F487273
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 977 | 454 | 1954 | 321 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_100281237|Ga0070708_1002812371 |
| Length | 371 |
| Sequence | MLTRLVLAALLAAAALAHAQTQNYPAKSIRIVLPLAEGGLDASSEQGSRLRDANVRESAAATWMIAQATISREQYPTRAIRIILPFAPGGGADIIARMLGQKMTDSWGQQVVVDNRAGASGNIGAEIVAKSAPDGYTLLITSSALAINPSVFRSVPYDLNRDFAPITQPGLLPNILVVHPSLPVKTVKDLIALARSQPGKLAYASAGXXXXTHLAAEMFKLLAGIDMVHVPYKGGGALISDLLGGQVALTFATLPSVMPYVKVGRLRAVAMTTTKRWPGLPAVPTIAESGFPGFEMSTWIGLLAPAGTPKDVIGKLHQEVVRILHLSDVRERFDGLGIEPVGDTPEQFAQYIKSELVKYAKVVKQSGARAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 5 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 6 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 7 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 13 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 86 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 88 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 89 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 90 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 93 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 94 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 95 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 96 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 98 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 99 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 100 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 101 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 102 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 103 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 104 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 105 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 106 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 108 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 109 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 132 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 137 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 215 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 217 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 219 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 222 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 223 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 224 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 225 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 226 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 227 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 228 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 229 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 230 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 231 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 232 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 233 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 234 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 235 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 236 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 237 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 238 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 239 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 240 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 241 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 242 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 243 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 244 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 245 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 246 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 247 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 248 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 249 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 250 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 251 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 253 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 255 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 256 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 257 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 258 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 259 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 260 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 261 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 262 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 263 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 264 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 265 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 266 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 267 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 268 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 269 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 270 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 271 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 272 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 273 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 274 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 275 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 277 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 278 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 279 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 280 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 281 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 282 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 283 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 284 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 285 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 286 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 287 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 288 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 289 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 290 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 291 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 292 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 364 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 365 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 366 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 367 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 368 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 369 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 372 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 373 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 374 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 375 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 376 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 377 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 378 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 379 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 380 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 381 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 382 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 383 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 384 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 385 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 386 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 387 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 388 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 389 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 405 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 406 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 407 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 408 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 409 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 410 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 420 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 423 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 426 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 427 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 428 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 429 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 430 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 431 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 432 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 433 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 434 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 435 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 436 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 437 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 438 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 439 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 440 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 441 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 442 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 443 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 444 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 445 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 446 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 447 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 448 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 449 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 450 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 451 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 452 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 453 | 2941479691 | |||
| 454 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.65 |
| Metatranscriptomes | 0 |
| Isolates | 2.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.59 |
| Nodule | 0.61 |
| Rhizoplane | 5.94 |
| Rhizosphere | 75.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070708_100281237 | 3300005445 | Bacteria | 1566 |
| 2 | JGI24743J22301_10023389 | 3300001991 | Bacteria | 1189 |
| 3 | JGI24738J21930_10022534 | 3300002075 | Bacteria | 1302 |
| 4 | JGI24749J21850_1012853 | 3300002076 | Bacteria | 1176 |
| 5 | JGI25152J39213_1000010 | 3300002773 | Bacteria | 134529 |
| 6 | JGI25150J39212_1000490 | 3300002774 | Bacteria | 16621 |
| 7 | JGI25159J45721_1000381 | 3300002987 | Bacteria | 20524 |
| 8 | JGI25151J46595_10000262 | 3300003187 | Bacteria | 61170 |
| 9 | JGI25151J46595_10001355 | 3300003187 | Bacteria | 16973 |
| 10 | JGI25151J46595_10002847 | 3300003187 | Bacteria | 9962 |
| 11 | JGI25406J46586_10000542 | 3300003203 | Bacteria | 17685 |
| 12 | JGI25153J46596_10002775 | 3300003215 | Bacteria | 9962 |
| 13 | JGI25160J50197_1000583 | 3300003354 | Bacteria | 20524 |
| 14 | JGI25161J50226_1000654 | 3300003374 | Bacteria | 13897 |
| 15 | JGI25161J50226_1000922 | 3300003374 | Bacteria | 10544 |
| 16 | Ga0055535_1000241 | 3300003761 | Bacteria | 57946 |
| 17 | Ga0055542_1000126 | 3300003762 | Bacteria | 100388 |
| 18 | Ga0055526_1001018 | 3300003771 | Bacteria | 20524 |
| 19 | Ga0055526_1001146 | 3300003771 | Bacteria | 19207 |
| 20 | Ga0055526_1005040 | 3300003771 | Bacteria | 7716 |
| 21 | Ga0055526_1012011 | 3300003771 | Bacteria | 3828 |
| 22 | Ga0055526_1019127 | 3300003771 | Bacteria | 2510 |
| 23 | Ga0055537_1000873 | 3300003773 | Bacteria | 14427 |
| 24 | Ga0055537_1001439 | 3300003773 | Bacteria | 9286 |
| 25 | Ga0055524_1000248 | 3300003775 | Bacteria | 56071 |
| 26 | Ga0055524_1000823 | 3300003775 | Bacteria | 20524 |
| 27 | Ga0055536_1034912 | 3300003781 | Bacteria | 1264 |
| 28 | Ga0055534_1000341 | 3300003784 | Bacteria | 30179 |
| 29 | Ga0055534_1000531 | 3300003784 | Bacteria | 20524 |
| 30 | Ga0055534_1000661 | 3300003784 | Bacteria | 17379 |
| 31 | Ga0055528_1000865 | 3300003790 | Bacteria | 20524 |
| 32 | Ga0055540_1015526 | 3300003792 | Bacteria | 2211 |
| 33 | Ga0055540_1015703 | 3300003792 | Bacteria | 2188 |
| 34 | Ga0055531_10004697 | 3300003794 | Bacteria | 8176 |
| 35 | Ga0055543_1000539 | 3300004625 | Bacteria | 21302 |
| 36 | Ga0065165_1001314 | 3300005262 | Bacteria | 27751 |
| 37 | Ga0070676_10220100 | 3300005328 | Bacteria | 1253 |
| 38 | Ga0070683_100018484 | 3300005329 | Bacteria | 6176 |
| 39 | Ga0070690_100019584 | 3300005330 | Bacteria | 4111 |
| 40 | Ga0070690_100056022 | 3300005330 | Bacteria | 2526 |
| 41 | Ga0070690_100238515 | 3300005330 | Bacteria | 1281 |
| 42 | Ga0070670_100042837 | 3300005331 | Bacteria | 3892 |
| 43 | Ga0070670_100123402 | 3300005331 | Bacteria | 2235 |
| 44 | Ga0070670_100277701 | 3300005331 | Bacteria | 1463 |
| 45 | Ga0070677_10047287 | 3300005333 | Bacteria | 1724 |
| 46 | Ga0068869_100017953 | 3300005334 | Bacteria | 4808 |
| 47 | Ga0068869_100102400 | 3300005334 | Bacteria | 2167 |
| 48 | Ga0068869_100192724 | 3300005334 | Bacteria | 1603 |
| 49 | Ga0070666_10285834 | 3300005335 | Bacteria | 1173 |
