F487277
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 977 | 407 | 977 | 139 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10003937|Ga0111539_1000393719 |
| Length | 146 |
| Sequence | MGLFMDCYHPCMAQWLVKEEPEHYNYAQLEKDKKTVWAGVRNPLAQKHLRGIKRGDRIFYYHTGKEKAVVATAKAASDAYADPNDTSGKLSVVDIVPDKKLTRPVTLAEIKGDKAFASFPLVRMSRLSVMPVTDAEWARIEKLSQS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 2 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 4 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 6 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 10 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 13 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 14 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 15 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 16 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 17 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 18 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 19 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 65 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 73 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 81 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 83 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 84 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 85 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 87 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 88 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 89 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 90 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 91 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 92 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 93 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 94 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 95 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 96 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 97 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 98 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 99 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 104 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 106 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 107 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 108 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 109 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 110 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 111 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 112 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 113 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 114 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 116 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 134 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 135 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 136 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 137 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 138 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 139 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 140 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 141 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 232 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 236 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 237 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 238 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 239 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 240 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 241 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 242 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 243 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 244 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 245 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 246 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 247 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 248 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 249 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 250 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 251 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 252 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 253 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 254 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 255 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 256 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 257 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 258 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 259 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 261 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 262 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 263 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 264 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 265 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 266 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 267 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 268 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 269 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 270 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 271 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 272 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 273 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 274 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 275 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 276 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 277 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 278 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 279 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 280 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 281 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 282 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 283 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 284 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 285 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 286 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 287 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 288 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 289 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 290 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 291 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 355 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 356 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 357 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 358 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 359 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 360 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 363 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 364 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 365 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 366 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 367 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 368 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 380 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 381 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 384 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 387 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 399 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 400 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 401 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 403 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 404 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 405 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 406 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.51 |
| Nodule | 0 |
| Rhizoplane | 6.35 |
| Rhizosphere | 93.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARSoilYngRDRAFT_c00080 | 3300000042 | Bacteria | 16083 |
| 2 | ARcpr5yngRDRAFT_c000055 | 3300000043 | Bacteria | 18216 |
| 3 | ARSoilOldRDRAFT_c000003 | 3300000044 | Bacteria | 63923 |
| 4 | ARCol0oldRDRAFT_c00230 | 3300000045 | Bacteria | 5194 |
| 5 | ARCol0yngRDRAFT_1000007 | 3300000652 | Bacteria | 46089 |
| 6 | JGI24746J21847_1002009 | 3300001977 | Bacteria | 3246 |
| 7 | JGI24739J22299_10000900 | 3300001989 | Bacteria | 10989 |
| 8 | JGI24737J22298_10000509 | 3300001990 | Bacteria | 13587 |
| 9 | JGI24737J22298_10023381 | 3300001990 | Bacteria | 1961 |
| 10 | JGI24745J21846_1000354 | 3300002073 | Bacteria | 3977 |
| 11 | JGI24748J21848_1001508 | 3300002074 | Bacteria | 2576 |
| 12 | JGI24738J21930_10000120 | 3300002075 | Bacteria | 18716 |
| 13 | JGI24749J21850_1003005 | 3300002076 | Bacteria | 2355 |
| 14 | JGI24744J21845_10004657 | 3300002077 | Bacteria | 2836 |
| 15 | JGI24035J26624_1000291 | 3300002126 | Bacteria | 4658 |
| 16 | JGI24034J26672_10000187 | 3300002239 | Bacteria | 8364 |
| 17 | JGI24742J22300_10000029 | 3300002244 | Bacteria | 23366 |
| 18 | JGI24751J29686_10046468 | 3300002459 | Bacteria | 897 |
| 19 | JGI26129J50193_1005105 | 3300003349 | Bacteria | 936 |
| 20 | Ga0065717_1002770 | 3300005276 | Bacteria | 1633 |
| 21 | Ga0065712_10000690 | 3300005290 | Bacteria | 10070 |
| 22 | Ga0065712_10001626 | 3300005290 | Bacteria | 6725 |
| 23 | Ga0065712_10091644 | 3300005290 | Bacteria | 2364 |
| 24 | Ga0065712_10290937 | 3300005290 | Unclassified | 877 |
| 25 | Ga0065712_10391798 | 3300005290 | Unclassified | 741 |
| 26 | Ga0065715_10001262 | 3300005293 | Bacteria | 15576 |
| 27 | Ga0065715_10147791 | 3300005293 | Bacteria | 1759 |
| 28 | Ga0065707_10165705 | 3300005295 | Bacteria | 1524 |
| 29 | Ga0070658_10348025 | 3300005327 | Bacteria | 1268 |
| 30 | Ga0070676_10003502 | 3300005328 | Bacteria | 8194 |
| 31 | Ga0070676_11216047 | 3300005328 | Bacteria | 573 |
| 32 | Ga0070683_100000116 | 3300005329 | Bacteria | 51956 |
| 33 | Ga0070683_100761316 | 3300005329 | Bacteria | 928 |
| 34 | Ga0070690_100011260 | 3300005330 | Bacteria | 5228 |
| 35 | Ga0070690_100014607 | 3300005330 | Bacteria | 4660 |
| 36 | Ga0070690_100066294 | 3300005330 | Bacteria | 2337 |
| 37 | Ga0070670_100006964 | 3300005331 | Bacteria | 9582 |
| 38 | Ga0070670_100016479 | 3300005331 | Bacteria | 6345 |
| 39 | Ga0070670_100036231 | 3300005331 | Bacteria | 4246 |
| 40 | Ga0070677_10000097 | 3300005333 | Bacteria | 28703 |
| 41 | Ga0068869_100040493 | 3300005334 | Bacteria | 3332 |
| 42 | Ga0068869_100064378 | 3300005334 | Bacteria | 2697 |
| 43 | Ga0068869_100349504 | 3300005334 | Unclassified | 1205 |
| 44 | Ga0070666_10003937 | 3300005335 | Bacteria | 9018 |
| 45 | Ga0070666_10004448 | 3300005335 | Bacteria | 8536 |
| 46 | Ga0070666_10035676 | 3300005335 | Bacteria | 3298 |
| 47 | Ga0070666_10418473 | 3300005335 | Bacteria | 965 |
| 48 | Ga0070680_100001035 | 3300005336 | Bacteria | 19930 |
| 49 | Ga0070680_100533561 | 3300005336 | Bacteria | 1005 |
| 50 | Ga0070682_100001635 | 3300005337 | Bacteria | 12449 |
| 51 | Ga0070682_100142101 | 3300005337 | Bacteria | 1637 |
| 52 | Ga0070682_100611362 | 3300005337 | Bacteria | 862 |
| 53 | Ga0068868_100006142 | 3300005338 | Bacteria | 8488 |
| 54 | Ga0068868_100060353 | 3300005338 | Bacteria | 3002 |
| 55 | Ga0068868_100139984 | 3300005338 | Bacteria | 1985 |
| 56 | Ga0068868_100464314 | 3300005338 | Unclassified | 1103 |
| 57 | Ga0070660_100034100 | 3300005339 | Bacteria | 3844 |
| 58 | Ga0070689_100016656 | 3300005340 | Bacteria | 5380 |
| 59 | Ga0070689_100099054 | 3300005340 | Bacteria | 2306 |
| 60 | Ga0070689_100424265 | 3300005340 | Unclassified | 1128 |
| 61 | Ga0070691_10000048 | 3300005341 | Bacteria | 33217 |
| 62 | Ga0070687_100017362 | 3300005343 | Bacteria | 3306 |
| 63 | Ga0070687_100026514 | 3300005343 | Bacteria | 2791 |
| 64 | Ga0070687_100059797 | 3300005343 | Unclassified | 2008 |
| 65 | Ga0070687_100140458 | 3300005343 | Bacteria | 1406 |
| 66 | Ga0070661_100000228 | 3300005344 | Bacteria | 46622 |
| 67 | Ga0070661_100080981 | 3300005344 | Bacteria | 2397 |
| 68 | Ga0070661_100676567 | 3300005344 | Bacteria | 839 |
| 69 | Ga0070661_101077346 | 3300005344 | Bacteria | 669 |
| 70 | Ga0070692_10000050 | 3300005345 | Bacteria | 22340 |
| 71 | Ga0070668_100010524 | 3300005347 | Bacteria | 6877 |
| 72 | Ga0070668_100125603 | 3300005347 | Bacteria | 2055 |
| 73 | Ga0070668_100214715 | 3300005347 | Bacteria | 1584 |
| 74 | Ga0070669_100031291 | 3300005353 | Bacteria | 3844 |
| 75 | Ga0070669_100656365 | 3300005353 | Unclassified | 883 |
| 76 | Ga0070669_100859548 | 3300005353 | Unclassified | 773 |
| 77 | Ga0070675_100000503 | 3300005354 | Bacteria | 26846 |
| 78 | Ga0070675_100072348 | 3300005354 | Unclassified | 2862 |
| 79 | Ga0070675_100072645 | 3300005354 | Unclassified | 2856 |
| 80 | Ga0070675_100075557 | 3300005354 | Bacteria | 2801 |
| 81 | Ga0070675_100327695 | 3300005354 | Unclassified | 1354 |
| 82 | Ga0070675_101153212 | 3300005354 | Unclassified | 713 |
| 83 | Ga0070671_100000720 | 3300005355 | Bacteria | 23686 |
| 84 | Ga0070671_100078879 | 3300005355 | Bacteria | 2752 |
| 85 | Ga0070671_100088410 | 3300005355 | Bacteria | 2593 |
| 86 | Ga0070674_100000570 | 3300005356 | Bacteria | 18571 |
| 87 | Ga0070674_100223669 | 3300005356 | Bacteria | 1465 |
| 88 | Ga0070673_100000045 | 3300005364 | Bacteria | 50756 |
| 89 | Ga0070673_100153938 | 3300005364 | Bacteria | 1949 |
| 90 | Ga0070673_100531525 | 3300005364 | Bacteria | 1067 |
| 91 | Ga0070673_101070688 | 3300005364 | Unclassified | 752 |
| 92 | Ga0070688_100000308 | 3300005365 | Bacteria | 24884 |
| 93 | Ga0070688_100038140 | 3300005365 | Unclassified | 2932 |
| 94 | Ga0070688_100069017 | 3300005365 | Bacteria | 2256 |
| 95 | Ga0070688_100099040 | 3300005365 | Bacteria | 1919 |
| 96 | Ga0070688_100895772 | 3300005365 | Unclassified | 699 |
| 97 | Ga0070659_100000183 | 3300005366 | Bacteria | 47789 |
| 98 | Ga0070659_100115869 | 3300005366 | Unclassified | 2166 |
| 99 | Ga0070659_100123226 | 3300005366 | Bacteria | 2101 |
| 100 | Ga0070667_100002774 | 3300005367 | Bacteria | 15139 |
| 101 | Ga0070667_100003874 | 3300005367 | Bacteria | 12703 |
| 102 | Ga0070667_100263573 | 3300005367 | Bacteria | 1544 |
| 103 | Ga0070703_10005702 | 3300005406 | Bacteria | 3486 |
| 104 | Ga0070703_10169907 | 3300005406 | Bacteria | 834 |
| 105 | Ga0070709_10003045 | 3300005434 | Bacteria | 8994 |
| 106 | Ga0070714_100006355 | 3300005435 | Bacteria | 9113 |
| 107 | Ga0070713_100043968 | 3300005436 | Bacteria | 3654 |
| 108 | Ga0070710_10031314 | 3300005437 | Bacteria | 2870 |
| 109 | Ga0070701_10106417 | 3300005438 | Unclassified | 1561 |
| 110 | Ga0070701_10166036 | 3300005438 | Bacteria | 1282 |
| 111 | Ga0070701_10326768 | 3300005438 | Bacteria | 951 |
| 112 | Ga0070701_10352389 | 3300005438 | Bacteria | 920 |
| 113 | Ga0070701_10647979 | 3300005438 | Bacteria | 705 |
| 114 | Ga0070711_100035477 | 3300005439 | Bacteria | 3335 |
| 115 | Ga0070705_100001770 | 3300005440 | Bacteria | 11188 |
| 116 | Ga0070705_100079927 | 3300005440 | Bacteria | 2004 |
| 117 | Ga0070705_100480256 | 3300005440 | Bacteria | 939 |
| 118 | Ga0070705_100507414 | 3300005440 | Bacteria | 917 |
| 119 | Ga0070705_100589355 | 3300005440 | Unclassified | 858 |
| 120 | Ga0070705_101060205 | 3300005440 | Bacteria | 661 |
| 121 | Ga0070700_100000239 | 3300005441 | Bacteria | 30133 |
| 122 | Ga0070694_100003730 | 3300005444 | Bacteria | 9088 |
| 123 | Ga0070694_100462166 | 3300005444 | Unclassified | 1004 |
| 124 | Ga0070708_100030075 | 3300005445 | Bacteria | 4691 |
| 125 | Ga0070708_100103463 | 3300005445 | Unclassified | 2610 |
| 126 | Ga0070708_101952936 | 3300005445 | Bacteria | 544 |
| 127 | Ga0070663_100000328 | 3300005455 | Bacteria | 24676 |
| 128 | Ga0070678_100000576 | 3300005456 | Bacteria | 17985 |
| 129 | Ga0070662_100011223 | 3300005457 | Bacteria | 5904 |
| 130 | Ga0070662_100056064 | 3300005457 | Bacteria | 2860 |
| 131 | Ga0070662_101230873 | 3300005457 | Bacteria | 644 |
| 132 | Ga0070681_10078407 | 3300005458 | Bacteria | 3260 |
| 133 | Ga0068867_100000160 | 3300005459 | Bacteria | 43656 |
| 134 | Ga0068867_101045807 | 3300005459 | Bacteria | 743 |
| 135 | Ga0068867_101055704 | 3300005459 | Unclassified | 739 |
| 136 | Ga0070685_10003069 | 3300005466 | Bacteria | 8508 |
| 137 | Ga0070685_10097202 | 3300005466 | Bacteria | 1792 |
| 138 | Ga0070685_10365854 | 3300005466 | Unclassified | 990 |
| 139 | Ga0070707_100889470 | 3300005468 | Unclassified | 855 |
| 140 | Ga0070707_102066961 | 3300005468 | Unclassified | 537 |
| 141 | Ga0070698_100980894 | 3300005471 | Bacteria | 792 |
| 142 | Ga0070699_100050460 | 3300005518 | Bacteria | 3602 |
| 143 | Ga0070699_100088539 | 3300005518 | Bacteria | 2704 |
| 144 | Ga0070699_100197400 | 3300005518 | Bacteria | 1789 |
| 145 | Ga0070679_100005744 | 3300005530 | Bacteria | 11509 |
| 146 | Ga0070679_100454183 | 3300005530 | Bacteria | 1226 |
| 147 | Ga0070684_100000352 | 3300005535 | Bacteria | 31642 |
| 148 | Ga0070684_100344868 | 3300005535 | Bacteria | 1369 |
| 149 | Ga0070684_100757528 | 3300005535 | Bacteria | 907 |
| 150 | Ga0070684_101032443 | 3300005535 | Bacteria | 772 |
| 151 | Ga0070697_100010084 | 3300005536 | Bacteria | 7370 |
| 152 | Ga0070697_100463412 | 3300005536 | Bacteria | 1105 |
| 153 | Ga0068853_100000902 | 3300005539 | Bacteria | 20677 |
| 154 | Ga0070672_100000016 | 3300005543 | Bacteria | 71848 |
| 155 | Ga0070672_100004109 | 3300005543 | Bacteria | 9503 |
| 156 | Ga0070672_100545830 | 3300005543 | Bacteria | 1006 |
| 157 | Ga0070672_101071143 | 3300005543 | Unclassified | 716 |
| 158 | Ga0070686_100006337 | 3300005544 | Bacteria | 6567 |
