853_100038292
1092 Ga0068853_100049105
1093 Ga0070672_100033355
1094 Ga0070672_100036428
1095 Ga0070672_100230977
1096 Ga0070686_100064113
1097 Ga0070686_100098164
1098 Ga0070686_100098988
1099 Ga0070686_100112039
1100 Ga0070686_100175083
1101 Ga0070686_100201730
1102 Ga0070695_100033205
1103 Ga0070695_100055626
1104 Ga0070696_100003112
1105 Ga0070696_100020591
1106 Ga0070693_100000016
1107 Ga0070704_100000837
1108 Ga0070704_100065286
1109 Ga0070704_100072778
1110 Ga0070704_100141823
1111 Ga0068855_100012963
1112 Ga0070664_100139169
1113 Ga0070664_100311573
1114 Ga0070664_100347762
1115 Ga0068857_100464610
1116 Ga0068856_100683449
1117 Ga0070702_100000017
1118 Ga0070702_100094968
1119 Ga0070702_100161664
1120 Ga0070702_100186014
1121 Ga0068852_100016862
1122 Ga0068852_100224587
1123 Ga0068852_100334792
1124 Ga0068852_100494472
1125 Ga0068859_100018784
1126 Ga0068859_100138373
1127 Ga0068859_100163787
1128 Ga0068864_100018789
1129 Ga0068864_100029246
1130 Ga0068864_100037951
1131 Ga0068864_100088907
1132 Ga0068864_100283198
1133 Ga0068866_10016800
1134 Ga0068861_100000496
1135 Ga0068861_100019728
1136 Ga0068861_100061114
1137 Ga0068861_100267540
1138 Ga0068861_100373273
1139 Ga0068870_10003235
1140 Ga0068870_10089499
1141 Ga0068863_100145229
1142 Ga0068863_100177149
1143 Ga0068858_100001011
1144 Ga0068858_100002315
1145 Ga0068858_100107316
1146 Ga0068858_100184476
1147 Ga0068858_100291891
1148 Ga0068858_100330901
1149 Ga0068860_100017045
1150 Ga0068860_100023020
1151 Ga0068860_100074316
1152 Ga0068860_100285616
1153 Ga0068862_100119071
1154 Ga0081455_10014492
1155 Ga0081455_10028957
1156 Ga0081455_10041286
1157 Ga0081539_10000847
1158 Ga0070717_10093279
1159 Ga0075365_10045375
1160 Ga0075365_10086763
1161 Ga0075365_10157232
1162 Ga0075363_100005216
1163 Ga0075363_100063798
1164 Ga0075364_10011199
1165 Ga0075364_10032938
1166 Ga0075364_10100238
1167 Ga0075364_10115861
1168 Ga0075364_10231932
1169 Ga0070716_100084483
1170 Ga0070716_100109793
1171 Ga0070716_100208567
1172 Ga0070712_100034989
1173 Ga0075362_10024056
1174 Ga0075362_10090042
1175 Ga0075367_10070103
1176 Ga0075367_10084814
1177 Ga0075367_10108334
1178 Ga0075369_10004234
1179 Ga0075366_10001589
1180 Ga0075366_10025588
1181 Ga0075366_10095398
1182 Ga0097621_100001049
1183 Ga0097621_100007640
1184 Ga0097621_100205373
1185 Ga0068871_100004173
1186 Ga0068871_100031226
1187 Ga0068871_100152558
1188 Ga0075428_100004582
1189 Ga0075428_100013933
1190 Ga0075428_100023614
1191 Ga0075428_100028423
1192 Ga0075430_100068042
1193 Ga0075431_100004337
1194 Ga0075431_100107621
1195 Ga0075431_100216103
1196 Ga0075431_100236014
1197 Ga0075433_10001240
1198 Ga0075433_10016219
1199 Ga0075433_10069944
1200 Ga0075433_10511373