| 50 | Ga0070680_100011245 | 3300005336 | Bacteria | 6920 |
| 51 | Ga0070680_100227620 | 3300005336 | Bacteria | 1574 |
| 52 | Ga0070682_100046709 | 3300005337 | Bacteria | 2688 |
| 53 | Ga0068868_100001010 | 3300005338 | Bacteria | 19254 |
| 54 | Ga0068868_100139607 | 3300005338 | Bacteria | 1988 |
| 55 | Ga0068868_100291653 | 3300005338 | Bacteria | 1383 |
| 56 | Ga0070689_100008032 | 3300005340 | Bacteria | 7408 |
| 57 | Ga0070689_100055638 | 3300005340 | Bacteria | 3066 |
| 58 | Ga0070689_100114513 | 3300005340 | Bacteria | 2148 |
| 59 | Ga0070689_100210663 | 3300005340 | Bacteria | 1590 |
| 60 | Ga0070689_100230355 | 3300005340 | Bacteria | 1523 |
| 61 | Ga0070687_100000472 | 3300005343 | Bacteria | 13540 |
| 62 | Ga0070687_100079239 | 3300005343 | Bacteria | 1787 |
| 63 | Ga0070692_10012681 | 3300005345 | Bacteria | 3911 |
| 64 | Ga0070668_100019524 | 3300005347 | Bacteria | 5101 |
| 65 | Ga0070668_100067479 | 3300005347 | Bacteria | 2779 |
| 66 | Ga0070669_100073390 | 3300005353 | Bacteria | 2535 |
| 67 | Ga0070669_100146514 | 3300005353 | Bacteria | 1825 |
| 68 | Ga0070675_100045107 | 3300005354 | Bacteria | 3606 |
| 69 | Ga0070675_100071179 | 3300005354 | Bacteria | 2884 |
| 70 | Ga0070675_100081169 | 3300005354 | Bacteria | 2704 |
| 71 | Ga0070671_100037790 | 3300005355 | Bacteria | 4006 |
| 72 | Ga0070671_100084181 | 3300005355 | Bacteria | 2660 |
| 73 | Ga0070671_100116982 | 3300005355 | Bacteria | 2241 |
| 74 | Ga0070671_100167541 | 3300005355 | Bacteria | 1858 |
| 75 | Ga0070674_100105194 | 3300005356 | Bacteria | 2063 |
| 76 | Ga0070674_100127626 | 3300005356 | Bacteria | 1892 |
| 77 | Ga0070673_100060127 | 3300005364 | Bacteria | 3010 |
| 78 | Ga0070673_100163593 | 3300005364 | Bacteria | 1894 |
| 79 | Ga0070673_100209369 | 3300005364 | Bacteria | 1683 |
| 80 | Ga0070688_100007930 | 3300005365 | Bacteria | 5743 |
| 81 | Ga0070688_100061466 | 3300005365 | Bacteria | 2375 |
| 82 | Ga0070667_100041279 | 3300005367 | Bacteria | 3871 |
| 83 | Ga0070667_100141322 | 3300005367 | Bacteria | 2108 |
| 84 | Ga0070667_100165424 | 3300005367 | Bacteria | 1951 |
| 85 | Ga0070667_100210054 | 3300005367 | Bacteria | 1730 |
| 86 | Ga0070667_100345258 | 3300005367 | Bacteria | 1347 |
| 87 | Ga0070714_100155983 | 3300005435 | Bacteria | 2061 |
| 88 | Ga0070713_100000019 | 3300005436 | Bacteria | 110100 |
| 89 | Ga0070713_100013794 | 3300005436 | Bacteria | 5980 |
| 90 | Ga0070713_100067932 | 3300005436 | Bacteria | 3003 |
| 91 | Ga0070710_10072573 | 3300005437 | Bacteria | 1988 |
| 92 | Ga0070701_10010189 | 3300005438 | Bacteria | 4146 |
| 93 | Ga0070705_100000043 | 3300005440 | Bacteria | 63978 |
| 94 | Ga0070705_100090944 | 3300005440 | Bacteria | 1901 |
| 95 | Ga0070705_100155137 | 3300005440 | Bacteria | 1524 |
| 96 | Ga0070700_100003779 | 3300005441 | Bacteria | 7837 |
| 97 | Ga0070700_100138422 | 3300005441 | Bacteria | 1651 |
| 98 | Ga0070694_100006344 | 3300005444 | Bacteria | 7174 |
| 99 | Ga0070694_100084540 | 3300005444 | Bacteria | 2214 |
| 100 | Ga0070678_100014403 | 3300005456 | Bacteria | 4989 |
| 101 | Ga0070662_100240262 | 3300005457 | Bacteria | 1452 |
| 102 | Ga0070681_10000685 | 3300005458 | Bacteria | 28045 |
| 103 | Ga0070681_10047234 | 3300005458 | Bacteria | 4303 |
| 104 | Ga0068867_100000225 | 3300005459 | Bacteria | 37110 |
| 105 | Ga0068867_100214314 | 3300005459 | Bacteria | 1549 |
| 106 | Ga0070685_10015443 | 3300005466 | Bacteria | 4056 |
| 107 | Ga0070706_100006414 | 3300005467 | Bacteria | 11119 |
| 108 | Ga0070706_100292218 | 3300005467 | Bacteria | 1521 |
| 109 | Ga0070707_100179645 | 3300005468 | Bacteria | 2063 |
| 110 | Ga0070679_100050267 | 3300005530 | Bacteria | 4153 |
| 111 | Ga0070684_100267382 | 3300005535 | Bacteria | 1565 |
| 112 | Ga0070684_100351647 | 3300005535 | Bacteria | 1355 |
| 113 | Ga0068853_100021309 | 3300005539 | Bacteria | 5402 |
| 114 | Ga0068853_100038292 | 3300005539 | Bacteria | 4084 |
| 115 | Ga0068853_100049105 | 3300005539 | Bacteria | 3625 |
| 116 | Ga0070672_100033355 | 3300005543 | Bacteria | 3898 |
| 117 | Ga0070672_100036428 | 3300005543 | Bacteria | 3748 |
| 118 | Ga0070672_100230977 | 3300005543 | Bacteria | 1554 |
| 119 | Ga0070686_100064113 | 3300005544 | Bacteria | 2382 |
| 120 | Ga0070686_100098164 | 3300005544 | Bacteria | 1973 |
| 121 | Ga0070686_100098988 | 3300005544 | Bacteria | 1966 |
| 122 | Ga0070686_100112039 | 3300005544 | Bacteria | 1860 |
| 123 | Ga0070686_100175083 | 3300005544 | Bacteria | 1520 |
| 124 | Ga0070686_100201730 | 3300005544 | Bacteria | 1426 |
| 125 | Ga0070695_100033205 | 3300005545 | Bacteria | 3228 |
| 126 | Ga0070695_100055626 | 3300005545 | Bacteria | 2551 |
| 127 | Ga0070696_100003112 | 3300005546 | Bacteria | 11038 |
| 128 | Ga0070696_100020591 | 3300005546 | Bacteria | 4468 |
| 129 | Ga0070693_100000016 | 3300005547 | Bacteria | 63019 |
| 130 | Ga0070704_100000837 | 3300005549 | Bacteria | 15281 |
| 131 | Ga0070704_100065286 | 3300005549 | Bacteria | 2619 |
| 132 | Ga0070704_100072778 | 3300005549 | Bacteria | 2501 |
| 133 | Ga0070704_100141823 | 3300005549 | Bacteria | 1877 |
| 134 | Ga0068855_100012963 | 3300005563 | Bacteria | 10058 |
| 135 | Ga0070664_100139169 | 3300005564 | Bacteria | 2136 |
| 136 | Ga0070664_100311573 | 3300005564 | Bacteria | 1424 |
| 137 | Ga0070664_100347762 | 3300005564 | Bacteria | 1348 |
| 138 | Ga0068857_100464610 | 3300005577 | Bacteria | 1185 |
| 139 | Ga0068856_100683449 | 3300005614 | Bacteria | 1047 |
| 140 | Ga0070702_100000017 | 3300005615 | Bacteria | 47208 |
| 141 | Ga0070702_100094968 | 3300005615 | Bacteria | 1816 |
| 142 | Ga0070702_100161664 | 3300005615 | Bacteria | 1448 |
| 143 | Ga0070702_100186014 | 3300005615 | Bacteria | 1363 |
| 144 | Ga0068852_100016862 | 3300005616 | Bacteria | 5712 |
| 145 | Ga0068852_100224587 | 3300005616 | Bacteria | 1787 |
| 146 | Ga0068852_100334792 | 3300005616 | Bacteria | 1474 |
| 147 | Ga0068852_100494472 | 3300005616 | Bacteria | 1217 |
| 148 | Ga0068859_100018784 | 3300005617 | Bacteria | 6947 |
| 149 | Ga0068859_100138373 | 3300005617 | Bacteria | 2509 |
| 150 | Ga0068859_100163787 | 3300005617 | Bacteria | 2303 |
| 151 | Ga0068864_100018789 | 3300005618 | Bacteria | 5777 |
| 152 | Ga0068864_100029246 | 3300005618 | Bacteria | 4663 |
| 153 | Ga0068864_100037951 | 3300005618 | Bacteria | 4112 |
| 154 | Ga0068864_100088907 | 3300005618 | Bacteria | 2721 |
| 155 | Ga0068864_100283198 | 3300005618 | Bacteria | 1548 |
| 156 | Ga0068866_10016800 | 3300005718 | Bacteria | 3278 |
| 157 | Ga0068861_100000496 | 3300005719 | Bacteria | 22901 |
| 158 | Ga0068861_100019728 | 3300005719 | Bacteria | 4817 |
| 159 | Ga0068861_100061114 | 3300005719 | Bacteria | 2890 |
| 160 | Ga0068861_100267540 | 3300005719 | Bacteria | 1466 |
| 161 | Ga0068861_100373273 | 3300005719 | Bacteria | 1258 |
| 162 | Ga0068870_10003235 | 3300005840 | Bacteria | 6876 |
| 163 | Ga0068870_10089499 | 3300005840 | Bacteria | 1718 |
| 164 | Ga0068863_100145229 | 3300005841 | Bacteria | 2269 |
| 165 | Ga0068863_100177149 | 3300005841 | Bacteria | 2046 |
| 166 | Ga0068858_100001011 | 3300005842 | Bacteria | 28980 |
| 167 | Ga0068858_100002315 | 3300005842 | Bacteria | 19249 |
| 168 | Ga0068858_100107316 | 3300005842 | Bacteria | 2606 |
| 169 | Ga0068858_100184476 | 3300005842 | Bacteria | 1971 |
| 170 | Ga0068858_100291891 | 3300005842 | Bacteria | 1555 |
| 171 | Ga0068858_100330901 | 3300005842 | Bacteria | 1457 |
| 172 | Ga0068860_100017045 | 3300005843 | Bacteria | 7081 |
| 173 | Ga0068860_100023020 | 3300005843 | Bacteria | 6025 |
| 174 | Ga0068860_100074316 | 3300005843 | Bacteria | 3232 |
| 175 | Ga0068860_100285616 | 3300005843 | Bacteria | 1613 |
| 176 | Ga0068862_100119071 | 3300005844 | Bacteria | 2325 |
| 177 | Ga0081455_10014492 | 3300005937 | Bacteria | 7723 |
| 178 | Ga0081455_10028957 | 3300005937 | Bacteria | 5055 |
| 179 | Ga0081455_10041286 | 3300005937 | Bacteria | 4059 |
| 180 | Ga0081539_10000847 | 3300005985 | Bacteria | 58528 |
| 181 | Ga0070717_10093279 | 3300006028 | Bacteria | 2545 |
| 182 | Ga0075365_10045375 | 3300006038 | Bacteria | 2883 |
| 183 | Ga0075365_10086763 | 3300006038 | Bacteria | 2127 |
| 184 | Ga0075365_10157232 | 3300006038 | Bacteria | 1582 |
| 185 | Ga0075363_100005216 | 3300006048 | Bacteria | 5756 |
| 186 | Ga0075363_100063798 | 3300006048 | Bacteria | 1989 |
| 187 | Ga0075364_10011199 | 3300006051 | Bacteria | 5445 |
| 188 | Ga0075364_10032938 | 3300006051 | Bacteria | 3334 |
| 189 | Ga0075364_10100238 | 3300006051 | Bacteria | 1928 |
| 190 | Ga0075364_10115861 | 3300006051 | Bacteria | 1791 |
| 191 | Ga0075364_10231932 | 3300006051 | Bacteria | 1253 |
| 192 | Ga0070716_100084483 | 3300006173 | Bacteria | 1904 |
| 193 | Ga0070716_100109793 | 3300006173 | Bacteria | 1707 |
| 194 | Ga0070716_100208567 | 3300006173 | Unclassified | 1304 |
| 195 | Ga0070712_100034989 | 3300006175 | Bacteria | 3407 |
| 196 | Ga0075362_10024056 | 3300006177 | Bacteria | 2581 |
| 197 | Ga0075362_10090042 | 3300006177 | Bacteria | 1423 |
| 198 | Ga0075367_10070103 | 3300006178 | Bacteria | 2106 |
| 199 | Ga0075367_10084814 | 3300006178 | Bacteria | 1921 |
| 200 | Ga0075367_10108334 | 3300006178 | Bacteria | 1703 |
| 201 | Ga0075369_10004234 | 3300006186 | Bacteria | 5287 |
| 202 | Ga0075366_10001589 | 3300006195 | Bacteria | 11365 |
| 203 | Ga0075366_10025588 | 3300006195 | Bacteria | 3449 |
| 204 | Ga0075366_10095398 | 3300006195 | Bacteria | 1783 |
| 205 | Ga0097621_100001049 | 3300006237 | Bacteria | 19393 |
| 206 | Ga0097621_100007640 | 3300006237 | Bacteria | 7749 |
| 207 | Ga0097621_100205373 | 3300006237 | Bacteria | 1712 |
| 208 | Ga0068871_100004173 | 3300006358 | Bacteria | 10001 |
| 209 | Ga0068871_100031226 | 3300006358 | Bacteria | 4199 |
| 210 | Ga0068871_100152558 | 3300006358 | Bacteria | 1971 |
| 211 | Ga0075428_100004582 | 3300006844 | Bacteria | 15289 |
| 212 | Ga0075428_100013933 | 3300006844 | Bacteria | 8953 |
| 213 | Ga0075428_100023614 | 3300006844 | Bacteria | 6807 |
| 214 | Ga0075428_100028423 | 3300006844 | Bacteria | 6186 |
| 215 | Ga0075430_100068042 | 3300006846 | Bacteria | 2988 |
| 216 | Ga0075431_100004337 | 3300006847 | Bacteria | 13900 |
| 217 | Ga0075431_100107621 | 3300006847 | Bacteria | 2877 |
| 218 | Ga0075431_100216103 | 3300006847 | Unclassified | 1957 |
| 219 | Ga0075431_100236014 | 3300006847 | Bacteria | 1862 |
| 220 | Ga0075433_10001240 | 3300006852 | Bacteria | 18606 |
| 221 | Ga0075433_10016219 | 3300006852 | Bacteria | 6129 |
| 222 | Ga0075433_10069944 | 3300006852 | Bacteria | 3083 |
| 223 | Ga0075433_10511373 | 3300006852 | Bacteria | 1057 |
| 224 | Ga0075434_100000017 | 3300006871 | Bacteria | 74154 |
| 225 | Ga0075434_100000549 | 3300006871 | Bacteria | 28671 |
| 226 | Ga0075434_100005820 | 3300006871 | Bacteria | 11258 |
| 227 | Ga0075434_100034296 | 3300006871 | Bacteria | 5011 |
| 228 | Ga0075434_100037443 | 3300006871 | Bacteria | 4802 |
| 229 | Ga0075434_100132341 | 3300006871 | Bacteria | 2514 |
| 230 | Ga0075434_100390409 | 3300006871 | Bacteria | 1413 |
| 231 | Ga0075429_100000506 | 3300006880 | Bacteria | 29418 |
| 232 | Ga0075429_100007303 | 3300006880 | Bacteria | 9589 |
| 233 | Ga0075429_100166865 | 3300006880 | Bacteria | 1929 |
| 234 | Ga0068865_100016551 | 3300006881 | Bacteria | 4721 |
| 235 | Ga0075436_100000896 | 3300006914 | Bacteria | 19786 |
| 236 | Ga0075436_100001337 | 3300006914 | Bacteria | 16769 |
| 237 | Ga0075436_100009262 | 3300006914 | Bacteria | 6737 |
| 238 | Ga0075436_100015208 | 3300006914 | Bacteria | 5271 |
| 239 | Ga0075436_100036090 | 3300006914 | Bacteria | 3411 |
| 240 | Ga0075436_100130099 | 3300006914 | Bacteria | 1765 |
| 241 | Ga0097620_100018783 | 3300006931 | Bacteria | 6947 |
| 242 | Ga0097620_100138368 | 3300006931 | Bacteria | 2509 |
| 243 | Ga0097620_100163771 | 3300006931 | Bacteria | 2303 |
| 244 | Ga0099826_10000019 | 3300006948 | Bacteria | 188386 |
| 245 | Ga0075435_100000241 | 3300007076 | Bacteria | 33718 |
| 246 | Ga0075435_100001546 | 3300007076 | Bacteria | 14830 |
| 247 | Ga0075435_100075757 | 3300007076 | Bacteria | 2756 |
| 248 | Ga0075435_100119638 | 3300007076 | Bacteria | 2197 |
| 249 | Ga0099795_10042805 | 3300007788 | Bacteria | 1618 |
| 250 | Ga0105240_10007572 | 3300009093 | Bacteria | 15732 |
| 251 | Ga0111539_10020771 | 3300009094 | Bacteria | 8083 |
| 252 | Ga0111539_10026228 | 3300009094 | Bacteria | 7130 |
| 253 | Ga0111539_10035923 | 3300009094 | Bacteria | 5998 |
| 254 | Ga0111539_10048183 | 3300009094 | Bacteria | 5089 |
| 255 | Ga0111539_10139578 | 3300009094 | Bacteria | 2838 |
| 256 | Ga0111539_10669351 | 3300009094 | Bacteria | 1209 |
| 257 | Ga0105245_10085899 | 3300009098 | Bacteria | 2885 |
| 258 | Ga0105245_10102244 | 3300009098 | Bacteria | 2654 |
| 259 | Ga0105245_10250114 | 3300009098 | Bacteria | 1722 |
| 260 | Ga0105245_10798775 | 3300009098 | Bacteria | 981 |
| 261 | Ga0105247_10012451 | 3300009101 | Bacteria | 5108 |
| 262 | Ga0114129_10000534 | 3300009147 | Bacteria | 46594 |