| 159 | Ga0070686_100006599 | 3300005544 | Bacteria | 6460 |
| 160 | Ga0070686_100008864 | 3300005544 | Bacteria | 5636 |
| 161 | Ga0070686_100107709 | 3300005544 | Unclassified | 1893 |
| 162 | Ga0070695_100001458 | 3300005545 | Bacteria | 13124 |
| 163 | Ga0070695_100004098 | 3300005545 | Bacteria | 8517 |
| 164 | Ga0070695_100169607 | 3300005545 | Bacteria | 1539 |
| 165 | Ga0070696_100006179 | 3300005546 | Bacteria | 8004 |
| 166 | Ga0070696_100019661 | 3300005546 | Bacteria | 4575 |
| 167 | Ga0070696_100073296 | 3300005546 | Bacteria | 2412 |
| 168 | Ga0070693_100002786 | 3300005547 | Bacteria | 8047 |
| 169 | Ga0070693_100100354 | 3300005547 | Bacteria | 1762 |
| 170 | Ga0070693_100484770 | 3300005547 | Bacteria | 874 |
| 171 | Ga0070665_100095421 | 3300005548 | Bacteria | 2979 |
| 172 | Ga0070704_100014046 | 3300005549 | Bacteria | 4991 |
| 173 | Ga0070704_100026483 | 3300005549 | Bacteria | 3832 |
| 174 | Ga0068855_100003504 | 3300005563 | Bacteria | 19223 |
| 175 | Ga0070664_100000067 | 3300005564 | Bacteria | 65201 |
| 176 | Ga0070664_100025650 | 3300005564 | Unclassified | 4888 |
| 177 | Ga0070664_100050415 | 3300005564 | Bacteria | 3522 |
| 178 | Ga0070664_100384557 | 3300005564 | Bacteria | 1281 |
| 179 | Ga0070664_100535698 | 3300005564 | Unclassified | 1082 |
| 180 | Ga0068857_100003331 | 3300005577 | Bacteria | 13366 |
| 181 | Ga0068857_100074904 | 3300005577 | Bacteria | 3017 |
| 182 | Ga0068854_100000131 | 3300005578 | Bacteria | 51521 |
| 183 | Ga0068854_100832197 | 3300005578 | Unclassified | 807 |
| 184 | Ga0068854_101029679 | 3300005578 | Bacteria | 730 |
| 185 | Ga0068854_101423473 | 3300005578 | Bacteria | 627 |
| 186 | Ga0068856_100002341 | 3300005614 | Bacteria | 19506 |
| 187 | Ga0068856_100233439 | 3300005614 | Bacteria | 1855 |
| 188 | Ga0070702_100001107 | 3300005615 | Bacteria | 10796 |
| 189 | Ga0070702_100473936 | 3300005615 | Bacteria | 913 |
| 190 | Ga0068852_101417415 | 3300005616 | Unclassified | 717 |
| 191 | Ga0068859_100003592 | 3300005617 | Bacteria | 15805 |
| 192 | Ga0068859_100070855 | 3300005617 | Unclassified | 3521 |
| 193 | Ga0068859_100181871 | 3300005617 | Bacteria | 2185 |
| 194 | Ga0068859_100245070 | 3300005617 | Bacteria | 1882 |
| 195 | Ga0068859_100559707 | 3300005617 | Unclassified | 1238 |
| 196 | Ga0068859_100563060 | 3300005617 | Bacteria | 1234 |
| 197 | Ga0068859_101475925 | 3300005617 | Unclassified | 750 |
| 198 | Ga0068864_100000234 | 3300005618 | Bacteria | 49663 |
| 199 | Ga0068864_100059635 | 3300005618 | Bacteria | 3302 |
| 200 | Ga0068864_100096129 | 3300005618 | Bacteria | 2621 |
| 201 | Ga0068864_100361972 | 3300005618 | Unclassified | 1371 |
| 202 | Ga0068864_101243077 | 3300005618 | Unclassified | 744 |
| 203 | Ga0068866_10000552 | 3300005718 | Bacteria | 17108 |
| 204 | Ga0068866_10199047 | 3300005718 | Bacteria | 1196 |
| 205 | Ga0068866_10245590 | 3300005718 | Unclassified | 1093 |
| 206 | Ga0068861_100000241 | 3300005719 | Bacteria | 30096 |
| 207 | Ga0068861_100242460 | 3300005719 | Bacteria | 1534 |
| 208 | Ga0068861_101580011 | 3300005719 | Bacteria | 646 |
| 209 | Ga0068861_102537982 | 3300005719 | Unclassified | 516 |
| 210 | Ga0068870_10000009 | 3300005840 | Bacteria | 70353 |
| 211 | Ga0068863_100003248 | 3300005841 | Bacteria | 16072 |
| 212 | Ga0068858_100001548 | 3300005842 | Bacteria | 23613 |
| 213 | Ga0068858_100056245 | 3300005842 | Unclassified | 3637 |
| 214 | Ga0068858_100057653 | 3300005842 | Bacteria | 3590 |
| 215 | Ga0068858_100060688 | 3300005842 | Bacteria | 3495 |
| 216 | Ga0068858_100390241 | 3300005842 | Bacteria | 1337 |
| 217 | Ga0068860_100001050 | 3300005843 | Bacteria | 30441 |
| 218 | Ga0068860_100094121 | 3300005843 | Bacteria | 2856 |
| 219 | Ga0068860_100381469 | 3300005843 | Bacteria | 1391 |
| 220 | Ga0068860_100450495 | 3300005843 | Bacteria | 1280 |
| 221 | Ga0068862_100001143 | 3300005844 | Bacteria | 25122 |
| 222 | Ga0068862_100034581 | 3300005844 | Bacteria | 4277 |
| 223 | Ga0068862_100746486 | 3300005844 | Bacteria | 952 |
| 224 | Ga0068862_101550222 | 3300005844 | Bacteria | 669 |
| 225 | Ga0081455_10605103 | 3300005937 | Bacteria | 714 |
| 226 | Ga0081538_10064500 | 3300005981 | Bacteria | 2071 |
| 227 | Ga0081539_10228045 | 3300005985 | Bacteria | 843 |
| 228 | Ga0070717_10058028 | 3300006028 | Bacteria | 3200 |
| 229 | Ga0070715_10028782 | 3300006163 | Bacteria | 2233 |
| 230 | Ga0070716_100003613 | 3300006173 | Bacteria | 7309 |
| 231 | Ga0070712_100151630 | 3300006175 | Bacteria | 1780 |
| 232 | Ga0075367_10024435 | 3300006178 | Bacteria | 3408 |
| 233 | Ga0097621_100000569 | 3300006237 | Bacteria | 25928 |
| 234 | Ga0097621_100076553 | 3300006237 | Bacteria | 2776 |
| 235 | Ga0097621_100118819 | 3300006237 | Unclassified | 2240 |
| 236 | Ga0097621_100122171 | 3300006237 | Bacteria | 2210 |
| 237 | Ga0097621_100416233 | 3300006237 | Unclassified | 1205 |
| 238 | Ga0068871_100000012 | 3300006358 | Bacteria | 105267 |
| 239 | Ga0068871_100004086 | 3300006358 | Bacteria | 10090 |
| 240 | Ga0068871_100009359 | 3300006358 | Bacteria | 7094 |
| 241 | Ga0068871_100058785 | 3300006358 | Bacteria | 3131 |
| 242 | Ga0068871_100066546 | 3300006358 | Archaea | 2954 |
| 243 | Ga0075428_100002901 | 3300006844 | Bacteria | 18656 |
| 244 | Ga0075428_100005542 | 3300006844 | Bacteria | 14036 |
| 245 | Ga0075428_100124605 | 3300006844 | Bacteria | 2804 |
| 246 | Ga0075428_100433024 | 3300006844 | Bacteria | 1409 |
| 247 | Ga0075428_101196402 | 3300006844 | Unclassified | 801 |
| 248 | Ga0075428_101571604 | 3300006844 | Bacteria | 688 |
| 249 | Ga0075430_100003290 | 3300006846 | Bacteria | 13548 |
| 250 | Ga0075430_100019613 | 3300006846 | Bacteria | 5752 |
| 251 | Ga0075430_100121353 | 3300006846 | Bacteria | 2179 |
| 252 | Ga0075430_100168650 | 3300006846 | Bacteria | 1821 |
| 253 | Ga0075430_100407113 | 3300006846 | Archaea | 1123 |
| 254 | Ga0075431_100015548 | 3300006847 | Bacteria | 7712 |
| 255 | Ga0075431_100027965 | 3300006847 | Bacteria | 5788 |
| 256 | Ga0075431_100067173 | 3300006847 | Unclassified | 3701 |
| 257 | Ga0075431_100130942 | 3300006847 | Bacteria | 2587 |
| 258 | Ga0075433_10009693 | 3300006852 | Bacteria | 7712 |
| 259 | Ga0075433_10013063 | 3300006852 | Bacteria | 6736 |
| 260 | Ga0075433_10082863 | 3300006852 | Bacteria | 2830 |
| 261 | Ga0075433_10088448 | 3300006852 | Bacteria | 2737 |
| 262 | Ga0075433_10380461 | 3300006852 | Unclassified | 1246 |
| 263 | Ga0075433_10426270 | 3300006852 | Bacteria | 1170 |
| 264 | Ga0075433_10552178 | 3300006852 | Bacteria | 1013 |
| 265 | Ga0075434_100001007 | 3300006871 | Bacteria | 22897 |
| 266 | Ga0075434_100079657 | 3300006871 | Bacteria | 3272 |
| 267 | Ga0075434_100098341 | 3300006871 | Bacteria | 2931 |
| 268 | Ga0075434_100351532 | 3300006871 | Unclassified | 1495 |
| 269 | Ga0075434_100434757 | 3300006871 | Bacteria | 1333 |
| 270 | Ga0075434_100434827 | 3300006871 | Bacteria | 1333 |
| 271 | Ga0075429_100002327 | 3300006880 | Bacteria | 15955 |
| 272 | Ga0075429_100003277 | 3300006880 | Bacteria | 13798 |
| 273 | Ga0075429_100539535 | 3300006880 | Bacteria | 1022 |
| 274 | Ga0075429_100553821 | 3300006880 | Unclassified | 1008 |
| 275 | Ga0068865_100000209 | 3300006881 | Bacteria | 32559 |
| 276 | Ga0068865_101675208 | 3300006881 | Unclassified | 573 |
| 277 | Ga0075436_100030775 | 3300006914 | Bacteria | 3694 |
| 278 | Ga0075436_100354863 | 3300006914 | Bacteria | 1057 |
| 279 | Ga0075436_100425788 | 3300006914 | Unclassified | 964 |
| 280 | Ga0075436_100429462 | 3300006914 | Unclassified | 960 |
| 281 | Ga0075436_100580529 | 3300006914 | Bacteria | 825 |
| 282 | Ga0097620_100003592 | 3300006931 | Bacteria | 15805 |
| 283 | Ga0097620_100070854 | 3300006931 | Unclassified | 3521 |
| 284 | Ga0097620_100181878 | 3300006931 | Bacteria | 2185 |
| 285 | Ga0097620_100245065 | 3300006931 | Bacteria | 1882 |
| 286 | Ga0097620_100559720 | 3300006931 | Unclassified | 1238 |
| 287 | Ga0097620_100563091 | 3300006931 | Bacteria | 1234 |
| 288 | Ga0097620_101475720 | 3300006931 | Unclassified | 750 |
| 289 | Ga0075435_100003730 | 3300007076 | Bacteria | 10380 |
| 290 | Ga0075435_100007651 | 3300007076 | Bacteria | 7715 |
| 291 | Ga0075435_100029012 | 3300007076 | Bacteria | 4342 |
| 292 | Ga0075435_100078508 | 3300007076 | Unclassified | 2707 |
| 293 | Ga0075435_100109402 | 3300007076 | Unclassified | 2297 |
| 294 | Ga0075435_100191013 | 3300007076 | Bacteria | 1733 |
| 295 | Ga0075435_100314289 | 3300007076 | Bacteria | 1341 |
| 296 | Ga0075435_100636847 | 3300007076 | Bacteria | 925 |
| 297 | Ga0105251_10010416 | 3300009011 | Bacteria | 5396 |
| 298 | Ga0105244_10013466 | 3300009036 | Bacteria | 4780 |
| 299 | Ga0105250_10046130 | 3300009092 | Bacteria | 1747 |
| 300 | Ga0105250_10154115 | 3300009092 | Unclassified | 957 |
| 301 | Ga0105250_10166835 | 3300009092 | Bacteria | 921 |
| 302 | Ga0105240_10073250 | 3300009093 | Bacteria | 4230 |
| 303 | Ga0111539_10000941 | 3300009094 | Bacteria | 38137 |
| 304 | Ga0111539_10001081 | 3300009094 | Bacteria | 36017 |
| 305 | Ga0111539_10003937 | 3300009094 | Bacteria | 19525 |
| 306 | Ga0111539_10046672 | 3300009094 | Bacteria | 5181 |
| 307 | Ga0111539_10470087 | 3300009094 | Bacteria | 1464 |
| 308 | Ga0105245_10001284 | 3300009098 | Bacteria | 22645 |
| 309 | Ga0105245_10746672 | 3300009098 | Unclassified | 1014 |
| 310 | Ga0105245_10813127 | 3300009098 | Bacteria | 973 |
| 311 | Ga0105245_11012962 | 3300009098 | Bacteria | 875 |
| 312 | Ga0105247_10003522 | 3300009101 | Bacteria | 10175 |
| 313 | Ga0105247_10086947 | 3300009101 | Bacteria | 1979 |
| 314 | Ga0114129_10005884 | 3300009147 | Bacteria | 17371 |
| 315 | Ga0114129_10006379 | 3300009147 | Bacteria | 16721 |
| 316 | Ga0114129_10009653 | 3300009147 | Bacteria | 13772 |
| 317 | Ga0114129_10030531 | 3300009147 | Bacteria | 7625 |
| 318 | Ga0114129_10035036 | 3300009147 | Bacteria | 7091 |
| 319 | Ga0114129_10052791 | 3300009147 | Bacteria | 5704 |
| 320 | Ga0105243_10003373 | 3300009148 | Bacteria | 12960 |
| 321 | Ga0105243_10093512 | 3300009148 | Bacteria | 2481 |
| 322 | Ga0105241_10000053 | 3300009174 | Bacteria | 94578 |
| 323 | Ga0105242_10000492 | 3300009176 | Bacteria | 31218 |
| 324 | Ga0105242_10090793 | 3300009176 | Bacteria | 2570 |
| 325 | Ga0105242_10287264 | 3300009176 | Bacteria | 1496 |
| 326 | Ga0105248_10000934 | 3300009177 | Bacteria | 32542 |
| 327 | Ga0105248_10001794 | 3300009177 | Bacteria | 23871 |
| 328 | Ga0105248_10015418 | 3300009177 | Bacteria | 8425 |
| 329 | Ga0105248_10031696 | 3300009177 | Bacteria | 5906 |
| 330 | Ga0105248_10112789 | 3300009177 | Bacteria | 3066 |
| 331 | Ga0105248_10836330 | 3300009177 | Unclassified | 1039 |
| 332 | Ga0105248_10959976 | 3300009177 | Bacteria | 965 |
| 333 | Ga0105248_11010302 | 3300009177 | Unclassified | 940 |
| 334 | Ga0105248_11302388 | 3300009177 | Unclassified | 822 |
| 335 | Ga0105237_10014650 | 3300009545 | Bacteria | 8189 |
| 336 | Ga0105237_10209046 | 3300009545 | Bacteria | 1951 |
| 337 | Ga0105238_10070681 | 3300009551 | Bacteria | 3489 |
| 338 | Ga0105238_10121677 | 3300009551 | Bacteria | 2589 |
| 339 | Ga0105249_10003582 | 3300009553 | Bacteria | 13439 |
| 340 | Ga0105249_10033319 | 3300009553 | Bacteria | 4664 |
| 341 | Ga0105249_12752150 | 3300009553 | Bacteria | 564 |
| 342 | Ga0105239_10016523 | 3300010375 | Bacteria | 8160 |
| 343 | Ga0105239_11418221 | 3300010375 | Bacteria | 802 |
| 344 | Ga0105246_10000055 | 3300011119 | Bacteria | 45431 |
| 345 | Ga0105246_10498358 | 3300011119 | Unclassified | 1034 |
| 346 | Ga0105246_11642420 | 3300011119 | Bacteria | 609 |
| 347 | Ga0157322_1003269 | 3300012490 | Bacteria | 981 |
| 348 | Ga0157335_1001325 | 3300012492 | Bacteria | 1339 |
| 349 | Ga0157335_1003155 | 3300012492 | Bacteria | 1040 |
| 350 | Ga0157341_1000580 | 3300012494 | Bacteria | 1908 |
| 351 | Ga0157347_1001471 | 3300012502 | Bacteria | 1854 |
| 352 | Ga0157313_1000610 | 3300012503 | Bacteria | 1700 |
| 353 | Ga0157342_1003586 | 3300012507 | Bacteria | 1337 |
| 354 | Ga0157327_1009899 | 3300012512 | Bacteria | 889 |
| 355 | Ga0157338_1003272 | 3300012515 | Bacteria | 1332 |
| 356 | Ga0157373_10006564 | 3300013100 | Bacteria | 8679 |
| 357 | Ga0157371_10098837 | 3300013102 | Bacteria | 2070 |
| 358 | Ga0157374_10001308 | 3300013296 | Bacteria | 21203 |
| 359 | Ga0157374_10326686 | 3300013296 | Bacteria | 1521 |
| 360 | Ga0157374_10468874 | 3300013296 | Bacteria | 1262 |
| 361 | Ga0157374_11098293 | 3300013296 | Unclassified | 816 |
| 362 | Ga0157374_11217466 | 3300013296 | Bacteria | 774 |
| 363 | Ga0157378_10000986 | 3300013297 | Bacteria | 26065 |
| 364 | Ga0157378_10176862 | 3300013297 | Bacteria | 2005 |
| 365 | Ga0163162_10002432 | 3300013306 | Bacteria | 17549 |
| 366 | Ga0163162_10031169 | 3300013306 | Bacteria | 5288 |
| 367 | Ga0163162_10078121 | 3300013306 | Bacteria | 3375 |
| 368 | Ga0163162_10116324 | 3300013306 | Bacteria | 2774 |
| 369 | Ga0163162_10223407 | 3300013306 | Bacteria | 2013 |
| 370 | Ga0157372_10031748 | 3300013307 | Bacteria | 5786 |
| 371 | Ga0157375_10000933 | 3300013308 | Bacteria | 25341 |
| 372 | Ga0157375_10024669 | 3300013308 | Bacteria | 5571 |
| 373 | Ga0157375_10041036 | 3300013308 | Bacteria | 4466 |
| 374 | Ga0157375_10168969 | 3300013308 | Bacteria | 2333 |
| 375 | Ga0163163_10005666 | 3300014325 | Bacteria | 10834 |
| 376 | Ga0163163_10009027 | 3300014325 | Bacteria | 8883 |
| 377 | Ga0163163_10014105 | 3300014325 | Bacteria | 7338 |
| 378 | Ga0163163_10039079 | 3300014325 | Bacteria | 4629 |
| 379 | Ga0163163_10244548 | 3300014325 | Bacteria | 1844 |
| 380 | Ga0163163_11171643 | 3300014325 | Bacteria | 831 |
| 381 | Ga0163163_11609086 | 3300014325 | Bacteria | 711 |
| 382 | Ga0157380_10000821 | 3300014326 | Bacteria | 19478 |
| 383 | Ga0157380_10792656 | 3300014326 | Unclassified | 964 |
| 384 | Ga0157380_11108013 | 3300014326 | Bacteria | 831 |
| 385 | Ga0157377_10002329 | 3300014745 | Bacteria | 8365 |
| 386 | Ga0157377_10038813 | 3300014745 | Unclassified | 2631 |
| 387 | Ga0157377_10094013 | 3300014745 | Bacteria | 1775 |
| 388 | Ga0157377_10139755 | 3300014745 | Bacteria | 1487 |
| 389 | Ga0157377_10371856 | 3300014745 | Bacteria | 965 |
| 390 | Ga0157379_10000679 | 3300014968 | Bacteria | 27606 |
| 391 | Ga0157379_10056130 | 3300014968 | Bacteria | 3519 |
| 392 | Ga0157379_10201412 | 3300014968 | Bacteria | 1800 |
| 393 | Ga0157379_10207352 | 3300014968 | Bacteria | 1773 |
| 394 | Ga0157379_11612568 | 3300014968 | Unclassified | 634 |
| 395 | Ga0157376_10000527 | 3300014969 | Bacteria | 24607 |
| 396 | Ga0157376_10015817 | 3300014969 | Bacteria | 5710 |
| 397 | Ga0157376_10247032 | 3300014969 | Bacteria | 1665 |
| 398 | Ga0163161_10000770 | 3300017792 | Bacteria | 25240 |
| 399 | Ga0163161_10768627 | 3300017792 | Bacteria | 807 |
| 400 | Ga0207666_1000026 | 3300025271 | Bacteria | 33873 |
| 401 | Ga0207666_1003755 | 3300025271 | Bacteria | 1877 |
| 402 | Ga0207673_1001793 | 3300025290 | Bacteria | 2386 |
| 403 | Ga0207697_10000245 | 3300025315 | Bacteria | 29793 |
| 404 | Ga0207697_10042301 | 3300025315 | Bacteria | 1872 |
| 405 | Ga0207655_1107185 | 3300025728 | Unclassified | 950 |
| 406 | Ga0207713_1061561 | 3300025735 | Bacteria | 1427 |
| 407 | Ga0207653_10013162 | 3300025885 | Bacteria | 2589 |
| 408 | Ga0207682_10000029 | 3300025893 | Bacteria | 57930 |
| 409 | Ga0207692_10015940 | 3300025898 | Bacteria | 3316 |
| 410 | Ga0207642_10001640 | 3300025899 | Bacteria | 6896 |
| 411 | Ga0207642_10120835 | 3300025899 | Bacteria | 1351 |
| 412 | Ga0207642_10140711 | 3300025899 | Bacteria | 1272 |
| 413 | Ga0207642_10490080 | 3300025899 | Bacteria | 751 |
| 414 | Ga0207710_10024606 | 3300025900 | Bacteria | 2595 |
| 415 | Ga0207710_10127543 | 3300025900 | Bacteria | 1220 |
| 416 | Ga0207688_10000084 | 3300025901 | Bacteria | 35752 |
| 417 | Ga0207688_10028735 | 3300025901 | Bacteria | 3058 |
| 418 | Ga0207688_10065550 | 3300025901 | Bacteria | 2053 |
| 419 | Ga0207680_10001429 | 3300025903 | Bacteria | 11322 |
| 420 | Ga0207680_10051106 | 3300025903 | Unclassified | 2470 |
| 421 | Ga0207680_10622693 | 3300025903 | Bacteria | 772 |
| 422 | Ga0207647_10001299 | 3300025904 | Bacteria | 19229 |
| 423 | Ga0207647_10018094 | 3300025904 | Bacteria | 4776 |
| 424 | Ga0207685_10002707 | 3300025905 | Bacteria | 4124 |
| 425 | Ga0207699_10001859 | 3300025906 | Bacteria | 9947 |
| 426 | Ga0207645_10000090 | 3300025907 | Bacteria | 65569 |
| 427 | Ga0207643_10000044 | 3300025908 | Bacteria | 82217 |
| 428 | Ga0207705_10275569 | 3300025909 | Bacteria | 1287 |
| 429 | Ga0207654_10000143 | 3300025911 | Bacteria | 45654 |
| 430 | Ga0207707_10000580 | 3300025912 | Bacteria | 37172 |
| 431 | Ga0207707_10107069 | 3300025912 | Bacteria | 2444 |
| 432 | Ga0207695_10065947 | 3300025913 | Bacteria | 3720 |
| 433 | Ga0207671_10014374 | 3300025914 | Bacteria | 6260 |
| 434 | Ga0207693_10036145 | 3300025915 | Bacteria | 3893 |
| 435 | Ga0207663_10019234 | 3300025916 | Bacteria | 3843 |
| 436 | Ga0207663_10135741 | 3300025916 | Bacteria | 1707 |
| 437 | Ga0207660_10000653 | 3300025917 | Bacteria | 23385 |
| 438 | Ga0207660_10192390 | 3300025917 | Bacteria | 1589 |
| 439 | Ga0207660_10904253 | 3300025917 | Bacteria | 720 |
| 440 | Ga0207662_10000104 | 3300025918 | Bacteria | 40365 |
| 441 | Ga0207662_10012668 | 3300025918 | Bacteria | 4699 |
| 442 | Ga0207662_10037005 | 3300025918 | Bacteria | 2855 |
| 443 | Ga0207662_10103825 | 3300025918 | Bacteria | 1764 |
| 444 | Ga0207657_10011813 | 3300025919 | Bacteria | 8646 |
| 445 | Ga0207657_10048554 | 3300025919 | Bacteria | 3705 |
| 446 | Ga0207649_10000057 | 3300025920 | Bacteria | 102314 |
| 447 | Ga0207649_10049764 | 3300025920 | Bacteria | 2590 |