1201 Ga0075434_100000017
1202 Ga0075434_100000549
1203 Ga0075434_100005820
1204 Ga0075434_100034296
1205 Ga0075434_100037443
1206 Ga0075434_100132341
1207 Ga0075434_100390409
1208 Ga0075429_100000506
1209 Ga0075429_100007303
1210 Ga0075429_100166865
1211 Ga0068865_100016551
1212 Ga0075436_100000896
1213 Ga0075436_100001337
1214 Ga0075436_100009262
1215 Ga0075436_100015208
1216 Ga0075436_100036090
1217 Ga0075436_100130099
1218 Ga0097620_100018783
1219 Ga0097620_100138368
1220 Ga0097620_100163771
1221 Ga0099826_10000019
1222 Ga0075435_100000241
1223 Ga0075435_100001546
1224 Ga0075435_100075757
1225 Ga0075435_100119638
1226 Ga0099795_10042805
1227 Ga0105240_10007572
1228 Ga0111539_10020771
1229 Ga0111539_10026228
1230 Ga0111539_10035923
1231 Ga0111539_10048183
1232 Ga0111539_10139578
1233 Ga0111539_10669351
1234 Ga0105245_10085899
1235 Ga0105245_10102244
1236 Ga0105245_10250114
1237 Ga0105245_10798775
1238 Ga0105247_10012451
1239 Ga0114129_10000534
1240 Ga0114129_10001202
1241 Ga0114129_10024407
1242 Ga0114129_10042156
1243 Ga0105243_10000743
1244 Ga0105243_10036148
1245 Ga0105243_10172997
1246 Ga0105243_10188739
1247 Ga0105243_10191090
1248 Ga0105243_10201300
1249 Ga0105241_10133962
1250 Ga0105242_10337902
1251 Ga0105248_10251964
1252 Ga0105248_10300618
1253 Ga0105248_10543404
1254 Ga0105237_10405381
1255 Ga0105238_10138160
1256 Ga0105238_10476566
1257 Ga0105249_10057924
1258 Ga0105246_10123763
1259 Ga0105246_10197654
1260 Ga0157371_10109606
1261 Ga0157374_10085143
1262 Ga0157374_10102708
1263 Ga0157374_10217492
1264 Ga0157378_10046757
1265 Ga0157378_10058354
1266 Ga0157378_10285305
1267 Ga0163162_10099076
1268 Ga0163162_10387645
1269 Ga0157372_10262757
1270 Ga0157375_10471632
1271 Ga0157375_10604962
1272 Ga0163163_10027646
1273 Ga0163163_10030887
1274 Ga0163163_10051329
1275 Ga0163163_10172110
1276 Ga0163163_10251300
1277 Ga0163163_10309182
1278 Ga0157380_10069201
1279 Ga0182008_10042415
1280 Ga0157377_10007048
1281 Ga0157377_10240015
1282 Ga0157379_10006399
1283 Ga0157379_10146350
1284 Ga0157379_10239821
1285 Ga0157376_10050117
1286 Ga0163161_10088396
1287 Ga0213876_10003512
1288 Ga0213876_10004235
1289 Ga0209436_101676
1290 Ga0209672_100550
1291 Ga0209147_100805
1292 Ga0209258_100018
1293 Ga0207425_1000057
1294 Ga0209148_1000030
1295 Ga0209129_1000030
1296 Ga0209565_1000019
1297 Ga0209565_1000255
1298 Ga0209565_1018952
1299 Ga0209673_1000155
1300 Ga0209673_1009186
1301 Ga0209130_1000011
1302 Ga0209675_1000031
1303 Ga0209675_1000457
1304 Ga0209675_1000510
1305 Ga0209675_1002115
1306 Ga0209676_1004622
1307 Ga0209676_1006264
1308 Ga0209676_1009204
1309 Ga0209025_1000057
1310 Ga0209025_1000078
1311 Ga0209025_1002582
1312 Ga0209025_1028513