| 263 | Ga0114129_10001202 | 3300009147 | Bacteria | 34348 |
| 264 | Ga0114129_10024407 | 3300009147 | Bacteria | 8567 |
| 265 | Ga0114129_10042156 | 3300009147 | Bacteria | 6427 |
| 266 | Ga0105243_10000743 | 3300009148 | Bacteria | 31200 |
| 267 | Ga0105243_10036148 | 3300009148 | Bacteria | 3832 |
| 268 | Ga0105243_10172997 | 3300009148 | Bacteria | 1872 |
| 269 | Ga0105243_10188739 | 3300009148 | Bacteria | 1798 |
| 270 | Ga0105243_10191090 | 3300009148 | Bacteria | 1788 |
| 271 | Ga0105243_10201300 | 3300009148 | Bacteria | 1746 |
| 272 | Ga0105241_10133962 | 3300009174 | Bacteria | 2009 |
| 273 | Ga0105242_10337902 | 3300009176 | Bacteria | 1387 |
| 274 | Ga0105248_10251964 | 3300009177 | Bacteria | 1987 |
| 275 | Ga0105248_10300618 | 3300009177 | Bacteria | 1807 |
| 276 | Ga0105248_10543404 | 3300009177 | Bacteria | 1311 |
| 277 | Ga0105237_10405381 | 3300009545 | Bacteria | 1368 |
| 278 | Ga0105238_10138160 | 3300009551 | Bacteria | 2414 |
| 279 | Ga0105238_10476566 | 3300009551 | Bacteria | 1247 |
| 280 | Ga0105249_10057924 | 3300009553 | Bacteria | 3550 |
| 281 | Ga0105246_10123763 | 3300011119 | Bacteria | 1921 |
| 282 | Ga0105246_10197654 | 3300011119 | Bacteria | 1561 |
| 283 | Ga0157371_10109606 | 3300013102 | Bacteria | 1960 |
| 284 | Ga0157374_10085143 | 3300013296 | Bacteria | 3005 |
| 285 | Ga0157374_10102708 | 3300013296 | Bacteria | 2742 |
| 286 | Ga0157374_10217492 | 3300013296 | Bacteria | 1874 |
| 287 | Ga0157378_10046757 | 3300013297 | Bacteria | 3847 |
| 288 | Ga0157378_10058354 | 3300013297 | Bacteria | 3442 |
| 289 | Ga0157378_10285305 | 3300013297 | Bacteria | 1593 |
| 290 | Ga0163162_10099076 | 3300013306 | Bacteria | 3005 |
| 291 | Ga0163162_10387645 | 3300013306 | Bacteria | 1530 |
| 292 | Ga0157372_10262757 | 3300013307 | Bacteria | 2004 |
| 293 | Ga0157375_10471632 | 3300013308 | Bacteria | 1420 |
| 294 | Ga0157375_10604962 | 3300013308 | Bacteria | 1255 |
| 295 | Ga0163163_10027646 | 3300014325 | Bacteria | 5436 |
| 296 | Ga0163163_10030887 | 3300014325 | Bacteria | 5165 |
| 297 | Ga0163163_10051329 | 3300014325 | Bacteria | 4067 |
| 298 | Ga0163163_10172110 | 3300014325 | Bacteria | 2212 |
| 299 | Ga0163163_10251300 | 3300014325 | Bacteria | 1819 |
| 300 | Ga0163163_10309182 | 3300014325 | Bacteria | 1633 |
| 301 | Ga0157380_10069201 | 3300014326 | Bacteria | 2847 |
| 302 | Ga0182008_10042415 | 3300014497 | Bacteria | 2266 |
| 303 | Ga0157377_10007048 | 3300014745 | Bacteria | 5399 |
| 304 | Ga0157377_10240015 | 3300014745 | Bacteria | 1169 |
| 305 | Ga0157379_10006399 | 3300014968 | Bacteria | 10146 |
| 306 | Ga0157379_10146350 | 3300014968 | Bacteria | 2131 |
| 307 | Ga0157379_10239821 | 3300014968 | Bacteria | 1644 |
| 308 | Ga0157376_10050117 | 3300014969 | Bacteria | 3462 |
| 309 | Ga0163161_10088396 | 3300017792 | Bacteria | 2290 |
| 310 | Ga0213876_10003512 | 3300021384 | Bacteria | 8949 |
| 311 | Ga0213876_10004235 | 3300021384 | Bacteria | 8049 |
| 312 | Ga0209436_101676 | 3300025208 | Bacteria | 7350 |
| 313 | Ga0209672_100550 | 3300025228 | Bacteria | 20292 |
| 314 | Ga0209147_100805 | 3300025229 | Bacteria | 15154 |
| 315 | Ga0209258_100018 | 3300025242 | Bacteria | 567561 |
| 316 | Ga0207425_1000057 | 3300025245 | Bacteria | 149738 |
| 317 | Ga0209148_1000030 | 3300025254 | Bacteria | 567582 |
| 318 | Ga0209129_1000030 | 3300025258 | Bacteria | 391958 |
| 319 | Ga0209565_1000019 | 3300025263 | Bacteria | 438920 |
| 320 | Ga0209565_1000255 | 3300025263 | Bacteria | 56576 |
| 321 | Ga0209565_1018952 | 3300025263 | Bacteria | 1477 |
| 322 | Ga0209673_1000155 | 3300025273 | Bacteria | 145667 |
| 323 | Ga0209673_1009186 | 3300025273 | Bacteria | 4313 |
| 324 | Ga0209130_1000011 | 3300025284 | Bacteria | 431723 |
| 325 | Ga0209675_1000031 | 3300025291 | Bacteria | 273599 |
| 326 | Ga0209675_1000457 | 3300025291 | Bacteria | 31374 |
| 327 | Ga0209675_1000510 | 3300025291 | Bacteria | 28831 |
| 328 | Ga0209675_1002115 | 3300025291 | Bacteria | 10517 |
| 329 | Ga0209676_1004622 | 3300025292 | Bacteria | 7582 |
| 330 | Ga0209676_1006264 | 3300025292 | Bacteria | 5921 |
| 331 | Ga0209676_1009204 | 3300025292 | Bacteria | 4295 |
| 332 | Ga0209025_1000057 | 3300025294 | Bacteria | 314601 |
| 333 | Ga0209025_1000078 | 3300025294 | Bacteria | 271683 |
| 334 | Ga0209025_1002582 | 3300025294 | Bacteria | 18768 |
| 335 | Ga0209025_1028513 | 3300025294 | Bacteria | 2732 |
| 336 | Ga0209564_1000056 | 3300025295 | Bacteria | 340873 |
| 337 | Ga0209564_1000546 | 3300025295 | Bacteria | 60886 |
| 338 | Ga0209564_1000600 | 3300025295 | Bacteria | 56188 |
| 339 | Ga0209564_1002095 | 3300025295 | Bacteria | 17070 |
| 340 | Ga0209758_1000037 | 3300025297 | Bacteria | 439101 |
| 341 | Ga0209758_1019878 | 3300025297 | Bacteria | 3210 |
| 342 | Ga0209050_1001259 | 3300025298 | Bacteria | 29240 |
| 343 | Ga0209050_1007505 | 3300025298 | Bacteria | 6089 |
| 344 | Ga0209256_1000043 | 3300025299 | Bacteria | 340873 |
| 345 | Ga0209256_1000518 | 3300025299 | Bacteria | 56459 |
| 346 | Ga0209256_1000661 | 3300025299 | Bacteria | 46620 |
| 347 | Ga0207426_1000029 | 3300025302 | Bacteria | 473835 |
| 348 | Ga0209051_1000804 | 3300025303 | Bacteria | 32919 |
| 349 | Ga0209051_1006197 | 3300025303 | Bacteria | 6781 |
| 350 | Ga0209257_1001647 | 3300025304 | Bacteria | 25488 |
| 351 | Ga0207682_10068119 | 3300025893 | Bacteria | 1503 |
| 352 | Ga0207682_10079540 | 3300025893 | Bacteria | 1402 |
| 353 | Ga0207692_10113619 | 3300025898 | Bacteria | 1505 |
| 354 | Ga0207642_10034515 | 3300025899 | Bacteria | 2152 |
| 355 | Ga0207710_10032070 | 3300025900 | Bacteria | 2301 |
| 356 | Ga0207688_10000077 | 3300025901 | Bacteria | 37350 |
| 357 | Ga0207688_10009054 | 3300025901 | Bacteria | 5420 |
| 358 | Ga0207688_10078236 | 3300025901 | Bacteria | 1885 |
| 359 | Ga0207688_10116738 | 3300025901 | Bacteria | 1554 |
| 360 | Ga0207680_10070700 | 3300025903 | Bacteria | 2161 |
| 361 | Ga0207647_10014714 | 3300025904 | Bacteria | 5388 |
| 362 | Ga0207647_10030672 | 3300025904 | Bacteria | 3466 |
| 363 | Ga0207645_10012169 | 3300025907 | Bacteria | 5843 |
| 364 | Ga0207645_10020137 | 3300025907 | Bacteria | 4368 |
| 365 | Ga0207643_10060781 | 3300025908 | Bacteria | 2158 |
| 366 | Ga0207643_10106289 | 3300025908 | Bacteria | 1650 |
| 367 | Ga0207643_10124687 | 3300025908 | Bacteria | 1528 |
| 368 | Ga0207684_10000788 | 3300025910 | Bacteria | 36846 |
| 369 | Ga0207684_10252761 | 3300025910 | Bacteria | 1521 |
| 370 | Ga0207707_10096778 | 3300025912 | Bacteria | 2579 |
| 371 | Ga0207695_10016654 | 3300025913 | Bacteria | 8591 |
| 372 | Ga0207671_10113150 | 3300025914 | Bacteria | 2067 |
| 373 | Ga0207671_10417824 | 3300025914 | Bacteria | 1067 |
| 374 | Ga0207693_10010472 | 3300025915 | Bacteria | 7525 |
| 375 | Ga0207693_10015493 | 3300025915 | Bacteria | 6116 |
| 376 | Ga0207663_10044643 | 3300025916 | Bacteria | 2722 |
| 377 | Ga0207663_10316611 | 3300025916 | Bacteria | 1171 |
| 378 | Ga0207660_10173589 | 3300025917 | Bacteria | 1670 |
| 379 | Ga0207662_10002112 | 3300025918 | Bacteria | 9875 |
| 380 | Ga0207662_10004898 | 3300025918 | Bacteria | 7082 |
| 381 | Ga0207662_10027735 | 3300025918 | Bacteria | 3270 |
| 382 | Ga0207662_10131049 | 3300025918 | Bacteria | 1581 |
| 383 | Ga0207657_10158746 | 3300025919 | Bacteria | 1838 |
| 384 | Ga0207657_10206919 | 3300025919 | Bacteria | 1576 |
| 385 | Ga0207652_10035230 | 3300025921 | Bacteria | 4223 |
| 386 | Ga0207646_10055525 | 3300025922 | Bacteria | 3541 |
| 387 | Ga0207646_10063874 | 3300025922 | Bacteria | 3286 |
| 388 | Ga0207681_10042080 | 3300025923 | Bacteria | 3049 |
| 389 | Ga0207694_10124355 | 3300025924 | Bacteria | 2062 |
| 390 | Ga0207650_10041764 | 3300025925 | Bacteria | 3362 |
| 391 | Ga0207650_10085284 | 3300025925 | Bacteria | 2402 |
| 392 | Ga0207650_10114738 | 3300025925 | Bacteria | 2090 |
| 393 | Ga0207659_10011421 | 3300025926 | Bacteria | 5610 |
| 394 | Ga0207659_10103002 | 3300025926 | Bacteria | 2156 |
| 395 | Ga0207687_10071957 | 3300025927 | Bacteria | 2472 |
| 396 | Ga0207687_10101226 | 3300025927 | Bacteria | 2121 |
| 397 | Ga0207687_10152212 | 3300025927 | Bacteria | 1766 |
| 398 | Ga0207700_10000035 | 3300025928 | Bacteria | 119648 |
| 399 | Ga0207644_10051645 | 3300025931 | Bacteria | 2952 |
| 400 | Ga0207644_10079951 | 3300025931 | Bacteria | 2413 |
| 401 | Ga0207706_10001566 | 3300025933 | Bacteria | 22667 |
| 402 | Ga0207706_10034208 | 3300025933 | Bacteria | 4521 |
| 403 | Ga0207709_10000085 | 3300025935 | Bacteria | 160514 |
| 404 | Ga0207709_10030284 | 3300025935 | Bacteria | 3147 |
| 405 | Ga0207709_10170271 | 3300025935 | Bacteria | 1528 |
| 406 | Ga0207709_10355480 | 3300025935 | Bacteria | 1107 |
| 407 | Ga0207670_10019546 | 3300025936 | Bacteria | 4139 |
| 408 | Ga0207670_10109838 | 3300025936 | Bacteria | 1985 |
| 409 | Ga0207670_10111609 | 3300025936 | Bacteria | 1971 |
| 410 | Ga0207670_10197380 | 3300025936 | Bacteria | 1526 |
| 411 | Ga0207704_10006104 | 3300025938 | Bacteria | 5588 |
| 412 | Ga0207704_10224899 | 3300025938 | Bacteria | 1391 |
| 413 | Ga0207665_10088026 | 3300025939 | Bacteria | 2148 |
| 414 | Ga0207665_10155183 | 3300025939 | Bacteria | 1642 |
| 415 | Ga0207691_10019431 | 3300025940 | Bacteria | 6428 |
| 416 | Ga0207691_10050211 | 3300025940 | Bacteria | 3820 |
| 417 | Ga0207691_10104303 | 3300025940 | Bacteria | 2527 |
| 418 | Ga0207711_10069681 | 3300025941 | Bacteria | 3049 |
| 419 | Ga0207711_10118617 | 3300025941 | Bacteria | 2361 |
| 420 | Ga0207689_10000079 | 3300025942 | Bacteria | 78891 |
| 421 | Ga0207689_10093130 | 3300025942 | Bacteria | 2475 |
| 422 | Ga0207689_10105965 | 3300025942 | Bacteria | 2309 |
| 423 | Ga0207661_10247906 | 3300025944 | Bacteria | 1582 |
| 424 | Ga0207679_10016937 | 3300025945 | Bacteria | 4847 |
| 425 | Ga0207679_10062953 | 3300025945 | Bacteria | 2767 |
| 426 | Ga0207679_10108065 | 3300025945 | Bacteria | 2190 |
| 427 | Ga0207679_10317385 | 3300025945 | Bacteria | 1348 |
| 428 | Ga0207667_10277003 | 3300025949 | Bacteria | 1715 |
| 429 | Ga0207667_10284195 | 3300025949 | Bacteria | 1691 |
| 430 | Ga0207651_10021125 | 3300025960 | Bacteria | 3948 |
| 431 | Ga0207651_10143638 | 3300025960 | Bacteria | 1847 |
| 432 | Ga0207651_10312147 | 3300025960 | Bacteria | 1311 |
| 433 | Ga0207712_10075917 | 3300025961 | Bacteria | 2431 |
| 434 | Ga0207668_10033345 | 3300025972 | Bacteria | 3410 |
| 435 | Ga0207668_10075903 | 3300025972 | Bacteria | 2418 |
| 436 | Ga0207668_10204983 | 3300025972 | Bacteria | 1573 |
| 437 | Ga0207658_10079628 | 3300025986 | Bacteria | 2507 |
| 438 | Ga0207658_10113890 | 3300025986 | Bacteria | 2144 |
| 439 | Ga0207658_10133023 | 3300025986 | Bacteria | 2001 |
| 440 | Ga0207677_10008782 | 3300026023 | Bacteria | 5661 |
| 441 | Ga0207703_10015337 | 3300026035 | Bacteria | 5977 |
| 442 | Ga0207703_10027651 | 3300026035 | Bacteria | 4466 |
| 443 | Ga0207703_10077644 | 3300026035 | Bacteria | 2757 |
| 444 | Ga0207703_10127140 | 3300026035 | Bacteria | 2196 |
| 445 | Ga0207703_10199565 | 3300026035 | Bacteria | 1777 |
| 446 | Ga0207639_10067489 | 3300026041 | Bacteria | 2783 |
| 447 | Ga0207708_10000155 | 3300026075 | Bacteria | 54651 |
| 448 | Ga0207708_10005791 | 3300026075 | Bacteria | 9136 |
| 449 | Ga0207708_10181617 | 3300026075 | Bacteria | 1671 |
| 450 | Ga0207702_10281415 | 3300026078 | Bacteria | 1573 |
| 451 | Ga0207641_10011199 | 3300026088 | Bacteria | 7358 |
| 452 | Ga0207648_10000018 | 3300026089 | Bacteria | 148157 |
| 453 | Ga0207648_10000071 | 3300026089 | Bacteria | 95176 |
| 454 | Ga0207648_10027150 | 3300026089 | Bacteria | 5084 |
| 455 | Ga0207648_10063126 | 3300026089 | Bacteria | 3229 |
| 456 | Ga0207648_10136026 | 3300026089 | Bacteria | 2165 |
| 457 | Ga0207676_10009920 | 3300026095 | Bacteria | 6773 |
| 458 | Ga0207676_10024356 | 3300026095 | Bacteria | 4478 |
| 459 | Ga0207676_10078295 | 3300026095 | Bacteria | 2677 |
| 460 | Ga0207676_10218588 | 3300026095 | Bacteria | 1695 |
| 461 | Ga0207674_10241548 | 3300026116 | Bacteria | 1753 |
| 462 | Ga0207675_100036493 | 3300026118 | Bacteria | 4585 |
| 463 | Ga0207675_100047119 | 3300026118 | Bacteria | 4025 |
| 464 | Ga0207675_100050720 | 3300026118 | Bacteria | 3872 |
| 465 | Ga0207675_100065835 | 3300026118 | Bacteria | 3387 |
| 466 | Ga0207675_100314024 | 3300026118 | Bacteria | 1529 |
| 467 | Ga0207675_100372204 | 3300026118 | Bacteria | 1403 |
| 468 | Ga0207683_10008847 | 3300026121 | Bacteria | 8590 |
| 469 | Ga0207683_10017801 | 3300026121 | Bacteria | 6060 |
| 470 | Ga0207698_10165456 | 3300026142 | Bacteria | 1940 |
| 471 | Ga0207698_10228424 | 3300026142 | Bacteria | 1688 |
| 472 | Ga0207698_10242347 | 3300026142 | Bacteria | 1644 |
| 473 | Ga0207698_10370702 | 3300026142 | Bacteria | 1359 |
| 474 | Ga0209371_1006207 | 3300027312 | Bacteria | 4491 |
| 475 | Ga0209969_1010345 | 3300027360 | Bacteria | 1334 |
| 476 | Ga0209179_1005804 | 3300027512 | Bacteria | 1953 |