| 448 | Ga0207652_10001436 | 3300025921 | Bacteria | 21120 |
| 449 | Ga0207652_10204797 | 3300025921 | Bacteria | 1776 |
| 450 | Ga0207646_10201309 | 3300025922 | Bacteria | 1799 |
| 451 | Ga0207646_10317005 | 3300025922 | Bacteria | 1409 |
| 452 | Ga0207681_10000154 | 3300025923 | Bacteria | 57555 |
| 453 | Ga0207681_10085889 | 3300025923 | Bacteria | 2234 |
| 454 | Ga0207681_10126211 | 3300025923 | Unclassified | 1885 |
| 455 | Ga0207681_10230035 | 3300025923 | Bacteria | 1439 |
| 456 | Ga0207694_10137941 | 3300025924 | Bacteria | 1960 |
| 457 | Ga0207694_10168251 | 3300025924 | Bacteria | 1773 |
| 458 | Ga0207650_10001069 | 3300025925 | Bacteria | 20358 |
| 459 | Ga0207650_10005233 | 3300025925 | Bacteria | 8844 |
| 460 | Ga0207650_10043547 | 3300025925 | Unclassified | 3295 |
| 461 | Ga0207650_10121055 | 3300025925 | Bacteria | 2038 |
| 462 | Ga0207659_10000028 | 3300025926 | Bacteria | 130804 |
| 463 | Ga0207659_10058328 | 3300025926 | Bacteria | 2771 |
| 464 | Ga0207659_10084610 | 3300025926 | Unclassified | 2354 |
| 465 | Ga0207659_10703603 | 3300025926 | Bacteria | 865 |
| 466 | Ga0207659_11588712 | 3300025926 | Unclassified | 558 |
| 467 | Ga0207687_10000249 | 3300025927 | Bacteria | 36556 |
| 468 | Ga0207687_10015275 | 3300025927 | Bacteria | 5031 |
| 469 | Ga0207687_10754400 | 3300025927 | Bacteria | 828 |
| 470 | Ga0207700_10031736 | 3300025928 | Bacteria | 3757 |
| 471 | Ga0207664_10014021 | 3300025929 | Bacteria | 5777 |
| 472 | Ga0207644_10002109 | 3300025931 | Bacteria | 12894 |
| 473 | Ga0207644_10020295 | 3300025931 | Bacteria | 4517 |
| 474 | Ga0207644_10149049 | 3300025931 | Bacteria | 1809 |
| 475 | Ga0207644_10162853 | 3300025931 | Bacteria | 1735 |
| 476 | Ga0207690_10000225 | 3300025932 | Bacteria | 42706 |
| 477 | Ga0207690_10059770 | 3300025932 | Bacteria | 2584 |
| 478 | Ga0207690_10094151 | 3300025932 | Bacteria | 2125 |
| 479 | Ga0207690_10308483 | 3300025932 | Bacteria | 1240 |
| 480 | Ga0207690_10421438 | 3300025932 | Bacteria | 1068 |
| 481 | Ga0207706_10001675 | 3300025933 | Bacteria | 21873 |
| 482 | Ga0207706_10259347 | 3300025933 | Bacteria | 1518 |
| 483 | Ga0207706_10737080 | 3300025933 | Unclassified | 840 |
| 484 | Ga0207686_10001701 | 3300025934 | Bacteria | 12258 |
| 485 | Ga0207686_10133387 | 3300025934 | Bacteria | 1706 |
| 486 | Ga0207686_10337406 | 3300025934 | Bacteria | 1131 |
| 487 | Ga0207709_10000291 | 3300025935 | Bacteria | 56621 |
| 488 | Ga0207709_10069957 | 3300025935 | Bacteria | 2224 |
| 489 | Ga0207709_10218038 | 3300025935 | Bacteria | 1374 |
| 490 | Ga0207670_10000463 | 3300025936 | Bacteria | 22617 |
| 491 | Ga0207670_10007249 | 3300025936 | Bacteria | 6178 |
| 492 | Ga0207670_10103898 | 3300025936 | Bacteria | 2034 |
| 493 | Ga0207670_10282986 | 3300025936 | Bacteria | 1293 |
| 494 | Ga0207669_10000019 | 3300025937 | Bacteria | 111630 |
| 495 | Ga0207669_10104728 | 3300025937 | Bacteria | 1880 |
| 496 | Ga0207669_10336251 | 3300025937 | Bacteria | 1161 |
| 497 | Ga0207669_10346884 | 3300025937 | Unclassified | 1145 |
| 498 | Ga0207669_10615491 | 3300025937 | Bacteria | 884 |
| 499 | Ga0207704_10000230 | 3300025938 | Bacteria | 27729 |
| 500 | Ga0207704_10022698 | 3300025938 | Bacteria | 3368 |
| 501 | Ga0207704_10129753 | 3300025938 | Bacteria | 1743 |
| 502 | Ga0207704_10757743 | 3300025938 | Unclassified | 808 |
| 503 | Ga0207665_10010796 | 3300025939 | Bacteria | 5997 |
| 504 | Ga0207691_10000882 | 3300025940 | Bacteria | 29793 |
| 505 | Ga0207691_10009942 | 3300025940 | Bacteria | 9136 |
| 506 | Ga0207691_10018118 | 3300025940 | Bacteria | 6669 |
| 507 | Ga0207691_10093609 | 3300025940 | Bacteria | 2690 |
| 508 | Ga0207691_10111783 | 3300025940 | Bacteria | 2429 |
| 509 | Ga0207691_10291881 | 3300025940 | Bacteria | 1402 |
| 510 | Ga0207711_10001381 | 3300025941 | Bacteria | 22842 |
| 511 | Ga0207711_10011217 | 3300025941 | Bacteria | 7446 |
| 512 | Ga0207711_10033459 | 3300025941 | Unclassified | 4349 |
| 513 | Ga0207711_10040118 | 3300025941 | Bacteria | 3983 |
| 514 | Ga0207711_10999594 | 3300025941 | Bacteria | 776 |
| 515 | Ga0207711_11129816 | 3300025941 | Bacteria | 724 |
| 516 | Ga0207689_10000228 | 3300025942 | Bacteria | 50020 |
| 517 | Ga0207689_10054554 | 3300025942 | Bacteria | 3291 |
| 518 | Ga0207689_10115647 | 3300025942 | Bacteria | 2205 |
| 519 | Ga0207689_10546287 | 3300025942 | Bacteria | 973 |
| 520 | Ga0207661_10000107 | 3300025944 | Bacteria | 52429 |
| 521 | Ga0207661_10503205 | 3300025944 | Bacteria | 1107 |
| 522 | Ga0207661_10849638 | 3300025944 | Unclassified | 840 |
| 523 | Ga0207679_10000026 | 3300025945 | Bacteria | 200073 |
| 524 | Ga0207679_10020751 | 3300025945 | Bacteria | 4440 |
| 525 | Ga0207679_10026036 | 3300025945 | Unclassified | 4030 |
| 526 | Ga0207679_10124099 | 3300025945 | Bacteria | 2061 |
| 527 | Ga0207679_10148976 | 3300025945 | Bacteria | 1902 |
| 528 | Ga0207679_10339848 | 3300025945 | Bacteria | 1305 |
| 529 | Ga0207667_10007642 | 3300025949 | Bacteria | 12950 |
| 530 | Ga0207651_10000069 | 3300025960 | Bacteria | 46408 |
| 531 | Ga0207651_10171106 | 3300025960 | Bacteria | 1713 |
| 532 | Ga0207651_10348771 | 3300025960 | Unclassified | 1246 |
| 533 | Ga0207651_10349307 | 3300025960 | Bacteria | 1245 |
| 534 | Ga0207651_10531336 | 3300025960 | Bacteria | 1020 |
| 535 | Ga0207651_10546104 | 3300025960 | Bacteria | 1007 |
| 536 | Ga0207712_10000242 | 3300025961 | Bacteria | 53794 |
| 537 | Ga0207712_10067736 | 3300025961 | Bacteria | 2556 |
| 538 | Ga0207712_10472090 | 3300025961 | Bacteria | 1068 |
| 539 | Ga0207668_10000049 | 3300025972 | Bacteria | 99391 |
| 540 | Ga0207668_10183651 | 3300025972 | Bacteria | 1652 |
| 541 | Ga0207640_10000301 | 3300025981 | Bacteria | 32802 |
| 542 | Ga0207658_10010690 | 3300025986 | Bacteria | 6238 |
| 543 | Ga0207658_10033574 | 3300025986 | Bacteria | 3661 |
| 544 | Ga0207658_10728510 | 3300025986 | Bacteria | 897 |
| 545 | Ga0207658_11554878 | 3300025986 | Bacteria | 605 |
| 546 | Ga0207677_10033906 | 3300026023 | Bacteria | 3300 |
| 547 | Ga0207677_10066907 | 3300026023 | Bacteria | 2514 |
| 548 | Ga0207677_10863146 | 3300026023 | Bacteria | 814 |
| 549 | Ga0207677_10942950 | 3300026023 | Unclassified | 780 |
| 550 | Ga0207703_10002075 | 3300026035 | Bacteria | 17625 |
| 551 | Ga0207703_10047218 | 3300026035 | Unclassified | 3471 |
| 552 | Ga0207703_10119645 | 3300026035 | Bacteria | 2259 |
| 553 | Ga0207703_10128659 | 3300026035 | Bacteria | 2184 |
| 554 | Ga0207703_10136077 | 3300026035 | Unclassified | 2127 |
| 555 | Ga0207703_10185762 | 3300026035 | Bacteria | 1837 |
| 556 | Ga0207639_10000413 | 3300026041 | Bacteria | 29583 |
| 557 | Ga0207639_10631383 | 3300026041 | Bacteria | 990 |
| 558 | Ga0207678_10000920 | 3300026067 | Bacteria | 26941 |
| 559 | Ga0207678_10007714 | 3300026067 | Bacteria | 9507 |
| 560 | Ga0207678_10419719 | 3300026067 | Bacteria | 1160 |
| 561 | Ga0207708_10002680 | 3300026075 | Bacteria | 13080 |
| 562 | Ga0207708_10002682 | 3300026075 | Bacteria | 13078 |
| 563 | Ga0207708_10266025 | 3300026075 | Bacteria | 1385 |
| 564 | Ga0207708_11725404 | 3300026075 | Bacteria | 550 |
| 565 | Ga0207702_10002075 | 3300026078 | Bacteria | 19368 |
| 566 | Ga0207641_10000542 | 3300026088 | Bacteria | 42352 |
| 567 | Ga0207641_10074355 | 3300026088 | Bacteria | 2931 |
| 568 | Ga0207641_10124275 | 3300026088 | Bacteria | 2307 |
| 569 | Ga0207641_10142353 | 3300026088 | Bacteria | 2165 |
| 570 | Ga0207641_10192942 | 3300026088 | Bacteria | 1873 |
| 571 | Ga0207641_11771034 | 3300026088 | Unclassified | 619 |
| 572 | Ga0207648_10002093 | 3300026089 | Bacteria | 21739 |
| 573 | Ga0207648_10051099 | 3300026089 | Bacteria | 3613 |
| 574 | Ga0207648_10475622 | 3300026089 | Bacteria | 1140 |
| 575 | Ga0207648_11022019 | 3300026089 | Unclassified | 774 |
| 576 | Ga0207676_10000511 | 3300026095 | Bacteria | 32689 |
| 577 | Ga0207676_10163889 | 3300026095 | Unclassified | 1929 |
| 578 | Ga0207676_11263867 | 3300026095 | Bacteria | 732 |
| 579 | Ga0207674_10000882 | 3300026116 | Bacteria | 39274 |
| 580 | Ga0207674_10149810 | 3300026116 | Bacteria | 2290 |
| 581 | Ga0207675_100001599 | 3300026118 | Bacteria | 22695 |
| 582 | Ga0207675_100032967 | 3300026118 | Bacteria | 4826 |
| 583 | Ga0207675_100128939 | 3300026118 | Unclassified | 2398 |
| 584 | Ga0207675_100890864 | 3300026118 | Unclassified | 906 |
| 585 | Ga0207683_10000653 | 3300026121 | Bacteria | 31779 |
| 586 | Ga0207683_10005584 | 3300026121 | Bacteria | 10781 |
| 587 | Ga0207683_10062420 | 3300026121 | Bacteria | 3281 |
| 588 | Ga0207698_10003176 | 3300026142 | Bacteria | 9855 |
| 589 | Ga0207698_10756239 | 3300026142 | Bacteria | 971 |
| 590 | Ga0209967_1001141 | 3300027364 | Bacteria | 3380 |
| 591 | Ga0209999_1003610 | 3300027543 | Bacteria | 2770 |
| 592 | Ga0210002_1000267 | 3300027617 | Bacteria | 7402 |
| 593 | Ga0209983_1013876 | 3300027665 | Bacteria | 1658 |
| 594 | Ga0209983_1054296 | 3300027665 | Bacteria | 879 |
| 595 | Ga0209971_1011327 | 3300027682 | Bacteria | 2112 |
| 596 | Ga0209998_10000855 | 3300027717 | Bacteria | 7842 |
| 597 | Ga0209998_10000913 | 3300027717 | Bacteria | 7554 |
| 598 | Ga0209974_10001240 | 3300027876 | Bacteria | 9154 |
| 599 | Ga0209974_10099596 | 3300027876 | Bacteria | 1015 |
| 600 | Ga0207428_10000130 | 3300027907 | Bacteria | 104457 |
| 601 | Ga0207428_10000286 | 3300027907 | Bacteria | 68250 |
| 602 | Ga0207428_10015465 | 3300027907 | Bacteria | 6601 |
| 603 | Ga0207428_10110621 | 3300027907 | Bacteria | 2115 |
| 604 | Ga0207428_10189886 | 3300027907 | Bacteria | 1549 |
| 605 | Ga0268266_10013545 | 3300028379 | Bacteria | 7022 |
| 606 | Ga0268265_10000410 | 3300028380 | Bacteria | 45939 |
| 607 | Ga0268265_10509228 | 3300028380 | Bacteria | 1136 |
| 608 | Ga0268265_11167409 | 3300028380 | Bacteria | 766 |
| 609 | Ga0268264_10001172 | 3300028381 | Bacteria | 25487 |
| 610 | Ga0268264_10132374 | 3300028381 | Bacteria | 2213 |
| 611 | Ga0268264_10407382 | 3300028381 | Bacteria | 1308 |
| 612 | Ga0268264_11139909 | 3300028381 | Bacteria | 789 |
| 613 | Ga0268264_11217447 | 3300028381 | Bacteria | 762 |
| 614 | Ga0268264_11702657 | 3300028381 | Bacteria | 641 |
| 615 | Ga0307405_10016886 | 3300031731 | Bacteria | 3992 |
| 616 | Ga0307413_10034670 | 3300031824 | Bacteria | 2887 |
| 617 | Ga0307410_10059355 | 3300031852 | Bacteria | 2611 |
| 618 | Ga0307410_10107587 | 3300031852 | Unclassified | 2012 |
| 619 | Ga0307406_10061754 | 3300031901 | Bacteria | 2421 |
| 620 | Ga0307407_10089475 | 3300031903 | Bacteria | 1883 |
| 621 | Ga0307412_10051980 | 3300031911 | Bacteria | 2711 |
| 622 | Ga0307412_10072569 | 3300031911 | Bacteria | 2353 |
| 623 | Ga0307409_100085397 | 3300031995 | Bacteria | 2565 |
| 624 | Ga0307409_100265543 | 3300031995 | Unclassified | 1578 |
| 625 | Ga0307416_100007987 | 3300032002 | Bacteria | 6776 |
| 626 | Ga0307416_100098982 | 3300032002 | Bacteria | 2531 |
| 627 | Ga0307416_100213190 | 3300032002 | Bacteria | 1844 |
| 628 | Ga0307416_102406911 | 3300032002 | Bacteria | 626 |
| 629 | Ga0307414_10088192 | 3300032004 | Bacteria | 2295 |
| 630 | Ga0307415_100043057 | 3300032126 | Bacteria | 3009 |
| 631 | Ga0307415_100138449 | 3300032126 | Bacteria | 1855 |
| 632 | Ga0373930_0001406 | 3300034816 | Bacteria | 3572 |
| 633 | Ga0373930_0018027 | 3300034816 | Bacteria | 1353 |
| 634 | Ga0373930_0018703 | 3300034816 | Bacteria | 1335 |
| 635 | Ga0373948_0000715 | 3300034817 | Bacteria | 4319 |
| 636 | Ga0373948_0020424 | 3300034817 | Bacteria | 1261 |
| 637 | Ga0373950_0006419 | 3300034818 | Bacteria | 1792 |
| 638 | Ga0373950_0008531 | 3300034818 | Bacteria | 1615 |
| 639 | Ga0373950_0015153 | 3300034818 | Bacteria | 1305 |
| 640 | Ga0373958_0000160 | 3300034819 | Bacteria | 7651 |
| 641 | Ga0373958_0000523 | 3300034819 | Bacteria | 4788 |
| 642 | Ga0373958_0036482 | 3300034819 | Bacteria | 988 |
| 643 | Ga0373959_0000166 | 3300034820 | Bacteria | 14768 |
| 644 | Ga0373959_0017523 | 3300034820 | Bacteria | 1338 |
| 645 | Ga0373938_0000260 | 3300034957 | Bacteria | 8284 |
| 646 | Ga0373938_0001185 | 3300034957 | Bacteria | 4200 |
| 647 | Ga0373938_0053583 | 3300034957 | Bacteria | 927 |
| 648 | Ga0373926_0000467 | 3300035083 | Bacteria | 10635 |
| 649 | Ga0373928_0000257 | 3300035084 | Bacteria | 10533 |
| 650 | Ga0373929_0000497 | 3300035085 | Bacteria | 7502 |
| 651 | Ga0373929_0001725 | 3300035085 | Bacteria | 4109 |
| 652 | Ga0373940_0002922 | 3300035088 | Bacteria | 3407 |
| 653 | Ga0373944_0023150 | 3300035089 | Bacteria | 1810 |
| 654 | Ga0373949_0000547 | 3300035090 | Bacteria | 12392 |
| 655 | Ga0373949_0009005 | 3300035090 | Bacteria | 2186 |
| 656 | Ga0373951_0001164 | 3300035091 | Bacteria | 6957 |
| 657 | Ga0373951_0002297 | 3300035091 | Bacteria | 4858 |
| 658 | Ga0373951_0115910 | 3300035091 | Bacteria | 725 |
| 659 | Ga0373952_0000266 | 3300035092 | Bacteria | 8600 |
| 660 | Ga0373952_0006102 | 3300035092 | Bacteria | 2222 |
| 661 | Ga0373952_0008171 | 3300035092 | Bacteria | 1980 |
| 662 | Ga0373932_0000908 | 3300035112 | Bacteria | 8652 |
| 663 | Ga0373932_0002722 | 3300035112 | Bacteria | 4399 |
| 664 | Ga0373932_0002850 | 3300035112 | Bacteria | 4277 |
| 665 | Ga0373936_0063562 | 3300035113 | Bacteria | 1511 |
| 666 | Ga0373939_0000911 | 3300035114 | Bacteria | 7343 |
| 667 | Ga0373939_0019090 | 3300035114 | Bacteria | 1845 |
| 668 | Ga0373941_0000037 | 3300035115 | Bacteria | 19599 |
| 669 | Ga0373941_0008858 | 3300035115 | Bacteria | 2517 |
| 670 | Ga0373941_0032799 | 3300035115 | Bacteria | 1557 |
| 671 | Ga0373945_0004426 | 3300035116 | Bacteria | 4463 |
| 672 | Ga0373945_0020567 | 3300035116 | Bacteria | 2260 |
| 673 | Ga0373945_0231452 | 3300035116 | Bacteria | 776 |
| 674 | Ga0373954_0099979 | 3300035118 | Bacteria | 1398 |
| 675 | Ga0373956_0177943 | 3300035119 | Bacteria | 1005 |
| 676 | Ga0373957_0138285 | 3300035120 | Unclassified | 995 |
| 677 | Ga0373960_0000805 | 3300035121 | Bacteria | 6600 |
| 678 | Ga0373960_0001073 | 3300035121 | Bacteria | 5899 |
| 679 | Ga0373943_0007096 | 3300035170 | Bacteria | 5027 |
| 680 | Ga0373943_0036408 | 3300035170 | Bacteria | 2356 |
| 681 | Ga0373946_0007998 | 3300035171 | Bacteria | 3884 |
| 682 | Ga0373946_0008924 | 3300035171 | Bacteria | 3685 |
| 683 | Ga0373955_0146517 | 3300035172 | Bacteria | 1387 |
| 684 | Ga0373955_0241805 | 3300035172 | Bacteria | 1081 |
| 685 | Ga0373942_0000388 | 3300035207 | Bacteria | 12155 |
| 686 | Ga0373942_0003774 | 3300035207 | Bacteria | 3545 |
| 687 | Ga0373961_0000658 | 3300035241 | Bacteria | 12233 |
| 688 | Ga0373961_0001498 | 3300035241 | Bacteria | 6828 |
| 689 | Ga0373961_0080101 | 3300035241 | Bacteria | 1026 |
| 690 | Ga0373962_0001121 | 3300035242 | Bacteria | 6245 |
| 691 | Ga0373962_0005442 | 3300035242 | Bacteria | 3082 |
| 692 | Ga0373924_0006388 | 3300035410 | Bacteria | 4223 |
| 693 | Ga0373931_0001169 | 3300035691 | Bacteria | 11182 |
| 694 | Ga0373931_0002000 | 3300035691 | Bacteria | 8971 |
| 695 | Ga0373931_0167922 | 3300035691 | Bacteria | 1290 |
| 696 | Ga0373931_0178067 | 3300035691 | Bacteria | 1257 |
| 697 | Ga0373935_0075240 | 3300035692 | Bacteria | 2184 |
| 698 | Ga0373935_0156250 | 3300035692 | Bacteria | 1551 |
| 699 | Ga0373927_0007496 | 3300035695 | Bacteria | 7379 |
| 700 | Ga0373927_0056853 | 3300035695 | Bacteria | 2530 |
| 701 | Ga0373933_0064444 | 3300035724 | Bacteria | 2217 |
| 702 | Ga0373947_0016221 | 3300035725 | Bacteria | 4281 |
| 703 | Ga0373937_0080759 | 3300036401 | Bacteria | 3008 |
| 704 | Ga0373937_0271599 | 3300036401 | Bacteria | 1600 |
| 705 | Ga0373925_0010099 | 3300037068 | Bacteria | 6858 |
| 706 | Ga0373925_0054869 | 3300037068 | Bacteria | 2981 |
| 707 | Ga0373925_0238122 | 3300037068 | Bacteria | 1457 |
| 708 | Ga0373925_0643519 | 3300037068 | Bacteria | 874 |
| 709 | Ga0373925_0869152 | 3300037068 | Bacteria | 743 |
| 710 | Ga0439443_020710 | 3300042003 | Bacteria | 1035 |
| 711 | Ga0439463_030103 | 3300042016 | Bacteria | 1368 |
| 712 | Ga0439463_107981 | 3300042016 | Bacteria | 718 |
| 713 | Ga0450923_008659 | 3300042125 | Bacteria | 1758 |
| 714 | Ga0439446_0073424 | 3300042156 | Bacteria | 1050 |
| 715 | Ga0439459_0015768 | 3300042438 | Bacteria | 1388 |
| 716 | Ga0451577_0242465 | 3300042876 | Bacteria | 1631 |
| 717 | Ga0439440_0102552 | 3300042993 | Bacteria | 780 |
| 718 | Ga0453684_0111442 | 3300044712 | Bacteria | 3324 |
| 719 | Ga0451576_0642772 | 3300045051 | Bacteria | 1115 |
| 720 | Ga0495617_010868 | 3300046452 | Bacteria | 3116 |
| 721 | Ga0495592_0089707 | 3300046454 | Bacteria | 2207 |
| 722 | Ga0495603_0050120 | 3300046455 | Bacteria | 2483 |
| 723 | Ga0495603_0181250 | 3300046455 | Bacteria | 1218 |
| 724 | Ga0495591_010442 | 3300046458 | Bacteria | 3601 |
| 725 | Ga0495629_0004767 | 3300046459 | Bacteria | 10168 |
| 726 | Ga0495629_0115970 | 3300046459 | Bacteria | 1866 |
| 727 | Ga0495629_0497621 | 3300046459 | Bacteria | 822 |
| 728 | Ga0495641_0068805 | 3300046461 | Bacteria | 1591 |
| 729 | Ga0495651_0010712 | 3300046462 | Bacteria | 7051 |
| 730 | Ga0495651_0402930 | 3300046462 | Bacteria | 893 |
| 731 | Ga0495653_0015854 | 3300046463 | Bacteria | 6142 |
| 732 | Ga0495653_0362211 | 3300046463 | Bacteria | 930 |
| 733 | Ga0495580_0033904 | 3300046472 | Bacteria | 3676 |
| 734 | Ga0495582_0000612 | 3300046473 | Bacteria | 19623 |
| 735 | Ga0495582_0014289 | 3300046473 | Bacteria | 4366 |
| 736 | Ga0495582_0064836 | 3300046473 | Unclassified | 2018 |
| 737 | Ga0495639_0008830 | 3300046475 | Bacteria | 4322 |
| 738 | Ga0495662_0016599 | 3300046476 | Bacteria | 3567 |
| 739 | Ga0495662_0639075 | 3300046476 | Bacteria | 520 |
| 740 | Ga0495584_0008866 | 3300046491 | Bacteria | 5202 |