1313 Ga0209564_1000056
1314 Ga0209564_1000546
1315 Ga0209564_1000600
1316 Ga0209564_1002095
1317 Ga0209758_1000037
1318 Ga0209758_1019878
1319 Ga0209050_1001259
1320 Ga0209050_1007505
1321 Ga0209256_1000043
1322 Ga0209256_1000518
1323 Ga0209256_1000661
1324 Ga0207426_1000029
1325 Ga0209051_1000804
1326 Ga0209051_1006197
1327 Ga0209257_1001647
1328 Ga0207682_10068119
1329 Ga0207682_10079540
1330 Ga0207692_10113619
1331 Ga0207642_10034515
1332 Ga0207710_10032070
1333 Ga0207688_10000077
1334 Ga0207688_10009054
1335 Ga0207688_10078236
1336 Ga0207688_10116738
1337 Ga0207680_10070700
1338 Ga0207647_10014714
1339 Ga0207647_10030672
1340 Ga0207645_10012169
1341 Ga0207645_10020137
1342 Ga0207643_10060781
1343 Ga0207643_10106289
1344 Ga0207643_10124687
1345 Ga0207684_10000788
1346 Ga0207684_10252761
1347 Ga0207707_10096778
1348 Ga0207695_10016654
1349 Ga0207671_10113150
1350 Ga0207671_10417824
1351 Ga0207693_10010472
1352 Ga0207693_10015493
1353 Ga0207663_10044643
1354 Ga0207663_10316611
1355 Ga0207660_10173589
1356 Ga0207662_10002112
1357 Ga0207662_10004898
1358 Ga0207662_10027735
1359 Ga0207662_10131049
1360 Ga0207657_10158746
1361 Ga0207657_10206919
1362 Ga0207652_10035230
1363 Ga0207646_10055525
1364 Ga0207646_10063874
1365 Ga0207681_10042080
1366 Ga0207694_10124355
1367 Ga0207650_10041764
1368 Ga0207650_10085284
1369 Ga0207650_10114738
1370 Ga0207659_10011421
1371 Ga0207659_10103002
1372 Ga0207687_10071957
1373 Ga0207687_10101226
1374 Ga0207687_10152212
1375 Ga0207700_10000035
1376 Ga0207644_10051645
1377 Ga0207644_10079951
1378 Ga0207706_10001566
1379 Ga0207706_10034208
1380 Ga0207709_10000085
1381 Ga0207709_10030284
1382 Ga0207709_10170271
1383 Ga0207709_10355480
1384 Ga0207670_10019546
1385 Ga0207670_10109838
1386 Ga0207670_10111609
1387 Ga0207670_10197380
1388 Ga0207704_10006104
1389 Ga0207704_10224899
1390 Ga0207665_10088026
1391 Ga0207665_10155183
1392 Ga0207691_10019431
1393 Ga0207691_10050211
1394 Ga0207691_10104303
1395 Ga0207711_10069681
1396 Ga0207711_10118617
1397 Ga0207689_10000079
1398 Ga0207689_10093130
1399 Ga0207689_10105965
1400 Ga0207661_10247906
1401 Ga0207679_10016937
1402 Ga0207679_10062953
1403 Ga0207679_10108065
1404 Ga0207679_10317385
1405 Ga0207667_10277003
1406 Ga0207667_10284195
1407 Ga0207651_10021125
1408 Ga0207651_10143638
1409 Ga0207651_10312147
1410 Ga0207712_10075917
1411 Ga0207668_10033345
1412 Ga0207668_10075903
1413 Ga0207668_10204983
1414 Ga0207658_10079628
1415 Ga0207658_10113890
1416 Ga0207658_10133023
1417 Ga0207677_10008782
1418 Ga0207703_10015337
1419 Ga0207703_10027651
1420 Ga0207703_10077644
1421 Ga0207703_10127140
1422 Ga0207703_10199565
1423 Ga0207639_10067489
1424 Ga0207708_10000155
1425 Ga0207708_10005791
1426 Ga0207708_10181617