| 477 | Ga0209282_1000148 | 3300027666 | Bacteria | 41213 |
| 478 | Ga0209971_1021659 | 3300027682 | Bacteria | 1529 |
| 479 | Ga0209813_10019746 | 3300027866 | Bacteria | 1877 |
| 480 | Ga0209974_10021683 | 3300027876 | Bacteria | 2129 |
| 481 | Ga0207428_10000758 | 3300027907 | Bacteria | 36770 |
| 482 | Ga0207428_10011171 | 3300027907 | Bacteria | 7964 |
| 483 | Ga0207428_10066049 | 3300027907 | Bacteria | 2851 |
| 484 | Ga0268265_10010174 | 3300028380 | Bacteria | 6348 |
| 485 | Ga0268265_10045598 | 3300028380 | Bacteria | 3272 |
| 486 | Ga0268265_10090411 | 3300028380 | Bacteria | 2445 |
| 487 | Ga0268264_10004862 | 3300028381 | Bacteria | 11383 |
| 488 | Ga0268264_10082221 | 3300028381 | Bacteria | 2755 |
| 489 | Ga0268264_10222351 | 3300028381 | Bacteria | 1739 |
| 490 | Ga0265334_10004160 | 3300028573 | Bacteria | 6480 |
| 491 | Ga0265318_10010718 | 3300028577 | Bacteria | 3981 |
| 492 | Ga0307515_10036166 | 3300028794 | Bacteria | 8000 |
| 493 | Ga0307515_10044146 | 3300028794 | Bacteria | 6898 |
| 494 | Ga0268256_1006209 | 3300030500 | Bacteria | 4491 |
| 495 | Ga0307511_10000003 | 3300030521 | Bacteria | 193269 |
| 496 | Ga0307511_10000291 | 3300030521 | Bacteria | 52887 |
| 497 | Ga0307511_10004074 | 3300030521 | Bacteria | 14943 |
| 498 | Ga0265330_10036161 | 3300031235 | Bacteria | 2201 |
| 499 | Ga0265332_10000918 | 3300031238 | Bacteria | 17669 |
| 500 | Ga0265328_10005428 | 3300031239 | Bacteria | 5458 |
| 501 | Ga0265325_10001565 | 3300031241 | Bacteria | 15956 |
| 502 | Ga0265340_10018193 | 3300031247 | Bacteria | 3627 |
| 503 | Ga0265340_10019823 | 3300031247 | Bacteria | 3461 |
| 504 | Ga0265339_10039003 | 3300031249 | Bacteria | 2646 |
| 505 | Ga0265331_10013032 | 3300031250 | Bacteria | 4480 |
| 506 | Ga0265327_10032700 | 3300031251 | Bacteria | 2908 |
| 507 | Ga0265327_10033246 | 3300031251 | Bacteria | 2877 |
| 508 | Ga0265327_10050585 | 3300031251 | Bacteria | 2173 |
| 509 | Ga0265327_10079765 | 3300031251 | Bacteria | 1620 |
| 510 | Ga0307513_10017907 | 3300031456 | Bacteria | 8482 |
| 511 | Ga0307408_100032375 | 3300031548 | Bacteria | 3645 |
| 512 | Ga0265314_10039949 | 3300031711 | Bacteria | 3373 |
| 513 | Ga0265314_10158732 | 3300031711 | Bacteria | 1379 |
| 514 | Ga0265342_10013002 | 3300031712 | Bacteria | 5611 |
| 515 | Ga0265342_10038213 | 3300031712 | Bacteria | 2924 |
| 516 | Ga0307405_10078016 | 3300031731 | Bacteria | 2154 |
| 517 | Ga0307407_10156295 | 3300031903 | Bacteria | 1488 |
| 518 | Ga0307412_10000837 | 3300031911 | Bacteria | 17678 |
| 519 | Ga0307412_10096622 | 3300031911 | Bacteria | 2080 |
| 520 | Ga0307412_10207387 | 3300031911 | Bacteria | 1493 |
| 521 | Ga0307416_100061953 | 3300032002 | Bacteria | 3056 |
| 522 | Ga0307416_100081311 | 3300032002 | Bacteria | 2739 |
| 523 | Ga0307416_100309314 | 3300032002 | Bacteria | 1576 |
| 524 | Ga0307411_10062082 | 3300032005 | Bacteria | 2491 |
| 525 | Ga0307411_10120657 | 3300032005 | Bacteria | 1896 |
| 526 | Ga0307507_10033219 | 3300033179 | Bacteria | 5361 |
| 527 | Ga0307507_10170294 | 3300033179 | Bacteria | 1584 |
| 528 | Ga0373948_0003025 | 3300034817 | Bacteria | 2546 |
| 529 | Ga0373950_0010391 | 3300034818 | Bacteria | 1503 |
| 530 | Ga0373959_0008868 | 3300034820 | Bacteria | 1722 |
| 531 | Ga0373959_0020155 | 3300034820 | Bacteria | 1270 |
| 532 | Ga0373926_0002597 | 3300035083 | Bacteria | 5737 |
| 533 | Ga0373926_0023408 | 3300035083 | Bacteria | 2145 |
| 534 | Ga0373928_0001062 | 3300035084 | Bacteria | 5431 |
| 535 | Ga0373928_0008849 | 3300035084 | Bacteria | 1961 |
| 536 | Ga0373929_0012240 | 3300035085 | Unclassified | 1628 |
| 537 | Ga0373949_0003293 | 3300035090 | Bacteria | 3882 |
| 538 | Ga0373949_0018958 | 3300035090 | Unclassified | 1563 |
| 539 | Ga0373951_0011292 | 3300035091 | Bacteria | 2005 |
| 540 | Ga0373951_0013523 | 3300035091 | Unclassified | 1835 |
| 541 | Ga0373923_0000495 | 3300035111 | Bacteria | 9476 |
| 542 | Ga0373923_0072545 | 3300035111 | Bacteria | 1481 |
| 543 | Ga0373932_0001314 | 3300035112 | Bacteria | 6996 |
| 544 | Ga0373932_0003182 | 3300035112 | Bacteria | 3991 |
| 545 | Ga0373936_0002892 | 3300035113 | Bacteria | 6411 |
| 546 | Ga0373936_0004697 | 3300035113 | Bacteria | 5162 |
| 547 | Ga0373936_0010042 | 3300035113 | Bacteria | 3574 |
| 548 | Ga0373936_0012815 | 3300035113 | Bacteria | 3195 |
| 549 | Ga0373939_0012698 | 3300035114 | Bacteria | 2152 |
| 550 | Ga0373939_0014135 | 3300035114 | Bacteria | 2066 |
| 551 | Ga0373941_0001753 | 3300035115 | Bacteria | 4661 |
| 552 | Ga0373941_0019039 | 3300035115 | Bacteria | 1905 |
| 553 | Ga0373945_0012190 | 3300035116 | Bacteria | 2851 |
| 554 | Ga0373953_0001502 | 3300035117 | Bacteria | 6766 |
| 555 | Ga0373953_0002531 | 3300035117 | Bacteria | 5521 |
| 556 | Ga0373954_0002119 | 3300035118 | Bacteria | 8234 |
| 557 | Ga0373956_0007806 | 3300035119 | Bacteria | 4316 |
| 558 | Ga0373960_0003865 | 3300035121 | Bacteria | 3410 |
| 559 | Ga0373960_0009403 | 3300035121 | Bacteria | 2367 |
| 560 | Ga0373943_0008697 | 3300035170 | Bacteria | 4552 |
| 561 | Ga0373946_0006665 | 3300035171 | Bacteria | 4195 |
| 562 | Ga0373946_0024813 | 3300035171 | Bacteria | 2353 |
| 563 | Ga0373946_0027439 | 3300035171 | Bacteria | 2252 |
| 564 | Ga0373955_0000114 | 3300035172 | Bacteria | 32465 |
| 565 | Ga0373955_0183533 | 3300035172 | Bacteria | 1242 |
| 566 | Ga0373942_0001366 | 3300035207 | Bacteria | 6305 |
| 567 | Ga0373942_0006353 | 3300035207 | Bacteria | 2729 |
| 568 | Ga0373961_0007738 | 3300035241 | Bacteria | 2603 |
| 569 | Ga0373962_0008076 | 3300035242 | Bacteria | 2586 |
| 570 | Ga0373962_0012009 | 3300035242 | Bacteria | 2178 |
| 571 | Ga0373962_0057273 | 3300035242 | Bacteria | 1137 |
| 572 | Ga0373962_0057477 | 3300035242 | Bacteria | 1135 |
| 573 | Ga0373962_0059180 | 3300035242 | Bacteria | 1122 |
| 574 | Ga0373924_0078273 | 3300035410 | Bacteria | 1403 |
| 575 | Ga0373931_0000248 | 3300035691 | Bacteria | 22945 |
| 576 | Ga0373931_0007632 | 3300035691 | Bacteria | 5100 |
| 577 | Ga0373931_0021328 | 3300035691 | Bacteria | 3249 |
| 578 | Ga0373931_0021482 | 3300035691 | Bacteria | 3239 |
| 579 | Ga0373931_0051166 | 3300035691 | Bacteria | 2199 |
| 580 | Ga0373931_0058671 | 3300035691 | Bacteria | 2068 |
| 581 | Ga0373935_0000367 | 3300035692 | Bacteria | 23034 |
| 582 | Ga0373935_0011448 | 3300035692 | Bacteria | 5325 |
| 583 | Ga0373935_0038632 | 3300035692 | Bacteria | 2989 |
| 584 | Ga0373935_0117403 | 3300035692 | Bacteria | 1773 |
| 585 | Ga0373935_0178847 | 3300035692 | Unclassified | 1455 |
| 586 | Ga0373927_0004943 | 3300035695 | Bacteria | 9248 |
| 587 | Ga0373927_0016071 | 3300035695 | Bacteria | 4938 |
| 588 | Ga0373927_0017712 | 3300035695 | Bacteria | 4686 |
| 589 | Ga0373927_0018530 | 3300035695 | Bacteria | 4571 |
| 590 | Ga0373927_0027947 | 3300035695 | Bacteria | 3681 |
| 591 | Ga0373927_0042945 | 3300035695 | Bacteria | 2929 |
| 592 | Ga0373933_0010246 | 3300035724 | Bacteria | 5135 |
| 593 | Ga0373933_0099356 | 3300035724 | Bacteria | 1804 |
| 594 | Ga0373947_0009271 | 3300035725 | Bacteria | 5655 |
| 595 | Ga0373947_0017478 | 3300035725 | Bacteria | 4125 |
| 596 | Ga0373947_0027599 | 3300035725 | Bacteria | 3323 |
| 597 | Ga0373947_0193206 | 3300035725 | Bacteria | 1329 |
| 598 | Ga0373937_0000079 | 3300036401 | Bacteria | 88626 |
| 599 | Ga0373937_0098638 | 3300036401 | Bacteria | 2710 |
| 600 | Ga0373937_0106150 | 3300036401 | Bacteria | 2611 |
| 601 | Ga0373925_0000007 | 3300037068 | Bacteria | 257023 |
| 602 | Ga0373925_0020792 | 3300037068 | Bacteria | 4782 |
| 603 | Ga0373925_0023218 | 3300037068 | Bacteria | 4526 |
| 604 | Ga0373925_0034905 | 3300037068 | Bacteria | 3708 |
| 605 | Ga0373925_0384308 | 3300037068 | Bacteria | 1143 |
| 606 | Ga0395899_0001158 | 3300037312 | Bacteria | 23306 |
| 607 | Ga0395900_0156171 | 3300037418 | Bacteria | 2330 |
| 608 | Ga0395900_0250587 | 3300037418 | Bacteria | 1772 |
| 609 | Ga0395898_0005496 | 3300037466 | Bacteria | 13687 |
| 610 | Ga0395898_0069032 | 3300037466 | Bacteria | 3420 |
| 611 | Ga0395905_0139539 | 3300037471 | Bacteria | 2281 |
| 612 | Ga0395905_0184678 | 3300037471 | Bacteria | 1957 |
| 613 | Ga0395905_0236122 | 3300037471 | Bacteria | 1709 |
| 614 | Ga0436365_1136772 | 3300039437 | Bacteria | 28283 |
| 615 | Ga0436365_1284888 | 3300039437 | Bacteria | 16521 |
| 616 | Ga0439436_0018312 | 3300041404 | Bacteria | 2094 |
| 617 | Ga0450898_003691 | 3300042134 | Bacteria | 2212 |
| 618 | Ga0439446_0031484 | 3300042156 | Bacteria | 1535 |
| 619 | Ga0439435_0029294 | 3300042436 | Bacteria | 1485 |
| 620 | Ga0451577_0178788 | 3300042876 | Bacteria | 1912 |
| 621 | Ga0466963_0166135 | 3300044694 | Bacteria | 1537 |
| 622 | Ga0466964_0078674 | 3300044706 | Bacteria | 1410 |
| 623 | Ga0453684_0382226 | 3300044712 | Bacteria | 1581 |
| 624 | Ga0466960_0003041 | 3300044901 | Bacteria | 6408 |
| 625 | Ga0451576_0017934 | 3300045051 | Bacteria | 7770 |
| 626 | Ga0451576_0018069 | 3300045051 | Bacteria | 7738 |
| 627 | Ga0451576_0114121 | 3300045051 | Bacteria | 2812 |
| 628 | Ga0451576_0119336 | 3300045051 | Bacteria | 2745 |
| 629 | Ga0451576_0392362 | 3300045051 | Bacteria | 1455 |
| 630 | Ga0466967_0007807 | 3300045976 | Bacteria | 7773 |
| 631 | Ga0466967_0010524 | 3300045976 | Bacteria | 6946 |
| 632 | Ga0466967_0376915 | 3300045976 | Bacteria | 1377 |
| 633 | Ga0495592_0000254 | 3300046454 | Bacteria | 45710 |
| 634 | Ga0495592_0054761 | 3300046454 | Bacteria | 2953 |
| 635 | Ga0495592_0067041 | 3300046454 | Bacteria | 2624 |
| 636 | Ga0495592_0107961 | 3300046454 | Bacteria | 1973 |
| 637 | Ga0495603_0002597 | 3300046455 | Bacteria | 10664 |
| 638 | Ga0495629_0004780 | 3300046459 | Bacteria | 10153 |
| 639 | Ga0495629_0024258 | 3300046459 | Bacteria | 4319 |
| 640 | Ga0495629_0157421 | 3300046459 | Bacteria | 1578 |
| 641 | Ga0495629_0194134 | 3300046459 | Bacteria | 1404 |
| 642 | Ga0495641_0025893 | 3300046461 | Bacteria | 2872 |
| 643 | Ga0495641_0065905 | 3300046461 | Bacteria | 1630 |
| 644 | Ga0495651_0000796 | 3300046462 | Bacteria | 24460 |
| 645 | Ga0495651_0217757 | 3300046462 | Bacteria | 1324 |
| 646 | Ga0495653_0000034 | 3300046463 | Bacteria | 131084 |
| 647 | Ga0495653_0048552 | 3300046463 | Bacteria | 3275 |
| 648 | Ga0495580_0004635 | 3300046472 | Bacteria | 11547 |
| 649 | Ga0495580_0080896 | 3300046472 | Bacteria | 2264 |
| 650 | Ga0495582_0008869 | 3300046473 | Bacteria | 5548 |
| 651 | Ga0495582_0134511 | 3300046473 | Bacteria | 1398 |
| 652 | Ga0495605_0005057 | 3300046474 | Bacteria | 7697 |
| 653 | Ga0495639_0042446 | 3300046475 | Bacteria | 2051 |
| 654 | Ga0495639_0047771 | 3300046475 | Bacteria | 1940 |
| 655 | Ga0495662_0025763 | 3300046476 | Bacteria | 2840 |
| 656 | Ga0495664_0000003 | 3300046477 | Bacteria | 551602 |
| 657 | Ga0495664_0222677 | 3300046477 | Bacteria | 1142 |
| 658 | Ga0495594_0020833 | 3300046499 | Bacteria | 3495 |
| 659 | Ga0495594_0036814 | 3300046499 | Bacteria | 2670 |
| 660 | Ga0495596_0001648 | 3300046500 | Bacteria | 12690 |
| 661 | Ga0495607_0027444 | 3300046501 | Bacteria | 3520 |
| 662 | Ga0495608_0000319 | 3300046511 | Bacteria | 33877 |
| 663 | Ga0495608_0030250 | 3300046511 | Bacteria | 3667 |
| 664 | Ga0495610_0002348 | 3300046512 | Bacteria | 15988 |
| 665 | Ga0495616_0001459 | 3300046513 | Bacteria | 16445 |
| 666 | Ga0495616_0006405 | 3300046513 | Bacteria | 7124 |
| 667 | Ga0495618_0000018 | 3300046514 | Bacteria | 139407 |
| 668 | Ga0495618_0042574 | 3300046514 | Bacteria | 2862 |
| 669 | Ga0495628_0000001 | 3300046516 | Bacteria | 917742 |
| 670 | Ga0495628_0043315 | 3300046516 | Bacteria | 3586 |
| 671 | Ga0495628_0043898 | 3300046516 | Bacteria | 3558 |
| 672 | Ga0495628_0128494 | 3300046516 | Bacteria | 1940 |
| 673 | Ga0495630_0001309 | 3300046517 | Bacteria | 17126 |
| 674 | Ga0495630_0003154 | 3300046517 | Bacteria | 11440 |
| 675 | Ga0495631_0074624 | 3300046518 | Bacteria | 1464 |
| 676 | Ga0495643_0000328 | 3300046522 | Bacteria | 65181 |
| 677 | Ga0495643_0008336 | 3300046522 | Bacteria | 6574 |
| 678 | Ga0495663_0017577 | 3300046525 | Bacteria | 2031 |
| 679 | Ga0495666_0019454 | 3300046526 | Bacteria | 3369 |
| 680 | Ga0495666_0045628 | 3300046526 | Bacteria | 2114 |
| 681 | Ga0495642_0004946 | 3300046528 | Bacteria | 5139 |
| 682 | Ga0495652_0000006 | 3300046529 | Bacteria | 459709 |
| 683 | Ga0495652_0007326 | 3300046529 | Bacteria | 10175 |
| 684 | Ga0495652_0219774 | 3300046529 | Bacteria | 1428 |
| 685 | Ga0495652_0242698 | 3300046529 | Bacteria | 1339 |
| 686 | Ga0495665_0035527 | 3300046531 | Bacteria | 2662 |
| 687 | Ga0495640_0000002 | 3300046533 | Bacteria | 646434 |
| 688 | Ga0495640_0038231 | 3300046533 | Bacteria | 3376 |
| 689 | Ga0495640_0191522 | 3300046533 | Bacteria | 1300 |
| 690 | Ga0495586_0012666 | 3300046535 | Bacteria | 4472 |
| 691 | Ga0495586_0018239 | 3300046535 | Bacteria | 3736 |
| 692 | Ga0495586_0144930 | 3300046535 | Bacteria | 1334 |