| 741 | Ga0495585_0007260 | 3300046492 | Bacteria | 6803 |
| 742 | Ga0495594_0006882 | 3300046499 | Bacteria | 5846 |
| 743 | Ga0495594_0059541 | 3300046499 | Bacteria | 2112 |
| 744 | Ga0495594_0488192 | 3300046499 | Unclassified | 700 |
| 745 | Ga0495607_0005387 | 3300046501 | Bacteria | 9181 |
| 746 | Ga0495618_0198546 | 3300046514 | Bacteria | 1270 |
| 747 | Ga0495628_0062639 | 3300046516 | Bacteria | 2915 |
| 748 | Ga0495630_0121371 | 3300046517 | Bacteria | 1982 |
| 749 | Ga0495630_0222724 | 3300046517 | Bacteria | 1440 |
| 750 | Ga0495630_0487607 | 3300046517 | Bacteria | 945 |
| 751 | Ga0495644_0000194 | 3300046523 | Bacteria | 28681 |
| 752 | Ga0495663_0006200 | 3300046525 | Bacteria | 3301 |
| 753 | Ga0495663_0018559 | 3300046525 | Bacteria | 1981 |
| 754 | Ga0495666_0093005 | 3300046526 | Bacteria | 1422 |
| 755 | Ga0495642_0001277 | 3300046528 | Bacteria | 11367 |
| 756 | Ga0495652_0027667 | 3300046529 | Bacteria | 4994 |
| 757 | Ga0495665_0008988 | 3300046531 | Bacteria | 5422 |
| 758 | Ga0495586_0050687 | 3300046535 | Bacteria | 2246 |
| 759 | Ga0495586_0327302 | 3300046535 | Bacteria | 879 |
| 760 | Ga0495587_0014105 | 3300046536 | Bacteria | 5018 |
| 761 | Ga0495598_0017364 | 3300046537 | Bacteria | 1853 |
| 762 | Ga0495609_0027254 | 3300046538 | Bacteria | 2612 |
| 763 | Ga0495609_0051748 | 3300046538 | Bacteria | 1828 |
| 764 | Ga0495622_0025454 | 3300046557 | Bacteria | 2763 |
| 765 | Ga0495622_0044804 | 3300046557 | Bacteria | 2056 |
| 766 | Ga0495633_0003579 | 3300046558 | Bacteria | 10276 |
| 767 | Ga0495667_0028506 | 3300046559 | Bacteria | 3759 |
| 768 | Ga0495634_0406038 | 3300046642 | Unclassified | 808 |
| 769 | Ga0495611_0029144 | 3300046648 | Bacteria | 2420 |
| 770 | Ga0495635_0074575 | 3300046663 | Bacteria | 2324 |
| 771 | Ga0495635_0100725 | 3300046663 | Bacteria | 1974 |
| 772 | Ga0495635_0133259 | 3300046663 | Bacteria | 1694 |
| 773 | Ga0495659_0001145 | 3300046664 | Bacteria | 9203 |
| 774 | Ga0495659_0016769 | 3300046664 | Bacteria | 2419 |
| 775 | Ga0495588_0035444 | 3300046674 | Bacteria | 2529 |
| 776 | Ga0495588_0113353 | 3300046674 | Bacteria | 1428 |
| 777 | Ga0495588_0341110 | 3300046674 | Unclassified | 788 |
| 778 | Ga0495646_0080436 | 3300046680 | Bacteria | 1900 |
| 779 | Ga0495647_0006635 | 3300046681 | Bacteria | 3842 |
| 780 | Ga0495647_0015759 | 3300046681 | Bacteria | 2652 |
| 781 | Ga0495647_0198128 | 3300046681 | Bacteria | 880 |
| 782 | Ga0495658_0005405 | 3300046683 | Bacteria | 6278 |
| 783 | Ga0495658_0012933 | 3300046683 | Unclassified | 4240 |
| 784 | Ga0495658_0793460 | 3300046683 | Bacteria | 606 |
| 785 | Ga0495669_0018964 | 3300046684 | Bacteria | 2965 |
| 786 | Ga0495613_0162070 | 3300046689 | Bacteria | 1590 |
| 787 | Ga0495613_0344264 | 3300046689 | Unclassified | 1025 |
| 788 | Ga0495613_1097145 | 3300046689 | Bacteria | 508 |
| 789 | Ga0495624_0005904 | 3300046690 | Bacteria | 8753 |
| 790 | Ga0495670_0001975 | 3300046691 | Bacteria | 10074 |
| 791 | Ga0495670_0621349 | 3300046691 | Bacteria | 589 |
| 792 | Ga0495671_0422577 | 3300046692 | Unclassified | 638 |
| 793 | Ga0495589_0036332 | 3300046794 | Bacteria | 2470 |
| 794 | Ga0495600_0006963 | 3300046809 | Bacteria | 6897 |
| 795 | Ga0495600_0204163 | 3300046809 | Bacteria | 1268 |
| 796 | Ga0495600_0615694 | 3300046809 | Bacteria | 659 |
| 797 | Ga0495581_0006224 | 3300047315 | Bacteria | 6920 |
| 798 | Ga0495581_0092779 | 3300047315 | Bacteria | 1752 |
| 799 | Ga0495604_0010469 | 3300047317 | Bacteria | 7351 |
| 800 | Ga0495636_0022113 | 3300047318 | Bacteria | 2569 |
| 801 | Ga0495674_0047890 | 3300047319 | Bacteria | 3786 |
| 802 | Ga0495674_0404891 | 3300047319 | Unclassified | 1101 |
| 803 | Ga0495676_0035932 | 3300047321 | Bacteria | 4142 |
| 804 | Ga0495676_0089008 | 3300047321 | Bacteria | 2313 |
| 805 | Ga0495680_0000399 | 3300047322 | Bacteria | 48640 |
| 806 | Ga0495680_0005166 | 3300047322 | Bacteria | 12312 |
| 807 | Ga0495680_0005187 | 3300047322 | Bacteria | 12292 |
| 808 | Ga0495677_0186257 | 3300047445 | Bacteria | 805 |
| 809 | Ga0495679_171347 | 3300047446 | Unclassified | 577 |
| 810 | Ga0495681_0173313 | 3300047470 | Bacteria | 891 |
| 811 | Ga0495684_0009567 | 3300047471 | Bacteria | 7472 |
| 812 | Ga0495684_0038621 | 3300047471 | Unclassified | 3660 |
| 813 | Ga0495684_0153395 | 3300047471 | Bacteria | 1721 |
| 814 | Ga0495684_0493756 | 3300047471 | Bacteria | 843 |
| 815 | Ga0495593_0067277 | 3300047673 | Bacteria | 1865 |
| 816 | Ga0495602_0044248 | 3300048088 | Bacteria | 4041 |
| 817 | Ga0495602_0344008 | 3300048088 | Bacteria | 1078 |
| 818 | Ga0495614_0080661 | 3300048089 | Bacteria | 1409 |
| 819 | Ga0495626_0398704 | 3300048091 | Unclassified | 532 |
| 820 | Ga0496100_0001568 | 3300048903 | Bacteria | 11248 |
| 821 | Ga0496100_0015639 | 3300048903 | Bacteria | 4434 |
| 822 | Ga0496101_0000171 | 3300048904 | Bacteria | 53757 |
| 823 | Ga0496101_0000290 | 3300048904 | Bacteria | 34975 |
| 824 | Ga0496101_0139232 | 3300048904 | Bacteria | 1848 |
| 825 | Ga0496102_0004724 | 3300048905 | Bacteria | 11533 |
| 826 | Ga0496102_0049455 | 3300048905 | Bacteria | 3825 |
| 827 | Ga0496102_0148204 | 3300048905 | Bacteria | 2203 |
| 828 | Ga0496102_0276915 | 3300048905 | Bacteria | 1581 |
| 829 | Ga0496102_1034882 | 3300048905 | Bacteria | 741 |
| 830 | Ga0496102_1366062 | 3300048905 | Bacteria | 627 |
| 831 | Ga0496103_0005627 | 3300048906 | Bacteria | 7489 |
| 832 | Ga0496103_0017226 | 3300048906 | Bacteria | 4321 |
| 833 | Ga0496103_0092519 | 3300048906 | Bacteria | 1909 |
| 834 | Ga0496103_0215207 | 3300048906 | Bacteria | 1235 |
| 835 | Ga0496104_0097739 | 3300048907 | Bacteria | 2810 |
| 836 | Ga0496104_0153074 | 3300048907 | Bacteria | 2213 |
| 837 | Ga0496104_0305751 | 3300048907 | Bacteria | 1502 |
| 838 | Ga0496104_0422784 | 3300048907 | Bacteria | 1244 |
| 839 | Ga0496105_0149162 | 3300048908 | Bacteria | 1922 |
| 840 | Ga0496105_0193514 | 3300048908 | Bacteria | 1662 |
| 841 | Ga0496105_0215363 | 3300048908 | Bacteria | 1565 |
| 842 | Ga0496105_0520577 | 3300048908 | Bacteria | 931 |
| 843 | Ga0496106_0002116 | 3300048909 | Bacteria | 14844 |
| 844 | Ga0496106_0096792 | 3300048909 | Bacteria | 2284 |
| 845 | Ga0496106_0546469 | 3300048909 | Unclassified | 929 |
| 846 | Ga0496107_0005829 | 3300048910 | Bacteria | 8433 |
| 847 | Ga0496107_0009248 | 3300048910 | Bacteria | 6831 |
| 848 | Ga0496107_0024003 | 3300048910 | Bacteria | 4311 |
| 849 | Ga0496107_0036330 | 3300048910 | Bacteria | 3534 |
| 850 | Ga0496107_0043616 | 3300048910 | Bacteria | 3222 |
| 851 | Ga0496108_0003417 | 3300048911 | Bacteria | 12751 |
| 852 | Ga0496108_0047350 | 3300048911 | Bacteria | 3594 |
| 853 | Ga0496108_0122691 | 3300048911 | Bacteria | 2229 |
| 854 | Ga0496108_0412346 | 3300048911 | Bacteria | 1180 |
| 855 | Ga0496109_0000606 | 3300048912 | Bacteria | 29948 |
| 856 | Ga0496109_0000714 | 3300048912 | Bacteria | 27676 |
| 857 | Ga0496109_0030825 | 3300048912 | Bacteria | 4807 |
| 858 | Ga0496109_0178876 | 3300048912 | Bacteria | 1991 |
| 859 | Ga0496110_0011093 | 3300048913 | Bacteria | 7361 |
| 860 | Ga0496110_0012732 | 3300048913 | Bacteria | 6925 |
| 861 | Ga0496110_0059126 | 3300048913 | Bacteria | 3377 |
| 862 | Ga0496110_0080773 | 3300048913 | Bacteria | 2898 |
| 863 | Ga0496110_0083757 | 3300048913 | Bacteria | 2845 |
| 864 | Ga0496111_0004865 | 3300048914 | Bacteria | 8525 |
| 865 | Ga0496111_0038001 | 3300048914 | Bacteria | 3447 |
| 866 | Ga0496111_0091797 | 3300048914 | Bacteria | 2225 |
| 867 | Ga0496111_0224737 | 3300048914 | Unclassified | 1395 |
| 868 | Ga0496112_0032467 | 3300048915 | Bacteria | 5069 |
| 869 | Ga0496112_0035091 | 3300048915 | Bacteria | 4881 |
| 870 | Ga0496112_0080920 | 3300048915 | Bacteria | 3212 |
| 871 | Ga0496112_0440174 | 3300048915 | Bacteria | 1241 |
| 872 | Ga0496113_0000399 | 3300048916 | Bacteria | 20918 |
| 873 | Ga0496113_0060944 | 3300048916 | Bacteria | 2845 |
| 874 | Ga0496113_0086954 | 3300048916 | Bacteria | 2402 |
| 875 | Ga0496113_0131369 | 3300048916 | Bacteria | 1965 |
| 876 | Ga0496114_0008317 | 3300048917 | Bacteria | 8221 |
| 877 | Ga0496114_0041803 | 3300048917 | Bacteria | 3798 |
| 878 | Ga0496114_0141759 | 3300048917 | Bacteria | 2081 |
| 879 | Ga0496115_0001189 | 3300048918 | Bacteria | 18669 |
| 880 | Ga0496115_0066251 | 3300048918 | Bacteria | 2918 |
| 881 | Ga0496115_0274496 | 3300048918 | Bacteria | 1384 |
| 882 | Ga0501037_0643591 | 3300049573 | Unclassified | 709 |
| 883 | Ga0501039_1584911 | 3300049575 | Bacteria | 503 |
| 884 | Ga0501040_0084567 | 3300049576 | Unclassified | 2201 |
| 885 | Ga0501041_0130967 | 3300049577 | Unclassified | 1562 |
| 886 | Ga0501042_0290666 | 3300049578 | Unclassified | 1180 |
| 887 | Ga0501046_0360355 | 3300049580 | Bacteria | 1054 |
| 888 | Ga0501048_0292634 | 3300049582 | Unclassified | 1158 |
| 889 | Ga0501072_0065539 | 3300049588 | Unclassified | 2864 |
| 890 | Ga0501072_0442010 | 3300049588 | Bacteria | 1030 |
| 891 | Ga0501075_0004771 | 3300049591 | Bacteria | 9217 |
| 892 | Ga0501075_0211570 | 3300049591 | Bacteria | 1479 |
| 893 | Ga0501075_0622973 | 3300049591 | Unclassified | 823 |
| 894 | Ga0501076_0101988 | 3300049592 | Bacteria | 2313 |
| 895 | Ga0501076_0366191 | 3300049592 | Bacteria | 1184 |
| 896 | Ga0501076_1103565 | 3300049592 | Bacteria | 653 |
| 897 | Ga0501077_0196378 | 3300049593 | Bacteria | 1282 |
| 898 | Ga0501077_0259543 | 3300049593 | Unclassified | 1105 |
| 899 | Ga0501206_059139 | 3300049653 | Unclassified | 626 |
| 900 | Ga0501259_174883 | 3300049688 | Unclassified | 542 |
| 901 | Ga0501079_0101132 | 3300049741 | Bacteria | 2235 |
| 902 | Ga0501081_0055350 | 3300049743 | Unclassified | 2741 |
| 903 | Ga0501081_0636139 | 3300049743 | Bacteria | 799 |
| 904 | Ga0501263_032622 | 3300049760 | Unclassified | 741 |
| 905 | Ga0501035_0216737 | 3300049822 | Bacteria | 1636 |
| 906 | Ga0501035_0893908 | 3300049822 | Bacteria | 704 |
| 907 | Ga0501045_0352038 | 3300049824 | Bacteria | 1096 |
| 908 | nmdc:mga06z11_16741_c1 | 3300050494 | Bacteria | 3309 |
| 909 | nmdc:mga05p37_107155_c1 | 3300050507 | Bacteria | 3438 |
| 910 | nmdc:mga05p37_21187_c1 | 3300050507 | Bacteria | 7869 |
| 911 | nmdc:mga05p37_36455_c1 | 3300050507 | Bacteria | 6033 |
| 912 | nmdc:mga05p37_68016_c1 | 3300050507 | Bacteria | 4381 |
| 913 | nmdc:mga05p37_68397_c1 | 3300050507 | Bacteria | 4367 |
| 914 | nmdc:mga09592_137533_c1 | 3300050508 | Unclassified | 2104 |
| 915 | nmdc:mga09592_149462_c1 | 3300050508 | Unclassified | 2015 |
| 916 | nmdc:mga09592_5261_c1 | 3300050508 | Bacteria | 10513 |
| 917 | nmdc:mga0qj67_411870_c1 | 3300050509 | Unclassified | 1090 |
| 918 | nmdc:mga0qj67_497989_c1 | 3300050509 | Unclassified | 980 |
| 919 | nmdc:mga0qj67_61777_c1 | 3300050509 | Bacteria | 2975 |
| 920 | nmdc:mga0qj67_8760_c1 | 3300050509 | Bacteria | 7508 |
| 921 | nmdc:mga06r32_40386_c1 | 3300050510 | Unclassified | 4429 |
| 922 | nmdc:mga06r32_594613_c1 | 3300050510 | Bacteria | 1078 |
| 923 | nmdc:mga06r32_67701_c1 | 3300050510 | Bacteria | 3448 |
| 924 | nmdc:mga06r32_71911_c1 | 3300050510 | Bacteria | 3348 |
| 925 | nmdc:mga06r32_78506_c1 | 3300050510 | Bacteria | 3209 |
| 926 | nmdc:mga08y16_1898_c1 | 3300050511 | Bacteria | 21299 |
| 927 | nmdc:mga08y16_270702_c1 | 3300050511 | Bacteria | 1753 |
| 928 | nmdc:mga08y16_2825_c1 | 3300050511 | Bacteria | 17843 |
| 929 | nmdc:mga08y16_37906_c1 | 3300050511 | Bacteria | 5061 |
| 930 | nmdc:mga08y16_38404_c1 | 3300050511 | Bacteria | 5028 |
| 931 | nmdc:mga08y16_538042_c1 | 3300050511 | Bacteria | 1183 |
| 932 | nmdc:mga0n895_1061_c1 | 3300050512 | Bacteria | 20040 |
| 933 | nmdc:mga0n895_1241189_c1 | 3300050512 | Unclassified | 718 |
| 934 | nmdc:mga0n895_20783_c1 | 3300050512 | Bacteria | 6130 |
| 935 | nmdc:mga0n895_342694_c1 | 3300050512 | Bacteria | 1514 |
| 936 | nmdc:mga0n895_490130_c1 | 3300050512 | Bacteria | 1239 |
| 937 | nmdc:mga0n895_532164_c1 | 3300050512 | Bacteria | 1182 |
| 938 | nmdc:mga0n895_62410_c1 | 3300050512 | Bacteria | 3683 |
| 939 | nmdc:mga0rr50_235648_c1 | 3300050513 | Bacteria | 1516 |
| 940 | nmdc:mga0rr50_573073_c1 | 3300050513 | Bacteria | 962 |
| 941 | nmdc:mga0rr50_6009_c1 | 3300050513 | Bacteria | 7328 |
| 942 | nmdc:mga0rr50_67477_c1 | 3300050513 | Unclassified | 2717 |
| 943 | nmdc:mga0rr50_88036_c1 | 3300050513 | Unclassified | 2411 |
| 944 | nmdc:mga0rr50_91648_c2 | 3300050513 | Bacteria | 1250 |
| 945 | nmdc:mga08x19_1113496_c1 | 3300050514 | Bacteria | 560 |
| 946 | nmdc:mga08x19_255602_c1 | 3300050514 | Unclassified | 1210 |
| 947 | nmdc:mga08x19_56550_c1 | 3300050514 | Bacteria | 2532 |
| 948 | nmdc:mga0a205_206857_c1 | 3300050515 | Bacteria | 1852 |
| 949 | nmdc:mga0a205_217928_c1 | 3300050515 | Bacteria | 1795 |
| 950 | nmdc:mga0a205_3445_c1 | 3300050515 | Bacteria | 14121 |
| 951 | nmdc:mga0a205_395650_c1 | 3300050515 | Unclassified | 1246 |
| 952 | nmdc:mga0a205_453771_c1 | 3300050515 | Bacteria | 1142 |
| 953 | nmdc:mga0a205_560372_c1 | 3300050515 | Bacteria | 997 |
| 954 | nmdc:mga0a205_633650_c1 | 3300050515 | Bacteria | 921 |
| 955 | nmdc:mga0a205_64986_c1 | 3300050515 | Bacteria | 3525 |
| 956 | nmdc:mga0a205_8902_c1 | 3300050515 | Bacteria | 9148 |
| 957 | Ga0495595_0004854 | 3300053084 | Bacteria | 5418 |
| 958 | Ga0495619_0006574 | 3300053085 | Bacteria | 7353 |
| 959 | Ga0495619_0056821 | 3300053085 | Bacteria | 2595 |
| 960 | Ga0500555_000392 | 3300053103 | Bacteria | 18411 |
| 961 | Ga0500645_000220 | 3300053730 | Bacteria | 43452 |
| 962 | Ga0500599_007074 | 3300053736 | Unclassified | 1439 |
| 963 | Ga0501084_0107909 | 3300054114 | Bacteria | 2339 |
| 964 | Ga0501084_0123508 | 3300054114 | Unclassified | 2177 |
| 965 | Ga0590071_000291 | 3300059421 | Bacteria | 14588 |
| 966 | Ga0590071_001060 | 3300059421 | Bacteria | 7446 |
| 967 | Ga0590071_010104 | 3300059421 | Bacteria | 2210 |
| 968 | Ga0590074_001671 | 3300059423 | Bacteria | 3617 |
| 969 | Ga0590074_011851 | 3300059423 | Bacteria | 1462 |
| 970 | Ga0590075_000253 | 3300059424 | Bacteria | 15075 |
| 971 | Ga0590075_002771 | 3300059424 | Bacteria | 4188 |
| 972 | Ga0590077_000007 | 3300059426 | Bacteria | 42591 |
| 973 | Ga0590077_000399 | 3300059426 | Bacteria | 12235 |
| 974 | Ga0590077_003099 | 3300059426 | Bacteria | 3483 |
| 975 | Ga0590077_021208 | 3300059426 | Unclassified | 1382 |
| 976 | Ga0501082_1523488 | 3300060353 | Unclassified | 584 |
| 977 | Ga0530510_0177620 | 3300061734 | Bacteria | 1578 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005842 | Ga0068858_100390241 | Ga0068858_1003902413 | 115 |
| 2 | 3300025937 | Ga0207669_10104728 | Ga0207669_101047282 | 119 |
| 3 | 3300042156 | Ga0439446_0073424 | Ga0439446_0073424_92_502 | 121 |
| 4 | 3300059426 | Ga0590077_021208 | Ga0590077_021208_546_956 | 124 |
| 5 | 3300005327 | Ga0070658_10348025 | Ga0070658_103480251 | 126 |
| 6 | 3300025909 | Ga0207705_10275569 | Ga0207705_102755692 | 127 |
| 7 | 3300048905 | Ga0496102_0049455 | Ga0496102_0049455_3354_3740 | 128 |
| 8 | 3300005438 | Ga0070701_10352389 | Ga0070701_103523892 | 129 |
| 9 | 3300005545 | Ga0070695_100169607 | Ga0070695_1001696072 | 129 |
| 10 | 3300005518 | Ga0070699_100050460 | Ga0070699_1000504604 | 130 |
| 11 | 3300005536 | Ga0070697_100010084 | Ga0070697_1000100848 | 130 |
| 12 | 3300005549 | Ga0070704_100026483 | Ga0070704_1000264833 | 130 |
| 13 | 3300006852 | Ga0075433_10088448 | Ga0075433_100884483 | 130 |
| 14 | 3300007076 | Ga0075435_100007651 | Ga0075435_1000076513 | 130 |
| 15 | 3300032002 | Ga0307416_102406911 | Ga0307416_1024069111 | 130 |
| 16 | 3300059421 | Ga0590071_000291 | Ga0590071_000291_9024_9422 | 132 |
| 17 | 3300059423 | Ga0590074_001671 | Ga0590074_001671_1711_2109 | 132 |
| 18 | 3300059424 | Ga0590075_000253 | Ga0590075_000253_13501_13899 | 132 |
| 19 | 3300059426 | Ga0590077_000007 | Ga0590077_000007_19517_19915 | 132 |
| 20 | 3300005337 | Ga0070682_100611362 | Ga0070682_1006113622 | 133 |
| 21 | 3300005340 | Ga0070689_100424265 | Ga0070689_1004242652 | 133 |
| 22 | 3300005353 | Ga0070669_100656365 | Ga0070669_1006563652 | 133 |
| 23 | 3300005354 | Ga0070675_100327695 | Ga0070675_1003276952 | 133 |
| 24 | 3300005365 | Ga0070688_100895772 | Ga0070688_1008957722 | 133 |
| 25 | 3300005564 | Ga0070664_100535698 | Ga0070664_1005356982 | 133 |
| 26 | 3300005577 | Ga0068857_100074904 | Ga0068857_1000749044 | 133 |
| 27 | 3300005617 | Ga0068859_100559707 | Ga0068859_1005597073 | 133 |
| 28 | 3300005617 | Ga0068859_101475925 | Ga0068859_1014759252 | 133 |
| 29 | 3300006931 | Ga0097620_100559720 | Ga0097620_1005597203 | 133 |
| 30 | 3300006931 | Ga0097620_101475720 | Ga0097620_1014757202 | 133 |
| 31 | 3300025936 | Ga0207670_10282986 | Ga0207670_102829862 | 133 |
| 32 | 3300026116 | Ga0207674_10149810 | Ga0207674_101498103 | 133 |
| 33 | 3300005290 | Ga0065712_10391798 | Ga0065712_103917981 | 134 |
| 34 | 3300005295 | Ga0065707_10165705 | Ga0065707_101657051 | 134 |
| 35 | 3300005330 | Ga0070690_100011260 | Ga0070690_1000112602 | 134 |
| 36 | 3300005331 | Ga0070670_100016479 | Ga0070670_1000164793 | 134 |
| 37 | 3300005335 | Ga0070666_10004448 | Ga0070666_100044486 | 134 |
| 38 | 3300005338 | Ga0068868_100006142 | Ga0068868_1000061423 | 134 |
| 39 | 3300005343 | Ga0070687_100026514 | Ga0070687_1000265142 | 134 |
| 40 | 3300005344 | Ga0070661_100080981 | Ga0070661_1000809812 | 134 |
| 41 | 3300005354 | Ga0070675_100072645 | Ga0070675_1000726453 | 134 |
| 42 | 3300005367 | Ga0070667_100002774 | Ga0070667_10000277414 | 134 |
| 43 | 3300005543 | Ga0070672_100004109 | Ga0070672_1000041094 | 134 |
| 44 | 3300005544 | Ga0070686_100006599 | Ga0070686_1000065995 | 134 |
| 45 | 3300005564 | Ga0070664_100050415 | Ga0070664_1000504152 | 134 |