1427 Ga0207702_10281415
1428 Ga0207641_10011199
1429 Ga0207648_10000018
1430 Ga0207648_10000071
1431 Ga0207648_10027150
1432 Ga0207648_10063126
1433 Ga0207648_10136026
1434 Ga0207676_10009920
1435 Ga0207676_10024356
1436 Ga0207676_10078295
1437 Ga0207676_10218588
1438 Ga0207674_10241548
1439 Ga0207675_100036493
1440 Ga0207675_100047119
1441 Ga0207675_100050720
1442 Ga0207675_100065835
1443 Ga0207675_100314024
1444 Ga0207675_100372204
1445 Ga0207683_10008847
1446 Ga0207683_10017801
1447 Ga0207698_10165456
1448 Ga0207698_10228424
1449 Ga0207698_10242347
1450 Ga0207698_10370702
1451 Ga0209371_1006207
1452 Ga0209969_1010345
1453 Ga0209179_1005804
1454 Ga0209282_1000148
1455 Ga0209971_1021659
1456 Ga0209813_10019746
1457 Ga0209974_10021683
1458 Ga0207428_10000758
1459 Ga0207428_10011171
1460 Ga0207428_10066049
1461 Ga0268265_10010174
1462 Ga0268265_10045598
1463 Ga0268265_10090411
1464 Ga0268264_10004862
1465 Ga0268264_10082221
1466 Ga0268264_10222351
1467 Ga0265334_10004160
1468 Ga0265318_10010718
1469 Ga0307515_10036166
1470 Ga0307515_10044146
1471 Ga0268256_1006209
1472 Ga0307511_10000003
1473 Ga0307511_10000291
1474 Ga0307511_10004074
1475 Ga0265330_10036161
1476 Ga0265332_10000918
1477 Ga0265328_10005428
1478 Ga0265325_10001565
1479 Ga0265340_10018193
1480 Ga0265340_10019823
1481 Ga0265339_10039003
1482 Ga0265331_10013032
1483 Ga0265327_10032700
1484 Ga0265327_10033246
1485 Ga0265327_10050585
1486 Ga0265327_10079765
1487 Ga0307513_10017907
1488 Ga0307408_100032375
1489 Ga0265314_10039949
1490 Ga0265314_10158732
1491 Ga0265342_10013002
1492 Ga0265342_10038213
1493 Ga0307405_10078016
1494 Ga0307407_10156295
1495 Ga0307412_10000837
1496 Ga0307412_10096622
1497 Ga0307412_10207387
1498 Ga0307416_100061953
1499 Ga0307416_100081311
1500 Ga0307416_100309314
1501 Ga0307411_10062082
1502 Ga0307411_10120657
1503 Ga0307507_10033219
1504 Ga0307507_10170294
1505 Ga0373948_0003025
1506 Ga0373950_0010391
1507 Ga0373959_0008868
1508 Ga0373959_0020155
1509 Ga0373926_0002597
1510 Ga0373926_0023408
1511 Ga0373928_0001062
1512 Ga0373928_0008849
1513 Ga0373929_0012240
1514 Ga0373949_0003293
1515 Ga0373949_0018958
1516 Ga0373951_0011292
1517 Ga0373951_0013523
1518 Ga0373923_0000495
1519 Ga0373923_0072545
1520 Ga0373932_0001314
1521 Ga0373932_0003182
1522 Ga0373936_0002892
1523 Ga0373936_0004697
1524 Ga0373936_0010042
1525 Ga0373936_0012815
1526 Ga0373939_0012698
1527 Ga0373939_0014135
1528 Ga0373941_0001753
1529 Ga0373941_0019039
1530 Ga0373945_0012190
1531 Ga0373953_0001502
1532 Ga0373953_0002531
1533 Ga0373954_0002119
1534 Ga0373956_0007806
1535 Ga0373960_0003865
1536 Ga0373960_0009403
1537 Ga0373943_0008697
1538 Ga0373946_0006665
1539 Ga0373946_0024813
1540 Ga0373946_0027439
1541 Ga0373955_0000114
1542 Ga0373955_0183533
1543 Ga0373942_0001366
1544 Ga0373942_0006353
1545 Ga0373961_0007738
1546 Ga0373962_0008076
1547 Ga0373962_0012009
1548 Ga0373962_0057273
1549 Ga0373962_0057477
1550 Ga0373962_0059180
1551 Ga0373924_0078273
1552 Ga0373931_0000248
1553 Ga0373931_0007632
1554 Ga0373931_0021328
1555 Ga0373931_0021482
1556 Ga0373931_0051166
1557 Ga0373931_0058671
1558 Ga0373935_0000367
1559 Ga0373935_0011448
1560 Ga0373935_0038632
1561 Ga0373935_0117403
1562 Ga0373935_0178847
1563 Ga0373927_0004943
1564 Ga0373927_0016071
1565 Ga0373927_0017712
1566 Ga0373927_0018530
1567 Ga0373927_0027947
1568 Ga0373927_0042945
1569 Ga0373933_0010246
1570 Ga0373933_0099356
1571 Ga0373947_0009271
1572 Ga0373947_0017478
1573 Ga0373947_0027599
1574 Ga0373947_0193206
1575 Ga0373937_0000079
1576 Ga0373937_0098638
1577 Ga0373937_0106150
1578 Ga0373925_0000007
1579 Ga0373925_0020792
1580 Ga0373925_0023218
1581 Ga0373925_0034905
1582 Ga0373925_0384308
1583 Ga0395899_0001158
1584 Ga0395900_0156171
1585 Ga0395900_0250587
1586 Ga0395898_0005496
1587 Ga0395898_0069032
1588 Ga0395905_0139539
1589 Ga0395905_0184678
1590 Ga0395905_0236122
1591 Ga0436365_1136772
1592 Ga0436365_1284888
1593 Ga0439436_0018312
1594 Ga0450898_003691
1595 Ga0439446_0031484
1596 Ga0439435_0029294
1597 Ga0451577_0178788
1598 Ga0466963_0166135
1599 Ga0466964_0078674
1600 Ga0453684_0382226
1601 Ga0466960_0003041
1602 Ga0451576_0017934
1603 Ga0451576_0018069
1604 Ga0451576_0114121
1605 Ga0451576_0119336
1606 Ga0451576_0392362
1607 Ga0466967_0007807
1608 Ga0466967_0010524
1609 Ga0466967_0376915
1610 Ga0495592_0000254
1611 Ga0495592_0054761
1612 Ga0495592_0067041
1613 Ga0495592_0107961
1614 Ga0495603_0002597
1615 Ga0495629_0004780
1616 Ga0495629_0024258
1617 Ga0495629_0157421
1618 Ga0495629_0194134
1619 Ga0495641_0025893
1620 Ga0495641_0065905
1621 Ga0495651_0000796
1622 Ga0495651_0217757
1623 Ga0495653_0000034
1624 Ga0495653_0048552
1625 Ga0495580_0004635
1626 Ga0495580_0080896
1627 Ga0495582_0008869
1628 Ga0495582_0134511
1629 Ga0495605_0005057
1630 Ga0495639_0042446
1631 Ga0495639_0047771
1632 Ga0495662_0025763
1633 Ga0495664_0000003
1634 Ga0495664_0222677
1635 Ga0495594_0020833
1636 Ga0495594_0036814
1637 Ga0495596_0001648
1638 Ga0495607_0027444
1639 Ga0495608_0000319
1640 Ga0495608_0030250
1641 Ga0495610_0002348
1642 Ga0495616_0001459
1643 Ga0495616_0006405
1644 Ga0495618_0000018
1645 Ga0495618_0042574
1646 Ga0495628_0000001
1647 Ga0495628_0043315
1648 Ga0495628_0043898
1649 Ga0495628_0128494
1650 Ga0495630_0001309
1651 Ga0495630_0003154
1652 Ga0495631_0074624
1653 Ga0495643_0000328
1654 Ga0495643_0008336
1655 Ga0495663_0017577
1656 Ga0495666_0019454
1657 Ga0495666_0045628
1658 Ga0495642_0004946
1659 Ga0495652_0000006
1660 Ga0495652_0007326
1661 Ga0495652_0219774
1662 Ga0495652_0242698
1663 Ga0495665_0035527
1664 Ga0495640_0000002
1665 Ga0495640_0038231
1666 Ga0495640_0191522
1667 Ga0495586_0012666
1668 Ga0495586_0018239
1669 Ga0495586_0144930
1670 Ga0495587_0000001
1671 Ga0495598_0026265
1672 Ga0495598_0040998
1673 Ga0495609_0003430
1674 Ga0495609_0084838
1675 Ga0495621_0008649
1676 Ga0495621_0060168
1677 Ga0495597_0028452
1678 Ga0495645_0000009
1679 Ga0495645_0001560
1680 Ga0495667_0000004
1681 Ga0495656_0001315
1682 Ga0495656_0085415
1683 Ga0495668_0096430
1684 Ga0495668_0123130
1685 Ga0495634_0000014
1686 Ga0495634_0019822
1687 Ga0495634_0038522
1688 Ga0495634_0103732
1689 Ga0495635_0000001
1690 Ga0495635_0336099
1691 Ga0495661_0007293
1692 Ga0495661_0175849
1693 Ga0495661_0188946
1694 Ga0495657_0000336
1695 Ga0495657_0011703
1696 Ga0495599_0000053
1697 Ga0495599_0003895
1698 Ga0495599_0174424
1699 Ga0495623_0000091
1700 Ga0495646_0000020
1701 Ga0495646_0116993
1702 Ga0495647_0000477
1703 Ga0495647_0011475
1704 Ga0495647_0069174
1705 Ga0495658_0014860
1706 Ga0495658_0119044
1707 Ga0495613_0009581
1708 Ga0495613_0132118
1709 Ga0495613_0219694
1710 Ga0495624_0081084
1711 Ga0495670_0139606
1712 Ga0495671_0019692
1713 Ga0495649_0012031
1714 Ga0495600_0000123
1715 Ga0495600_0014825
1716 Ga0495581_0111908
1717 Ga0495604_0000008
1718 Ga0495604_0121878
1719 Ga0495636_0108300
1720 Ga0495674_0000016
1721 Ga0495674_0026636
1722 Ga0495674_0092029
1723 Ga0495674_0180261
1724 Ga0495672_0013747
1725 Ga0495672_0054522
1726 Ga0495676_0007711
1727 Ga0495676_0021776
1728 Ga0495680_0024757
1729 Ga0495680_0203478
1730 Ga0495687_029483
1731 Ga0495675_0014865
1732 Ga0495675_0024425
1733 Ga0495679_042683
1734 Ga0495681_0114367
1735 Ga0495684_0000002
1736 Ga0495684_0028395
1737 Ga0495684_0101229
1738 Ga0495684_0329526
1739 Ga0495593_0001468
1740 Ga0495602_0000022
1741 Ga0495602_0098310
1742 Ga0495602_0103211
1743 Ga0495602_0217112
1744 Ga0495626_0000652
1745 Ga0495626_0014553
1746 Ga0496100_0088053
1747 Ga0496100_0237526
1748 Ga0496101_0004652
1749 Ga0496101_0013711
1750 Ga0496101_0072282
1751 Ga0496102_0006819
1752 Ga0496102_0019179
1753 Ga0496102_0028178
1754 Ga0496102_0621472
1755 Ga0496103_0015056
1756 Ga0496103_0020735
1757 Ga0496103_0240574
1758 Ga0496104_0000833
1759 Ga0496104_0001498
1760 Ga0496104_0014338
1761 Ga0496105_0000355
1762 Ga0496105_0006679
1763 Ga0496105_0026794
1764 Ga0496105_0045267
1765 Ga0496105_0074093
1766 Ga0496105_0084557
1767 Ga0496106_0003706
1768 Ga0496106_0050670
1769 Ga0496106_0066422
1770 Ga0496107_0017060
1771 Ga0496107_0035525
1772 Ga0496107_0071406
1773 Ga0496108_0049181
1774 Ga0496108_0109059
1775 Ga0496109_0006773
1776 Ga0496109_0014145
1777 Ga0496109_0124796
1778 Ga0496109_0184285
1779 Ga0496109_0377269
1780 Ga0496110_0006467
1781 Ga0496110_0060655
1782 Ga0496110_0151410
1783 Ga0496110_0406882
1784 Ga0496110_0492800
1785 Ga0496111_0004396
1786 Ga0496111_0014603
1787 Ga0496111_0069916
1788 Ga0496112_0001747
1789 Ga0496112_0011575
1790 Ga0496112_0015894
1791 Ga0496112_0073985
1792 Ga0496113_0000322
1793 Ga0496113_0000645
1794 Ga0496113_0086728
1795 Ga0496114_0020754
1796 Ga0496114_0021866
1797 Ga0496114_0050710
1798 Ga0496114_0137361
1799 Ga0496114_0157570
1800 Ga0496115_0003546
1801 Ga0496115_0081022
1802 Ga0496116_0001838
1803 Ga0496117_0019813
1804 Ga0496117_0213509
1805 Ga0496118_0010842
1806 Ga0496118_0016901
1807 Ga0496119_0012107
1808 Ga0496119_0210570
1809 Ga0496120_0106325
1810 Ga0496121_0000127
1811 Ga0496121_0026802
1812 Ga0496121_0032233
1813 Ga0496122_0000601
1814 Ga0496122_0076019
1815 Ga0496122_0082403
1816 Ga0496123_0001435
1817 Ga0496123_0002704
1818 Ga0496123_0035472
1819 Ga0496124_0000346
1820 Ga0496124_0090623
1821 Ga0496124_0107594
1822 Ga0496124_0165800
1823 Ga0496124_0168399
1824 Ga0496125_0000011
1825 Ga0496125_0002692
1826 Ga0496125_0022861
1827 Ga0496125_0045932
1828 Ga0496126_0010507
1829 Ga0501299_011371
1830 Ga0501033_0045454
1831 Ga0501034_0146215
1832 Ga0501037_0367392
1833 Ga0501039_0177799
1834 Ga0501042_0117158
1835 Ga0501042_0262798
1836 Ga0501043_0036204
1837 Ga0501043_0180118
1838 Ga0501047_0006619
1839 Ga0501067_0012561
1840 Ga0501071_0257645
1841 Ga0501076_0073575
1842 Ga0501077_0028385
1843 Ga0501079_0012449
1844 Ga0501080_0066635
1845 Ga0501035_0010453
1846 Ga0501044_0004409
1847 Ga0501044_0256039
1848 nmdc:mga03683_28381_c1
1849 nmdc:mga03683_31875_c1
1850 nmdc:mga03683_7685_c1
1851 nmdc:mga00v17_43570_c1
1852 nmdc:mga00v17_97219_c1
1853 nmdc:mga0yw44_11367_c1
1854 nmdc:mga0yw44_175562_c1
1855 nmdc:mga0yw44_190996_c1
1856 nmdc:mga0yw44_21483_c1
1857 nmdc:mga0yw44_296007_c1
1858 nmdc:mga0k408_15449_c1
1859 nmdc:mga0k408_83582_c1
1860 nmdc:mga06z11_35069_c1
1861 nmdc:mga06z11_35616_c1
1862 nmdc:mga07m45_10183_c1
1863 nmdc:mga05p37_453_c1
1864 nmdc:mga05p37_5672_c1
1865 nmdc:mga09592_2036_c1
1866 nmdc:mga09592_2477_c1
1867 nmdc:mga0qj67_102839_c1
1868 nmdc:mga06r32_101596_c1
1869 nmdc:mga06r32_268879_c1
1870 nmdc:mga06r32_58494_c1
1871 nmdc:mga08y16_10655_c1
1872 nmdc:mga08y16_11404_c1
1873 nmdc:mga08y16_13184_c1
1874 nmdc:mga08y16_168649_c1
1875 nmdc:mga08y16_30147_c1
1876 nmdc:mga08y16_51079_c1
1877 nmdc:mga08y16_532970_c1
1878 nmdc:mga08y16_81141_c1
1879 nmdc:mga0n895_151_c1
1880 nmdc:mga0n895_16155_c1
1881 nmdc:mga0n895_2741_c1
1882 nmdc:mga0n895_276122_c1
1883 nmdc:mga0n895_287519_c1
1884 nmdc:mga0n895_80247_c1
1885 nmdc:mga0rr50_104989_c1
1886 nmdc:mga0rr50_1131_c1
1887 nmdc:mga0rr50_147293_c1
1888 nmdc:mga0rr50_2318_c1
1889 nmdc:mga0rr50_262381_c1
1890 nmdc:mga08x19_11499_c1
1891 nmdc:mga08x19_125760_c1
1892 nmdc:mga08x19_37114_c1
1893 nmdc:mga08x19_3775_c1
1894 nmdc:mga08x19_548_c1
1895 nmdc:mga08x19_7499_c1
1896 nmdc:mga0a205_1935_c1
1897 nmdc:mga0a205_284_c1
1898 nmdc:mga0a205_39962_c1
1899 nmdc:mga0sz30_20660_c1
1900 nmdc:mga0sz30_62920_c1
1901 nmdc:mga0sz30_85365_c1
1902 Ga0495601_0000001
1903 Ga0495601_0011988
1904 Ga0495601_0030384
1905 Ga0495601_0037851
1906 Ga0495601_0097252
1907 Ga0495601_0247841
1908 Ga0495612_0000003
1909 Ga0495612_0102124
1910 Ga0495612_0176068
1911 Ga0500610_0000022
1912 Ga0495595_0000082
1913 Ga0495595_0005771
1914 Ga0495619_0000004
1915 Ga0495619_0015254
1916 Ga0495619_0071972
1917 Ga0500644_0047593
1918 Ga0500646_0002103
1919 Ga0500646_0007545
1920 Ga0500646_0007754
1921 Ga0500651_0081671
1922 Ga0500566_0181016
1923 Ga0500555_015627
1924 Ga0500658_0025225
1925 Ga0500568_0018098
1926 Ga0500568_0074291
1927 Ga0500604_0002634
1928 Ga0500604_0008950
1929 Ga0500616_0002390
1930 Ga0500552_000160
1931 Ga0530510_0171579
1932 2514042729
1933 2599905993
1934 2599906170
1935 2643859001
1936 2643861952
1937 2643981004
1938 2643981822
1939 2776265189
1940 2809031670
1941 2809033882
1942 2819600868
1943 2855732517
1944 2855769225
1945 2857546780
1946 2858956490
1947 2881414891
1948 2883577154
1949 2894023573
1950 2894773894
1951 2929201930
1952 2939635059
1953 2941482330
1954 8055910918

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

95

368

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.9537 32 318
7ndr-assembly1.cif.gz_E crystal structure of tphc in an open conformation 0.9502 32 318
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.944 30 321
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.9379 32 318
7ndr-assembly1.cif.gz_E crystal structure of tphc in an open conformation 0.9315 32 318
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9394 125 238 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9265 125 246 3.40.190.10
2f5xC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9161 126 246 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9095 125 246 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9055 125 246 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A5N7RLR6-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9763 25 321
AF-A0A2N4SUF0-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.969 37 321
AF-A0A1Q3XNW8-F1-model_v4 deleted 0.9687 25 321
AF-A0A5A8EZ22-F1-model_v4 deleted 0.9679 22 321
AF-A0A375FQQ0-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9657 66 321

Map