| 693 | Ga0495587_0000001 | 3300046536 | Bacteria | 724132 |
| 694 | Ga0495598_0026265 | 3300046537 | Bacteria | 1595 |
| 695 | Ga0495598_0040998 | 3300046537 | Bacteria | 1353 |
| 696 | Ga0495609_0003430 | 3300046538 | Bacteria | 9084 |
| 697 | Ga0495609_0084838 | 3300046538 | Bacteria | 1382 |
| 698 | Ga0495621_0008649 | 3300046539 | Bacteria | 3062 |
| 699 | Ga0495621_0060168 | 3300046539 | Bacteria | 1377 |
| 700 | Ga0495597_0028452 | 3300046542 | Archaea | 2558 |
| 701 | Ga0495645_0000009 | 3300046543 | Bacteria | 239632 |
| 702 | Ga0495645_0001560 | 3300046543 | Bacteria | 15521 |
| 703 | Ga0495667_0000004 | 3300046559 | Bacteria | 295297 |
| 704 | Ga0495656_0001315 | 3300046615 | Bacteria | 8082 |
| 705 | Ga0495656_0085415 | 3300046615 | Bacteria | 1433 |
| 706 | Ga0495668_0096430 | 3300046616 | Unclassified | 1618 |
| 707 | Ga0495668_0123130 | 3300046616 | Bacteria | 1419 |
| 708 | Ga0495634_0000014 | 3300046642 | Bacteria | 128091 |
| 709 | Ga0495634_0019822 | 3300046642 | Bacteria | 4774 |
| 710 | Ga0495634_0038522 | 3300046642 | Bacteria | 3259 |
| 711 | Ga0495634_0103732 | 3300046642 | Bacteria | 1835 |
| 712 | Ga0495635_0000001 | 3300046663 | Bacteria | 704901 |
| 713 | Ga0495635_0336099 | 3300046663 | Bacteria | 1009 |
| 714 | Ga0495661_0007293 | 3300046665 | Bacteria | 7709 |
| 715 | Ga0495661_0175849 | 3300046665 | Bacteria | 1138 |
| 716 | Ga0495661_0188946 | 3300046665 | Bacteria | 1086 |
| 717 | Ga0495657_0000336 | 3300046675 | Bacteria | 43164 |
| 718 | Ga0495657_0011703 | 3300046675 | Bacteria | 6544 |
| 719 | Ga0495599_0000053 | 3300046678 | Bacteria | 80559 |
| 720 | Ga0495599_0003895 | 3300046678 | Bacteria | 8780 |
| 721 | Ga0495599_0174424 | 3300046678 | Bacteria | 1326 |
| 722 | Ga0495623_0000091 | 3300046679 | Bacteria | 53677 |
| 723 | Ga0495646_0000020 | 3300046680 | Bacteria | 117021 |
| 724 | Ga0495646_0116993 | 3300046680 | Bacteria | 1512 |
| 725 | Ga0495647_0000477 | 3300046681 | Bacteria | 11635 |
| 726 | Ga0495647_0011475 | 3300046681 | Bacteria | 3037 |
| 727 | Ga0495647_0069174 | 3300046681 | Bacteria | 1409 |
| 728 | Ga0495658_0014860 | 3300046683 | Bacteria | 3985 |
| 729 | Ga0495658_0119044 | 3300046683 | Bacteria | 1595 |
| 730 | Ga0495613_0009581 | 3300046689 | Bacteria | 7196 |
| 731 | Ga0495613_0132118 | 3300046689 | Bacteria | 1787 |
| 732 | Ga0495613_0219694 | 3300046689 | Bacteria | 1334 |
| 733 | Ga0495624_0081084 | 3300046690 | Bacteria | 2010 |
| 734 | Ga0495670_0139606 | 3300046691 | Bacteria | 1267 |
| 735 | Ga0495671_0019692 | 3300046692 | Bacteria | 3562 |
| 736 | Ga0495649_0012031 | 3300046694 | Bacteria | 5054 |
| 737 | Ga0495600_0000123 | 3300046809 | Bacteria | 43494 |
| 738 | Ga0495600_0014825 | 3300046809 | Bacteria | 4916 |
| 739 | Ga0495581_0111908 | 3300047315 | Bacteria | 1588 |
| 740 | Ga0495604_0000008 | 3300047317 | Bacteria | 341160 |
| 741 | Ga0495604_0121878 | 3300047317 | Bacteria | 1886 |
| 742 | Ga0495636_0108300 | 3300047318 | Bacteria | 1221 |
| 743 | Ga0495674_0000016 | 3300047319 | Bacteria | 216763 |
| 744 | Ga0495674_0026636 | 3300047319 | Bacteria | 5290 |
| 745 | Ga0495674_0092029 | 3300047319 | Bacteria | 2590 |
| 746 | Ga0495674_0180261 | 3300047319 | Bacteria | 1759 |
| 747 | Ga0495672_0013747 | 3300047320 | Bacteria | 5570 |
| 748 | Ga0495672_0054522 | 3300047320 | Bacteria | 2336 |
| 749 | Ga0495676_0007711 | 3300047321 | Bacteria | 9874 |
| 750 | Ga0495676_0021776 | 3300047321 | Bacteria | 5590 |
| 751 | Ga0495680_0024757 | 3300047322 | Bacteria | 4974 |
| 752 | Ga0495680_0203478 | 3300047322 | Bacteria | 1419 |
| 753 | Ga0495687_029483 | 3300047443 | Bacteria | 2538 |
| 754 | Ga0495675_0014865 | 3300047444 | Bacteria | 4922 |
| 755 | Ga0495675_0024425 | 3300047444 | Bacteria | 3852 |
| 756 | Ga0495679_042683 | 3300047446 | Bacteria | 1398 |
| 757 | Ga0495681_0114367 | 3300047470 | Bacteria | 1165 |
| 758 | Ga0495684_0000002 | 3300047471 | Bacteria | 341216 |
| 759 | Ga0495684_0028395 | 3300047471 | Bacteria | 4295 |
| 760 | Ga0495684_0101229 | 3300047471 | Bacteria | 2178 |
| 761 | Ga0495684_0329526 | 3300047471 | Bacteria | 1089 |
| 762 | Ga0495593_0001468 | 3300047673 | Bacteria | 13846 |
| 763 | Ga0495602_0000022 | 3300048088 | Bacteria | 163672 |
| 764 | Ga0495602_0098310 | 3300048088 | Bacteria | 2409 |
| 765 | Ga0495602_0103211 | 3300048088 | Bacteria | 2334 |
| 766 | Ga0495602_0217112 | 3300048088 | Bacteria | 1446 |
| 767 | Ga0495626_0000652 | 3300048091 | Bacteria | 33405 |
| 768 | Ga0495626_0014553 | 3300048091 | Bacteria | 4053 |
| 769 | Ga0496100_0088053 | 3300048903 | Bacteria | 2112 |
| 770 | Ga0496100_0237526 | 3300048903 | Bacteria | 1343 |
| 771 | Ga0496101_0004652 | 3300048904 | Bacteria | 8678 |
| 772 | Ga0496101_0013711 | 3300048904 | Bacteria | 5436 |
| 773 | Ga0496101_0072282 | 3300048904 | Bacteria | 2531 |
| 774 | Ga0496102_0006819 | 3300048905 | Bacteria | 9746 |
| 775 | Ga0496102_0019179 | 3300048905 | Bacteria | 6021 |
| 776 | Ga0496102_0028178 | 3300048905 | Bacteria | 5017 |
| 777 | Ga0496102_0621472 | 3300048905 | Bacteria | 1003 |
| 778 | Ga0496103_0015056 | 3300048906 | Bacteria | 4598 |
| 779 | Ga0496103_0020735 | 3300048906 | Bacteria | 3951 |
| 780 | Ga0496103_0240574 | 3300048906 | Bacteria | 1164 |
| 781 | Ga0496104_0000833 | 3300048907 | Bacteria | 26625 |
| 782 | Ga0496104_0001498 | 3300048907 | Bacteria | 20143 |
| 783 | Ga0496104_0014338 | 3300048907 | Bacteria | 7158 |
| 784 | Ga0496105_0000355 | 3300048908 | Bacteria | 30230 |
| 785 | Ga0496105_0006679 | 3300048908 | Bacteria | 8880 |
| 786 | Ga0496105_0026794 | 3300048908 | Bacteria | 4705 |
| 787 | Ga0496105_0045267 | 3300048908 | Bacteria | 3630 |
| 788 | Ga0496105_0074093 | 3300048908 | Bacteria | 2812 |
| 789 | Ga0496105_0084557 | 3300048908 | Bacteria | 2621 |
| 790 | Ga0496106_0003706 | 3300048909 | Bacteria | 11402 |
| 791 | Ga0496106_0050670 | 3300048909 | Bacteria | 3129 |
| 792 | Ga0496106_0066422 | 3300048909 | Bacteria | 2747 |
| 793 | Ga0496107_0017060 | 3300048910 | Bacteria | 5105 |
| 794 | Ga0496107_0035525 | 3300048910 | Bacteria | 3572 |
| 795 | Ga0496107_0071406 | 3300048910 | Bacteria | 2522 |
| 796 | Ga0496108_0049181 | 3300048911 | Bacteria | 3526 |
| 797 | Ga0496108_0109059 | 3300048911 | Bacteria | 2365 |
| 798 | Ga0496109_0006773 | 3300048912 | Bacteria | 9650 |
| 799 | Ga0496109_0014145 | 3300048912 | Bacteria | 6937 |
| 800 | Ga0496109_0124796 | 3300048912 | Bacteria | 2400 |
| 801 | Ga0496109_0184285 | 3300048912 | Bacteria | 1961 |
| 802 | Ga0496109_0377269 | 3300048912 | Bacteria | 1340 |
| 803 | Ga0496110_0006467 | 3300048913 | Bacteria | 9285 |
| 804 | Ga0496110_0060655 | 3300048913 | Bacteria | 3337 |
| 805 | Ga0496110_0151410 | 3300048913 | Bacteria | 2100 |
| 806 | Ga0496110_0406882 | 3300048913 | Bacteria | 1240 |
| 807 | Ga0496110_0492800 | 3300048913 | Bacteria | 1116 |
| 808 | Ga0496111_0004396 | 3300048914 | Bacteria | 8901 |
| 809 | Ga0496111_0014603 | 3300048914 | Bacteria | 5371 |
| 810 | Ga0496111_0069916 | 3300048914 | Bacteria | 2553 |
| 811 | Ga0496112_0001747 | 3300048915 | Bacteria | 17023 |
| 812 | Ga0496112_0011575 | 3300048915 | Bacteria | 8064 |
| 813 | Ga0496112_0015894 | 3300048915 | Bacteria | 7033 |
| 814 | Ga0496112_0073985 | 3300048915 | Bacteria | 3368 |
| 815 | Ga0496113_0000322 | 3300048916 | Bacteria | 22806 |
| 816 | Ga0496113_0000645 | 3300048916 | Bacteria | 17565 |
| 817 | Ga0496113_0086728 | 3300048916 | Bacteria | 2405 |
| 818 | Ga0496114_0020754 | 3300048917 | Bacteria | 5333 |
| 819 | Ga0496114_0021866 | 3300048917 | Bacteria | 5206 |
| 820 | Ga0496114_0050710 | 3300048917 | Bacteria | 3455 |
| 821 | Ga0496114_0137361 | 3300048917 | Bacteria | 2114 |
| 822 | Ga0496114_0157570 | 3300048917 | Bacteria | 1972 |
| 823 | Ga0496115_0003546 | 3300048918 | Bacteria | 11224 |
| 824 | Ga0496115_0081022 | 3300048918 | Bacteria | 2643 |
| 825 | Ga0496116_0001838 | 3300048919 | Bacteria | 22937 |
| 826 | Ga0496117_0019813 | 3300048920 | Bacteria | 5511 |
| 827 | Ga0496117_0213509 | 3300048920 | Bacteria | 1080 |
| 828 | Ga0496118_0010842 | 3300048921 | Bacteria | 8975 |
| 829 | Ga0496118_0016901 | 3300048921 | Bacteria | 6665 |
| 830 | Ga0496119_0012107 | 3300048922 | Bacteria | 7045 |
| 831 | Ga0496119_0210570 | 3300048922 | Bacteria | 1000 |
| 832 | Ga0496120_0106325 | 3300048923 | Bacteria | 1473 |
| 833 | Ga0496121_0000127 | 3300048924 | Bacteria | 168545 |
| 834 | Ga0496121_0026802 | 3300048924 | Bacteria | 5415 |
| 835 | Ga0496121_0032233 | 3300048924 | Bacteria | 4768 |
| 836 | Ga0496122_0000601 | 3300048925 | Bacteria | 74140 |
| 837 | Ga0496122_0076019 | 3300048925 | Bacteria | 2365 |
| 838 | Ga0496122_0082403 | 3300048925 | Bacteria | 2234 |
| 839 | Ga0496123_0001435 | 3300048926 | Bacteria | 33260 |
| 840 | Ga0496123_0002704 | 3300048926 | Bacteria | 21311 |
| 841 | Ga0496123_0035472 | 3300048926 | Bacteria | 3553 |
| 842 | Ga0496124_0000346 | 3300048927 | Bacteria | 84852 |
| 843 | Ga0496124_0090623 | 3300048927 | Bacteria | 2493 |
| 844 | Ga0496124_0107594 | 3300048927 | Bacteria | 2249 |
| 845 | Ga0496124_0165800 | 3300048927 | Bacteria | 1717 |
| 846 | Ga0496124_0168399 | 3300048927 | Bacteria | 1700 |
| 847 | Ga0496125_0000011 | 3300048928 | Bacteria | 655895 |
| 848 | Ga0496125_0002692 | 3300048928 | Bacteria | 22621 |
| 849 | Ga0496125_0022861 | 3300048928 | Bacteria | 5792 |
| 850 | Ga0496125_0045932 | 3300048928 | Bacteria | 3670 |
| 851 | Ga0496126_0010507 | 3300048929 | Bacteria | 9695 |
| 852 | Ga0501299_011371 | 3300049522 | Bacteria | 1503 |
| 853 | Ga0501033_0045454 | 3300049570 | Bacteria | 3268 |
| 854 | Ga0501034_0146215 | 3300049571 | Bacteria | 2341 |
| 855 | Ga0501037_0367392 | 3300049573 | Bacteria | 990 |
| 856 | Ga0501039_0177799 | 3300049575 | Bacteria | 1673 |
| 857 | Ga0501042_0117158 | 3300049578 | Bacteria | 1918 |
| 858 | Ga0501042_0262798 | 3300049578 | Bacteria | 1246 |
| 859 | Ga0501043_0036204 | 3300049579 | Bacteria | 3882 |
| 860 | Ga0501043_0180118 | 3300049579 | Bacteria | 1647 |
| 861 | Ga0501047_0006619 | 3300049581 | Bacteria | 10900 |
| 862 | Ga0501067_0012561 | 3300049583 | Bacteria | 4700 |
| 863 | Ga0501071_0257645 | 3300049587 | Bacteria | 1317 |
| 864 | Ga0501076_0073575 | 3300049592 | Bacteria | 2736 |
| 865 | Ga0501077_0028385 | 3300049593 | Bacteria | 3557 |
| 866 | Ga0501079_0012449 | 3300049741 | Bacteria | 6492 |
| 867 | Ga0501080_0066635 | 3300049742 | Bacteria | 3349 |
| 868 | Ga0501035_0010453 | 3300049822 | Bacteria | 8602 |
| 869 | Ga0501044_0004409 | 3300049823 | Bacteria | 15749 |
| 870 | Ga0501044_0256039 | 3300049823 | Bacteria | 1690 |
| 871 | nmdc:mga03683_28381_c1 | 3300050489 | Bacteria | 2225 |
| 872 | nmdc:mga03683_31875_c1 | 3300050489 | Unclassified | 2117 |
| 873 | nmdc:mga03683_7685_c1 | 3300050489 | Bacteria | 3754 |
| 874 | nmdc:mga00v17_43570_c1 | 3300050491 | Bacteria | 2703 |
| 875 | nmdc:mga00v17_97219_c1 | 3300050491 | Bacteria | 1856 |
| 876 | nmdc:mga0yw44_11367_c1 | 3300050492 | Bacteria | 4590 |
| 877 | nmdc:mga0yw44_175562_c1 | 3300050492 | Bacteria | 1408 |
| 878 | nmdc:mga0yw44_190996_c1 | 3300050492 | Bacteria | 1351 |
| 879 | nmdc:mga0yw44_21483_c1 | 3300050492 | Bacteria | 3601 |
| 880 | nmdc:mga0yw44_296007_c1 | 3300050492 | Bacteria | 1084 |
| 881 | nmdc:mga0k408_15449_c1 | 3300050493 | Bacteria | 4223 |
| 882 | nmdc:mga0k408_83582_c1 | 3300050493 | Bacteria | 1872 |
| 883 | nmdc:mga06z11_35069_c1 | 3300050494 | Bacteria | 2467 |
| 884 | nmdc:mga06z11_35616_c1 | 3300050494 | Bacteria | 2452 |
| 885 | nmdc:mga07m45_10183_c1 | 3300050496 | Bacteria | 4903 |
| 886 | nmdc:mga05p37_453_c1 | 3300050507 | Bacteria | 44606 |
| 887 | nmdc:mga05p37_5672_c1 | 3300050507 | Bacteria | 14675 |
| 888 | nmdc:mga09592_2036_c1 | 3300050508 | Bacteria | 16307 |
| 889 | nmdc:mga09592_2477_c1 | 3300050508 | Bacteria | 14910 |
| 890 | nmdc:mga0qj67_102839_c1 | 3300050509 | Bacteria | 2304 |
| 891 | nmdc:mga06r32_101596_c1 | 3300050510 | Bacteria | 2822 |
| 892 | nmdc:mga06r32_268879_c1 | 3300050510 | Bacteria | 1692 |
| 893 | nmdc:mga06r32_58494_c1 | 3300050510 | Bacteria | 3704 |
| 894 | nmdc:mga08y16_10655_c1 | 3300050511 | Bacteria | 9649 |
| 895 | nmdc:mga08y16_11404_c1 | 3300050511 | Bacteria | 9339 |
| 896 | nmdc:mga08y16_13184_c1 | 3300050511 | Bacteria | 8694 |
| 897 | nmdc:mga08y16_168649_c1 | 3300050511 | Bacteria | 2274 |
| 898 | nmdc:mga08y16_30147_c1 | 3300050511 | Bacteria | 5710 |
| 899 | nmdc:mga08y16_51079_c1 | 3300050511 | Bacteria | 4325 |
| 900 | nmdc:mga08y16_532970_c1 | 3300050511 | Bacteria | 1190 |
| 901 | nmdc:mga08y16_81141_c1 | 3300050511 | Bacteria | 3381 |
| 902 | nmdc:mga0n895_151_c1 | 3300050512 | Bacteria | 42739 |
| 903 | nmdc:mga0n895_16155_c1 | 3300050512 | Bacteria | 6842 |
| 904 | nmdc:mga0n895_2741_c1 | 3300050512 | Bacteria | 13912 |
| 905 | nmdc:mga0n895_276122_c1 | 3300050512 | Bacteria | 1704 |
| 906 | nmdc:mga0n895_287519_c1 | 3300050512 | Bacteria | 1667 |
| 907 | nmdc:mga0n895_80247_c1 | 3300050512 | Bacteria | 3250 |