| 46 | 3300005617 | Ga0068859_100563060 | Ga0068859_1005630602 | 134 |
| 47 | 3300005618 | Ga0068864_101243077 | Ga0068864_1012430772 | 134 |
| 48 | 3300005842 | Ga0068858_100057653 | Ga0068858_1000576532 | 134 |
| 49 | 3300006237 | Ga0097621_100118819 | Ga0097621_1001188192 | 134 |
| 50 | 3300006237 | Ga0097621_100416233 | Ga0097621_1004162332 | 134 |
| 51 | 3300006358 | Ga0068871_100066546 | Ga0068871_1000665463 | 134 |
| 52 | 3300006844 | Ga0075428_100005542 | Ga0075428_1000055427 | 134 |
| 53 | 3300006846 | Ga0075430_100121353 | Ga0075430_1001213532 | 134 |
| 54 | 3300006847 | Ga0075431_100027965 | Ga0075431_1000279653 | 134 |
| 55 | 3300006871 | Ga0075434_100351532 | Ga0075434_1003515322 | 134 |
| 56 | 3300006880 | Ga0075429_100003277 | Ga0075429_10000327710 | 134 |
| 57 | 3300006881 | Ga0068865_101675208 | Ga0068865_1016752082 | 134 |
| 58 | 3300006914 | Ga0075436_100425788 | Ga0075436_1004257882 | 134 |
| 59 | 3300006931 | Ga0097620_100563091 | Ga0097620_1005630912 | 134 |
| 60 | 3300007076 | Ga0075435_100109402 | Ga0075435_1001094022 | 134 |
| 61 | 3300009098 | Ga0105245_10746672 | Ga0105245_107466721 | 134 |
| 62 | 3300009147 | Ga0114129_10006379 | Ga0114129_1000637913 | 134 |
| 63 | 3300009147 | Ga0114129_10035036 | Ga0114129_100350366 | 134 |
| 64 | 3300009177 | Ga0105248_10001794 | Ga0105248_100017948 | 134 |
| 65 | 3300009177 | Ga0105248_11010302 | Ga0105248_110103022 | 134 |
| 66 | 3300011119 | Ga0105246_10498358 | Ga0105246_104983582 | 134 |
| 67 | 3300013296 | Ga0157374_10326686 | Ga0157374_103266862 | 134 |
| 68 | 3300013306 | Ga0163162_10031169 | Ga0163162_100311692 | 134 |
| 69 | 3300013308 | Ga0157375_10024669 | Ga0157375_100246693 | 134 |
| 70 | 3300014325 | Ga0163163_10005666 | Ga0163163_100056664 | 134 |
| 71 | 3300014325 | Ga0163163_10014105 | Ga0163163_100141053 | 134 |
| 72 | 3300014326 | Ga0157380_11108013 | Ga0157380_111080132 | 134 |
| 73 | 3300014968 | Ga0157379_11612568 | Ga0157379_116125681 | 134 |
| 74 | 3300014969 | Ga0157376_10247032 | Ga0157376_102470322 | 134 |
| 75 | 3300025903 | Ga0207680_10051106 | Ga0207680_100511062 | 134 |
| 76 | 3300025917 | Ga0207660_10904253 | Ga0207660_109042532 | 134 |
| 77 | 3300025918 | Ga0207662_10103825 | Ga0207662_101038251 | 134 |
| 78 | 3300025920 | Ga0207649_10049764 | Ga0207649_100497642 | 134 |
| 79 | 3300025925 | Ga0207650_10005233 | Ga0207650_100052333 | 134 |
| 80 | 3300025926 | Ga0207659_10703603 | Ga0207659_107036031 | 134 |
| 81 | 3300025931 | Ga0207644_10162853 | Ga0207644_101628532 | 134 |
| 82 | 3300025938 | Ga0207704_10757743 | Ga0207704_107577432 | 134 |
| 83 | 3300025940 | Ga0207691_10018118 | Ga0207691_100181185 | 134 |
| 84 | 3300025941 | Ga0207711_10033459 | Ga0207711_100334592 | 134 |
| 85 | 3300025941 | Ga0207711_11129816 | Ga0207711_111298161 | 134 |
| 86 | 3300025945 | Ga0207679_10026036 | Ga0207679_100260363 | 134 |
| 87 | 3300025960 | Ga0207651_10546104 | Ga0207651_105461042 | 134 |
| 88 | 3300025986 | Ga0207658_10010690 | Ga0207658_100106905 | 134 |
| 89 | 3300026023 | Ga0207677_10066907 | Ga0207677_100669072 | 134 |
| 90 | 3300026035 | Ga0207703_10136077 | Ga0207703_101360772 | 134 |
| 91 | 3300026035 | Ga0207703_10185762 | Ga0207703_101857622 | 134 |
| 92 | 3300026088 | Ga0207641_10074355 | Ga0207641_100743552 | 134 |
| 93 | 3300026088 | Ga0207641_10142353 | Ga0207641_101423532 | 134 |
| 94 | 3300026121 | Ga0207683_10062420 | Ga0207683_100624203 | 134 |
| 95 | 3300028381 | Ga0268264_11139909 | Ga0268264_111399091 | 134 |
| 96 | 3300035120 | Ga0373957_0138285 | Ga0373957_0138285_528_932 | 134 |
| 97 | 3300036401 | Ga0373937_0080759 | Ga0373937_0080759_335_739 | 134 |
| 98 | 3300046462 | Ga0495651_0402930 | Ga0495651_0402930_176_580 | 134 |
| 99 | 3300046473 | Ga0495582_0064836 | Ga0495582_0064836_1185_1589 | 134 |
| 100 | 3300046499 | Ga0495594_0488192 | Ga0495594_0488192_153_557 | 134 |
| 101 | 3300046674 | Ga0495588_0341110 | Ga0495588_0341110_85_489 | 134 |
| 102 | 3300046683 | Ga0495658_0012933 | Ga0495658_0012933_1735_2139 | 134 |
| 103 | 3300047471 | Ga0495684_0038621 | Ga0495684_0038621_238_642 | 134 |
| 104 | 3300049575 | Ga0501039_1584911 | Ga0501039_1584911_33_437 | 134 |
| 105 | 3300049588 | Ga0501072_0442010 | Ga0501072_0442010_337_741 | 134 |
| 106 | 3300049591 | Ga0501075_0211570 | Ga0501075_0211570_960_1364 | 134 |
| 107 | 3300049592 | Ga0501076_1103565 | Ga0501076_1103565_39_443 | 134 |
| 108 | 3300049593 | Ga0501077_0196378 | Ga0501077_0196378_226_630 | 134 |
| 109 | 3300049743 | Ga0501081_0636139 | Ga0501081_0636139_37_441 | 134 |
| 110 | 3300049822 | Ga0501035_0893908 | Ga0501035_0893908_205_609 | 134 |
| 111 | 3300049824 | Ga0501045_0352038 | Ga0501045_0352038_531_935 | 134 |
| 112 | 3300050507 | nmdc:mga05p37_36455_c1 | nmdc:mga05p37_36455_c1_2364_2768 | 134 |
| 113 | 3300050507 | nmdc:mga05p37_68397_c1 | nmdc:mga05p37_68397_c1_448_852 | 134 |
| 114 | 3300050508 | nmdc:mga09592_5261_c1 | nmdc:mga09592_5261_c1_5867_6271 | 134 |
| 115 | 3300050509 | nmdc:mga0qj67_411870_c1 | nmdc:mga0qj67_411870_c1_546_950 | 134 |
| 116 | 3300050509 | nmdc:mga0qj67_497989_c1 | nmdc:mga0qj67_497989_c1_57_461 | 134 |
| 117 | 3300050510 | nmdc:mga06r32_71911_c1 | nmdc:mga06r32_71911_c1_1079_1483 | 134 |
| 118 | 3300050512 | nmdc:mga0n895_1241189_c1 | nmdc:mga0n895_1241189_c1_259_663 | 134 |
| 119 | 3300050513 | nmdc:mga0rr50_88036_c1 | nmdc:mga0rr50_88036_c1_216_620 | 134 |
| 120 | 3300005290 | Ga0065712_10290937 | Ga0065712_102909372 | 135 |
| 121 | 3300005329 | Ga0070683_100761316 | Ga0070683_1007613162 | 135 |
| 122 | 3300005331 | Ga0070670_100036231 | Ga0070670_1000362314 | 135 |
| 123 | 3300005334 | Ga0068869_100349504 | Ga0068869_1003495042 | 135 |
| 124 | 3300005336 | Ga0070680_100533561 | Ga0070680_1005335612 | 135 |
| 125 | 3300005338 | Ga0068868_100464314 | Ga0068868_1004643142 | 135 |
| 126 | 3300005340 | Ga0070689_100016656 | Ga0070689_1000166562 | 135 |
| 127 | 3300005343 | Ga0070687_100059797 | Ga0070687_1000597973 | 135 |
| 128 | 3300005353 | Ga0070669_100859548 | Ga0070669_1008595481 | 135 |
| 129 | 3300005354 | Ga0070675_100072348 | Ga0070675_1000723484 | 135 |
| 130 | 3300005354 | Ga0070675_100075557 | Ga0070675_1000755572 | 135 |
| 131 | 3300005364 | Ga0070673_101070688 | Ga0070673_1010706881 | 135 |
| 132 | 3300005365 | Ga0070688_100038140 | Ga0070688_1000381402 | 135 |
| 133 | 3300005366 | Ga0070659_100115869 | Ga0070659_1001158692 | 135 |
| 134 | 3300005438 | Ga0070701_10106417 | Ga0070701_101064172 | 135 |
| 135 | 3300005438 | Ga0070701_10647979 | Ga0070701_106479791 | 135 |
| 136 | 3300005440 | Ga0070705_100507414 | Ga0070705_1005074142 | 135 |
| 137 | 3300005440 | Ga0070705_100589355 | Ga0070705_1005893551 | 135 |
| 138 | 3300005440 | Ga0070705_101060205 | Ga0070705_1010602052 | 135 |
| 139 | 3300005444 | Ga0070694_100462166 | Ga0070694_1004621662 | 135 |
| 140 | 3300005445 | Ga0070708_100103463 | Ga0070708_1001034633 | 135 |
| 141 | 3300005466 | Ga0070685_10365854 | Ga0070685_103658542 | 135 |
| 142 | 3300005468 | Ga0070707_102066961 | Ga0070707_1020669611 | 135 |
| 143 | 3300005471 | Ga0070698_100980894 | Ga0070698_1009808941 | 135 |
| 144 | 3300005518 | Ga0070699_100088539 | Ga0070699_1000885393 | 135 |
| 145 | 3300005544 | Ga0070686_100107709 | Ga0070686_1001077093 | 135 |
| 146 | 3300005546 | Ga0070696_100073296 | Ga0070696_1000732962 | 135 |
| 147 | 3300005547 | Ga0070693_100484770 | Ga0070693_1004847701 | 135 |
| 148 | 3300005564 | Ga0070664_100025650 | Ga0070664_1000256503 | 135 |
| 149 | 3300005578 | Ga0068854_101029679 | Ga0068854_1010296792 | 135 |
| 150 | 3300005616 | Ga0068852_101417415 | Ga0068852_1014174152 | 135 |
| 151 | 3300005617 | Ga0068859_100070855 | Ga0068859_1000708552 | 135 |
| 152 | 3300005618 | Ga0068864_100361972 | Ga0068864_1003619722 | 135 |
| 153 | 3300005719 | Ga0068861_100242460 | Ga0068861_1002424602 | 135 |
| 154 | 3300005842 | Ga0068858_100056245 | Ga0068858_1000562454 | 135 |
| 155 | 3300005985 | Ga0081539_10228045 | Ga0081539_102280452 | 135 |
| 156 | 3300006844 | Ga0075428_100002901 | Ga0075428_10000290116 | 135 |
| 157 | 3300006844 | Ga0075428_100433024 | Ga0075428_1004330242 | 135 |
| 158 | 3300006844 | Ga0075428_101571604 | Ga0075428_1015716042 | 135 |
| 159 | 3300006846 | Ga0075430_100003290 | Ga0075430_10000329013 | 135 |
| 160 | 3300006846 | Ga0075430_100168650 | Ga0075430_1001686502 | 135 |
| 161 | 3300006846 | Ga0075430_100407113 | Ga0075430_1004071132 | 135 |
| 162 | 3300006847 | Ga0075431_100015548 | Ga0075431_1000155484 | 135 |
| 163 | 3300006847 | Ga0075431_100130942 | Ga0075431_1001309423 | 135 |
| 164 | 3300006852 | Ga0075433_10013063 | Ga0075433_100130635 | 135 |
| 165 | 3300006852 | Ga0075433_10380461 | Ga0075433_103804612 | 135 |
| 166 | 3300006871 | Ga0075434_100079657 | Ga0075434_1000796571 | 135 |
| 167 | 3300006871 | Ga0075434_100434827 | Ga0075434_1004348272 | 135 |
| 168 | 3300006880 | Ga0075429_100002327 | Ga0075429_1000023272 | 135 |
| 169 | 3300006880 | Ga0075429_100553821 | Ga0075429_1005538212 | 135 |
| 170 | 3300006914 | Ga0075436_100354863 | Ga0075436_1003548632 | 135 |
| 171 | 3300006931 | Ga0097620_100070854 | Ga0097620_1000708542 | 135 |
| 172 | 3300007076 | Ga0075435_100078508 | Ga0075435_1000785083 | 135 |
| 173 | 3300009094 | Ga0111539_10003937 | Ga0111539_1000393719 | 135 |
| 174 | 3300009094 | Ga0111539_10046672 | Ga0111539_100466722 | 135 |
| 175 | 3300009147 | Ga0114129_10005884 | Ga0114129_1000588410 | 135 |
| 176 | 3300009147 | Ga0114129_10030531 | Ga0114129_100305312 | 135 |
| 177 | 3300009147 | Ga0114129_10052791 | Ga0114129_100527915 | 135 |
| 178 | 3300009177 | Ga0105248_10836330 | Ga0105248_108363301 | 135 |
| 179 | 3300009177 | Ga0105248_11302388 | Ga0105248_113023881 | 135 |
| 180 | 3300009553 | Ga0105249_12752150 | Ga0105249_127521501 | 135 |
| 181 | 3300014325 | Ga0163163_10039079 | Ga0163163_100390793 | 135 |
| 182 | 3300014325 | Ga0163163_11609086 | Ga0163163_116090862 | 135 |
| 183 | 3300014326 | Ga0157380_10792656 | Ga0157380_107926561 | 135 |
| 184 | 3300014745 | Ga0157377_10038813 | Ga0157377_100388133 | 135 |
| 185 | 3300014745 | Ga0157377_10139755 | Ga0157377_101397552 | 135 |
| 186 | 3300025922 | Ga0207646_10317005 | Ga0207646_103170052 | 135 |
| 187 | 3300025923 | Ga0207681_10126211 | Ga0207681_101262113 | 135 |
| 188 | 3300025925 | Ga0207650_10043547 | Ga0207650_100435473 | 135 |
| 189 | 3300025926 | Ga0207659_10058328 | Ga0207659_100583283 | 135 |
| 190 | 3300025926 | Ga0207659_10084610 | Ga0207659_100846103 | 135 |
| 191 | 3300025932 | Ga0207690_10308483 | Ga0207690_103084832 | 135 |
| 192 | 3300025940 | Ga0207691_10009942 | Ga0207691_100099423 | 135 |
| 193 | 3300025942 | Ga0207689_10546287 | Ga0207689_105462872 | 135 |
| 194 | 3300025945 | Ga0207679_10020751 | Ga0207679_100207514 | 135 |
| 195 | 3300025945 | Ga0207679_10148976 | Ga0207679_101489763 | 135 |
| 196 | 3300025960 | Ga0207651_10348771 | Ga0207651_103487712 | 135 |
| 197 | 3300026023 | Ga0207677_10942950 | Ga0207677_109429502 | 135 |
| 198 | 3300026035 | Ga0207703_10047218 | Ga0207703_100472184 | 135 |
| 199 | 3300026075 | Ga0207708_11725404 | Ga0207708_117254041 | 135 |
| 200 | 3300026095 | Ga0207676_10163889 | Ga0207676_101638893 | 135 |
| 201 | 3300026118 | Ga0207675_100128939 | Ga0207675_1001289392 | 135 |
| 202 | 3300026118 | Ga0207675_100890864 | Ga0207675_1008908642 | 135 |
| 203 | 3300027907 | Ga0207428_10015465 | Ga0207428_100154657 | 135 |
| 204 | 3300027907 | Ga0207428_10189886 | Ga0207428_101898862 | 135 |
| 205 | 3300031731 | Ga0307405_10016886 | Ga0307405_100168863 | 135 |
| 206 | 3300031824 | Ga0307413_10034670 | Ga0307413_100346702 | 135 |
| 207 | 3300031901 | Ga0307406_10061754 | Ga0307406_100617542 | 135 |
| 208 | 3300031911 | Ga0307412_10051980 | Ga0307412_100519802 | 135 |
| 209 | 3300031995 | Ga0307409_100085397 | Ga0307409_1000853973 | 135 |
| 210 | 3300032002 | Ga0307416_100007987 | Ga0307416_1000079873 | 135 |
| 211 | 3300032002 | Ga0307416_100213190 | Ga0307416_1002131902 | 135 |
| 212 | 3300032004 | Ga0307414_10088192 | Ga0307414_100881922 | 135 |
| 213 | 3300032126 | Ga0307415_100043057 | Ga0307415_1000430573 | 135 |
| 214 | 3300032126 | Ga0307415_100138449 | Ga0307415_1001384493 | 135 |
| 215 | 3300035172 | Ga0373955_0241805 | Ga0373955_0241805_154_561 | 135 |
| 216 | 3300037068 | Ga0373925_0238122 | Ga0373925_0238122_539_946 | 135 |
| 217 | 3300045051 | Ga0451576_0642772 | Ga0451576_0642772_213_632 | 135 |
| 218 | 3300046459 | Ga0495629_0497621 | Ga0495629_0497621_252_659 | 135 |
| 219 | 3300046517 | Ga0495630_0487607 | Ga0495630_0487607_416_823 | 135 |
| 220 | 3300046525 | Ga0495663_0018559 | Ga0495663_0018559_782_1189 | 135 |
| 221 | 3300046528 | Ga0495642_0001277 | Ga0495642_0001277_4766_5173 | 135 |
| 222 | 3300046537 | Ga0495598_0017364 | Ga0495598_0017364_1330_1737 | 135 |
| 223 | 3300046538 | Ga0495609_0051748 | Ga0495609_0051748_348_755 | 135 |
| 224 | 3300046664 | Ga0495659_0016769 | Ga0495659_0016769_1081_1488 | 135 |
| 225 | 3300046689 | Ga0495613_1097145 | Ga0495613_1097145_91_498 | 135 |
| 226 | 3300046691 | Ga0495670_0621349 | Ga0495670_0621349_73_480 | 135 |
| 227 | 3300046809 | Ga0495600_0615694 | Ga0495600_0615694_231_638 | 135 |
| 228 | 3300047318 | Ga0495636_0022113 | Ga0495636_0022113_2011_2418 | 135 |
| 229 | 3300047471 | Ga0495684_0493756 | Ga0495684_0493756_256_663 | 135 |
| 230 | 3300048088 | Ga0495602_0344008 | Ga0495602_0344008_473_880 | 135 |
| 231 | 3300048091 | Ga0495626_0398704 | Ga0495626_0398704_31_483 | 135 |
| 232 | 3300049573 | Ga0501037_0643591 | Ga0501037_0643591_53_472 | 135 |
| 233 | 3300049576 | Ga0501040_0084567 | Ga0501040_0084567_348_767 | 135 |
| 234 | 3300049577 | Ga0501041_0130967 | Ga0501041_0130967_911_1330 | 135 |
| 235 | 3300049578 | Ga0501042_0290666 | Ga0501042_0290666_276_695 | 135 |
| 236 | 3300049580 | Ga0501046_0360355 | Ga0501046_0360355_42_461 | 135 |
| 237 | 3300049582 | Ga0501048_0292634 | Ga0501048_0292634_566_985 | 135 |
| 238 | 3300049588 | Ga0501072_0065539 | Ga0501072_0065539_40_459 | 135 |
| 239 | 3300049591 | Ga0501075_0004771 | Ga0501075_0004771_167_586 | 135 |
| 240 | 3300049592 | Ga0501076_0101988 | Ga0501076_0101988_660_1079 | 135 |
| 241 | 3300049593 | Ga0501077_0259543 | Ga0501077_0259543_196_615 | 135 |
| 242 | 3300049653 | Ga0501206_059139 | Ga0501206_059139_124_531 | 135 |
| 243 | 3300049688 | Ga0501259_174883 | Ga0501259_174883_106_513 | 135 |
| 244 | 3300049741 | Ga0501079_0101132 | Ga0501079_0101132_1046_1465 | 135 |
| 245 | 3300049743 | Ga0501081_0055350 | Ga0501081_0055350_594_1013 | 135 |
| 246 | 3300049760 | Ga0501263_032622 | Ga0501263_032622_43_462 | 135 |
| 247 | 3300049822 | Ga0501035_0216737 | Ga0501035_0216737_1046_1465 | 135 |
| 248 | 3300050507 | nmdc:mga05p37_107155_c1 | nmdc:mga05p37_107155_c1_1775_2182 | 135 |
| 249 | 3300050507 | nmdc:mga05p37_21187_c1 | nmdc:mga05p37_21187_c1_5398_5805 | 135 |
| 250 | 3300050508 | nmdc:mga09592_137533_c1 | nmdc:mga09592_137533_c1_88_495 | 135 |
| 251 | 3300050509 | nmdc:mga0qj67_61777_c1 | nmdc:mga0qj67_61777_c1_1705_2112 | 135 |
| 252 | 3300050510 | nmdc:mga06r32_67701_c1 | nmdc:mga06r32_67701_c1_1902_2321 | 135 |
| 253 | 3300050510 | nmdc:mga06r32_78506_c1 | nmdc:mga06r32_78506_c1_200_607 | 135 |
| 254 | 3300050511 | nmdc:mga08y16_270702_c1 | nmdc:mga08y16_270702_c1_1044_1451 | 135 |
| 255 | 3300050511 | nmdc:mga08y16_37906_c1 | nmdc:mga08y16_37906_c1_3104_3511 | 135 |
| 256 | 3300050511 | nmdc:mga08y16_38404_c1 | nmdc:mga08y16_38404_c1_1791_2198 | 135 |
| 257 | 3300050512 | nmdc:mga0n895_342694_c1 | nmdc:mga0n895_342694_c1_308_715 | 135 |
| 258 | 3300050513 | nmdc:mga0rr50_235648_c1 | nmdc:mga0rr50_235648_c1_556_963 | 135 |
| 259 | 3300050513 | nmdc:mga0rr50_67477_c1 | nmdc:mga0rr50_67477_c1_551_958 | 135 |
| 260 | 3300050514 | nmdc:mga08x19_1113496_c1 | nmdc:mga08x19_1113496_c1_104_511 | 135 |
| 261 | 3300050515 | nmdc:mga0a205_206857_c1 | nmdc:mga0a205_206857_c1_1361_1768 | 135 |
| 262 | 3300050515 | nmdc:mga0a205_3445_c1 | nmdc:mga0a205_3445_c1_12530_12937 | 135 |
| 263 | 3300050515 | nmdc:mga0a205_395650_c1 | nmdc:mga0a205_395650_c1_748_1155 | 135 |
| 264 | 3300053736 | Ga0500599_007074 | Ga0500599_007074_495_902 | 135 |
| 265 | 3300054114 | Ga0501084_0123508 | Ga0501084_0123508_1172_1591 | 135 |
| 266 | 3300060353 | Ga0501082_1523488 | Ga0501082_1523488_108_527 | 135 |
| 267 | 3300061734 | Ga0530510_0177620 | Ga0530510_0177620_63_482 | 135 |
| 268 | 3300005364 | Ga0070673_100531525 | Ga0070673_1005315252 | 136 |
| 269 | 3300005459 | Ga0068867_101055704 | Ga0068867_1010557042 | 136 |
| 270 | 3300005543 | Ga0070672_100545830 | Ga0070672_1005458301 | 136 |
| 271 | 3300005718 | Ga0068866_10245590 | Ga0068866_102455902 | 136 |
| 272 | 3300005719 | Ga0068861_102537982 | Ga0068861_1025379821 | 136 |
| 273 | 3300006237 | Ga0097621_100122171 | Ga0097621_1001221714 | 136 |
| 274 | 3300006358 | Ga0068871_100004086 | Ga0068871_1000040864 | 136 |
| 275 | 3300006358 | Ga0068871_100009359 | Ga0068871_1000093598 | 136 |
| 276 | 3300009098 | Ga0105245_10813127 | Ga0105245_108131272 | 136 |
| 277 | 3300009176 | Ga0105242_10287264 | Ga0105242_102872642 | 136 |
| 278 | 3300009177 | Ga0105248_10112789 | Ga0105248_101127892 | 136 |
| 279 | 3300009177 | Ga0105248_10959976 | Ga0105248_109599761 | 136 |
| 280 | 3300014969 | Ga0157376_10015817 | Ga0157376_100158173 | 136 |
| 281 | 3300025899 | Ga0207642_10140711 | Ga0207642_101407111 | 136 |
| 282 | 3300025899 | Ga0207642_10490080 | Ga0207642_104900802 | 136 |
| 283 | 3300025934 | Ga0207686_10337406 | Ga0207686_103374062 | 136 |
| 284 | 3300025937 | Ga0207669_10336251 | Ga0207669_103362512 | 136 |
| 285 | 3300025940 | Ga0207691_10111783 | Ga0207691_101117835 | 136 |
| 286 | 3300025941 | Ga0207711_10999594 | Ga0207711_109995942 | 136 |
| 287 | 3300025960 | Ga0207651_10531336 | Ga0207651_105313362 | 136 |
| 288 | 3300025986 | Ga0207658_11554878 | Ga0207658_115548781 | 136 |
| 289 | 3300026088 | Ga0207641_10192942 | Ga0207641_101929422 | 136 |
| 290 | 3300026089 | Ga0207648_11022019 | Ga0207648_110220191 | 136 |
| 291 | 3300028381 | Ga0268264_11217447 | Ga0268264_112174472 | 136 |
| 292 | 3300035116 | Ga0373945_0231452 | Ga0373945_0231452_347_757 | 136 |
| 293 | 3300037068 | Ga0373925_0643519 | Ga0373925_0643519_287_697 | 136 |
| 294 | 3300037068 | Ga0373925_0869152 | Ga0373925_0869152_205_633 | 136 |
| 295 | 3300046463 | Ga0495653_0362211 | Ga0495653_0362211_74_502 | 136 |
| 296 | 3300046514 | Ga0495618_0198546 | Ga0495618_0198546_686_1114 | 136 |
| 297 | 3300046517 | Ga0495630_0222724 | Ga0495630_0222724_164_592 | 136 |
| 298 | 3300046535 | Ga0495586_0327302 | Ga0495586_0327302_329_757 | 136 |
| 299 | 3300046663 | Ga0495635_0100725 | Ga0495635_0100725_1411_1839 | 136 |
| 300 | 3300046681 | Ga0495647_0198128 | Ga0495647_0198128_210_620 | 136 |
| 301 | 3300046683 | Ga0495658_0793460 | Ga0495658_0793460_149_559 | 136 |
| 302 | 3300046689 | Ga0495613_0344264 | Ga0495613_0344264_67_477 | 136 |
| 303 | 3300047319 | Ga0495674_0404891 | Ga0495674_0404891_115_525 | 136 |
| 304 | 3300047322 | Ga0495680_0000399 | Ga0495680_0000399_17092_17520 | 136 |
| 305 | 3300047471 | Ga0495684_0153395 | Ga0495684_0153395_334_762 | 136 |
| 306 | 3300048903 | Ga0496100_0015639 | Ga0496100_0015639_1205_1615 | 136 |
| 307 | 3300048904 | Ga0496101_0000290 | Ga0496101_0000290_26157_26567 | 136 |
| 308 | 3300048907 | Ga0496104_0153074 | Ga0496104_0153074_750_1160 | 136 |
| 309 | 3300048908 | Ga0496105_0215363 | Ga0496105_0215363_526_936 | 136 |
| 310 | 3300048910 | Ga0496107_0024003 | Ga0496107_0024003_3429_3839 | 136 |
| 311 | 3300053103 | Ga0500555_000392 | Ga0500555_000392_8664_9104 | 136 |
| 312 | 3300053730 | Ga0500645_000220 | Ga0500645_000220_28967_29407 | 136 |
| 313 | 3300059421 | Ga0590071_001060 | Ga0590071_001060_3741_4151 | 136 |
| 314 | 3300059423 | Ga0590074_011851 | Ga0590074_011851_949_1359 | 136 |
| 315 | 3300059424 | Ga0590075_002771 | Ga0590075_002771_3023_3433 | 136 |
| 316 | 3300059426 | Ga0590077_000399 | Ga0590077_000399_9309_9719 | 136 |
| 317 | 3300005354 | Ga0070675_101153212 | Ga0070675_1011532122 | 137 |
| 318 | 3300005844 | Ga0068862_100746486 | Ga0068862_1007464861 | 137 |
| 319 | 3300005981 | Ga0081538_10064500 | Ga0081538_100645002 | 137 |
| 320 | 3300006844 | Ga0075428_100124605 | Ga0075428_1001246052 | 137 |
| 321 | 3300006844 | Ga0075428_101196402 | Ga0075428_1011964022 | 137 |
| 322 | 3300006846 | Ga0075430_100019613 | Ga0075430_1000196137 | 137 |
| 323 | 3300006847 | Ga0075431_100067173 | Ga0075431_1000671735 | 137 |
| 324 | 3300006880 | Ga0075429_100539535 | Ga0075429_1005395352 | 137 |
| 325 | 3300025926 | Ga0207659_11588712 | Ga0207659_115887121 | 137 |
| 326 | 3300026075 | Ga0207708_10266025 | Ga0207708_102660251 | 137 |
| 327 | 3300027665 | Ga0209983_1054296 | Ga0209983_10542961 | 137 |
| 328 | 3300031852 | Ga0307410_10059355 | Ga0307410_100593552 | 137 |
| 329 | 3300031852 | Ga0307410_10107587 | Ga0307410_101075872 | 137 |
| 330 | 3300031903 | Ga0307407_10089475 | Ga0307407_100894753 | 137 |
| 331 | 3300031911 | Ga0307412_10072569 | Ga0307412_100725692 | 137 |
| 332 | 3300031995 | Ga0307409_100265543 | Ga0307409_1002655433 | 137 |
| 333 | 3300032002 | Ga0307416_100098982 | Ga0307416_1000989822 | 137 |
| 334 | 3300042003 | Ga0439443_020710 | Ga0439443_020710_564_998 | 137 |
| 335 | 3300042125 | Ga0450923_008659 | Ga0450923_008659_349_783 | 137 |
| 336 | 3300049591 | Ga0501075_0622973 | Ga0501075_0622973_70_495 | 137 |
| 337 | 3300050508 | nmdc:mga09592_149462_c1 | nmdc:mga09592_149462_c1_1405_1821 | 137 |
| 338 | 3300050509 | nmdc:mga0qj67_8760_c1 | nmdc:mga0qj67_8760_c1_3170_3586 | 137 |
| 339 | 3300050510 | nmdc:mga06r32_40386_c1 | nmdc:mga06r32_40386_c1_909_1325 | 137 |
| 340 | 3300050510 | nmdc:mga06r32_594613_c1 | nmdc:mga06r32_594613_c1_357_773 | 137 |
| 341 | 3300059421 | Ga0590071_010104 | Ga0590071_010104_1270_1683 | 137 |
| 342 | 3300059426 | Ga0590077_003099 | Ga0590077_003099_974_1387 | 137 |
| 343 | 3300035083 | Ga0373926_0000467 | Ga0373926_0000467_3945_4370 | 138 |
| 344 | 3300035089 | Ga0373944_0023150 | Ga0373944_0023150_156_581 | 138 |
| 345 | 3300035113 | Ga0373936_0063562 | Ga0373936_0063562_1062_1487 | 138 |
| 346 | 3300035116 | Ga0373945_0020567 | Ga0373945_0020567_506_931 | 138 |
| 347 | 3300035118 | Ga0373954_0099979 | Ga0373954_0099979_834_1259 | 138 |
| 348 | 3300035119 | Ga0373956_0177943 | Ga0373956_0177943_450_875 | 138 |
| 349 | 3300035170 | Ga0373943_0036408 | Ga0373943_0036408_1261_1686 | 138 |
| 350 | 3300035171 | Ga0373946_0007998 | Ga0373946_0007998_193_618 | 138 |
| 351 | 3300035172 | Ga0373955_0146517 | Ga0373955_0146517_17_442 | 138 |
| 352 | 3300035410 | Ga0373924_0006388 | Ga0373924_0006388_2733_3158 | 138 |
| 353 | 3300035692 | Ga0373935_0156250 | Ga0373935_0156250_1061_1486 | 138 |
| 354 | 3300035695 | Ga0373927_0007496 | Ga0373927_0007496_2186_2611 | 138 |
| 355 | 3300035724 | Ga0373933_0064444 | Ga0373933_0064444_945_1370 | 138 |
| 356 | 3300036401 | Ga0373937_0271599 | Ga0373937_0271599_841_1266 | 138 |
| 357 | 3300037068 | Ga0373925_0010099 | Ga0373925_0010099_4068_4493 | 138 |
| 358 | 3300046452 | Ga0495617_010868 | Ga0495617_010868_1380_1805 | 138 |
| 359 | 3300046454 | Ga0495592_0089707 | Ga0495592_0089707_939_1364 | 138 |
| 360 | 3300046455 | Ga0495603_0050120 | Ga0495603_0050120_1480_1905 | 138 |
| 361 | 3300046458 | Ga0495591_010442 | Ga0495591_010442_1366_1791 | 138 |
| 362 | 3300046459 | Ga0495629_0115970 | Ga0495629_0115970_885_1310 | 138 |
| 363 | 3300046461 | Ga0495641_0068805 | Ga0495641_0068805_309_734 | 138 |
| 364 | 3300046462 | Ga0495651_0010712 | Ga0495651_0010712_3355_3780 | 138 |
| 365 | 3300046463 | Ga0495653_0015854 | Ga0495653_0015854_4480_4905 | 138 |
| 366 | 3300046472 | Ga0495580_0033904 | Ga0495580_0033904_1113_1538 | 138 |
| 367 | 3300046473 | Ga0495582_0014289 | Ga0495582_0014289_2554_2979 | 138 |
| 368 | 3300046475 | Ga0495639_0008830 | Ga0495639_0008830_2329_2754 | 138 |
| 369 | 3300046476 | Ga0495662_0016599 | Ga0495662_0016599_398_823 | 138 |
| 370 | 3300046491 | Ga0495584_0008866 | Ga0495584_0008866_374_799 | 138 |
| 371 | 3300046492 | Ga0495585_0007260 | Ga0495585_0007260_645_1070 | 138 |
| 372 | 3300046499 | Ga0495594_0006882 | Ga0495594_0006882_1713_2138 | 138 |
| 373 | 3300046501 | Ga0495607_0005387 | Ga0495607_0005387_2276_2701 | 138 |
| 374 | 3300046516 | Ga0495628_0062639 | Ga0495628_0062639_2163_2588 | 138 |
| 375 | 3300046517 | Ga0495630_0121371 | Ga0495630_0121371_1222_1647 | 138 |
| 376 | 3300046523 | Ga0495644_0000194 | Ga0495644_0000194_6859_7284 | 138 |
| 377 | 3300046525 | Ga0495663_0006200 | Ga0495663_0006200_2749_3174 | 138 |
| 378 | 3300046526 | Ga0495666_0093005 | Ga0495666_0093005_663_1088 | 138 |
| 379 | 3300046529 | Ga0495652_0027667 | Ga0495652_0027667_2098_2523 | 138 |
| 380 | 3300046531 | Ga0495665_0008988 | Ga0495665_0008988_2377_2802 | 138 |
| 381 | 3300046535 | Ga0495586_0050687 | Ga0495586_0050687_1082_1507 | 138 |
| 382 | 3300046536 | Ga0495587_0014105 | Ga0495587_0014105_4554_4979 | 138 |
| 383 | 3300046538 | Ga0495609_0027254 | Ga0495609_0027254_2036_2461 | 138 |
| 384 | 3300046557 | Ga0495622_0025454 | Ga0495622_0025454_248_673 | 138 |
| 385 | 3300046558 | Ga0495633_0003579 | Ga0495633_0003579_1368_1793 | 138 |
| 386 | 3300046559 | Ga0495667_0028506 | Ga0495667_0028506_2661_3086 | 138 |
| 387 | 3300046642 | Ga0495634_0406038 | Ga0495634_0406038_136_561 | 138 |
| 388 | 3300046648 | Ga0495611_0029144 | Ga0495611_0029144_1974_2399 | 138 |
| 389 | 3300046663 | Ga0495635_0074575 | Ga0495635_0074575_671_1096 | 138 |
| 390 | 3300046664 | Ga0495659_0001145 | Ga0495659_0001145_6964_7389 | 138 |
| 391 | 3300046674 | Ga0495588_0113353 | Ga0495588_0113353_437_862 | 138 |
| 392 | 3300046680 | Ga0495646_0080436 | Ga0495646_0080436_248_673 | 138 |
| 393 | 3300046681 | Ga0495647_0006635 | Ga0495647_0006635_1081_1506 | 138 |
| 394 | 3300046689 | Ga0495613_0162070 | Ga0495613_0162070_560_985 | 138 |
| 395 | 3300046690 | Ga0495624_0005904 | Ga0495624_0005904_2283_2708 | 138 |
| 396 | 3300046691 | Ga0495670_0001975 | Ga0495670_0001975_7377_7802 | 138 |
| 397 | 3300046692 | Ga0495671_0422577 | Ga0495671_0422577_148_573 | 138 |
| 398 | 3300046794 | Ga0495589_0036332 | Ga0495589_0036332_47_472 | 138 |
| 399 | 3300046809 | Ga0495600_0006963 | Ga0495600_0006963_2738_3163 | 138 |
| 400 | 3300047315 | Ga0495581_0006224 | Ga0495581_0006224_3444_3869 | 138 |
| 401 | 3300047317 | Ga0495604_0010469 | Ga0495604_0010469_4353_4778 | 138 |
| 402 | 3300047319 | Ga0495674_0047890 | Ga0495674_0047890_309_734 | 138 |
| 403 | 3300047321 | Ga0495676_0089008 | Ga0495676_0089008_558_983 | 138 |
| 404 | 3300047322 | Ga0495680_0005166 | Ga0495680_0005166_9208_9633 | 138 |
| 405 | 3300047446 | Ga0495679_171347 | Ga0495679_171347_26_451 | 138 |
| 406 | 3300047470 | Ga0495681_0173313 | Ga0495681_0173313_51_476 | 138 |
| 407 | 3300047471 | Ga0495684_0009567 | Ga0495684_0009567_5373_5798 | 138 |
| 408 | 3300047673 | Ga0495593_0067277 | Ga0495593_0067277_436_861 | 138 |
| 409 | 3300048088 | Ga0495602_0044248 | Ga0495602_0044248_125_550 | 138 |
| 410 | 3300048089 | Ga0495614_0080661 | Ga0495614_0080661_550_975 | 138 |
| 411 | 3300053084 | Ga0495595_0004854 | Ga0495595_0004854_2595_3020 | 138 |
| 412 | 3300053085 | Ga0495619_0056821 | Ga0495619_0056821_1216_1641 | 138 |
| 413 | 3300005330 | Ga0070690_100014607 | Ga0070690_1000146075 | 139 |
| 414 | 3300005334 | Ga0068869_100040493 | Ga0068869_1000404933 | 139 |
| 415 | 3300005335 | Ga0070666_10035676 | Ga0070666_100356763 | 139 |
| 416 | 3300005337 | Ga0070682_100142101 | Ga0070682_1001421012 | 139 |
| 417 | 3300005338 | Ga0068868_100139984 | Ga0068868_1001399842 | 139 |
| 418 | 3300005343 | Ga0070687_100140458 | Ga0070687_1001404582 | 139 |
| 419 | 3300005347 | Ga0070668_100214715 | Ga0070668_1002147152 | 139 |
| 420 | 3300005355 | Ga0070671_100088410 | Ga0070671_1000884103 | 139 |
| 421 | 3300005356 | Ga0070674_100223669 | Ga0070674_1002236692 | 139 |
| 422 | 3300005364 | Ga0070673_100153938 | Ga0070673_1001539383 | 139 |
| 423 | 3300005366 | Ga0070659_100123226 | Ga0070659_1001232263 | 139 |
| 424 | 3300005406 | Ga0070703_10169907 | Ga0070703_101699072 | 139 |
| 425 | 3300005434 | Ga0070709_10003045 | Ga0070709_100030453 | 139 |
| 426 | 3300005435 | Ga0070714_100006355 | Ga0070714_1000063553 | 139 |
| 427 | 3300005436 | Ga0070713_100043968 | Ga0070713_1000439683 | 139 |
| 428 | 3300005437 | Ga0070710_10031314 | Ga0070710_100313143 | 139 |
| 429 | 3300005438 | Ga0070701_10166036 | Ga0070701_101660362 | 139 |
| 430 | 3300005439 | Ga0070711_100035477 | Ga0070711_1000354773 | 139 |
| 431 | 3300005440 | Ga0070705_100079927 | Ga0070705_1000799273 | 139 |
| 432 | 3300005457 | Ga0070662_101230873 | Ga0070662_1012308732 | 139 |
| 433 | 3300005459 | Ga0068867_101045807 | Ga0068867_1010458071 | 139 |
| 434 | 3300005466 | Ga0070685_10097202 | Ga0070685_100972023 | 139 |
| 435 | 3300005535 | Ga0070684_100344868 | Ga0070684_1003448682 | 139 |
| 436 | 3300005535 | Ga0070684_100757528 | Ga0070684_1007575282 | 139 |
| 437 | 3300005543 | Ga0070672_101071143 | Ga0070672_1010711432 | 139 |
| 438 | 3300005544 | Ga0070686_100008864 | Ga0070686_1000088645 | 139 |
| 439 | 3300005547 | Ga0070693_100100354 | Ga0070693_1001003542 | 139 |
| 440 | 3300005548 | Ga0070665_100095421 | Ga0070665_1000954213 | 139 |
| 441 | 3300005564 | Ga0070664_100384557 | Ga0070664_1003845572 | 139 |
| 442 | 3300005614 | Ga0068856_100233439 | Ga0068856_1002334392 | 139 |
| 443 | 3300005615 | Ga0070702_100473936 | Ga0070702_1004739362 | 139 |
| 444 | 3300005617 | Ga0068859_100181871 | Ga0068859_1001818713 | 139 |
| 445 | 3300005618 | Ga0068864_100096129 | Ga0068864_1000961293 | 139 |
| 446 | 3300005718 | Ga0068866_10199047 | Ga0068866_101990472 | 139 |
| 447 | 3300005719 | Ga0068861_101580011 | Ga0068861_1015800111 | 139 |
| 448 | 3300005843 | Ga0068860_100381469 | Ga0068860_1003814693 | 139 |
| 449 | 3300005844 | Ga0068862_101550222 | Ga0068862_1015502222 | 139 |
| 450 | 3300005937 | Ga0081455_10605103 | Ga0081455_106051031 | 139 |
| 451 | 3300006028 | Ga0070717_10058028 | Ga0070717_100580283 | 139 |
| 452 | 3300006163 | Ga0070715_10028782 | Ga0070715_100287822 | 139 |
| 453 | 3300006173 | Ga0070716_100003613 | Ga0070716_1000036133 | 139 |
| 454 | 3300006175 | Ga0070712_100151630 | Ga0070712_1001516303 | 139 |
| 455 | 3300006237 | Ga0097621_100076553 | Ga0097621_1000765533 | 139 |
| 456 | 3300006358 | Ga0068871_100058785 | Ga0068871_1000587853 | 139 |
| 457 | 3300006852 | Ga0075433_10082863 | Ga0075433_100828633 | 139 |
| 458 | 3300006852 | Ga0075433_10426270 | Ga0075433_104262702 | 139 |
| 459 | 3300006852 | Ga0075433_10552178 | Ga0075433_105521782 | 139 |
| 460 | 3300006871 | Ga0075434_100098341 | Ga0075434_1000983412 | 139 |
| 461 | 3300006914 | Ga0075436_100030775 | Ga0075436_1000307752 | 139 |
| 462 | 3300006914 | Ga0075436_100580529 | Ga0075436_1005805292 | 139 |
| 463 | 3300006931 | Ga0097620_100181878 | Ga0097620_1001818783 | 139 |
| 464 | 3300007076 | Ga0075435_100029012 | Ga0075435_1000290121 | 139 |
| 465 | 3300007076 | Ga0075435_100191013 | Ga0075435_1001910132 | 139 |
| 466 | 3300007076 | Ga0075435_100314289 | Ga0075435_1003142892 | 139 |
| 467 | 3300009011 | Ga0105251_10010416 | Ga0105251_100104165 | 139 |
| 468 | 3300009092 | Ga0105250_10154115 | Ga0105250_101541152 | 139 |
| 469 | 3300009094 | Ga0111539_10470087 | Ga0111539_104700872 | 139 |
| 470 | 3300009098 | Ga0105245_11012962 | Ga0105245_110129622 | 139 |
| 471 | 3300009147 | Ga0114129_10009653 | Ga0114129_100096535 | 139 |
| 472 | 3300009148 | Ga0105243_10093512 | Ga0105243_100935123 | 139 |
| 473 | 3300009177 | Ga0105248_10031696 | Ga0105248_100316964 | 139 |
| 474 | 3300009551 | Ga0105238_10070681 | Ga0105238_100706813 | 139 |
| 475 | 3300010375 | Ga0105239_11418221 | Ga0105239_114182212 | 139 |
| 476 | 3300012492 | Ga0157335_1003155 | Ga0157335_10031552 | 139 |
| 477 | 3300012502 | Ga0157347_1001471 | Ga0157347_10014712 | 139 |
| 478 | 3300012512 | Ga0157327_1009899 | Ga0157327_10098992 | 139 |
| 479 | 3300013296 | Ga0157374_10468874 | Ga0157374_104688742 | 139 |
| 480 | 3300013296 | Ga0157374_11098293 | Ga0157374_110982931 | 139 |
| 481 | 3300013296 | Ga0157374_11217466 | Ga0157374_112174661 | 139 |
| 482 | 3300013297 | Ga0157378_10176862 | Ga0157378_101768623 | 139 |
| 483 | 3300013306 | Ga0163162_10078121 | Ga0163162_100781213 | 139 |
| 484 | 3300013306 | Ga0163162_10223407 | Ga0163162_102234073 | 139 |
| 485 | 3300013308 | Ga0157375_10168969 | Ga0157375_101689693 | 139 |
| 486 | 3300014325 | Ga0163163_10244548 | Ga0163163_102445483 | 139 |
| 487 | 3300014745 | Ga0157377_10094013 | Ga0157377_100940131 | 139 |
| 488 | 3300014968 | Ga0157379_10201412 | Ga0157379_102014122 | 139 |
| 489 | 3300014968 | Ga0157379_10207352 | Ga0157379_102073522 | 139 |
| 490 | 3300017792 | Ga0163161_10768627 | Ga0163161_107686272 | 139 |
| 491 | 3300025735 | Ga0207713_1061561 | Ga0207713_10615612 | 139 |
| 492 | 3300025898 | Ga0207692_10015940 | Ga0207692_100159403 | 139 |
| 493 | 3300025899 | Ga0207642_10120835 | Ga0207642_101208351 | 139 |
| 494 | 3300025900 | Ga0207710_10024606 | Ga0207710_100246062 | 139 |
| 495 | 3300025901 | Ga0207688_10028735 | Ga0207688_100287353 | 139 |
| 496 | 3300025905 | Ga0207685_10002707 | Ga0207685_100027073 | 139 |
| 497 | 3300025906 | Ga0207699_10001859 | Ga0207699_100018593 | 139 |
| 498 | 3300025915 | Ga0207693_10036145 | Ga0207693_100361453 | 139 |
| 499 | 3300025916 | Ga0207663_10019234 | Ga0207663_100192343 | 139 |
| 500 | 3300025916 | Ga0207663_10135741 | Ga0207663_101357412 | 139 |
| 501 | 3300025918 | Ga0207662_10037005 | Ga0207662_100370052 | 139 |
| 502 | 3300025923 | Ga0207681_10230035 | Ga0207681_102300353 | 139 |
| 503 | 3300025924 | Ga0207694_10168251 | Ga0207694_101682512 | 139 |
| 504 | 3300025927 | Ga0207687_10015275 | Ga0207687_100152753 | 139 |
| 505 | 3300025927 | Ga0207687_10754400 | Ga0207687_107544002 | 139 |
| 506 | 3300025928 | Ga0207700_10031736 | Ga0207700_100317363 | 139 |
| 507 | 3300025929 | Ga0207664_10014021 | Ga0207664_100140213 | 139 |
| 508 | 3300025931 | Ga0207644_10020295 | Ga0207644_100202953 | 139 |
| 509 | 3300025932 | Ga0207690_10059770 | Ga0207690_100597702 | 139 |
| 510 | 3300025933 | Ga0207706_10737080 | Ga0207706_107370802 | 139 |
| 511 | 3300025934 | Ga0207686_10133387 | Ga0207686_101333872 | 139 |
| 512 | 3300025935 | Ga0207709_10069957 | Ga0207709_100699573 | 139 |
| 513 | 3300025937 | Ga0207669_10346884 | Ga0207669_103468842 | 139 |
| 514 | 3300025938 | Ga0207704_10129753 | Ga0207704_101297533 | 139 |
| 515 | 3300025939 | Ga0207665_10010796 | Ga0207665_100107966 | 139 |
| 516 | 3300025940 | Ga0207691_10093609 | Ga0207691_100936092 | 139 |
| 517 | 3300025941 | Ga0207711_10011217 | Ga0207711_100112175 | 139 |
| 518 | 3300025942 | Ga0207689_10054554 | Ga0207689_100545543 | 139 |
| 519 | 3300025944 | Ga0207661_10849638 | Ga0207661_108496382 | 139 |
| 520 | 3300025945 | Ga0207679_10339848 | Ga0207679_103398482 | 139 |
| 521 | 3300025960 | Ga0207651_10171106 | Ga0207651_101711062 | 139 |
| 522 | 3300025961 | Ga0207712_10472090 | Ga0207712_104720902 | 139 |
| 523 | 3300025972 | Ga0207668_10183651 | Ga0207668_101836512 | 139 |
| 524 | 3300026035 | Ga0207703_10119645 | Ga0207703_101196452 | 139 |
| 525 | 3300026067 | Ga0207678_10007714 | Ga0207678_100077145 | 139 |