| 908 | nmdc:mga0rr50_104989_c1 | 3300050513 | Bacteria | 2227 |
| 909 | nmdc:mga0rr50_1131_c1 | 3300050513 | Bacteria | 14513 |
| 910 | nmdc:mga0rr50_147293_c1 | 3300050513 | Bacteria | 1899 |
| 911 | nmdc:mga0rr50_2318_c1 | 3300050513 | Bacteria | 10677 |
| 912 | nmdc:mga0rr50_262381_c1 | 3300050513 | Bacteria | 1437 |
| 913 | nmdc:mga08x19_11499_c1 | 3300050514 | Bacteria | 5326 |
| 914 | nmdc:mga08x19_125760_c1 | 3300050514 | Bacteria | 1721 |
| 915 | nmdc:mga08x19_37114_c1 | 3300050514 | Bacteria | 3091 |
| 916 | nmdc:mga08x19_3775_c1 | 3300050514 | Bacteria | 9016 |
| 917 | nmdc:mga08x19_548_c1 | 3300050514 | Bacteria | 24677 |
| 918 | nmdc:mga08x19_7499_c1 | 3300050514 | Bacteria | 6480 |
| 919 | nmdc:mga0a205_1935_c1 | 3300050515 | Bacteria | 17991 |
| 920 | nmdc:mga0a205_284_c1 | 3300050515 | Bacteria | 37182 |
| 921 | nmdc:mga0a205_39962_c1 | 3300050515 | Bacteria | 4516 |
| 922 | nmdc:mga0sz30_20660_c1 | 3300050516 | Bacteria | 2657 |
| 923 | nmdc:mga0sz30_62920_c1 | 3300050516 | Bacteria | 1588 |
| 924 | nmdc:mga0sz30_85365_c1 | 3300050516 | Bacteria | 1370 |
| 925 | Ga0495601_0000001 | 3300053077 | Bacteria | 549454 |
| 926 | Ga0495601_0011988 | 3300053077 | Bacteria | 5194 |
| 927 | Ga0495601_0030384 | 3300053077 | Bacteria | 3354 |
| 928 | Ga0495601_0037851 | 3300053077 | Bacteria | 3015 |
| 929 | Ga0495601_0097252 | 3300053077 | Bacteria | 1899 |
| 930 | Ga0495601_0247841 | 3300053077 | Bacteria | 1163 |
| 931 | Ga0495612_0000003 | 3300053078 | Bacteria | 303629 |
| 932 | Ga0495612_0102124 | 3300053078 | Bacteria | 1221 |
| 933 | Ga0495612_0176068 | 3300053078 | Bacteria | 938 |
| 934 | Ga0500610_0000022 | 3300053079 | Bacteria | 60344 |
| 935 | Ga0495595_0000082 | 3300053084 | Bacteria | 45698 |
| 936 | Ga0495595_0005771 | 3300053084 | Bacteria | 5012 |
| 937 | Ga0495619_0000004 | 3300053085 | Bacteria | 500068 |
| 938 | Ga0495619_0015254 | 3300053085 | Bacteria | 4859 |
| 939 | Ga0495619_0071972 | 3300053085 | Bacteria | 2314 |
| 940 | Ga0500644_0047593 | 3300053088 | Bacteria | 1455 |
| 941 | Ga0500646_0002103 | 3300053090 | Bacteria | 5191 |
| 942 | Ga0500646_0007545 | 3300053090 | Bacteria | 2782 |
| 943 | Ga0500646_0007754 | 3300053090 | Bacteria | 2743 |
| 944 | Ga0500651_0081671 | 3300053093 | Bacteria | 2001 |
| 945 | Ga0500566_0181016 | 3300053094 | Bacteria | 1081 |
| 946 | Ga0500555_015627 | 3300053103 | Bacteria | 2189 |
| 947 | Ga0500658_0025225 | 3300053134 | Bacteria | 2284 |
| 948 | Ga0500568_0018098 | 3300053139 | Bacteria | 3093 |
| 949 | Ga0500568_0074291 | 3300053139 | Bacteria | 1297 |
| 950 | Ga0500604_0002634 | 3300053151 | Bacteria | 4883 |
| 951 | Ga0500604_0008950 | 3300053151 | Bacteria | 2662 |
| 952 | Ga0500616_0002390 | 3300053153 | Bacteria | 15675 |
| 953 | Ga0500552_000160 | 3300053733 | Bacteria | 5869 |
| 954 | Ga0530510_0171579 | 3300061734 | Bacteria | 1607 |
| 955 | 2514042729 | 2513237165 | Bacteria | 6771773 |
| 956 | 2599905993 | 2599185292 | Bacteria | 6290804 |
| 957 | 2599906170 | 2599185292 | Bacteria | 6290804 |
| 958 | 2643859001 | 2643221569 | Bacteria | 6064337 |
| 959 | 2643861952 | 2643221569 | Bacteria | 6064337 |
| 960 | 2643981004 | 2643221594 | Bacteria | 5811388 |
| 961 | 2643981822 | 2643221594 | Bacteria | 5811388 |
| 962 | 2776265189 | 2775506901 | Bacteria | 9631051 |
| 963 | 2809031670 | 2808606395 | Bacteria | 6020352 |
| 964 | 2809033882 | 2808606395 | Bacteria | 6020352 |
| 965 | 2819600868 | 2818991446 | Bacteria | 7757362 |
| 966 | 2855732517 | 2855730933 | Bacteria | 7047938 |
| 967 | 2855769225 | 2855767633 | Bacteria | 7049357 |
| 968 | 2857546780 | 2857542790 | Bacteria | 5326616 |
| 969 | 2858956490 | 2858950400 | Bacteria | 6783797 |
| 970 | 2881414891 | 2881412998 | Bacteria | 6492157 |
| 971 | 2883577154 | 2883577096 | Bacteria | 4709178 |
| 972 | 2894023573 | 2894023352 | Bacteria | 5167372 |
| 973 | 2894773894 | 2894772417 | Bacteria | 5305674 |
| 974 | 2929201930 | 2929199973 | Bacteria | 7260745 |
| 975 | 2939635059 | 2939631187 | Bacteria | 6118131 |
| 976 | 2941482330 | |||
| 977 | 8055910918 | 8055909800 | Bacteria | 7278581 |
| 978 | Ga0070708_100281237 | |||
| 979 | JGI24743J22301_10023389 | |||
| 980 | JGI24738J21930_10022534 | |||
| 981 | JGI24749J21850_1012853 | |||
| 982 | JGI25152J39213_1000010 | |||
| 983 | JGI25150J39212_1000490 | |||
| 984 | JGI25159J45721_1000381 | |||
| 985 | JGI25151J46595_10000262 | |||
| 986 | JGI25151J46595_10001355 | |||
| 987 | JGI25151J46595_10002847 | |||
| 988 | JGI25406J46586_10000542 | |||
| 989 | JGI25153J46596_10002775 | |||
| 990 | JGI25160J50197_1000583 | |||
| 991 | JGI25161J50226_1000654 | |||
| 992 | JGI25161J50226_1000922 | |||
| 993 | Ga0055535_1000241 | |||
| 994 | Ga0055542_1000126 | |||
| 995 | Ga0055526_1001018 | |||
| 996 | Ga0055526_1001146 | |||
| 997 | Ga0055526_1005040 | |||
| 998 | Ga0055526_1012011 | |||
| 999 | Ga0055526_1019127 | |||
| 1000 | Ga0055537_1000873 | |||
| 1001 | Ga0055537_1001439 | |||
| 1002 | Ga0055524_1000248 | |||
| 1003 | Ga0055524_1000823 | |||
| 1004 | Ga0055536_1034912 | |||
| 1005 | Ga0055534_1000341 | |||
| 1006 | Ga0055534_1000531 | |||
| 1007 | Ga0055534_1000661 | |||
| 1008 | Ga0055528_1000865 | |||
| 1009 | Ga0055540_1015526 | |||
| 1010 | Ga0055540_1015703 | |||
| 1011 | Ga0055531_10004697 | |||
| 1012 | Ga0055543_1000539 | |||
| 1013 | Ga0065165_1001314 | |||
| 1014 | Ga0070676_10220100 | |||
| 1015 | Ga0070683_100018484 | |||
| 1016 | Ga0070690_100019584 | |||
| 1017 | Ga0070690_100056022 | |||
| 1018 | Ga0070690_100238515 | |||
| 1019 | Ga0070670_100042837 | |||
| 1020 | Ga0070670_100123402 | |||
| 1021 | Ga0070670_100277701 | |||
| 1022 | Ga0070677_10047287 | |||
| 1023 | Ga0068869_100017953 | |||
| 1024 | Ga0068869_100102400 | |||
| 1025 | Ga0068869_100192724 | |||
| 1026 | Ga0070666_10285834 | |||
| 1027 | Ga0070680_100011245 | |||
| 1028 | Ga0070680_100227620 | |||
| 1029 | Ga0070682_100046709 | |||
| 1030 | Ga0068868_100001010 | |||
| 1031 | Ga0068868_100139607 | |||
| 1032 | Ga0068868_100291653 | |||
| 1033 | Ga0070689_100008032 | |||
| 1034 | Ga0070689_100055638 | |||
| 1035 | Ga0070689_100114513 | |||
| 1036 | Ga0070689_100210663 | |||
| 1037 | Ga0070689_100230355 | |||
| 1038 | Ga0070687_100000472 | |||
| 1039 | Ga0070687_100079239 | |||
| 1040 | Ga0070692_10012681 | |||
| 1041 | Ga0070668_100019524 | |||
| 1042 | Ga0070668_100067479 | |||
| 1043 | Ga0070669_100073390 | |||
| 1044 | Ga0070669_100146514 | |||
| 1045 | Ga0070675_100045107 | |||
| 1046 | Ga0070675_100071179 | |||
| 1047 | Ga0070675_100081169 | |||
| 1048 | Ga0070671_100037790 | |||
| 1049 | Ga0070671_100084181 | |||
| 1050 | Ga0070671_100116982 | |||
| 1051 | Ga0070671_100167541 | |||
| 1052 | Ga0070674_100105194 | |||
| 1053 | Ga0070674_100127626 | |||
| 1054 | Ga0070673_100060127 | |||
| 1055 | Ga0070673_100163593 | |||
| 1056 | Ga0070673_100209369 | |||
| 1057 | Ga0070688_100007930 | |||
| 1058 | Ga0070688_100061466 | |||
| 1059 | Ga0070667_100041279 | |||
| 1060 | Ga0070667_100141322 | |||
| 1061 | Ga0070667_100165424 | |||
| 1062 | Ga0070667_100210054 | |||
| 1063 | Ga0070667_100345258 | |||
| 1064 | Ga0070714_100155983 | |||
| 1065 | Ga0070713_100000019 | |||
| 1066 | Ga0070713_100013794 | |||
| 1067 | Ga0070713_100067932 | |||
| 1068 | Ga0070710_10072573 | |||
| 1069 | Ga0070701_10010189 | |||
| 1070 | Ga0070705_100000043 | |||
| 1071 | Ga0070705_100090944 | |||
| 1072 | Ga0070705_100155137 | |||
| 1073 | Ga0070700_100003779 | |||
| 1074 | Ga0070700_100138422 | |||
| 1075 | Ga0070694_100006344 | |||
| 1076 | Ga0070694_100084540 | |||
| 1077 | Ga0070678_100014403 | |||
| 1078 | Ga0070662_100240262 | |||
| 1079 | Ga0070681_10000685 | |||
| 1080 | Ga0070681_10047234 | |||
| 1081 | Ga0068867_100000225 | |||
| 1082 | Ga0068867_100214314 | |||
| 1083 | Ga0070685_10015443 | |||
| 1084 | Ga0070706_100006414 | |||
| 1085 | Ga0070706_100292218 | |||
| 1086 | Ga0070707_100179645 | |||
| 1087 | Ga0070679_100050267 | |||
| 1088 | Ga0070684_100267382 | |||
| 1089 | Ga0070684_100351647 | |||
| 1090 | Ga0068853_100021309 | |||
| 1091 | Ga0068853_100038292 | |||
| 1092 | Ga0068853_100049105 | |||
| 1093 | Ga0070672_100033355 | |||
| 1094 | Ga0070672_100036428 | |||
| 1095 | Ga0070672_100230977 | |||
| 1096 | Ga0070686_100064113 | |||
| 1097 | Ga0070686_100098164 | |||
| 1098 | Ga0070686_100098988 | |||
| 1099 | Ga0070686_100112039 | |||
| 1100 | Ga0070686_100175083 | |||
| 1101 | Ga0070686_100201730 | |||
| 1102 | Ga0070695_100033205 | |||
| 1103 | Ga0070695_100055626 | |||
| 1104 | Ga0070696_100003112 | |||
| 1105 | Ga0070696_100020591 | |||
| 1106 | Ga0070693_100000016 | |||
| 1107 | Ga0070704_100000837 | |||
| 1108 | Ga0070704_100065286 | |||
| 1109 | Ga0070704_100072778 | |||
| 1110 | Ga0070704_100141823 | |||
| 1111 | Ga0068855_100012963 | |||
| 1112 | Ga0070664_100139169 | |||
| 1113 | Ga0070664_100311573 | |||
| 1114 | Ga0070664_100347762 | |||
| 1115 | Ga0068857_100464610 | |||
| 1116 | Ga0068856_100683449 | |||
| 1117 | Ga0070702_100000017 | |||
| 1118 | Ga0070702_100094968 | |||
| 1119 | Ga0070702_100161664 | |||
| 1120 | Ga0070702_100186014 | |||
| 1121 | Ga0068852_100016862 | |||
| 1122 | Ga0068852_100224587 | |||
| 1123 | Ga0068852_100334792 | |||
| 1124 | Ga0068852_100494472 | |||
| 1125 | Ga0068859_100018784 | |||
| 1126 | Ga0068859_100138373 | |||
| 1127 | Ga0068859_100163787 | |||
| 1128 | Ga0068864_100018789 | |||
| 1129 | Ga0068864_100029246 | |||
| 1130 | Ga0068864_100037951 | |||
| 1131 | Ga0068864_100088907 | |||
| 1132 | Ga0068864_100283198 | |||
| 1133 | Ga0068866_10016800 | |||
| 1134 | Ga0068861_100000496 | |||
| 1135 | Ga0068861_100019728 | |||
| 1136 | Ga0068861_100061114 | |||
| 1137 | Ga0068861_100267540 | |||
| 1138 | Ga0068861_100373273 | |||
| 1139 | Ga0068870_10003235 | |||
| 1140 | Ga0068870_10089499 | |||
| 1141 | Ga0068863_100145229 | |||
| 1142 | Ga0068863_100177149 | |||
| 1143 | Ga0068858_100001011 | |||
| 1144 | Ga0068858_100002315 | |||
| 1145 | Ga0068858_100107316 | |||
| 1146 | Ga0068858_100184476 | |||
| 1147 | Ga0068858_100291891 | |||
| 1148 | Ga0068858_100330901 | |||
| 1149 | Ga0068860_100017045 | |||
| 1150 | Ga0068860_100023020 | |||
| 1151 | Ga0068860_100074316 | |||
| 1152 | Ga0068860_100285616 | |||
| 1153 | Ga0068862_100119071 | |||
| 1154 | Ga0081455_10014492 | |||
| 1155 | Ga0081455_10028957 | |||
| 1156 | Ga0081455_10041286 | |||
| 1157 | Ga0081539_10000847 | |||
| 1158 | Ga0070717_10093279 | |||
| 1159 | Ga0075365_10045375 | |||
| 1160 | Ga0075365_10086763 | |||
| 1161 | Ga0075365_10157232 | |||
| 1162 | Ga0075363_100005216 | |||
| 1163 | Ga0075363_100063798 | |||
| 1164 | Ga0075364_10011199 | |||
| 1165 | Ga0075364_10032938 | |||
| 1166 | Ga0075364_10100238 | |||
| 1167 | Ga0075364_10115861 | |||
| 1168 | Ga0075364_10231932 | |||
| 1169 | Ga0070716_100084483 | |||
| 1170 | Ga0070716_100109793 | |||
| 1171 | Ga0070716_100208567 | |||
| 1172 | Ga0070712_100034989 | |||
| 1173 | Ga0075362_10024056 | |||
| 1174 | Ga0075362_10090042 | |||
| 1175 | Ga0075367_10070103 | |||
| 1176 | Ga0075367_10084814 | |||
| 1177 | Ga0075367_10108334 | |||
| 1178 | Ga0075369_10004234 | |||
| 1179 | Ga0075366_10001589 | |||
| 1180 | Ga0075366_10025588 | |||
| 1181 | Ga0075366_10095398 | |||
| 1182 | Ga0097621_100001049 | |||
| 1183 | Ga0097621_100007640 | |||
| 1184 | Ga0097621_100205373 | |||
| 1185 | Ga0068871_100004173 | |||
| 1186 | Ga0068871_100031226 | |||
| 1187 | Ga0068871_100152558 | |||
| 1188 | Ga0075428_100004582 | |||
| 1189 | Ga0075428_100013933 | |||
| 1190 | Ga0075428_100023614 | |||
| 1191 | Ga0075428_100028423 | |||
| 1192 | Ga0075430_100068042 | |||
| 1193 | Ga0075431_100004337 | |||
| 1194 | Ga0075431_100107621 | |||
| 1195 | Ga0075431_100216103 | |||
| 1196 | Ga0075431_100236014 | |||
| 1197 | Ga0075433_10001240 | |||
| 1198 | Ga0075433_10016219 | |||
| 1199 | Ga0075433_10069944 | |||
| 1200 | Ga0075433_10511373 | |||
| 1201 | Ga0075434_100000017 | |||
| 1202 | Ga0075434_100000549 | |||
| 1203 | Ga0075434_100005820 | |||
| 1204 | Ga0075434_100034296 | |||
| 1205 | Ga0075434_100037443 | |||
| 1206 | Ga0075434_100132341 | |||
| 1207 | Ga0075434_100390409 | |||
| 1208 | Ga0075429_100000506 | |||
| 1209 | Ga0075429_100007303 | |||
| 1210 | Ga0075429_100166865 | |||
| 1211 | Ga0068865_100016551 | |||
| 1212 | Ga0075436_100000896 | |||
| 1213 | Ga0075436_100001337 | |||
| 1214 | Ga0075436_100009262 | |||
| 1215 | Ga0075436_100015208 | |||
| 1216 | Ga0075436_100036090 | |||
| 1217 | Ga0075436_100130099 | |||
| 1218 | Ga0097620_100018783 | |||
| 1219 | Ga0097620_100138368 | |||
| 1220 | Ga0097620_100163771 | |||
| 1221 | Ga0099826_10000019 | |||
| 1222 | Ga0075435_100000241 | |||
| 1223 | Ga0075435_100001546 | |||
| 1224 | Ga0075435_100075757 | |||
| 1225 | Ga0075435_100119638 | |||
| 1226 | Ga0099795_10042805 | |||
| 1227 | Ga0105240_10007572 | |||
| 1228 | Ga0111539_10020771 | |||
| 1229 | Ga0111539_10026228 | |||
| 1230 | Ga0111539_10035923 | |||
| 1231 | Ga0111539_10048183 | |||
| 1232 | Ga0111539_10139578 | |||
| 1233 | Ga0111539_10669351 | |||
| 1234 | Ga0105245_10085899 | |||
| 1235 | Ga0105245_10102244 | |||
| 1236 | Ga0105245_10250114 | |||
| 1237 | Ga0105245_10798775 | |||
| 1238 | Ga0105247_10012451 | |||
| 1239 | Ga0114129_10000534 | |||
| 1240 | Ga0114129_10001202 | |||
| 1241 | Ga0114129_10024407 | |||
| 1242 | Ga0114129_10042156 | |||
| 1243 | Ga0105243_10000743 | |||
| 1244 | Ga0105243_10036148 | |||
| 1245 | Ga0105243_10172997 | |||
| 1246 | Ga0105243_10188739 | |||
| 1247 | Ga0105243_10191090 | |||
| 1248 | Ga0105243_10201300 | |||
| 1249 | Ga0105241_10133962 | |||
| 1250 | Ga0105242_10337902 | |||
| 1251 | Ga0105248_10251964 | |||
| 1252 | Ga0105248_10300618 | |||
| 1253 | Ga0105248_10543404 | |||
| 1254 | Ga0105237_10405381 | |||
| 1255 | Ga0105238_10138160 | |||
| 1256 | Ga0105238_10476566 | |||
| 1257 | Ga0105249_10057924 | |||
| 1258 | Ga0105246_10123763 | |||
| 1259 | Ga0105246_10197654 | |||
| 1260 | Ga0157371_10109606 | |||
| 1261 | Ga0157374_10085143 | |||
| 1262 | Ga0157374_10102708 | |||
| 1263 | Ga0157374_10217492 | |||
| 1264 | Ga0157378_10046757 | |||
| 1265 | Ga0157378_10058354 | |||
| 1266 | Ga0157378_10285305 | |||
| 1267 | Ga0163162_10099076 | |||
| 1268 | Ga0163162_10387645 | |||
| 1269 | Ga0157372_10262757 | |||
| 1270 | Ga0157375_10471632 | |||
| 1271 | Ga0157375_10604962 | |||
| 1272 | Ga0163163_10027646 | |||
| 1273 | Ga0163163_10030887 | |||
| 1274 | Ga0163163_10051329 | |||
| 1275 | Ga0163163_10172110 | |||
| 1276 | Ga0163163_10251300 | |||
| 1277 | Ga0163163_10309182 | |||
| 1278 | Ga0157380_10069201 | |||
| 1279 | Ga0182008_10042415 | |||
| 1280 | Ga0157377_10007048 | |||
| 1281 | Ga0157377_10240015 | |||
| 1282 | Ga0157379_10006399 | |||
| 1283 | Ga0157379_10146350 | |||
| 1284 | Ga0157379_10239821 | |||
| 1285 | Ga0157376_10050117 | |||
| 1286 | Ga0163161_10088396 | |||
| 1287 | Ga0213876_10003512 | |||
| 1288 | Ga0213876_10004235 | |||
| 1289 | Ga0209436_101676 | |||
| 1290 | Ga0209672_100550 | |||
| 1291 | Ga0209147_100805 | |||
| 1292 | Ga0209258_100018 | |||
| 1293 | Ga0207425_1000057 | |||
| 1294 | Ga0209148_1000030 | |||
| 1295 | Ga0209129_1000030 | |||
| 1296 | Ga0209565_1000019 | |||
| 1297 | Ga0209565_1000255 | |||
| 1298 | Ga0209565_1018952 | |||
| 1299 | Ga0209673_1000155 | |||
| 1300 | Ga0209673_1009186 | |||
| 1301 | Ga0209130_1000011 | |||
| 1302 | Ga0209675_1000031 | |||
| 1303 | Ga0209675_1000457 | |||
| 1304 | Ga0209675_1000510 | |||
| 1305 | Ga0209675_1002115 | |||
| 1306 | Ga0209676_1004622 | |||
| 1307 | Ga0209676_1006264 | |||
| 1308 | Ga0209676_1009204 | |||
| 1309 | Ga0209025_1000057 | |||
| 1310 | Ga0209025_1000078 | |||
| 1311 | Ga0209025_1002582 | |||
| 1312 | Ga0209025_1028513 | |||
| 1313 | Ga0209564_1000056 | |||
| 1314 | Ga0209564_1000546 | |||
| 1315 | Ga0209564_1000600 | |||
| 1316 | Ga0209564_1002095 | |||
| 1317 | Ga0209758_1000037 | |||
| 1318 | Ga0209758_1019878 | |||
| 1319 | Ga0209050_1001259 | |||
| 1320 | Ga0209050_1007505 | |||
| 1321 | Ga0209256_1000043 | |||
| 1322 | Ga0209256_1000518 | |||
| 1323 | Ga0209256_1000661 | |||
| 1324 | Ga0207426_1000029 | |||
| 1325 | Ga0209051_1000804 | |||
| 1326 | Ga0209051_1006197 | |||
| 1327 | Ga0209257_1001647 | |||
| 1328 | Ga0207682_10068119 | |||
| 1329 | Ga0207682_10079540 | |||
| 1330 | Ga0207692_10113619 | |||
| 1331 | Ga0207642_10034515 | |||
| 1332 | Ga0207710_10032070 | |||
| 1333 | Ga0207688_10000077 | |||
| 1334 | Ga0207688_10009054 | |||
| 1335 | Ga0207688_10078236 | |||
| 1336 | Ga0207688_10116738 | |||
| 1337 | Ga0207680_10070700 | |||
| 1338 | Ga0207647_10014714 | |||
| 1339 | Ga0207647_10030672 | |||
| 1340 | Ga0207645_10012169 | |||
| 1341 | Ga0207645_10020137 | |||
| 1342 | Ga0207643_10060781 | |||
| 1343 | Ga0207643_10106289 | |||
| 1344 | Ga0207643_10124687 | |||
| 1345 | Ga0207684_10000788 | |||
| 1346 | Ga0207684_10252761 | |||
| 1347 | Ga0207707_10096778 | |||
| 1348 | Ga0207695_10016654 | |||
| 1349 | Ga0207671_10113150 | |||
| 1350 | Ga0207671_10417824 | |||
| 1351 | Ga0207693_10010472 | |||
| 1352 | Ga0207693_10015493 | |||
| 1353 | Ga0207663_10044643 | |||
| 1354 | Ga0207663_10316611 | |||
| 1355 | Ga0207660_10173589 | |||
| 1356 | Ga0207662_10002112 | |||
| 1357 | Ga0207662_10004898 | |||
| 1358 | Ga0207662_10027735 | |||
| 1359 | Ga0207662_10131049 | |||
| 1360 | Ga0207657_10158746 | |||
| 1361 | Ga0207657_10206919 | |||
| 1362 | Ga0207652_10035230 | |||
| 1363 | Ga0207646_10055525 | |||
| 1364 | Ga0207646_10063874 | |||
| 1365 | Ga0207681_10042080 | |||
| 1366 | Ga0207694_10124355 | |||
| 1367 | Ga0207650_10041764 | |||
| 1368 | Ga0207650_10085284 | |||
| 1369 | Ga0207650_10114738 | |||
| 1370 | Ga0207659_10011421 | |||
| 1371 | Ga0207659_10103002 | |||
| 1372 | Ga0207687_10071957 | |||
| 1373 | Ga0207687_10101226 | |||
| 1374 | Ga0207687_10152212 | |||
| 1375 | Ga0207700_10000035 | |||
| 1376 | Ga0207644_10051645 | |||
| 1377 | Ga0207644_10079951 | |||
| 1378 | Ga0207706_10001566 | |||
| 1379 | Ga0207706_10034208 | |||
| 1380 | Ga0207709_10000085 | |||
| 1381 | Ga0207709_10030284 | |||
| 1382 | Ga0207709_10170271 | |||
| 1383 | Ga0207709_10355480 | |||
| 1384 | Ga0207670_10019546 | |||
| 1385 | Ga0207670_10109838 | |||
| 1386 | Ga0207670_10111609 | |||
| 1387 | Ga0207670_10197380 | |||
| 1388 | Ga0207704_10006104 | |||
| 1389 | Ga0207704_10224899 | |||
| 1390 | Ga0207665_10088026 | |||
| 1391 | Ga0207665_10155183 | |||
| 1392 | Ga0207691_10019431 | |||
| 1393 | Ga0207691_10050211 | |||
| 1394 | Ga0207691_10104303 | |||
| 1395 | Ga0207711_10069681 | |||
| 1396 | Ga0207711_10118617 | |||
| 1397 | Ga0207689_10000079 | |||
| 1398 | Ga0207689_10093130 | |||
| 1399 | Ga0207689_10105965 | |||
| 1400 | Ga0207661_10247906 | |||
| 1401 | Ga0207679_10016937 | |||
| 1402 | Ga0207679_10062953 | |||
| 1403 | Ga0207679_10108065 | |||
| 1404 | Ga0207679_10317385 | |||
| 1405 | Ga0207667_10277003 | |||
| 1406 | Ga0207667_10284195 | |||
| 1407 | Ga0207651_10021125 | |||
| 1408 | Ga0207651_10143638 | |||
| 1409 | Ga0207651_10312147 | |||
| 1410 | Ga0207712_10075917 | |||
| 1411 | Ga0207668_10033345 | |||
| 1412 | Ga0207668_10075903 | |||
| 1413 | Ga0207668_10204983 | |||
| 1414 | Ga0207658_10079628 | |||
| 1415 | Ga0207658_10113890 | |||
| 1416 | Ga0207658_10133023 | |||
| 1417 | Ga0207677_10008782 | |||
| 1418 | Ga0207703_10015337 | |||
| 1419 | Ga0207703_10027651 | |||
| 1420 | Ga0207703_10077644 | |||
| 1421 | Ga0207703_10127140 | |||
| 1422 | Ga0207703_10199565 | |||
| 1423 | Ga0207639_10067489 | |||
| 1424 | Ga0207708_10000155 | |||
| 1425 | Ga0207708_10005791 | |||
| 1426 | Ga0207708_10181617 | |||
| 1427 | Ga0207702_10281415 | |||
| 1428 | Ga0207641_10011199 | |||
| 1429 | Ga0207648_10000018 | |||
| 1430 | Ga0207648_10000071 | |||
| 1431 | Ga0207648_10027150 | |||
| 1432 | Ga0207648_10063126 | |||
| 1433 | Ga0207648_10136026 | |||
| 1434 | Ga0207676_10009920 | |||
| 1435 | Ga0207676_10024356 | |||
| 1436 | Ga0207676_10078295 | |||
| 1437 | Ga0207676_10218588 | |||
| 1438 | Ga0207674_10241548 | |||
| 1439 | Ga0207675_100036493 | |||
| 1440 | Ga0207675_100047119 | |||
| 1441 | Ga0207675_100050720 | |||
| 1442 | Ga0207675_100065835 | |||
| 1443 | Ga0207675_100314024 | |||
| 1444 | Ga0207675_100372204 | |||
| 1445 | Ga0207683_10008847 | |||
| 1446 | Ga0207683_10017801 | |||
| 1447 | Ga0207698_10165456 | |||
| 1448 | Ga0207698_10228424 | |||
| 1449 | Ga0207698_10242347 | |||
| 1450 | Ga0207698_10370702 | |||
| 1451 | Ga0209371_1006207 | |||
| 1452 | Ga0209969_1010345 | |||
| 1453 | Ga0209179_1005804 | |||
| 1454 | Ga0209282_1000148 | |||
| 1455 | Ga0209971_1021659 | |||
| 1456 | Ga0209813_10019746 | |||
| 1457 | Ga0209974_10021683 | |||
| 1458 | Ga0207428_10000758 | |||
| 1459 | Ga0207428_10011171 | |||
| 1460 | Ga0207428_10066049 | |||
| 1461 | Ga0268265_10010174 | |||
| 1462 | Ga0268265_10045598 | |||
| 1463 | Ga0268265_10090411 | |||
| 1464 | Ga0268264_10004862 | |||
| 1465 | Ga0268264_10082221 | |||
| 1466 | Ga0268264_10222351 | |||
| 1467 | Ga0265334_10004160 | |||
| 1468 | Ga0265318_10010718 | |||
| 1469 | Ga0307515_10036166 | |||
| 1470 | Ga0307515_10044146 | |||
| 1471 | Ga0268256_1006209 | |||
| 1472 | Ga0307511_10000003 | |||
| 1473 | Ga0307511_10000291 | |||
| 1474 | Ga0307511_10004074 | |||
| 1475 | Ga0265330_10036161 | |||
| 1476 | Ga0265332_10000918 | |||
| 1477 | Ga0265328_10005428 | |||
| 1478 | Ga0265325_10001565 | |||
| 1479 | Ga0265340_10018193 | |||
| 1480 | Ga0265340_10019823 | |||
| 1481 | Ga0265339_10039003 | |||
| 1482 | Ga0265331_10013032 | |||
| 1483 | Ga0265327_10032700 | |||
| 1484 | Ga0265327_10033246 | |||
| 1485 | Ga0265327_10050585 | |||
| 1486 | Ga0265327_10079765 | |||
| 1487 | Ga0307513_10017907 | |||
| 1488 | Ga0307408_100032375 | |||
| 1489 | Ga0265314_10039949 | |||
| 1490 | Ga0265314_10158732 | |||
| 1491 | Ga0265342_10013002 | |||
| 1492 | Ga0265342_10038213 | |||
| 1493 | Ga0307405_10078016 | |||
| 1494 | Ga0307407_10156295 | |||
| 1495 | Ga0307412_10000837 | |||
| 1496 | Ga0307412_10096622 | |||
| 1497 | Ga0307412_10207387 | |||
| 1498 | Ga0307416_100061953 | |||
| 1499 | Ga0307416_100081311 | |||
| 1500 | Ga0307416_100309314 | |||
| 1501 | Ga0307411_10062082 | |||
| 1502 | Ga0307411_10120657 | |||
| 1503 | Ga0307507_10033219 | |||
| 1504 | Ga0307507_10170294 | |||
| 1505 | Ga0373948_0003025 | |||
| 1506 | Ga0373950_0010391 | |||
| 1507 | Ga0373959_0008868 | |||
| 1508 | Ga0373959_0020155 | |||
| 1509 | Ga0373926_0002597 | |||
| 1510 | Ga0373926_0023408 | |||
| 1511 | Ga0373928_0001062 | |||
| 1512 | Ga0373928_0008849 | |||
| 1513 | Ga0373929_0012240 | |||
| 1514 | Ga0373949_0003293 | |||
| 1515 | Ga0373949_0018958 | |||
| 1516 | Ga0373951_0011292 | |||
| 1517 | Ga0373951_0013523 | |||
| 1518 | Ga0373923_0000495 | |||
| 1519 | Ga0373923_0072545 | |||
| 1520 | Ga0373932_0001314 | |||
| 1521 | Ga0373932_0003182 | |||
| 1522 | Ga0373936_0002892 | |||
| 1523 | Ga0373936_0004697 | |||
| 1524 | Ga0373936_0010042 | |||
| 1525 | Ga0373936_0012815 | |||
| 1526 | Ga0373939_0012698 | |||
| 1527 | Ga0373939_0014135 | |||
| 1528 | Ga0373941_0001753 | |||
| 1529 | Ga0373941_0019039 | |||
| 1530 | Ga0373945_0012190 | |||
| 1531 | Ga0373953_0001502 | |||
| 1532 | Ga0373953_0002531 | |||
| 1533 | Ga0373954_0002119 | |||
| 1534 | Ga0373956_0007806 | |||
| 1535 | Ga0373960_0003865 | |||
| 1536 | Ga0373960_0009403 | |||
| 1537 | Ga0373943_0008697 | |||
| 1538 | Ga0373946_0006665 | |||
| 1539 | Ga0373946_0024813 | |||
| 1540 | Ga0373946_0027439 | |||
| 1541 | Ga0373955_0000114 | |||
| 1542 | Ga0373955_0183533 | |||
| 1543 | Ga0373942_0001366 | |||
| 1544 | Ga0373942_0006353 | |||
| 1545 | Ga0373961_0007738 | |||
| 1546 | Ga0373962_0008076 | |||
| 1547 | Ga0373962_0012009 | |||
| 1548 | Ga0373962_0057273 | |||
| 1549 | Ga0373962_0057477 | |||
| 1550 | Ga0373962_0059180 | |||
| 1551 | Ga0373924_0078273 | |||
| 1552 | Ga0373931_0000248 | |||
| 1553 | Ga0373931_0007632 | |||
| 1554 | Ga0373931_0021328 | |||
| 1555 | Ga0373931_0021482 | |||
| 1556 | Ga0373931_0051166 | |||
| 1557 | Ga0373931_0058671 | |||
| 1558 | Ga0373935_0000367 | |||
| 1559 | Ga0373935_0011448 | |||
| 1560 | Ga0373935_0038632 | |||
| 1561 | Ga0373935_0117403 | |||
| 1562 | Ga0373935_0178847 | |||
| 1563 | Ga0373927_0004943 | |||
| 1564 | Ga0373927_0016071 | |||
| 1565 | Ga0373927_0017712 | |||
| 1566 | Ga0373927_0018530 | |||
| 1567 | Ga0373927_0027947 | |||
| 1568 | Ga0373927_0042945 | |||
| 1569 | Ga0373933_0010246 | |||
| 1570 | Ga0373933_0099356 | |||
| 1571 | Ga0373947_0009271 | |||
| 1572 | Ga0373947_0017478 | |||
| 1573 | Ga0373947_0027599 | |||
| 1574 | Ga0373947_0193206 | |||
| 1575 | Ga0373937_0000079 | |||
| 1576 | Ga0373937_0098638 | |||
| 1577 | Ga0373937_0106150 | |||
| 1578 | Ga0373925_0000007 | |||
| 1579 | Ga0373925_0020792 | |||
| 1580 | Ga0373925_0023218 | |||
| 1581 | Ga0373925_0034905 | |||
| 1582 | Ga0373925_0384308 | |||
| 1583 | Ga0395899_0001158 | |||
| 1584 | Ga0395900_0156171 | |||
| 1585 | Ga0395900_0250587 | |||
| 1586 | Ga0395898_0005496 | |||
| 1587 | Ga0395898_0069032 | |||
| 1588 | Ga0395905_0139539 | |||
| 1589 | Ga0395905_0184678 | |||
| 1590 | Ga0395905_0236122 | |||
| 1591 | Ga0436365_1136772 | |||
| 1592 | Ga0436365_1284888 | |||
| 1593 | Ga0439436_0018312 | |||
| 1594 | Ga0450898_003691 | |||
| 1595 | Ga0439446_0031484 | |||
| 1596 | Ga0439435_0029294 | |||
| 1597 | Ga0451577_0178788 | |||
| 1598 | Ga0466963_0166135 | |||
| 1599 | Ga0466964_0078674 | |||
| 1600 | Ga0453684_0382226 | |||
| 1601 | Ga0466960_0003041 | |||
| 1602 | Ga0451576_0017934 | |||
| 1603 | Ga0451576_0018069 | |||
| 1604 | Ga0451576_0114121 | |||
| 1605 | Ga0451576_0119336 | |||
| 1606 | Ga0451576_0392362 | |||
| 1607 | Ga0466967_0007807 | |||
| 1608 | Ga0466967_0010524 | |||
| 1609 | Ga0466967_0376915 | |||
| 1610 | Ga0495592_0000254 | |||
| 1611 | Ga0495592_0054761 | |||
| 1612 | Ga0495592_0067041 | |||
| 1613 | Ga0495592_0107961 | |||
| 1614 | Ga0495603_0002597 | |||
| 1615 | Ga0495629_0004780 | |||
| 1616 | Ga0495629_0024258 | |||
| 1617 | Ga0495629_0157421 | |||
| 1618 | Ga0495629_0194134 | |||
| 1619 | Ga0495641_0025893 | |||
| 1620 | Ga0495641_0065905 | |||
| 1621 | Ga0495651_0000796 | |||
| 1622 | Ga0495651_0217757 | |||
| 1623 | Ga0495653_0000034 | |||
| 1624 | Ga0495653_0048552 | |||
| 1625 | Ga0495580_0004635 | |||
| 1626 | Ga0495580_0080896 | |||
| 1627 | Ga0495582_0008869 | |||
| 1628 | Ga0495582_0134511 | |||
| 1629 | Ga0495605_0005057 | |||
| 1630 | Ga0495639_0042446 | |||
| 1631 | Ga0495639_0047771 | |||
| 1632 | Ga0495662_0025763 | |||
| 1633 | Ga0495664_0000003 | |||
| 1634 | Ga0495664_0222677 | |||
| 1635 | Ga0495594_0020833 | |||
| 1636 | Ga0495594_0036814 | |||
| 1637 | Ga0495596_0001648 | |||
| 1638 | Ga0495607_0027444 | |||
| 1639 | Ga0495608_0000319 | |||
| 1640 | Ga0495608_0030250 | |||
| 1641 | Ga0495610_0002348 | |||
| 1642 | Ga0495616_0001459 | |||
| 1643 | Ga0495616_0006405 | |||
| 1644 | Ga0495618_0000018 | |||
| 1645 | Ga0495618_0042574 | |||
| 1646 | Ga0495628_0000001 | |||
| 1647 | Ga0495628_0043315 | |||
| 1648 | Ga0495628_0043898 | |||
| 1649 | Ga0495628_0128494 | |||
| 1650 | Ga0495630_0001309 | |||
| 1651 | Ga0495630_0003154 | |||
| 1652 | Ga0495631_0074624 | |||
| 1653 | Ga0495643_0000328 | |||
| 1654 | Ga0495643_0008336 | |||
| 1655 | Ga0495663_0017577 | |||
| 1656 | Ga0495666_0019454 | |||
| 1657 | Ga0495666_0045628 | |||
| 1658 | Ga0495642_0004946 | |||
| 1659 | Ga0495652_0000006 | |||
| 1660 | Ga0495652_0007326 | |||
| 1661 | Ga0495652_0219774 | |||
| 1662 | Ga0495652_0242698 | |||
| 1663 | Ga0495665_0035527 | |||
| 1664 | Ga0495640_0000002 | |||
| 1665 | Ga0495640_0038231 | |||
| 1666 | Ga0495640_0191522 | |||
| 1667 | Ga0495586_0012666 | |||
| 1668 | Ga0495586_0018239 | |||
| 1669 | Ga0495586_0144930 | |||
| 1670 | Ga0495587_0000001 | |||
| 1671 | Ga0495598_0026265 | |||
| 1672 | Ga0495598_0040998 | |||
| 1673 | Ga0495609_0003430 | |||
| 1674 | Ga0495609_0084838 | |||
| 1675 | Ga0495621_0008649 | |||
| 1676 | Ga0495621_0060168 | |||
| 1677 | Ga0495597_0028452 | |||
| 1678 | Ga0495645_0000009 | |||
| 1679 | Ga0495645_0001560 | |||
| 1680 | Ga0495667_0000004 | |||
| 1681 | Ga0495656_0001315 | |||
| 1682 | Ga0495656_0085415 | |||
| 1683 | Ga0495668_0096430 | |||
| 1684 | Ga0495668_0123130 | |||
| 1685 | Ga0495634_0000014 | |||
| 1686 | Ga0495634_0019822 | |||
| 1687 | Ga0495634_0038522 | |||
| 1688 | Ga0495634_0103732 | |||
| 1689 | Ga0495635_0000001 | |||
| 1690 | Ga0495635_0336099 | |||
| 1691 | Ga0495661_0007293 | |||
| 1692 | Ga0495661_0175849 | |||
| 1693 | Ga0495661_0188946 | |||
| 1694 | Ga0495657_0000336 | |||
| 1695 | Ga0495657_0011703 | |||
| 1696 | Ga0495599_0000053 | |||
| 1697 | Ga0495599_0003895 | |||
| 1698 | Ga0495599_0174424 | |||
| 1699 | Ga0495623_0000091 | |||
| 1700 | Ga0495646_0000020 | |||
| 1701 | Ga0495646_0116993 | |||
| 1702 | Ga0495647_0000477 | |||
| 1703 | Ga0495647_0011475 | |||
| 1704 | Ga0495647_0069174 | |||
| 1705 | Ga0495658_0014860 | |||
| 1706 | Ga0495658_0119044 | |||
| 1707 | Ga0495613_0009581 | |||
| 1708 | Ga0495613_0132118 | |||
| 1709 | Ga0495613_0219694 | |||
| 1710 | Ga0495624_0081084 | |||
| 1711 | Ga0495670_0139606 | |||
| 1712 | Ga0495671_0019692 | |||
| 1713 | Ga0495649_0012031 | |||
| 1714 | Ga0495600_0000123 | |||
| 1715 | Ga0495600_0014825 | |||
| 1716 | Ga0495581_0111908 | |||
| 1717 | Ga0495604_0000008 | |||
| 1718 | Ga0495604_0121878 | |||
| 1719 | Ga0495636_0108300 | |||
| 1720 | Ga0495674_0000016 | |||
| 1721 | Ga0495674_0026636 | |||
| 1722 | Ga0495674_0092029 | |||
| 1723 | Ga0495674_0180261 | |||
| 1724 | Ga0495672_0013747 | |||
| 1725 | Ga0495672_0054522 | |||
| 1726 | Ga0495676_0007711 | |||
| 1727 | Ga0495676_0021776 | |||
| 1728 | Ga0495680_0024757 | |||
| 1729 | Ga0495680_0203478 | |||
| 1730 | Ga0495687_029483 | |||
| 1731 | Ga0495675_0014865 | |||
| 1732 | Ga0495675_0024425 | |||
| 1733 | Ga0495679_042683 | |||
| 1734 | Ga0495681_0114367 | |||
| 1735 | Ga0495684_0000002 | |||
| 1736 | Ga0495684_0028395 | |||
| 1737 | Ga0495684_0101229 | |||
| 1738 | Ga0495684_0329526 | |||
| 1739 | Ga0495593_0001468 | |||
| 1740 | Ga0495602_0000022 | |||
| 1741 | Ga0495602_0098310 | |||
| 1742 | Ga0495602_0103211 | |||
| 1743 | Ga0495602_0217112 | |||
| 1744 | Ga0495626_0000652 | |||
| 1745 | Ga0495626_0014553 | |||
| 1746 | Ga0496100_0088053 | |||
| 1747 | Ga0496100_0237526 | |||
| 1748 | Ga0496101_0004652 | |||
| 1749 | Ga0496101_0013711 | |||
| 1750 | Ga0496101_0072282 | |||
| 1751 | Ga0496102_0006819 | |||
| 1752 | Ga0496102_0019179 | |||
| 1753 | Ga0496102_0028178 | |||
| 1754 | Ga0496102_0621472 | |||
| 1755 | Ga0496103_0015056 | |||
| 1756 | Ga0496103_0020735 | |||
| 1757 | Ga0496103_0240574 | |||
| 1758 | Ga0496104_0000833 | |||
| 1759 | Ga0496104_0001498 | |||
| 1760 | Ga0496104_0014338 | |||
| 1761 | Ga0496105_0000355 | |||
| 1762 | Ga0496105_0006679 | |||
| 1763 | Ga0496105_0026794 | |||
| 1764 | Ga0496105_0045267 | |||
| 1765 | Ga0496105_0074093 | |||
| 1766 | Ga0496105_0084557 | |||
| 1767 | Ga0496106_0003706 | |||
| 1768 | Ga0496106_0050670 | |||
| 1769 | Ga0496106_0066422 | |||
| 1770 | Ga0496107_0017060 | |||
| 1771 | Ga0496107_0035525 | |||
| 1772 | Ga0496107_0071406 | |||
| 1773 | Ga0496108_0049181 | |||
| 1774 | Ga0496108_0109059 | |||
| 1775 | Ga0496109_0006773 | |||
| 1776 | Ga0496109_0014145 | |||
| 1777 | Ga0496109_0124796 | |||
| 1778 | Ga0496109_0184285 | |||
| 1779 | Ga0496109_0377269 | |||
| 1780 | Ga0496110_0006467 | |||
| 1781 | Ga0496110_0060655 | |||
| 1782 | Ga0496110_0151410 | |||
| 1783 | Ga0496110_0406882 | |||
| 1784 | Ga0496110_0492800 | |||
| 1785 | Ga0496111_0004396 | |||
| 1786 | Ga0496111_0014603 | |||
| 1787 | Ga0496111_0069916 | |||
| 1788 | Ga0496112_0001747 | |||
| 1789 | Ga0496112_0011575 | |||
| 1790 | Ga0496112_0015894 | |||
| 1791 | Ga0496112_0073985 | |||
| 1792 | Ga0496113_0000322 | |||
| 1793 | Ga0496113_0000645 | |||
| 1794 | Ga0496113_0086728 | |||
| 1795 | Ga0496114_0020754 | |||
| 1796 | Ga0496114_0021866 | |||
| 1797 | Ga0496114_0050710 | |||
| 1798 | Ga0496114_0137361 | |||
| 1799 | Ga0496114_0157570 | |||
| 1800 | Ga0496115_0003546 | |||
| 1801 | Ga0496115_0081022 | |||
| 1802 | Ga0496116_0001838 | |||
| 1803 | Ga0496117_0019813 | |||
| 1804 | Ga0496117_0213509 | |||
| 1805 | Ga0496118_0010842 | |||
| 1806 | Ga0496118_0016901 | |||
| 1807 | Ga0496119_0012107 | |||
| 1808 | Ga0496119_0210570 | |||
| 1809 | Ga0496120_0106325 | |||
| 1810 | Ga0496121_0000127 | |||
| 1811 | Ga0496121_0026802 | |||
| 1812 | Ga0496121_0032233 | |||
| 1813 | Ga0496122_0000601 | |||
| 1814 | Ga0496122_0076019 | |||
| 1815 | Ga0496122_0082403 | |||
| 1816 | Ga0496123_0001435 | |||
| 1817 | Ga0496123_0002704 | |||
| 1818 | Ga0496123_0035472 | |||
| 1819 | Ga0496124_0000346 | |||
| 1820 | Ga0496124_0090623 | |||
| 1821 | Ga0496124_0107594 | |||
| 1822 | Ga0496124_0165800 | |||
| 1823 | Ga0496124_0168399 | |||
| 1824 | Ga0496125_0000011 | |||
| 1825 | Ga0496125_0002692 | |||
| 1826 | Ga0496125_0022861 | |||
| 1827 | Ga0496125_0045932 | |||
| 1828 | Ga0496126_0010507 | |||
| 1829 | Ga0501299_011371 | |||
| 1830 | Ga0501033_0045454 | |||
| 1831 | Ga0501034_0146215 | |||
| 1832 | Ga0501037_0367392 | |||
| 1833 | Ga0501039_0177799 | |||
| 1834 | Ga0501042_0117158 | |||
| 1835 | Ga0501042_0262798 | |||
| 1836 | Ga0501043_0036204 | |||
| 1837 | Ga0501043_0180118 | |||
| 1838 | Ga0501047_0006619 | |||
| 1839 | Ga0501067_0012561 | |||
| 1840 | Ga0501071_0257645 | |||
| 1841 | Ga0501076_0073575 | |||
| 1842 | Ga0501077_0028385 | |||
| 1843 | Ga0501079_0012449 | |||
| 1844 | Ga0501080_0066635 | |||
| 1845 | Ga0501035_0010453 | |||
| 1846 | Ga0501044_0004409 | |||
| 1847 | Ga0501044_0256039 | |||
| 1848 | nmdc:mga03683_28381_c1 | |||
| 1849 | nmdc:mga03683_31875_c1 | |||
| 1850 | nmdc:mga03683_7685_c1 | |||
| 1851 | nmdc:mga00v17_43570_c1 | |||
| 1852 | nmdc:mga00v17_97219_c1 | |||
| 1853 | nmdc:mga0yw44_11367_c1 | |||
| 1854 | nmdc:mga0yw44_175562_c1 | |||
| 1855 | nmdc:mga0yw44_190996_c1 | |||
| 1856 | nmdc:mga0yw44_21483_c1 | |||
| 1857 | nmdc:mga0yw44_296007_c1 | |||
| 1858 | nmdc:mga0k408_15449_c1 | |||
| 1859 | nmdc:mga0k408_83582_c1 | |||
| 1860 | nmdc:mga06z11_35069_c1 | |||
| 1861 | nmdc:mga06z11_35616_c1 | |||
| 1862 | nmdc:mga07m45_10183_c1 | |||
| 1863 | nmdc:mga05p37_453_c1 | |||
| 1864 | nmdc:mga05p37_5672_c1 | |||
| 1865 | nmdc:mga09592_2036_c1 | |||
| 1866 | nmdc:mga09592_2477_c1 | |||
| 1867 | nmdc:mga0qj67_102839_c1 | |||
| 1868 | nmdc:mga06r32_101596_c1 | |||
| 1869 | nmdc:mga06r32_268879_c1 | |||
| 1870 | nmdc:mga06r32_58494_c1 | |||
| 1871 | nmdc:mga08y16_10655_c1 | |||
| 1872 | nmdc:mga08y16_11404_c1 | |||
| 1873 | nmdc:mga08y16_13184_c1 | |||
| 1874 | nmdc:mga08y16_168649_c1 | |||
| 1875 | nmdc:mga08y16_30147_c1 | |||
| 1876 | nmdc:mga08y16_51079_c1 | |||
| 1877 | nmdc:mga08y16_532970_c1 | |||
| 1878 | nmdc:mga08y16_81141_c1 | |||
| 1879 | nmdc:mga0n895_151_c1 | |||
| 1880 | nmdc:mga0n895_16155_c1 | |||
| 1881 | nmdc:mga0n895_2741_c1 | |||
| 1882 | nmdc:mga0n895_276122_c1 | |||
| 1883 | nmdc:mga0n895_287519_c1 | |||
| 1884 | nmdc:mga0n895_80247_c1 | |||
| 1885 | nmdc:mga0rr50_104989_c1 | |||
| 1886 | nmdc:mga0rr50_1131_c1 | |||
| 1887 | nmdc:mga0rr50_147293_c1 | |||
| 1888 | nmdc:mga0rr50_2318_c1 | |||
| 1889 | nmdc:mga0rr50_262381_c1 | |||
| 1890 | nmdc:mga08x19_11499_c1 | |||
| 1891 | nmdc:mga08x19_125760_c1 | |||
| 1892 | nmdc:mga08x19_37114_c1 | |||
| 1893 | nmdc:mga08x19_3775_c1 | |||
| 1894 | nmdc:mga08x19_548_c1 | |||
| 1895 | nmdc:mga08x19_7499_c1 | |||
| 1896 | nmdc:mga0a205_1935_c1 | |||
| 1897 | nmdc:mga0a205_284_c1 | |||
| 1898 | nmdc:mga0a205_39962_c1 | |||
| 1899 | nmdc:mga0sz30_20660_c1 | |||
| 1900 | nmdc:mga0sz30_62920_c1 | |||
| 1901 | nmdc:mga0sz30_85365_c1 | |||
| 1902 | Ga0495601_0000001 | |||
| 1903 | Ga0495601_0011988 | |||
| 1904 | Ga0495601_0030384 | |||
| 1905 | Ga0495601_0037851 | |||
| 1906 | Ga0495601_0097252 | |||
| 1907 | Ga0495601_0247841 | |||
| 1908 | Ga0495612_0000003 | |||
| 1909 | Ga0495612_0102124 | |||
| 1910 | Ga0495612_0176068 | |||
| 1911 | Ga0500610_0000022 | |||
| 1912 | Ga0495595_0000082 | |||
| 1913 | Ga0495595_0005771 | |||
| 1914 | Ga0495619_0000004 | |||
| 1915 | Ga0495619_0015254 | |||
| 1916 | Ga0495619_0071972 | |||
| 1917 | Ga0500644_0047593 | |||
| 1918 | Ga0500646_0002103 | |||
| 1919 | Ga0500646_0007545 | |||
| 1920 | Ga0500646_0007754 | |||
| 1921 | Ga0500651_0081671 | |||
| 1922 | Ga0500566_0181016 | |||
| 1923 | Ga0500555_015627 | |||
| 1924 | Ga0500658_0025225 | |||
| 1925 | Ga0500568_0018098 | |||
| 1926 | Ga0500568_0074291 | |||
| 1927 | Ga0500604_0002634 | |||
| 1928 | Ga0500604_0008950 | |||
| 1929 | Ga0500616_0002390 | |||
| 1930 | Ga0500552_000160 | |||
| 1931 | Ga0530510_0171579 | |||
| 1932 | 2514042729 | |||
| 1933 | 2599905993 | |||
| 1934 | 2599906170 | |||
| 1935 | 2643859001 | |||
| 1936 | 2643861952 | |||
| 1937 | 2643981004 | |||
| 1938 | 2643981822 | |||
| 1939 | 2776265189 | |||
| 1940 | 2809031670 | |||
| 1941 | 2809033882 | |||
| 1942 | 2819600868 | |||
| 1943 | 2855732517 | |||
| 1944 | 2855769225 | |||
| 1945 | 2857546780 | |||
| 1946 | 2858956490 | |||
| 1947 | 2881414891 | |||
| 1948 | 2883577154 | |||
| 1949 | 2894023573 | |||
| 1950 | 2894773894 | |||
| 1951 | 2929201930 | |||
| 1952 | 2939635059 | |||
| 1953 | 2941482330 | |||
| 1954 | 8055910918 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8hk9-assembly2.cif.gz_A | apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis | 0.9537 | 32 | 318 |
| 7ndr-assembly1.cif.gz_E | crystal structure of tphc in an open conformation | 0.9502 | 32 | 318 |
| 2qpq-assembly3.cif.gz_C | structure of bug27 from bordetella pertussis | 0.944 | 30 | 321 |
| 8hk9-assembly2.cif.gz_A | apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis | 0.9379 | 32 | 318 |
| 7ndr-assembly1.cif.gz_E | crystal structure of tphc in an open conformation | 0.9315 | 32 | 318 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4x9tA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9394 | 125 | 238 | 3.40.190.10 |
| 6hkeC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9265 | 125 | 246 | 3.40.190.10 |
| 2f5xC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9161 | 126 | 246 | 3.40.190.10 |
| 2qpqC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9095 | 125 | 246 | 3.40.190.10 |
| 6hkeC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9055 | 125 | 246 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5N7RLR6-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9763 | 25 | 321 |
|
| AF-A0A2N4SUF0-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.969 | 37 | 321 |
|
| AF-A0A1Q3XNW8-F1-model_v4 | deleted | 0.9687 | 25 | 321 |
|
| AF-A0A5A8EZ22-F1-model_v4 | deleted | 0.9679 | 22 | 321 |
|
| AF-A0A375FQQ0-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9657 | 66 | 321 |
|