| 526 | 3300026088 | Ga0207641_10124275 | Ga0207641_101242753 | 139 |
| 527 | 3300026088 | Ga0207641_11771034 | Ga0207641_117710342 | 139 |
| 528 | 3300026089 | Ga0207648_10475622 | Ga0207648_104756222 | 139 |
| 529 | 3300026121 | Ga0207683_10005584 | Ga0207683_100055844 | 139 |
| 530 | 3300027907 | Ga0207428_10110621 | Ga0207428_101106213 | 139 |
| 531 | 3300028379 | Ga0268266_10013545 | Ga0268266_100135454 | 139 |
| 532 | 3300028380 | Ga0268265_10509228 | Ga0268265_105092282 | 139 |
| 533 | 3300028381 | Ga0268264_10132374 | Ga0268264_101323742 | 139 |
| 534 | 3300034816 | Ga0373930_0018027 | Ga0373930_0018027_693_1121 | 139 |
| 535 | 3300034818 | Ga0373950_0015153 | Ga0373950_0015153_115_543 | 139 |
| 536 | 3300034819 | Ga0373958_0036482 | Ga0373958_0036482_354_782 | 139 |
| 537 | 3300034820 | Ga0373959_0017523 | Ga0373959_0017523_506_934 | 139 |
| 538 | 3300034957 | Ga0373938_0053583 | Ga0373938_0053583_485_913 | 139 |
| 539 | 3300035091 | Ga0373951_0115910 | Ga0373951_0115910_222_650 | 139 |
| 540 | 3300035092 | Ga0373952_0006102 | Ga0373952_0006102_554_982 | 139 |
| 541 | 3300035112 | Ga0373932_0002850 | Ga0373932_0002850_1444_1872 | 139 |
| 542 | 3300035115 | Ga0373941_0032799 | Ga0373941_0032799_359_787 | 139 |
| 543 | 3300035116 | Ga0373945_0004426 | Ga0373945_0004426_26_445 | 139 |
| 544 | 3300035170 | Ga0373943_0007096 | Ga0373943_0007096_4267_4686 | 139 |
| 545 | 3300035171 | Ga0373946_0008924 | Ga0373946_0008924_3174_3593 | 139 |
| 546 | 3300035241 | Ga0373961_0080101 | Ga0373961_0080101_392_820 | 139 |
| 547 | 3300035242 | Ga0373962_0005442 | Ga0373962_0005442_2577_3005 | 139 |
| 548 | 3300035691 | Ga0373931_0002000 | Ga0373931_0002000_5027_5455 | 139 |
| 549 | 3300035691 | Ga0373931_0178067 | Ga0373931_0178067_739_1167 | 139 |
| 550 | 3300035692 | Ga0373935_0075240 | Ga0373935_0075240_59_478 | 139 |
| 551 | 3300035695 | Ga0373927_0056853 | Ga0373927_0056853_492_911 | 139 |
| 552 | 3300035725 | Ga0373947_0016221 | Ga0373947_0016221_604_1023 | 139 |
| 553 | 3300037068 | Ga0373925_0054869 | Ga0373925_0054869_564_983 | 139 |
| 554 | 3300046455 | Ga0495603_0181250 | Ga0495603_0181250_564_983 | 139 |
| 555 | 3300046459 | Ga0495629_0004767 | Ga0495629_0004767_9070_9489 | 139 |
| 556 | 3300046473 | Ga0495582_0000612 | Ga0495582_0000612_18554_18973 | 139 |
| 557 | 3300046476 | Ga0495662_0639075 | Ga0495662_0639075_84_503 | 139 |
| 558 | 3300046499 | Ga0495594_0059541 | Ga0495594_0059541_1015_1434 | 139 |
| 559 | 3300046557 | Ga0495622_0044804 | Ga0495622_0044804_574_993 | 139 |
| 560 | 3300046663 | Ga0495635_0133259 | Ga0495635_0133259_156_575 | 139 |
| 561 | 3300046674 | Ga0495588_0035444 | Ga0495588_0035444_969_1388 | 139 |
| 562 | 3300046681 | Ga0495647_0015759 | Ga0495647_0015759_1743_2162 | 139 |
| 563 | 3300046683 | Ga0495658_0005405 | Ga0495658_0005405_1894_2313 | 139 |
| 564 | 3300046809 | Ga0495600_0204163 | Ga0495600_0204163_347_766 | 139 |
| 565 | 3300047315 | Ga0495581_0092779 | Ga0495581_0092779_61_480 | 139 |
| 566 | 3300047321 | Ga0495676_0035932 | Ga0495676_0035932_1459_1878 | 139 |
| 567 | 3300047322 | Ga0495680_0005187 | Ga0495680_0005187_10390_10809 | 139 |
| 568 | 3300048904 | Ga0496101_0139232 | Ga0496101_0139232_180_608 | 139 |
| 569 | 3300048905 | Ga0496102_0148204 | Ga0496102_0148204_134_562 | 139 |
| 570 | 3300048905 | Ga0496102_0276915 | Ga0496102_0276915_133_561 | 139 |
| 571 | 3300048905 | Ga0496102_1366062 | Ga0496102_1366062_180_608 | 139 |
| 572 | 3300048906 | Ga0496103_0017226 | Ga0496103_0017226_1072_1500 | 139 |
| 573 | 3300048906 | Ga0496103_0215207 | Ga0496103_0215207_507_935 | 139 |
| 574 | 3300048907 | Ga0496104_0305751 | Ga0496104_0305751_275_703 | 139 |
| 575 | 3300048907 | Ga0496104_0422784 | Ga0496104_0422784_325_753 | 139 |
| 576 | 3300048908 | Ga0496105_0149162 | Ga0496105_0149162_322_750 | 139 |
| 577 | 3300048908 | Ga0496105_0520577 | Ga0496105_0520577_39_467 | 139 |
| 578 | 3300048909 | Ga0496106_0546469 | Ga0496106_0546469_322_750 | 139 |
| 579 | 3300048910 | Ga0496107_0043616 | Ga0496107_0043616_1456_1884 | 139 |
| 580 | 3300048911 | Ga0496108_0122691 | Ga0496108_0122691_1480_1908 | 139 |
| 581 | 3300048912 | Ga0496109_0030825 | Ga0496109_0030825_2082_2510 | 139 |
| 582 | 3300048912 | Ga0496109_0178876 | Ga0496109_0178876_492_920 | 139 |
| 583 | 3300048913 | Ga0496110_0059126 | Ga0496110_0059126_1477_1905 | 139 |
| 584 | 3300048913 | Ga0496110_0083757 | Ga0496110_0083757_20_448 | 139 |
| 585 | 3300048914 | Ga0496111_0038001 | Ga0496111_0038001_95_523 | 139 |
| 586 | 3300048914 | Ga0496111_0091797 | Ga0496111_0091797_1333_1761 | 139 |
| 587 | 3300048915 | Ga0496112_0032467 | Ga0496112_0032467_3141_3569 | 139 |
| 588 | 3300048915 | Ga0496112_0440174 | Ga0496112_0440174_322_750 | 139 |
| 589 | 3300048916 | Ga0496113_0060944 | Ga0496113_0060944_931_1359 | 139 |
| 590 | 3300048917 | Ga0496114_0041803 | Ga0496114_0041803_465_893 | 139 |
| 591 | 3300048917 | Ga0496114_0141759 | Ga0496114_0141759_1353_1781 | 139 |
| 592 | 3300048918 | Ga0496115_0066251 | Ga0496115_0066251_1456_1884 | 139 |
| 593 | 3300048918 | Ga0496115_0274496 | Ga0496115_0274496_492_920 | 139 |
| 594 | 3300050507 | nmdc:mga05p37_68016_c1 | nmdc:mga05p37_68016_c1_1042_1461 | 139 |
| 595 | 3300050511 | nmdc:mga08y16_538042_c1 | nmdc:mga08y16_538042_c1_598_1026 | 139 |
| 596 | 3300050512 | nmdc:mga0n895_20783_c1 | nmdc:mga0n895_20783_c1_144_563 | 139 |
| 597 | 3300050512 | nmdc:mga0n895_62410_c1 | nmdc:mga0n895_62410_c1_2746_3174 | 139 |
| 598 | 3300050513 | nmdc:mga0rr50_91648_c2 | nmdc:mga0rr50_91648_c2_642_1070 | 139 |
| 599 | 3300050514 | nmdc:mga08x19_56550_c1 | nmdc:mga08x19_56550_c1_888_1316 | 139 |
| 600 | 3300050515 | nmdc:mga0a205_453771_c1 | nmdc:mga0a205_453771_c1_254_682 | 139 |
| 601 | 3300050515 | nmdc:mga0a205_633650_c1 | nmdc:mga0a205_633650_c1_252_680 | 139 |
| 602 | 3300050515 | nmdc:mga0a205_8902_c1 | nmdc:mga0a205_8902_c1_3174_3593 | 139 |
| 603 | 3300053085 | Ga0495619_0006574 | Ga0495619_0006574_2790_3209 | 139 |
| 604 | 3300000042 | ARSoilYngRDRAFT_c00080 | ARSoilYngRDRAFT_000805 | 140 |
| 605 | 3300000043 | ARcpr5yngRDRAFT_c000055 | ARcpr5yngRDRAFT_0000555 | 140 |
| 606 | 3300000044 | ARSoilOldRDRAFT_c000003 | ARSoilOldRDRAFT_00000358 | 140 |
| 607 | 3300000045 | ARCol0oldRDRAFT_c00230 | ARCol0oldRDRAFT_002303 | 140 |
| 608 | 3300000652 | ARCol0yngRDRAFT_1000007 | ARCol0yngRDRAFT_10000075 | 140 |
| 609 | 3300001977 | JGI24746J21847_1002009 | JGI24746J21847_10020093 | 140 |
| 610 | 3300001989 | JGI24739J22299_10000900 | JGI24739J22299_100009003 | 140 |
| 611 | 3300001990 | JGI24737J22298_10000509 | JGI24737J22298_100005098 | 140 |
| 612 | 3300001990 | JGI24737J22298_10023381 | JGI24737J22298_100233811 | 140 |
| 613 | 3300002073 | JGI24745J21846_1000354 | JGI24745J21846_10003543 | 140 |
| 614 | 3300002074 | JGI24748J21848_1001508 | JGI24748J21848_10015083 | 140 |
| 615 | 3300002075 | JGI24738J21930_10000120 | JGI24738J21930_100001207 | 140 |
| 616 | 3300002076 | JGI24749J21850_1003005 | JGI24749J21850_10030053 | 140 |
| 617 | 3300002077 | JGI24744J21845_10004657 | JGI24744J21845_100046572 | 140 |
| 618 | 3300002126 | JGI24035J26624_1000291 | JGI24035J26624_10002914 | 140 |
| 619 | 3300002239 | JGI24034J26672_10000187 | JGI24034J26672_100001876 | 140 |
| 620 | 3300002244 | JGI24742J22300_10000029 | JGI24742J22300_1000002916 | 140 |
| 621 | 3300002459 | JGI24751J29686_10046468 | JGI24751J29686_100464681 | 140 |
| 622 | 3300003349 | JGI26129J50193_1005105 | JGI26129J50193_10051051 | 140 |
| 623 | 3300005276 | Ga0065717_1002770 | Ga0065717_10027702 | 140 |
| 624 | 3300005290 | Ga0065712_10000690 | Ga0065712_100006905 | 140 |
| 625 | 3300005290 | Ga0065712_10001626 | Ga0065712_100016263 | 140 |
| 626 | 3300005290 | Ga0065712_10091644 | Ga0065712_100916443 | 140 |
| 627 | 3300005293 | Ga0065715_10001262 | Ga0065715_100012627 | 140 |
| 628 | 3300005293 | Ga0065715_10147791 | Ga0065715_101477912 | 140 |
| 629 | 3300005328 | Ga0070676_10003502 | Ga0070676_100035028 | 140 |
| 630 | 3300005328 | Ga0070676_11216047 | Ga0070676_112160471 | 140 |
| 631 | 3300005329 | Ga0070683_100000116 | Ga0070683_10000011626 | 140 |
| 632 | 3300005330 | Ga0070690_100066294 | Ga0070690_1000662943 | 140 |
| 633 | 3300005331 | Ga0070670_100006964 | Ga0070670_1000069649 | 140 |
| 634 | 3300005333 | Ga0070677_10000097 | Ga0070677_1000009726 | 140 |
| 635 | 3300005334 | Ga0068869_100064378 | Ga0068869_1000643783 | 140 |
| 636 | 3300005335 | Ga0070666_10003937 | Ga0070666_100039377 | 140 |
| 637 | 3300005335 | Ga0070666_10418473 | Ga0070666_104184732 | 140 |
| 638 | 3300005336 | Ga0070680_100001035 | Ga0070680_10000103514 | 140 |
| 639 | 3300005337 | Ga0070682_100001635 | Ga0070682_1000016354 | 140 |
| 640 | 3300005338 | Ga0068868_100060353 | Ga0068868_1000603533 | 140 |
| 641 | 3300005339 | Ga0070660_100034100 | Ga0070660_1000341003 | 140 |
| 642 | 3300005340 | Ga0070689_100099054 | Ga0070689_1000990543 | 140 |
| 643 | 3300005341 | Ga0070691_10000048 | Ga0070691_1000004820 | 140 |
| 644 | 3300005343 | Ga0070687_100017362 | Ga0070687_1000173623 | 140 |
| 645 | 3300005344 | Ga0070661_100000228 | Ga0070661_10000022840 | 140 |
| 646 | 3300005344 | Ga0070661_100676567 | Ga0070661_1006765672 | 140 |
| 647 | 3300005344 | Ga0070661_101077346 | Ga0070661_1010773461 | 140 |
| 648 | 3300005345 | Ga0070692_10000050 | Ga0070692_100000503 | 140 |
| 649 | 3300005347 | Ga0070668_100010524 | Ga0070668_1000105242 | 140 |
| 650 | 3300005347 | Ga0070668_100125603 | Ga0070668_1001256033 | 140 |
| 651 | 3300005353 | Ga0070669_100031291 | Ga0070669_1000312912 | 140 |
| 652 | 3300005354 | Ga0070675_100000503 | Ga0070675_10000050317 | 140 |
| 653 | 3300005355 | Ga0070671_100000720 | Ga0070671_1000007209 | 140 |
| 654 | 3300005355 | Ga0070671_100078879 | Ga0070671_1000788793 | 140 |
| 655 | 3300005356 | Ga0070674_100000570 | Ga0070674_10000057010 | 140 |
| 656 | 3300005364 | Ga0070673_100000045 | Ga0070673_10000004521 | 140 |
| 657 | 3300005365 | Ga0070688_100000308 | Ga0070688_10000030819 | 140 |
| 658 | 3300005365 | Ga0070688_100069017 | Ga0070688_1000690172 | 140 |
| 659 | 3300005365 | Ga0070688_100099040 | Ga0070688_1000990402 | 140 |
| 660 | 3300005366 | Ga0070659_100000183 | Ga0070659_10000018342 | 140 |
| 661 | 3300005367 | Ga0070667_100003874 | Ga0070667_10000387412 | 140 |
| 662 | 3300005367 | Ga0070667_100263573 | Ga0070667_1002635733 | 140 |
| 663 | 3300005406 | Ga0070703_10005702 | Ga0070703_100057023 | 140 |
| 664 | 3300005438 | Ga0070701_10326768 | Ga0070701_103267682 | 140 |
| 665 | 3300005440 | Ga0070705_100001770 | Ga0070705_10000177012 | 140 |
| 666 | 3300005440 | Ga0070705_100480256 | Ga0070705_1004802562 | 140 |
| 667 | 3300005441 | Ga0070700_100000239 | Ga0070700_10000023926 | 140 |
| 668 | 3300005444 | Ga0070694_100003730 | Ga0070694_1000037305 | 140 |
| 669 | 3300005445 | Ga0070708_100030075 | Ga0070708_1000300753 | 140 |
| 670 | 3300005445 | Ga0070708_101952936 | Ga0070708_1019529361 | 140 |
| 671 | 3300005455 | Ga0070663_100000328 | Ga0070663_10000032810 | 140 |
| 672 | 3300005456 | Ga0070678_100000576 | Ga0070678_10000057610 | 140 |
| 673 | 3300005457 | Ga0070662_100011223 | Ga0070662_1000112234 | 140 |
| 674 | 3300005457 | Ga0070662_100056064 | Ga0070662_1000560642 | 140 |
| 675 | 3300005458 | Ga0070681_10078407 | Ga0070681_100784073 | 140 |
| 676 | 3300005459 | Ga0068867_100000160 | Ga0068867_1000001603 | 140 |
| 677 | 3300005466 | Ga0070685_10003069 | Ga0070685_100030695 | 140 |
| 678 | 3300005468 | Ga0070707_100889470 | Ga0070707_1008894702 | 140 |
| 679 | 3300005518 | Ga0070699_100197400 | Ga0070699_1001974003 | 140 |
| 680 | 3300005530 | Ga0070679_100005744 | Ga0070679_1000057444 | 140 |
| 681 | 3300005530 | Ga0070679_100454183 | Ga0070679_1004541832 | 140 |
| 682 | 3300005535 | Ga0070684_100000352 | Ga0070684_10000035227 | 140 |
| 683 | 3300005535 | Ga0070684_101032443 | Ga0070684_1010324432 | 140 |
| 684 | 3300005536 | Ga0070697_100463412 | Ga0070697_1004634122 | 140 |
| 685 | 3300005539 | Ga0068853_100000902 | Ga0068853_1000009027 | 140 |
| 686 | 3300005543 | Ga0070672_100000016 | Ga0070672_10000001623 | 140 |
| 687 | 3300005544 | Ga0070686_100006337 | Ga0070686_1000063375 | 140 |
| 688 | 3300005545 | Ga0070695_100001458 | Ga0070695_1000014584 | 140 |
| 689 | 3300005545 | Ga0070695_100004098 | Ga0070695_1000040983 | 140 |
| 690 | 3300005546 | Ga0070696_100006179 | Ga0070696_1000061794 | 140 |
| 691 | 3300005546 | Ga0070696_100019661 | Ga0070696_1000196613 | 140 |
| 692 | 3300005547 | Ga0070693_100002786 | Ga0070693_1000027865 | 140 |
| 693 | 3300005549 | Ga0070704_100014046 | Ga0070704_1000140463 | 140 |
| 694 | 3300005563 | Ga0068855_100003504 | Ga0068855_1000035049 | 140 |
| 695 | 3300005564 | Ga0070664_100000067 | Ga0070664_10000006727 | 140 |
| 696 | 3300005577 | Ga0068857_100003331 | Ga0068857_1000033315 | 140 |
| 697 | 3300005578 | Ga0068854_100000131 | Ga0068854_1000001313 | 140 |
| 698 | 3300005578 | Ga0068854_100832197 | Ga0068854_1008321972 | 140 |
| 699 | 3300005578 | Ga0068854_101423473 | Ga0068854_1014234731 | 140 |
| 700 | 3300005614 | Ga0068856_100002341 | Ga0068856_10000234112 | 140 |
| 701 | 3300005615 | Ga0070702_100001107 | Ga0070702_1000011076 | 140 |
| 702 | 3300005617 | Ga0068859_100003592 | Ga0068859_1000035928 | 140 |
| 703 | 3300005617 | Ga0068859_100245070 | Ga0068859_1002450703 | 140 |
| 704 | 3300005618 | Ga0068864_100000234 | Ga0068864_10000023447 | 140 |
| 705 | 3300005618 | Ga0068864_100059635 | Ga0068864_1000596353 | 140 |
| 706 | 3300005718 | Ga0068866_10000552 | Ga0068866_100005529 | 140 |
| 707 | 3300005719 | Ga0068861_100000241 | Ga0068861_1000002418 | 140 |
| 708 | 3300005840 | Ga0068870_10000009 | Ga0068870_1000000977 | 140 |
| 709 | 3300005841 | Ga0068863_100003248 | Ga0068863_10000324811 | 140 |
| 710 | 3300005842 | Ga0068858_100001548 | Ga0068858_1000015489 | 140 |
| 711 | 3300005842 | Ga0068858_100060688 | Ga0068858_1000606883 | 140 |
| 712 | 3300005843 | Ga0068860_100001050 | Ga0068860_10000105011 | 140 |
| 713 | 3300005843 | Ga0068860_100094121 | Ga0068860_1000941213 | 140 |
| 714 | 3300005843 | Ga0068860_100450495 | Ga0068860_1004504952 | 140 |
| 715 | 3300005844 | Ga0068862_100001143 | Ga0068862_1000011438 | 140 |
| 716 | 3300005844 | Ga0068862_100034581 | Ga0068862_1000345813 | 140 |
| 717 | 3300006178 | Ga0075367_10024435 | Ga0075367_100244353 | 140 |
| 718 | 3300006237 | Ga0097621_100000569 | Ga0097621_10000056912 | 140 |
| 719 | 3300006358 | Ga0068871_100000012 | Ga0068871_100000012102 | 140 |
| 720 | 3300006852 | Ga0075433_10009693 | Ga0075433_100096933 | 140 |
| 721 | 3300006871 | Ga0075434_100001007 | Ga0075434_10000100710 | 140 |
| 722 | 3300006871 | Ga0075434_100434757 | Ga0075434_1004347572 | 140 |
| 723 | 3300006881 | Ga0068865_100000209 | Ga0068865_10000020920 | 140 |
| 724 | 3300006914 | Ga0075436_100429462 | Ga0075436_1004294621 | 140 |
| 725 | 3300006931 | Ga0097620_100003592 | Ga0097620_1000035928 | 140 |
| 726 | 3300006931 | Ga0097620_100245065 | Ga0097620_1002450653 | 140 |
| 727 | 3300007076 | Ga0075435_100003730 | Ga0075435_1000037303 | 140 |
| 728 | 3300007076 | Ga0075435_100636847 | Ga0075435_1006368472 | 140 |
| 729 | 3300009036 | Ga0105244_10013466 | Ga0105244_100134663 | 140 |
| 730 | 3300009092 | Ga0105250_10046130 | Ga0105250_100461302 | 140 |
| 731 | 3300009092 | Ga0105250_10166835 | Ga0105250_101668352 | 140 |
| 732 | 3300009093 | Ga0105240_10073250 | Ga0105240_100732504 | 140 |
| 733 | 3300009094 | Ga0111539_10000941 | Ga0111539_100009418 | 140 |
| 734 | 3300009094 | Ga0111539_10001081 | Ga0111539_1000108126 | 140 |
| 735 | 3300009098 | Ga0105245_10001284 | Ga0105245_100012849 | 140 |
| 736 | 3300009101 | Ga0105247_10003522 | Ga0105247_100035226 | 140 |
| 737 | 3300009101 | Ga0105247_10086947 | Ga0105247_100869473 | 140 |
| 738 | 3300009148 | Ga0105243_10003373 | Ga0105243_100033734 | 140 |
| 739 | 3300009174 | Ga0105241_10000053 | Ga0105241_1000005341 | 140 |
| 740 | 3300009176 | Ga0105242_10000492 | Ga0105242_1000049210 | 140 |
| 741 | 3300009176 | Ga0105242_10090793 | Ga0105242_100907933 | 140 |
| 742 | 3300009177 | Ga0105248_10000934 | Ga0105248_100009348 | 140 |
| 743 | 3300009177 | Ga0105248_10015418 | Ga0105248_100154183 | 140 |
| 744 | 3300009545 | Ga0105237_10014650 | Ga0105237_100146506 | 140 |
| 745 | 3300009545 | Ga0105237_10209046 | Ga0105237_102090463 | 140 |
| 746 | 3300009551 | Ga0105238_10121677 | Ga0105238_101216772 | 140 |
| 747 | 3300009553 | Ga0105249_10003582 | Ga0105249_100035825 | 140 |
| 748 | 3300009553 | Ga0105249_10033319 | Ga0105249_100333193 | 140 |
| 749 | 3300010375 | Ga0105239_10016523 | Ga0105239_100165238 | 140 |
| 750 | 3300011119 | Ga0105246_10000055 | Ga0105246_1000005520 | 140 |
| 751 | 3300011119 | Ga0105246_11642420 | Ga0105246_116424201 | 140 |
| 752 | 3300012490 | Ga0157322_1003269 | Ga0157322_10032692 | 140 |
| 753 | 3300012492 | Ga0157335_1001325 | Ga0157335_10013252 | 140 |
| 754 | 3300012494 | Ga0157341_1000580 | Ga0157341_10005803 | 140 |
| 755 | 3300012503 | Ga0157313_1000610 | Ga0157313_10006103 | 140 |
| 756 | 3300012507 | Ga0157342_1003586 | Ga0157342_10035862 | 140 |
| 757 | 3300012515 | Ga0157338_1003272 | Ga0157338_10032722 | 140 |
| 758 | 3300013100 | Ga0157373_10006564 | Ga0157373_100065643 | 140 |
| 759 | 3300013102 | Ga0157371_10098837 | Ga0157371_100988373 | 140 |
| 760 | 3300013296 | Ga0157374_10001308 | Ga0157374_100013087 | 140 |
| 761 | 3300013297 | Ga0157378_10000986 | Ga0157378_1000098613 | 140 |
| 762 | 3300013306 | Ga0163162_10002432 | Ga0163162_100024328 | 140 |
| 763 | 3300013306 | Ga0163162_10116324 | Ga0163162_101163243 | 140 |
| 764 | 3300013307 | Ga0157372_10031748 | Ga0157372_100317484 | 140 |
| 765 | 3300013308 | Ga0157375_10000933 | Ga0157375_1000093311 | 140 |
| 766 | 3300013308 | Ga0157375_10041036 | Ga0157375_100410365 | 140 |
| 767 | 3300014325 | Ga0163163_10009027 | Ga0163163_100090274 | 140 |
| 768 | 3300014325 | Ga0163163_11171643 | Ga0163163_111716432 | 140 |
| 769 | 3300014326 | Ga0157380_10000821 | Ga0157380_100008215 | 140 |
| 770 | 3300014745 | Ga0157377_10002329 | Ga0157377_100023297 | 140 |
| 771 | 3300014745 | Ga0157377_10371856 | Ga0157377_103718562 | 140 |
| 772 | 3300014968 | Ga0157379_10000679 | Ga0157379_1000067923 | 140 |
| 773 | 3300014968 | Ga0157379_10056130 | Ga0157379_100561301 | 140 |
| 774 | 3300014969 | Ga0157376_10000527 | Ga0157376_1000052711 | 140 |
| 775 | 3300017792 | Ga0163161_10000770 | Ga0163161_100007709 | 140 |
| 776 | 3300025271 | Ga0207666_1000026 | Ga0207666_10000268 | 140 |
| 777 | 3300025271 | Ga0207666_1003755 | Ga0207666_10037551 | 140 |
| 778 | 3300025290 | Ga0207673_1001793 | Ga0207673_10017933 | 140 |
| 779 | 3300025315 | Ga0207697_10000245 | Ga0207697_1000024521 | 140 |
| 780 | 3300025315 | Ga0207697_10042301 | Ga0207697_100423012 | 140 |
| 781 | 3300025728 | Ga0207655_1107185 | Ga0207655_11071852 | 140 |
| 782 | 3300025885 | Ga0207653_10013162 | Ga0207653_100131622 | 140 |
| 783 | 3300025893 | Ga0207682_10000029 | Ga0207682_1000002940 | 140 |
| 784 | 3300025899 | Ga0207642_10001640 | Ga0207642_100016403 | 140 |
| 785 | 3300025900 | Ga0207710_10127543 | Ga0207710_101275432 | 140 |
| 786 | 3300025901 | Ga0207688_10000084 | Ga0207688_100000848 | 140 |
| 787 | 3300025901 | Ga0207688_10065550 | Ga0207688_100655501 | 140 |
| 788 | 3300025903 | Ga0207680_10001429 | Ga0207680_100014297 | 140 |
| 789 | 3300025903 | Ga0207680_10622693 | Ga0207680_106226931 | 140 |
| 790 | 3300025904 | Ga0207647_10001299 | Ga0207647_100012991 | 140 |
| 791 | 3300025904 | Ga0207647_10018094 | Ga0207647_100180945 | 140 |
| 792 | 3300025907 | Ga0207645_10000090 | Ga0207645_1000009055 | 140 |
| 793 | 3300025908 | Ga0207643_10000044 | Ga0207643_1000004433 | 140 |
| 794 | 3300025911 | Ga0207654_10000143 | Ga0207654_100001439 | 140 |
| 795 | 3300025912 | Ga0207707_10000580 | Ga0207707_1000058016 | 140 |
| 796 | 3300025912 | Ga0207707_10107069 | Ga0207707_101070693 | 140 |
| 797 | 3300025913 | Ga0207695_10065947 | Ga0207695_100659473 | 140 |
| 798 | 3300025914 | Ga0207671_10014374 | Ga0207671_100143744 | 140 |
| 799 | 3300025917 | Ga0207660_10000653 | Ga0207660_1000065312 | 140 |
| 800 | 3300025917 | Ga0207660_10192390 | Ga0207660_101923902 | 140 |
| 801 | 3300025918 | Ga0207662_10000104 | Ga0207662_1000010436 | 140 |
| 802 | 3300025918 | Ga0207662_10012668 | Ga0207662_100126683 | 140 |
| 803 | 3300025919 | Ga0207657_10011813 | Ga0207657_100118138 | 140 |
| 804 | 3300025919 | Ga0207657_10048554 | Ga0207657_100485543 | 140 |
| 805 | 3300025920 | Ga0207649_10000057 | Ga0207649_100000577 | 140 |
| 806 | 3300025921 | Ga0207652_10001436 | Ga0207652_1000143612 | 140 |
| 807 | 3300025921 | Ga0207652_10204797 | Ga0207652_102047971 | 140 |
| 808 | 3300025922 | Ga0207646_10201309 | Ga0207646_102013093 | 140 |
| 809 | 3300025923 | Ga0207681_10000154 | Ga0207681_1000015428 | 140 |
| 810 | 3300025923 | Ga0207681_10085889 | Ga0207681_100858893 | 140 |
| 811 | 3300025924 | Ga0207694_10137941 | Ga0207694_101379413 | 140 |
| 812 | 3300025925 | Ga0207650_10001069 | Ga0207650_1000106921 | 140 |
| 813 | 3300025925 | Ga0207650_10121055 | Ga0207650_101210553 | 140 |
| 814 | 3300025926 | Ga0207659_10000028 | Ga0207659_10000028127 | 140 |
| 815 | 3300025927 | Ga0207687_10000249 | Ga0207687_1000024926 | 140 |
| 816 | 3300025931 | Ga0207644_10002109 | Ga0207644_100021097 | 140 |
| 817 | 3300025931 | Ga0207644_10149049 | Ga0207644_101490492 | 140 |
| 818 | 3300025932 | Ga0207690_10000225 | Ga0207690_100002255 | 140 |
| 819 | 3300025932 | Ga0207690_10094151 | Ga0207690_100941513 | 140 |
| 820 | 3300025932 | Ga0207690_10421438 | Ga0207690_104214381 | 140 |
| 821 | 3300025933 | Ga0207706_10001675 | Ga0207706_100016758 | 140 |
| 822 | 3300025933 | Ga0207706_10259347 | Ga0207706_102593473 | 140 |
| 823 | 3300025934 | Ga0207686_10001701 | Ga0207686_1000170112 | 140 |
| 824 | 3300025935 | Ga0207709_10000291 | Ga0207709_100002914 | 140 |
| 825 | 3300025935 | Ga0207709_10218038 | Ga0207709_102180381 | 140 |
| 826 | 3300025936 | Ga0207670_10000463 | Ga0207670_100004639 | 140 |
| 827 | 3300025936 | Ga0207670_10007249 | Ga0207670_100072493 | 140 |
| 828 | 3300025936 | Ga0207670_10103898 | Ga0207670_101038983 | 140 |
| 829 | 3300025937 | Ga0207669_10000019 | Ga0207669_1000001972 | 140 |
| 830 | 3300025937 | Ga0207669_10615491 | Ga0207669_106154911 | 140 |
| 831 | 3300025938 | Ga0207704_10000230 | Ga0207704_100002307 | 140 |
| 832 | 3300025938 | Ga0207704_10022698 | Ga0207704_100226983 | 140 |
| 833 | 3300025940 | Ga0207691_10000882 | Ga0207691_1000088221 | 140 |
| 834 | 3300025940 | Ga0207691_10291881 | Ga0207691_102918812 | 140 |
| 835 | 3300025941 | Ga0207711_10001381 | Ga0207711_100013814 | 140 |
| 836 | 3300025941 | Ga0207711_10040118 | Ga0207711_100401184 | 140 |
| 837 | 3300025942 | Ga0207689_10000228 | Ga0207689_1000022822 | 140 |
| 838 | 3300025942 | Ga0207689_10115647 | Ga0207689_101156472 | 140 |
| 839 | 3300025944 | Ga0207661_10000107 | Ga0207661_1000010741 | 140 |
| 840 | 3300025944 | Ga0207661_10503205 | Ga0207661_105032052 | 140 |
| 841 | 3300025945 | Ga0207679_10000026 | Ga0207679_1000002675 | 140 |
| 842 | 3300025945 | Ga0207679_10124099 | Ga0207679_101240993 | 140 |
| 843 | 3300025949 | Ga0207667_10007642 | Ga0207667_100076423 | 140 |
| 844 | 3300025960 | Ga0207651_10000069 | Ga0207651_1000006927 | 140 |
| 845 | 3300025960 | Ga0207651_10349307 | Ga0207651_103493072 | 140 |
| 846 | 3300025961 | Ga0207712_10000242 | Ga0207712_100002429 | 140 |
| 847 | 3300025961 | Ga0207712_10067736 | Ga0207712_100677362 | 140 |
| 848 | 3300025972 | Ga0207668_10000049 | Ga0207668_1000004947 | 140 |
| 849 | 3300025981 | Ga0207640_10000301 | Ga0207640_100003017 | 140 |
| 850 | 3300025986 | Ga0207658_10033574 | Ga0207658_100335743 | 140 |
| 851 | 3300025986 | Ga0207658_10728510 | Ga0207658_107285102 | 140 |
| 852 | 3300026023 | Ga0207677_10033906 | Ga0207677_100339063 | 140 |
| 853 | 3300026023 | Ga0207677_10863146 | Ga0207677_108631461 | 140 |
| 854 | 3300026035 | Ga0207703_10002075 | Ga0207703_100020759 | 140 |
| 855 | 3300026035 | Ga0207703_10128659 | Ga0207703_101286593 | 140 |
| 856 | 3300026041 | Ga0207639_10000413 | Ga0207639_1000041321 | 140 |
| 857 | 3300026041 | Ga0207639_10631383 | Ga0207639_106313832 | 140 |
| 858 | 3300026067 | Ga0207678_10000920 | Ga0207678_1000092021 | 140 |
| 859 | 3300026067 | Ga0207678_10419719 | Ga0207678_104197192 | 140 |
| 860 | 3300026075 | Ga0207708_10002680 | Ga0207708_100026805 | 140 |
| 861 | 3300026075 | Ga0207708_10002682 | Ga0207708_100026828 | 140 |
| 862 | 3300026078 | Ga0207702_10002075 | Ga0207702_1000207510 | 140 |
| 863 | 3300026088 | Ga0207641_10000542 | Ga0207641_1000054234 | 140 |
| 864 | 3300026089 | Ga0207648_10002093 | Ga0207648_100020939 | 140 |
| 865 | 3300026089 | Ga0207648_10051099 | Ga0207648_100510993 | 140 |
| 866 | 3300026095 | Ga0207676_10000511 | Ga0207676_1000051114 | 140 |
| 867 | 3300026095 | Ga0207676_11263867 | Ga0207676_112638672 | 140 |
| 868 | 3300026116 | Ga0207674_10000882 | Ga0207674_1000088229 | 140 |
| 869 | 3300026118 | Ga0207675_100001599 | Ga0207675_1000015998 | 140 |
| 870 | 3300026118 | Ga0207675_100032967 | Ga0207675_1000329674 | 140 |
| 871 | 3300026121 | Ga0207683_10000653 | Ga0207683_1000065311 | 140 |
| 872 | 3300026142 | Ga0207698_10003176 | Ga0207698_100031765 | 140 |
| 873 | 3300026142 | Ga0207698_10756239 | Ga0207698_107562392 | 140 |
| 874 | 3300027364 | Ga0209967_1001141 | Ga0209967_10011413 | 140 |
| 875 | 3300027543 | Ga0209999_1003610 | Ga0209999_10036103 | 140 |
| 876 | 3300027617 | Ga0210002_1000267 | Ga0210002_10002672 | 140 |
| 877 | 3300027665 | Ga0209983_1013876 | Ga0209983_10138762 | 140 |
| 878 | 3300027682 | Ga0209971_1011327 | Ga0209971_10113273 | 140 |
| 879 | 3300027717 | Ga0209998_10000855 | Ga0209998_100008555 | 140 |
| 880 | 3300027717 | Ga0209998_10000913 | Ga0209998_100009134 | 140 |
| 881 | 3300027876 | Ga0209974_10001240 | Ga0209974_100012405 | 140 |
| 882 | 3300027876 | Ga0209974_10099596 | Ga0209974_100995962 | 140 |
| 883 | 3300027907 | Ga0207428_10000130 | Ga0207428_1000013076 | 140 |
| 884 | 3300027907 | Ga0207428_10000286 | Ga0207428_1000028662 | 140 |
| 885 | 3300028380 | Ga0268265_10000410 | Ga0268265_100004107 | 140 |
| 886 | 3300028380 | Ga0268265_11167409 | Ga0268265_111674092 | 140 |
| 887 | 3300028381 | Ga0268264_10001172 | Ga0268264_1000117215 | 140 |
| 888 | 3300028381 | Ga0268264_10407382 | Ga0268264_104073821 | 140 |
| 889 | 3300028381 | Ga0268264_11702657 | Ga0268264_117026571 | 140 |
| 890 | 3300034816 | Ga0373930_0001406 | Ga0373930_0001406_2197_2619 | 140 |
| 891 | 3300034816 | Ga0373930_0018703 | Ga0373930_0018703_79_501 | 140 |
| 892 | 3300034817 | Ga0373948_0000715 | Ga0373948_0000715_2354_2776 | 140 |
| 893 | 3300034817 | Ga0373948_0020424 | Ga0373948_0020424_599_1021 | 140 |
| 894 | 3300034818 | Ga0373950_0006419 | Ga0373950_0006419_470_892 | 140 |
| 895 | 3300034818 | Ga0373950_0008531 | Ga0373950_0008531_167_589 | 140 |
| 896 | 3300034819 | Ga0373958_0000160 | Ga0373958_0000160_1581_2003 | 140 |
| 897 | 3300034819 | Ga0373958_0000523 | Ga0373958_0000523_24_446 | 140 |
| 898 | 3300034820 | Ga0373959_0000166 | Ga0373959_0000166_147_569 | 140 |
| 899 | 3300034957 | Ga0373938_0000260 | Ga0373938_0000260_5514_5936 | 140 |
| 900 | 3300034957 | Ga0373938_0001185 | Ga0373938_0001185_3730_4152 | 140 |
| 901 | 3300035084 | Ga0373928_0000257 | Ga0373928_0000257_9034_9456 | 140 |
| 902 | 3300035085 | Ga0373929_0000497 | Ga0373929_0000497_1573_1995 | 140 |
| 903 | 3300035085 | Ga0373929_0001725 | Ga0373929_0001725_2535_2957 | 140 |
| 904 | 3300035088 | Ga0373940_0002922 | Ga0373940_0002922_1829_2251 | 140 |
| 905 | 3300035090 | Ga0373949_0000547 | Ga0373949_0000547_6240_6662 | 140 |
| 906 | 3300035090 | Ga0373949_0009005 | Ga0373949_0009005_522_944 | 140 |
| 907 | 3300035091 | Ga0373951_0001164 | Ga0373951_0001164_197_619 | 140 |
| 908 | 3300035091 | Ga0373951_0002297 | Ga0373951_0002297_2472_2894 | 140 |
| 909 | 3300035092 | Ga0373952_0000266 | Ga0373952_0000266_8031_8453 | 140 |
| 910 | 3300035092 | Ga0373952_0008171 | Ga0373952_0008171_1512_1934 | 140 |
| 911 | 3300035112 | Ga0373932_0000908 | Ga0373932_0000908_1414_1836 | 140 |
| 912 | 3300035112 | Ga0373932_0002722 | Ga0373932_0002722_2354_2776 | 140 |
| 913 | 3300035114 | Ga0373939_0000911 | Ga0373939_0000911_6801_7223 | 140 |
| 914 | 3300035114 | Ga0373939_0019090 | Ga0373939_0019090_901_1323 | 140 |
| 915 | 3300035115 | Ga0373941_0000037 | Ga0373941_0000037_5196_5618 | 140 |
| 916 | 3300035115 | Ga0373941_0008858 | Ga0373941_0008858_1770_2192 | 140 |
| 917 | 3300035121 | Ga0373960_0000805 | Ga0373960_0000805_3797_4219 | 140 |
| 918 | 3300035121 | Ga0373960_0001073 | Ga0373960_0001073_380_802 | 140 |
| 919 | 3300035207 | Ga0373942_0000388 | Ga0373942_0000388_3449_3871 | 140 |
| 920 | 3300035207 | Ga0373942_0003774 | Ga0373942_0003774_1757_2179 | 140 |
| 921 | 3300035241 | Ga0373961_0000658 | Ga0373961_0000658_9471_9893 | 140 |
| 922 | 3300035241 | Ga0373961_0001498 | Ga0373961_0001498_1253_1675 | 140 |
| 923 | 3300035242 | Ga0373962_0001121 | Ga0373962_0001121_4581_5003 | 140 |
| 924 | 3300035691 | Ga0373931_0001169 | Ga0373931_0001169_6475_6897 | 140 |
| 925 | 3300035691 | Ga0373931_0167922 | Ga0373931_0167922_424_846 | 140 |
| 926 | 3300042016 | Ga0439463_030103 | Ga0439463_030103_14_436 | 140 |
| 927 | 3300042016 | Ga0439463_107981 | Ga0439463_107981_203_625 | 140 |
| 928 | 3300042438 | Ga0439459_0015768 | Ga0439459_0015768_329_751 | 140 |
| 929 | 3300042876 | Ga0451577_0242465 | Ga0451577_0242465_239_661 | 140 |
| 930 | 3300042993 | Ga0439440_0102552 | Ga0439440_0102552_280_702 | 140 |
| 931 | 3300044712 | Ga0453684_0111442 | Ga0453684_0111442_964_1386 | 140 |
| 932 | 3300046684 | Ga0495669_0018964 | Ga0495669_0018964_553_975 | 140 |
| 933 | 3300047445 | Ga0495677_0186257 | Ga0495677_0186257_229_651 | 140 |
| 934 | 3300048903 | Ga0496100_0001568 | Ga0496100_0001568_2023_2445 | 140 |
| 935 | 3300048904 | Ga0496101_0000171 | Ga0496101_0000171_51221_51643 | 140 |
| 936 | 3300048905 | Ga0496102_0004724 | Ga0496102_0004724_2953_3375 | 140 |
| 937 | 3300048905 | Ga0496102_1034882 | Ga0496102_1034882_24_446 | 140 |
| 938 | 3300048906 | Ga0496103_0005627 | Ga0496103_0005627_4115_4537 | 140 |
| 939 | 3300048906 | Ga0496103_0092519 | Ga0496103_0092519_1435_1857 | 140 |
| 940 | 3300048907 | Ga0496104_0097739 | Ga0496104_0097739_910_1332 | 140 |
| 941 | 3300048908 | Ga0496105_0193514 | Ga0496105_0193514_903_1325 | 140 |
| 942 | 3300048909 | Ga0496106_0002116 | Ga0496106_0002116_5193_5615 | 140 |
| 943 | 3300048909 | Ga0496106_0096792 | Ga0496106_0096792_950_1372 | 140 |
| 944 | 3300048910 | Ga0496107_0005829 | Ga0496107_0005829_2103_2525 | 140 |
| 945 | 3300048910 | Ga0496107_0009248 | Ga0496107_0009248_3081_3503 | 140 |
| 946 | 3300048910 | Ga0496107_0036330 | Ga0496107_0036330_50_472 | 140 |
| 947 | 3300048911 | Ga0496108_0003417 | Ga0496108_0003417_3105_3527 | 140 |
| 948 | 3300048911 | Ga0496108_0047350 | Ga0496108_0047350_2122_2544 | 140 |
| 949 | 3300048911 | Ga0496108_0412346 | Ga0496108_0412346_276_698 | 140 |
| 950 | 3300048912 | Ga0496109_0000606 | Ga0496109_0000606_15843_16265 | 140 |
| 951 | 3300048912 | Ga0496109_0000714 | Ga0496109_0000714_16403_16825 | 140 |
| 952 | 3300048913 | Ga0496110_0011093 | Ga0496110_0011093_521_943 | 140 |
| 953 | 3300048913 | Ga0496110_0012732 | Ga0496110_0012732_5584_6006 | 140 |
| 954 | 3300048913 | Ga0496110_0080773 | Ga0496110_0080773_183_605 | 140 |
| 955 | 3300048914 | Ga0496111_0004865 | Ga0496111_0004865_513_935 | 140 |
| 956 | 3300048914 | Ga0496111_0224737 | Ga0496111_0224737_747_1169 | 140 |
| 957 | 3300048915 | Ga0496112_0035091 | Ga0496112_0035091_3799_4221 | 140 |
| 958 | 3300048915 | Ga0496112_0080920 | Ga0496112_0080920_1899_2321 | 140 |
| 959 | 3300048916 | Ga0496113_0000399 | Ga0496113_0000399_11943_12365 | 140 |
| 960 | 3300048916 | Ga0496113_0086954 | Ga0496113_0086954_1528_1950 | 140 |
| 961 | 3300048916 | Ga0496113_0131369 | Ga0496113_0131369_750_1172 | 140 |
| 962 | 3300048917 | Ga0496114_0008317 | Ga0496114_0008317_13_435 | 140 |
| 963 | 3300048918 | Ga0496115_0001189 | Ga0496115_0001189_11241_11663 | 140 |
| 964 | 3300049592 | Ga0501076_0366191 | Ga0501076_0366191_13_435 | 140 |
| 965 | 3300050494 | nmdc:mga06z11_16741_c1 | nmdc:mga06z11_16741_c1_875_1297 | 140 |
| 966 | 3300050511 | nmdc:mga08y16_1898_c1 | nmdc:mga08y16_1898_c1_3314_3736 | 140 |
| 967 | 3300050511 | nmdc:mga08y16_2825_c1 | nmdc:mga08y16_2825_c1_3448_3870 | 140 |
| 968 | 3300050512 | nmdc:mga0n895_1061_c1 | nmdc:mga0n895_1061_c1_13242_13664 | 140 |
| 969 | 3300050512 | nmdc:mga0n895_490130_c1 | nmdc:mga0n895_490130_c1_730_1152 | 140 |
| 970 | 3300050512 | nmdc:mga0n895_532164_c1 | nmdc:mga0n895_532164_c1_588_1010 | 140 |
| 971 | 3300050513 | nmdc:mga0rr50_573073_c1 | nmdc:mga0rr50_573073_c1_358_780 | 140 |
| 972 | 3300050513 | nmdc:mga0rr50_6009_c1 | nmdc:mga0rr50_6009_c1_3965_4387 | 140 |
| 973 | 3300050514 | nmdc:mga08x19_255602_c1 | nmdc:mga08x19_255602_c1_513_935 | 140 |
| 974 | 3300050515 | nmdc:mga0a205_217928_c1 | nmdc:mga0a205_217928_c1_967_1389 | 140 |
| 975 | 3300050515 | nmdc:mga0a205_560372_c1 | nmdc:mga0a205_560372_c1_411_833 | 140 |
| 976 | 3300050515 | nmdc:mga0a205_64986_c1 | nmdc:mga0a205_64986_c1_2295_2717 | 140 |
| 977 | 3300054114 | Ga0501084_0107909 | Ga0501084_0107909_558_980 | 140 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1zce-assembly1.cif.gz_A | x-ray crystal structure of protein atu2648 from agrobacterium tumefaciens. northeast structural genomics consortium target atr33. | 0.9467 | 1 | 138 |
| 2gbs-assembly1.cif.gz_A | nmr structure of rpa0253 from rhodopseudomonas palustris. northeast structural genomics consortium target rpr3 | 0.9309 | 1 | 137 |
| 1zce-assembly1.cif.gz_A | x-ray crystal structure of protein atu2648 from agrobacterium tumefaciens. northeast structural genomics consortium target atr33. | 0.9273 | 1 | 138 |
| 2gbs-assembly1.cif.gz_A | nmr structure of rpa0253 from rhodopseudomonas palustris. northeast structural genomics consortium target rpr3 | 0.8994 | 1 | 137 |
| 2eve-assembly1.cif.gz_A | x-ray crystal structure of protein pspto5229 from pseudomonas syringae. northeast structural genomics consortium target psr62 | 0.8979 | 2 | 136 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1zceA00 | Alpha Beta;Roll;ph1033 like fold;ph1033 like domains | 0.9248 | 1 | 138 | 3.10.590.10 |
| af_O94645_8_177_3.10.590.10 | Alpha Beta;Roll;ph1033 like fold;ph1033 like domains | 0.893 | 1 | 140 | 3.10.590.10 |
| af_A4ICC8_1_164_3.10.590.10 | Alpha Beta;Roll;ph1033 like fold;ph1033 like domains | 0.8898 | 1 | 136 | 3.10.590.10 |
| af_O94645_8_177_3.10.590.10 | Alpha Beta;Roll;ph1033 like fold;ph1033 like domains | 0.8869 | 1 | 140 | 3.10.590.10 |
| af_Q9ZVK5_4_152_3.10.590.10 | Alpha Beta;Roll;ph1033 like fold;ph1033 like domains | 0.8783 | 2 | 138 | 3.10.590.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V5ZYM0-F1-model_v4 | EVE domain-containing protein | 0.9918 | 91 | 136 |
|
| AF-A0A4Q5RA21-F1-model_v4 | EVE domain-containing protein | 0.9872 | 68 | 137 |
|
| AF-A0A4Q5ZQM4-F1-model_v4 | deleted | 0.9723 | 31 | 139 |
|
| AF-A0A382GXA6-F1-model_v4 | EVE domain-containing protein | 0.9704 | 43 | 138 |
GO:0005634
|
| AF-A0A3D2RC19-F1-model_v4 | deleted | 0.9696 | 33 | 136 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar