F487277

General Info

Members Datasets Scaffolds Average Seq Length
977 407 977 139

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10003937|Ga0111539_1000393719
Length 146
Sequence MGLFMDCYHPCMAQWLVKEEPEHYNYAQLEKDKKTVWAGVRNPLAQKHLRGIKRGDRIFYYHTGKEKAVVATAKAASDAYADPNDTSGKLSVVDIVPDKKLTRPVTLAEIKGDKAFASFPLVRMSRLSVMPVTDAEWARIEKLSQS

Samples

Sample ID Description Type Environment
1 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
5 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
6 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
18 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
19 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
54 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
55 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
56 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
57 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
58 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
59 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
67 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
68 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
69 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
70 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
71 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
75 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
76 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
77 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
89 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
90 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
91 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
92 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
93 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
94 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
95 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
96 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
97 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
98 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
99 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
100 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
101 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
102 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
103 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
108 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
109 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
110 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
111 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
116 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
117 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
118 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
119 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
120 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
122 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
123 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
126 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
127 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
128 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
129 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
130 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
131 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
132 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
133 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
134 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
135 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
136 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
137 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
138 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
139 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
140 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
141 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
142 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
143 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
144 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
145 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
146 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
147 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
148 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
149 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
150 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
151 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
152 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
156 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
232 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
236 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
237 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
238 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
239 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
240 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
241 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
242 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
243 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
244 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
245 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
246 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
247 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
248 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
249 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
250 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
251 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
252 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
253 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
254 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
255 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
256 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
257 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
258 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
259 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
260 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
261 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
262 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
263 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
264 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
265 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
266 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
267 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
268 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
269 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
270 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
271 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
272 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
273 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
274 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
275 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
276 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
277 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
278 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
279 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
280 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
281 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
282 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
283 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
284 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
285 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
286 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
287 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
288 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
289 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
290 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
291 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
292 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
293 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
294 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
295 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
296 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
297 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
298 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
299 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
300 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
301 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
302 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
303 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
304 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
305 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
306 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
307 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
308 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
309 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
310 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
311 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
312 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
313 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
314 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
315 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
316 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
317 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
318 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
319 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
320 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
321 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
322 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
323 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
324 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
325 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
326 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
327 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
328 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
329 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
330 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
331 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
332 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
333 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
334 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
335 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
336 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
337 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
338 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
339 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
340 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
341 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
342 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
343 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
344 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
345 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
346 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
347 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
348 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
349 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
350 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
351 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
352 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
353 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
354 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
355 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
356 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
357 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
358 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
359 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
360 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
361 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
362 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
363 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
364 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
365 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
366 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
367 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
368 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
376 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
377 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
378 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
379 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
380 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
381 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
382 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
383 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
384 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
386 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
387 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
388 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
389 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
390 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
391 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
392 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
393 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
394 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
395 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
396 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
397 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
398 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
399 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
400 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
401 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
402 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
403 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
404 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
405 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
406 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
407 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.51
Nodule 0
Rhizoplane 6.35
Rhizosphere 93.14
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARSoilYngRDRAFT_c00080 3300000042 Bacteria 16083
2 ARcpr5yngRDRAFT_c000055 3300000043 Bacteria 18216
3 ARSoilOldRDRAFT_c000003 3300000044 Bacteria 63923
4 ARCol0oldRDRAFT_c00230 3300000045 Bacteria 5194
5 ARCol0yngRDRAFT_1000007 3300000652 Bacteria 46089
6 JGI24746J21847_1002009 3300001977 Bacteria 3246
7 JGI24739J22299_10000900 3300001989 Bacteria 10989
8 JGI24737J22298_10000509 3300001990 Bacteria 13587
9 JGI24737J22298_10023381 3300001990 Bacteria 1961
10 JGI24745J21846_1000354 3300002073 Bacteria 3977
11 JGI24748J21848_1001508 3300002074 Bacteria 2576
12 JGI24738J21930_10000120 3300002075 Bacteria 18716
13 JGI24749J21850_1003005 3300002076 Bacteria 2355
14 JGI24744J21845_10004657 3300002077 Bacteria 2836
15 JGI24035J26624_1000291 3300002126 Bacteria 4658
16 JGI24034J26672_10000187 3300002239 Bacteria 8364
17 JGI24742J22300_10000029 3300002244 Bacteria 23366
18 JGI24751J29686_10046468 3300002459 Bacteria 897
19 JGI26129J50193_1005105 3300003349 Bacteria 936
20 Ga0065717_1002770 3300005276 Bacteria 1633
21 Ga0065712_10000690 3300005290 Bacteria 10070
22 Ga0065712_10001626 3300005290 Bacteria 6725
23 Ga0065712_10091644 3300005290 Bacteria 2364
24 Ga0065712_10290937 3300005290 Unclassified 877
25 Ga0065712_10391798 3300005290 Unclassified 741
26 Ga0065715_10001262 3300005293 Bacteria 15576
27 Ga0065715_10147791 3300005293 Bacteria 1759
28 Ga0065707_10165705 3300005295 Bacteria 1524
29 Ga0070658_10348025 3300005327 Bacteria 1268
30 Ga0070676_10003502 3300005328 Bacteria 8194
31 Ga0070676_11216047 3300005328 Bacteria 573
32 Ga0070683_100000116 3300005329 Bacteria 51956
33 Ga0070683_100761316 3300005329 Bacteria 928
34 Ga0070690_100011260 3300005330 Bacteria 5228
35 Ga0070690_100014607 3300005330 Bacteria 4660
36 Ga0070690_100066294 3300005330 Bacteria 2337
37 Ga0070670_100006964 3300005331 Bacteria 9582
38 Ga0070670_100016479 3300005331 Bacteria 6345
39 Ga0070670_100036231 3300005331 Bacteria 4246
40 Ga0070677_10000097 3300005333 Bacteria 28703
41 Ga0068869_100040493 3300005334 Bacteria 3332
42 Ga0068869_100064378 3300005334 Bacteria 2697
43 Ga0068869_100349504 3300005334 Unclassified 1205
44 Ga0070666_10003937 3300005335 Bacteria 9018
45 Ga0070666_10004448 3300005335 Bacteria 8536
46 Ga0070666_10035676 3300005335 Bacteria 3298
47 Ga0070666_10418473 3300005335 Bacteria 965
48 Ga0070680_100001035 3300005336 Bacteria 19930
49 Ga0070680_100533561 3300005336 Bacteria 1005
50 Ga0070682_100001635 3300005337 Bacteria 12449
51 Ga0070682_100142101 3300005337 Bacteria 1637
52 Ga0070682_100611362 3300005337 Bacteria 862
53 Ga0068868_100006142 3300005338 Bacteria 8488
54 Ga0068868_100060353 3300005338 Bacteria 3002
55 Ga0068868_100139984 3300005338 Bacteria 1985
56 Ga0068868_100464314 3300005338 Unclassified 1103
57 Ga0070660_100034100 3300005339 Bacteria 3844
58 Ga0070689_100016656 3300005340 Bacteria 5380
59 Ga0070689_100099054 3300005340 Bacteria 2306
60 Ga0070689_100424265 3300005340 Unclassified 1128
61 Ga0070691_10000048 3300005341 Bacteria 33217
62 Ga0070687_100017362 3300005343 Bacteria 3306
63 Ga0070687_100026514 3300005343 Bacteria 2791
64 Ga0070687_100059797 3300005343 Unclassified 2008
65 Ga0070687_100140458 3300005343 Bacteria 1406
66 Ga0070661_100000228 3300005344 Bacteria 46622
67 Ga0070661_100080981 3300005344 Bacteria 2397
68 Ga0070661_100676567 3300005344 Bacteria 839
69 Ga0070661_101077346 3300005344 Bacteria 669
70 Ga0070692_10000050 3300005345 Bacteria 22340
71 Ga0070668_100010524 3300005347 Bacteria 6877
72 Ga0070668_100125603 3300005347 Bacteria 2055
73 Ga0070668_100214715 3300005347 Bacteria 1584
74 Ga0070669_100031291 3300005353 Bacteria 3844
75 Ga0070669_100656365 3300005353 Unclassified 883
76 Ga0070669_100859548 3300005353 Unclassified 773
77 Ga0070675_100000503 3300005354 Bacteria 26846
78 Ga0070675_100072348 3300005354 Unclassified 2862
79 Ga0070675_100072645 3300005354 Unclassified 2856
80 Ga0070675_100075557 3300005354 Bacteria 2801
81 Ga0070675_100327695 3300005354 Unclassified 1354
82 Ga0070675_101153212 3300005354 Unclassified 713
83 Ga0070671_100000720 3300005355 Bacteria 23686
84 Ga0070671_100078879 3300005355 Bacteria 2752
85 Ga0070671_100088410 3300005355 Bacteria 2593
86 Ga0070674_100000570 3300005356 Bacteria 18571
87 Ga0070674_100223669 3300005356 Bacteria 1465
88 Ga0070673_100000045 3300005364 Bacteria 50756
89 Ga0070673_100153938 3300005364 Bacteria 1949
90 Ga0070673_100531525 3300005364 Bacteria 1067
91 Ga0070673_101070688 3300005364 Unclassified 752
92 Ga0070688_100000308 3300005365 Bacteria 24884
93 Ga0070688_100038140 3300005365 Unclassified 2932
94 Ga0070688_100069017 3300005365 Bacteria 2256
95 Ga0070688_100099040 3300005365 Bacteria 1919
96 Ga0070688_100895772 3300005365 Unclassified 699
97 Ga0070659_100000183 3300005366 Bacteria 47789
98 Ga0070659_100115869 3300005366 Unclassified 2166
99 Ga0070659_100123226 3300005366 Bacteria 2101
100 Ga0070667_100002774 3300005367 Bacteria 15139
101 Ga0070667_100003874 3300005367 Bacteria 12703
102 Ga0070667_100263573 3300005367 Bacteria 1544
103 Ga0070703_10005702 3300005406 Bacteria 3486
104 Ga0070703_10169907 3300005406 Bacteria 834
105 Ga0070709_10003045 3300005434 Bacteria 8994
106 Ga0070714_100006355 3300005435 Bacteria 9113
107 Ga0070713_100043968 3300005436 Bacteria 3654
108 Ga0070710_10031314 3300005437 Bacteria 2870
109 Ga0070701_10106417 3300005438 Unclassified 1561
110 Ga0070701_10166036 3300005438 Bacteria 1282
111 Ga0070701_10326768 3300005438 Bacteria 951
112 Ga0070701_10352389 3300005438 Bacteria 920
113 Ga0070701_10647979 3300005438 Bacteria 705
114 Ga0070711_100035477 3300005439 Bacteria 3335
115 Ga0070705_100001770 3300005440 Bacteria 11188
116 Ga0070705_100079927 3300005440 Bacteria 2004
117 Ga0070705_100480256 3300005440 Bacteria 939
118 Ga0070705_100507414 3300005440 Bacteria 917
119 Ga0070705_100589355 3300005440 Unclassified 858
120 Ga0070705_101060205 3300005440 Bacteria 661
121 Ga0070700_100000239 3300005441 Bacteria 30133
122 Ga0070694_100003730 3300005444 Bacteria 9088
123 Ga0070694_100462166 3300005444 Unclassified 1004
124 Ga0070708_100030075 3300005445 Bacteria 4691
125 Ga0070708_100103463 3300005445 Unclassified 2610
126 Ga0070708_101952936 3300005445 Bacteria 544
127 Ga0070663_100000328 3300005455 Bacteria 24676
128 Ga0070678_100000576 3300005456 Bacteria 17985
129 Ga0070662_100011223 3300005457 Bacteria 5904
130 Ga0070662_100056064 3300005457 Bacteria 2860
131 Ga0070662_101230873 3300005457 Bacteria 644
132 Ga0070681_10078407 3300005458 Bacteria 3260
133 Ga0068867_100000160 3300005459 Bacteria 43656
134 Ga0068867_101045807 3300005459 Bacteria 743
135 Ga0068867_101055704 3300005459 Unclassified 739
136 Ga0070685_10003069 3300005466 Bacteria 8508
137 Ga0070685_10097202 3300005466 Bacteria 1792
138 Ga0070685_10365854 3300005466 Unclassified 990
139 Ga0070707_100889470 3300005468 Unclassified 855
140 Ga0070707_102066961 3300005468 Unclassified 537
141 Ga0070698_100980894 3300005471 Bacteria 792
142 Ga0070699_100050460 3300005518 Bacteria 3602
143 Ga0070699_100088539 3300005518 Bacteria 2704
144 Ga0070699_100197400 3300005518 Bacteria 1789
145 Ga0070679_100005744 3300005530 Bacteria 11509
146 Ga0070679_100454183 3300005530 Bacteria 1226
147 Ga0070684_100000352 3300005535 Bacteria 31642
148 Ga0070684_100344868 3300005535 Bacteria 1369
149 Ga0070684_100757528 3300005535 Bacteria 907
150 Ga0070684_101032443 3300005535 Bacteria 772
151 Ga0070697_100010084 3300005536 Bacteria 7370
152 Ga0070697_100463412 3300005536 Bacteria 1105
153 Ga0068853_100000902 3300005539 Bacteria 20677
154 Ga0070672_100000016 3300005543 Bacteria 71848
155 Ga0070672_100004109 3300005543 Bacteria 9503
156 Ga0070672_100545830 3300005543 Bacteria 1006
157 Ga0070672_101071143 3300005543 Unclassified 716
158 Ga0070686_100006337 3300005544 Bacteria 6567
159 Ga0070686_100006599 3300005544 Bacteria 6460
160 Ga0070686_100008864 3300005544 Bacteria 5636
161 Ga0070686_100107709 3300005544 Unclassified 1893
162 Ga0070695_100001458 3300005545 Bacteria 13124
163 Ga0070695_100004098 3300005545 Bacteria 8517
164 Ga0070695_100169607 3300005545 Bacteria 1539
165 Ga0070696_100006179 3300005546 Bacteria 8004
166 Ga0070696_100019661 3300005546 Bacteria 4575
167 Ga0070696_100073296 3300005546 Bacteria 2412
168 Ga0070693_100002786 3300005547 Bacteria 8047
169 Ga0070693_100100354 3300005547 Bacteria 1762
170 Ga0070693_100484770 3300005547 Bacteria 874
171 Ga0070665_100095421 3300005548 Bacteria 2979
172 Ga0070704_100014046 3300005549 Bacteria 4991
173 Ga0070704_100026483 3300005549 Bacteria 3832
174 Ga0068855_100003504 3300005563 Bacteria 19223
175 Ga0070664_100000067 3300005564 Bacteria 65201
176 Ga0070664_100025650 3300005564 Unclassified 4888
177 Ga0070664_100050415 3300005564 Bacteria 3522
178 Ga0070664_100384557 3300005564 Bacteria 1281
179 Ga0070664_100535698 3300005564 Unclassified 1082
180 Ga0068857_100003331 3300005577 Bacteria 13366
181 Ga0068857_100074904 3300005577 Bacteria 3017
182 Ga0068854_100000131 3300005578 Bacteria 51521
183 Ga0068854_100832197 3300005578 Unclassified 807
184 Ga0068854_101029679 3300005578 Bacteria 730
185 Ga0068854_101423473 3300005578 Bacteria 627
186 Ga0068856_100002341 3300005614 Bacteria 19506
187 Ga0068856_100233439 3300005614 Bacteria 1855
188 Ga0070702_100001107 3300005615 Bacteria 10796
189 Ga0070702_100473936 3300005615 Bacteria 913
190 Ga0068852_101417415 3300005616 Unclassified 717
191 Ga0068859_100003592 3300005617 Bacteria 15805
192 Ga0068859_100070855 3300005617 Unclassified 3521
193 Ga0068859_100181871 3300005617 Bacteria 2185
194 Ga0068859_100245070 3300005617 Bacteria 1882
195 Ga0068859_100559707 3300005617 Unclassified 1238
196 Ga0068859_100563060 3300005617 Bacteria 1234
197 Ga0068859_101475925 3300005617 Unclassified 750
198 Ga0068864_100000234 3300005618 Bacteria 49663
199 Ga0068864_100059635 3300005618 Bacteria 3302
200 Ga0068864_100096129 3300005618 Bacteria 2621
201 Ga0068864_100361972 3300005618 Unclassified 1371
202 Ga0068864_101243077 3300005618 Unclassified 744
203 Ga0068866_10000552 3300005718 Bacteria 17108
204 Ga0068866_10199047 3300005718 Bacteria 1196
205 Ga0068866_10245590 3300005718 Unclassified 1093
206 Ga0068861_100000241 3300005719 Bacteria 30096
207 Ga0068861_100242460 3300005719 Bacteria 1534
208 Ga0068861_101580011 3300005719 Bacteria 646
209 Ga0068861_102537982 3300005719 Unclassified 516
210 Ga0068870_10000009 3300005840 Bacteria 70353
211 Ga0068863_100003248 3300005841 Bacteria 16072
212 Ga0068858_100001548 3300005842 Bacteria 23613
213 Ga0068858_100056245 3300005842 Unclassified 3637
214 Ga0068858_100057653 3300005842 Bacteria 3590
215 Ga0068858_100060688 3300005842 Bacteria 3495
216 Ga0068858_100390241 3300005842 Bacteria 1337
217 Ga0068860_100001050 3300005843 Bacteria 30441
218 Ga0068860_100094121 3300005843 Bacteria 2856
219 Ga0068860_100381469 3300005843 Bacteria 1391
220 Ga0068860_100450495 3300005843 Bacteria 1280
221 Ga0068862_100001143 3300005844 Bacteria 25122
222 Ga0068862_100034581 3300005844 Bacteria 4277
223 Ga0068862_100746486 3300005844 Bacteria 952
224 Ga0068862_101550222 3300005844 Bacteria 669
225 Ga0081455_10605103 3300005937 Bacteria 714
226 Ga0081538_10064500 3300005981 Bacteria 2071
227 Ga0081539_10228045 3300005985 Bacteria 843
228 Ga0070717_10058028 3300006028 Bacteria 3200
229 Ga0070715_10028782 3300006163 Bacteria 2233
230 Ga0070716_100003613 3300006173 Bacteria 7309
231 Ga0070712_100151630 3300006175 Bacteria 1780
232 Ga0075367_10024435 3300006178 Bacteria 3408
233 Ga0097621_100000569 3300006237 Bacteria 25928
234 Ga0097621_100076553 3300006237 Bacteria 2776
235 Ga0097621_100118819 3300006237 Unclassified 2240
236 Ga0097621_100122171 3300006237 Bacteria 2210
237 Ga0097621_100416233 3300006237 Unclassified 1205
238 Ga0068871_100000012 3300006358 Bacteria 105267
239 Ga0068871_100004086 3300006358 Bacteria 10090
240 Ga0068871_100009359 3300006358 Bacteria 7094
241 Ga0068871_100058785 3300006358 Bacteria 3131
242 Ga0068871_100066546 3300006358 Archaea 2954
243 Ga0075428_100002901 3300006844 Bacteria 18656
244 Ga0075428_100005542 3300006844 Bacteria 14036
245 Ga0075428_100124605 3300006844 Bacteria 2804
246 Ga0075428_100433024 3300006844 Bacteria 1409
247 Ga0075428_101196402 3300006844 Unclassified 801
248 Ga0075428_101571604 3300006844 Bacteria 688
249 Ga0075430_100003290 3300006846 Bacteria 13548
250 Ga0075430_100019613 3300006846 Bacteria 5752
251 Ga0075430_100121353 3300006846 Bacteria 2179
252 Ga0075430_100168650 3300006846 Bacteria 1821
253 Ga0075430_100407113 3300006846 Archaea 1123
254 Ga0075431_100015548 3300006847 Bacteria 7712
255 Ga0075431_100027965 3300006847 Bacteria 5788
256 Ga0075431_100067173 3300006847 Unclassified 3701
257 Ga0075431_100130942 3300006847 Bacteria 2587
258 Ga0075433_10009693 3300006852 Bacteria 7712
259 Ga0075433_10013063 3300006852 Bacteria 6736
260 Ga0075433_10082863 3300006852 Bacteria 2830
261 Ga0075433_10088448 3300006852 Bacteria 2737
262 Ga0075433_10380461 3300006852 Unclassified 1246
263 Ga0075433_10426270 3300006852 Bacteria 1170
264 Ga0075433_10552178 3300006852 Bacteria 1013
265 Ga0075434_100001007 3300006871 Bacteria 22897
266 Ga0075434_100079657 3300006871 Bacteria 3272
267 Ga0075434_100098341 3300006871 Bacteria 2931
268 Ga0075434_100351532 3300006871 Unclassified 1495
269 Ga0075434_100434757 3300006871 Bacteria 1333
270 Ga0075434_100434827 3300006871 Bacteria 1333
271 Ga0075429_100002327 3300006880 Bacteria 15955
272 Ga0075429_100003277 3300006880 Bacteria 13798
273 Ga0075429_100539535 3300006880 Bacteria 1022
274 Ga0075429_100553821 3300006880 Unclassified 1008
275 Ga0068865_100000209 3300006881 Bacteria 32559
276 Ga0068865_101675208 3300006881 Unclassified 573
277 Ga0075436_100030775 3300006914 Bacteria 3694
278 Ga0075436_100354863 3300006914 Bacteria 1057
279 Ga0075436_100425788 3300006914 Unclassified 964
280 Ga0075436_100429462 3300006914 Unclassified 960
281 Ga0075436_100580529 3300006914 Bacteria 825
282 Ga0097620_100003592 3300006931 Bacteria 15805
283 Ga0097620_100070854 3300006931 Unclassified 3521
284 Ga0097620_100181878 3300006931 Bacteria 2185
285 Ga0097620_100245065 3300006931 Bacteria 1882
286 Ga0097620_100559720 3300006931 Unclassified 1238
287 Ga0097620_100563091 3300006931 Bacteria 1234
288 Ga0097620_101475720 3300006931 Unclassified 750
289 Ga0075435_100003730 3300007076 Bacteria 10380
290 Ga0075435_100007651 3300007076 Bacteria 7715
291 Ga0075435_100029012 3300007076 Bacteria 4342
292 Ga0075435_100078508 3300007076 Unclassified 2707
293 Ga0075435_100109402 3300007076 Unclassified 2297
294 Ga0075435_100191013 3300007076 Bacteria 1733
295 Ga0075435_100314289 3300007076 Bacteria 1341
296 Ga0075435_100636847 3300007076 Bacteria 925
297 Ga0105251_10010416 3300009011 Bacteria 5396
298 Ga0105244_10013466 3300009036 Bacteria 4780
299 Ga0105250_10046130 3300009092 Bacteria 1747
300 Ga0105250_10154115 3300009092 Unclassified 957
301 Ga0105250_10166835 3300009092 Bacteria 921
302 Ga0105240_10073250 3300009093 Bacteria 4230
303 Ga0111539_10000941 3300009094 Bacteria 38137
304 Ga0111539_10001081 3300009094 Bacteria 36017
305 Ga0111539_10003937 3300009094 Bacteria 19525
306 Ga0111539_10046672 3300009094 Bacteria 5181
307 Ga0111539_10470087 3300009094 Bacteria 1464
308 Ga0105245_10001284 3300009098 Bacteria 22645
309 Ga0105245_10746672 3300009098 Unclassified 1014
310 Ga0105245_10813127 3300009098 Bacteria 973
311 Ga0105245_11012962 3300009098 Bacteria 875
312 Ga0105247_10003522 3300009101 Bacteria 10175
313 Ga0105247_10086947 3300009101 Bacteria 1979
314 Ga0114129_10005884 3300009147 Bacteria 17371
315 Ga0114129_10006379 3300009147 Bacteria 16721
316 Ga0114129_10009653 3300009147 Bacteria 13772
317 Ga0114129_10030531 3300009147 Bacteria 7625
318 Ga0114129_10035036 3300009147 Bacteria 7091
319 Ga0114129_10052791 3300009147 Bacteria 5704
320 Ga0105243_10003373 3300009148 Bacteria 12960
321 Ga0105243_10093512 3300009148 Bacteria 2481
322 Ga0105241_10000053 3300009174 Bacteria 94578
323 Ga0105242_10000492 3300009176 Bacteria 31218
324 Ga0105242_10090793 3300009176 Bacteria 2570
325 Ga0105242_10287264 3300009176 Bacteria 1496
326 Ga0105248_10000934 3300009177 Bacteria 32542
327 Ga0105248_10001794 3300009177 Bacteria 23871
328 Ga0105248_10015418 3300009177 Bacteria 8425
329 Ga0105248_10031696 3300009177 Bacteria 5906
330 Ga0105248_10112789 3300009177 Bacteria 3066
331 Ga0105248_10836330 3300009177 Unclassified 1039
332 Ga0105248_10959976 3300009177 Bacteria 965
333 Ga0105248_11010302 3300009177 Unclassified 940
334 Ga0105248_11302388 3300009177 Unclassified 822
335 Ga0105237_10014650 3300009545 Bacteria 8189
336 Ga0105237_10209046 3300009545 Bacteria 1951
337 Ga0105238_10070681 3300009551 Bacteria 3489
338 Ga0105238_10121677 3300009551 Bacteria 2589
339 Ga0105249_10003582 3300009553 Bacteria 13439
340 Ga0105249_10033319 3300009553 Bacteria 4664
341 Ga0105249_12752150 3300009553 Bacteria 564
342 Ga0105239_10016523 3300010375 Bacteria 8160
343 Ga0105239_11418221 3300010375 Bacteria 802
344 Ga0105246_10000055 3300011119 Bacteria 45431
345 Ga0105246_10498358 3300011119 Unclassified 1034
346 Ga0105246_11642420 3300011119 Bacteria 609
347 Ga0157322_1003269 3300012490 Bacteria 981
348 Ga0157335_1001325 3300012492 Bacteria 1339
349 Ga0157335_1003155 3300012492 Bacteria 1040
350 Ga0157341_1000580 3300012494 Bacteria 1908
351 Ga0157347_1001471 3300012502 Bacteria 1854
352 Ga0157313_1000610 3300012503 Bacteria 1700
353 Ga0157342_1003586 3300012507 Bacteria 1337
354 Ga0157327_1009899 3300012512 Bacteria 889
355 Ga0157338_1003272 3300012515 Bacteria 1332
356 Ga0157373_10006564 3300013100 Bacteria 8679
357 Ga0157371_10098837 3300013102 Bacteria 2070
358 Ga0157374_10001308 3300013296 Bacteria 21203
359 Ga0157374_10326686 3300013296 Bacteria 1521
360 Ga0157374_10468874 3300013296 Bacteria 1262
361 Ga0157374_11098293 3300013296 Unclassified 816
362 Ga0157374_11217466 3300013296 Bacteria 774
363 Ga0157378_10000986 3300013297 Bacteria 26065
364 Ga0157378_10176862 3300013297 Bacteria 2005
365 Ga0163162_10002432 3300013306 Bacteria 17549
366 Ga0163162_10031169 3300013306 Bacteria 5288
367 Ga0163162_10078121 3300013306 Bacteria 3375
368 Ga0163162_10116324 3300013306 Bacteria 2774
369 Ga0163162_10223407 3300013306 Bacteria 2013
370 Ga0157372_10031748 3300013307 Bacteria 5786
371 Ga0157375_10000933 3300013308 Bacteria 25341
372 Ga0157375_10024669 3300013308 Bacteria 5571
373 Ga0157375_10041036 3300013308 Bacteria 4466
374 Ga0157375_10168969 3300013308 Bacteria 2333
375 Ga0163163_10005666 3300014325 Bacteria 10834
376 Ga0163163_10009027 3300014325 Bacteria 8883
377 Ga0163163_10014105 3300014325 Bacteria 7338
378 Ga0163163_10039079 3300014325 Bacteria 4629
379 Ga0163163_10244548 3300014325 Bacteria 1844
380 Ga0163163_11171643 3300014325 Bacteria 831
381 Ga0163163_11609086 3300014325 Bacteria 711
382 Ga0157380_10000821 3300014326 Bacteria 19478
383 Ga0157380_10792656 3300014326 Unclassified 964
384 Ga0157380_11108013 3300014326 Bacteria 831
385 Ga0157377_10002329 3300014745 Bacteria 8365
386 Ga0157377_10038813 3300014745 Unclassified 2631
387 Ga0157377_10094013 3300014745 Bacteria 1775
388 Ga0157377_10139755 3300014745 Bacteria 1487
389 Ga0157377_10371856 3300014745 Bacteria 965
390 Ga0157379_10000679 3300014968 Bacteria 27606
391 Ga0157379_10056130 3300014968 Bacteria 3519
392 Ga0157379_10201412 3300014968 Bacteria 1800
393 Ga0157379_10207352 3300014968 Bacteria 1773
394 Ga0157379_11612568 3300014968 Unclassified 634
395 Ga0157376_10000527 3300014969 Bacteria 24607
396 Ga0157376_10015817 3300014969 Bacteria 5710
397 Ga0157376_10247032 3300014969 Bacteria 1665
398 Ga0163161_10000770 3300017792 Bacteria 25240
399 Ga0163161_10768627 3300017792 Bacteria 807
400 Ga0207666_1000026 3300025271 Bacteria 33873
401 Ga0207666_1003755 3300025271 Bacteria 1877
402 Ga0207673_1001793 3300025290 Bacteria 2386
403 Ga0207697_10000245 3300025315 Bacteria 29793
404 Ga0207697_10042301 3300025315 Bacteria 1872
405 Ga0207655_1107185 3300025728 Unclassified 950
406 Ga0207713_1061561 3300025735 Bacteria 1427
407 Ga0207653_10013162 3300025885 Bacteria 2589
408 Ga0207682_10000029 3300025893 Bacteria 57930
409 Ga0207692_10015940 3300025898 Bacteria 3316
410 Ga0207642_10001640 3300025899 Bacteria 6896
411 Ga0207642_10120835 3300025899 Bacteria 1351
412 Ga0207642_10140711 3300025899 Bacteria 1272
413 Ga0207642_10490080 3300025899 Bacteria 751
414 Ga0207710_10024606 3300025900 Bacteria 2595
415 Ga0207710_10127543 3300025900 Bacteria 1220
416 Ga0207688_10000084 3300025901 Bacteria 35752
417 Ga0207688_10028735 3300025901 Bacteria 3058
418 Ga0207688_10065550 3300025901 Bacteria 2053
419 Ga0207680_10001429 3300025903 Bacteria 11322
420 Ga0207680_10051106 3300025903 Unclassified 2470
421 Ga0207680_10622693 3300025903 Bacteria 772
422 Ga0207647_10001299 3300025904 Bacteria 19229
423 Ga0207647_10018094 3300025904 Bacteria 4776
424 Ga0207685_10002707 3300025905 Bacteria 4124
425 Ga0207699_10001859 3300025906 Bacteria 9947
426 Ga0207645_10000090 3300025907 Bacteria 65569
427 Ga0207643_10000044 3300025908 Bacteria 82217
428 Ga0207705_10275569 3300025909 Bacteria 1287
429 Ga0207654_10000143 3300025911 Bacteria 45654
430 Ga0207707_10000580 3300025912 Bacteria 37172
431 Ga0207707_10107069 3300025912 Bacteria 2444
432 Ga0207695_10065947 3300025913 Bacteria 3720
433 Ga0207671_10014374 3300025914 Bacteria 6260
434 Ga0207693_10036145 3300025915 Bacteria 3893
435 Ga0207663_10019234 3300025916 Bacteria 3843
436 Ga0207663_10135741 3300025916 Bacteria 1707
437 Ga0207660_10000653 3300025917 Bacteria 23385
438 Ga0207660_10192390 3300025917 Bacteria 1589
439 Ga0207660_10904253 3300025917 Bacteria 720
440 Ga0207662_10000104 3300025918 Bacteria 40365
441 Ga0207662_10012668 3300025918 Bacteria 4699
442 Ga0207662_10037005 3300025918 Bacteria 2855
443 Ga0207662_10103825 3300025918 Bacteria 1764
444 Ga0207657_10011813 3300025919 Bacteria 8646
445 Ga0207657_10048554 3300025919 Bacteria 3705
446 Ga0207649_10000057 3300025920 Bacteria 102314
447 Ga0207649_10049764 3300025920 Bacteria 2590
448 Ga0207652_10001436 3300025921 Bacteria 21120
449 Ga0207652_10204797 3300025921 Bacteria 1776
450 Ga0207646_10201309 3300025922 Bacteria 1799
451 Ga0207646_10317005 3300025922 Bacteria 1409
452 Ga0207681_10000154 3300025923 Bacteria 57555
453 Ga0207681_10085889 3300025923 Bacteria 2234
454 Ga0207681_10126211 3300025923 Unclassified 1885
455 Ga0207681_10230035 3300025923 Bacteria 1439
456 Ga0207694_10137941 3300025924 Bacteria 1960
457 Ga0207694_10168251 3300025924 Bacteria 1773
458 Ga0207650_10001069 3300025925 Bacteria 20358
459 Ga0207650_10005233 3300025925 Bacteria 8844
460 Ga0207650_10043547 3300025925 Unclassified 3295
461 Ga0207650_10121055 3300025925 Bacteria 2038
462 Ga0207659_10000028 3300025926 Bacteria 130804
463 Ga0207659_10058328 3300025926 Bacteria 2771
464 Ga0207659_10084610 3300025926 Unclassified 2354
465 Ga0207659_10703603 3300025926 Bacteria 865
466 Ga0207659_11588712 3300025926 Unclassified 558
467 Ga0207687_10000249 3300025927 Bacteria 36556
468 Ga0207687_10015275 3300025927 Bacteria 5031
469 Ga0207687_10754400 3300025927 Bacteria 828
470 Ga0207700_10031736 3300025928 Bacteria 3757
471 Ga0207664_10014021 3300025929 Bacteria 5777
472 Ga0207644_10002109 3300025931 Bacteria 12894
473 Ga0207644_10020295 3300025931 Bacteria 4517
474 Ga0207644_10149049 3300025931 Bacteria 1809
475 Ga0207644_10162853 3300025931 Bacteria 1735
476 Ga0207690_10000225 3300025932 Bacteria 42706
477 Ga0207690_10059770 3300025932 Bacteria 2584
478 Ga0207690_10094151 3300025932 Bacteria 2125
479 Ga0207690_10308483 3300025932 Bacteria 1240
480 Ga0207690_10421438 3300025932 Bacteria 1068
481 Ga0207706_10001675 3300025933 Bacteria 21873
482 Ga0207706_10259347 3300025933 Bacteria 1518
483 Ga0207706_10737080 3300025933 Unclassified 840
484 Ga0207686_10001701 3300025934 Bacteria 12258
485 Ga0207686_10133387 3300025934 Bacteria 1706
486 Ga0207686_10337406 3300025934 Bacteria 1131
487 Ga0207709_10000291 3300025935 Bacteria 56621
488 Ga0207709_10069957 3300025935 Bacteria 2224
489 Ga0207709_10218038 3300025935 Bacteria 1374
490 Ga0207670_10000463 3300025936 Bacteria 22617
491 Ga0207670_10007249 3300025936 Bacteria 6178
492 Ga0207670_10103898 3300025936 Bacteria 2034
493 Ga0207670_10282986 3300025936 Bacteria 1293
494 Ga0207669_10000019 3300025937 Bacteria 111630
495 Ga0207669_10104728 3300025937 Bacteria 1880
496 Ga0207669_10336251 3300025937 Bacteria 1161
497 Ga0207669_10346884 3300025937 Unclassified 1145
498 Ga0207669_10615491 3300025937 Bacteria 884
499 Ga0207704_10000230 3300025938 Bacteria 27729
500 Ga0207704_10022698 3300025938 Bacteria 3368
501 Ga0207704_10129753 3300025938 Bacteria 1743
502 Ga0207704_10757743 3300025938 Unclassified 808
503 Ga0207665_10010796 3300025939 Bacteria 5997
504 Ga0207691_10000882 3300025940 Bacteria 29793
505 Ga0207691_10009942 3300025940 Bacteria 9136
506 Ga0207691_10018118 3300025940 Bacteria 6669
507 Ga0207691_10093609 3300025940 Bacteria 2690
508 Ga0207691_10111783 3300025940 Bacteria 2429
509 Ga0207691_10291881 3300025940 Bacteria 1402
510 Ga0207711_10001381 3300025941 Bacteria 22842
511 Ga0207711_10011217 3300025941 Bacteria 7446
512 Ga0207711_10033459 3300025941 Unclassified 4349
513 Ga0207711_10040118 3300025941 Bacteria 3983
514 Ga0207711_10999594 3300025941 Bacteria 776
515 Ga0207711_11129816 3300025941 Bacteria 724
516 Ga0207689_10000228 3300025942 Bacteria 50020
517 Ga0207689_10054554 3300025942 Bacteria 3291
518 Ga0207689_10115647 3300025942 Bacteria 2205
519 Ga0207689_10546287 3300025942 Bacteria 973
520 Ga0207661_10000107 3300025944 Bacteria 52429
521 Ga0207661_10503205 3300025944 Bacteria 1107
522 Ga0207661_10849638 3300025944 Unclassified 840
523 Ga0207679_10000026 3300025945 Bacteria 200073
524 Ga0207679_10020751 3300025945 Bacteria 4440
525 Ga0207679_10026036 3300025945 Unclassified 4030
526 Ga0207679_10124099 3300025945 Bacteria 2061
527 Ga0207679_10148976 3300025945 Bacteria 1902
528 Ga0207679_10339848 3300025945 Bacteria 1305
529 Ga0207667_10007642 3300025949 Bacteria 12950
530 Ga0207651_10000069 3300025960 Bacteria 46408
531 Ga0207651_10171106 3300025960 Bacteria 1713
532 Ga0207651_10348771 3300025960 Unclassified 1246
533 Ga0207651_10349307 3300025960 Bacteria 1245
534 Ga0207651_10531336 3300025960 Bacteria 1020
535 Ga0207651_10546104 3300025960 Bacteria 1007
536 Ga0207712_10000242 3300025961 Bacteria 53794
537 Ga0207712_10067736 3300025961 Bacteria 2556
538 Ga0207712_10472090 3300025961 Bacteria 1068
539 Ga0207668_10000049 3300025972 Bacteria 99391
540 Ga0207668_10183651 3300025972 Bacteria 1652
541 Ga0207640_10000301 3300025981 Bacteria 32802
542 Ga0207658_10010690 3300025986 Bacteria 6238
543 Ga0207658_10033574 3300025986 Bacteria 3661
544 Ga0207658_10728510 3300025986 Bacteria 897
545 Ga0207658_11554878 3300025986 Bacteria 605
546 Ga0207677_10033906 3300026023 Bacteria 3300
547 Ga0207677_10066907 3300026023 Bacteria 2514
548 Ga0207677_10863146 3300026023 Bacteria 814
549 Ga0207677_10942950 3300026023 Unclassified 780
550 Ga0207703_10002075 3300026035 Bacteria 17625
551 Ga0207703_10047218 3300026035 Unclassified 3471
552 Ga0207703_10119645 3300026035 Bacteria 2259
553 Ga0207703_10128659 3300026035 Bacteria 2184
554 Ga0207703_10136077 3300026035 Unclassified 2127
555 Ga0207703_10185762 3300026035 Bacteria 1837
556 Ga0207639_10000413 3300026041 Bacteria 29583
557 Ga0207639_10631383 3300026041 Bacteria 990
558 Ga0207678_10000920 3300026067 Bacteria 26941
559 Ga0207678_10007714 3300026067 Bacteria 9507
560 Ga0207678_10419719 3300026067 Bacteria 1160
561 Ga0207708_10002680 3300026075 Bacteria 13080
562 Ga0207708_10002682 3300026075 Bacteria 13078
563 Ga0207708_10266025 3300026075 Bacteria 1385
564 Ga0207708_11725404 3300026075 Bacteria 550
565 Ga0207702_10002075 3300026078 Bacteria 19368
566 Ga0207641_10000542 3300026088 Bacteria 42352
567 Ga0207641_10074355 3300026088 Bacteria 2931
568 Ga0207641_10124275 3300026088 Bacteria 2307
569 Ga0207641_10142353 3300026088 Bacteria 2165
570 Ga0207641_10192942 3300026088 Bacteria 1873
571 Ga0207641_11771034 3300026088 Unclassified 619
572 Ga0207648_10002093 3300026089 Bacteria 21739
573 Ga0207648_10051099 3300026089 Bacteria 3613
574 Ga0207648_10475622 3300026089 Bacteria 1140
575 Ga0207648_11022019 3300026089 Unclassified 774
576 Ga0207676_10000511 3300026095 Bacteria 32689
577 Ga0207676_10163889 3300026095 Unclassified 1929
578 Ga0207676_11263867 3300026095 Bacteria 732
579 Ga0207674_10000882 3300026116 Bacteria 39274
580 Ga0207674_10149810 3300026116 Bacteria 2290
581 Ga0207675_100001599 3300026118 Bacteria 22695
582 Ga0207675_100032967 3300026118 Bacteria 4826
583 Ga0207675_100128939 3300026118 Unclassified 2398
584 Ga0207675_100890864 3300026118 Unclassified 906
585 Ga0207683_10000653 3300026121 Bacteria 31779
586 Ga0207683_10005584 3300026121 Bacteria 10781
587 Ga0207683_10062420 3300026121 Bacteria 3281
588 Ga0207698_10003176 3300026142 Bacteria 9855
589 Ga0207698_10756239 3300026142 Bacteria 971
590 Ga0209967_1001141 3300027364 Bacteria 3380
591 Ga0209999_1003610 3300027543 Bacteria 2770
592 Ga0210002_1000267 3300027617 Bacteria 7402
593 Ga0209983_1013876 3300027665 Bacteria 1658
594 Ga0209983_1054296 3300027665 Bacteria 879
595 Ga0209971_1011327 3300027682 Bacteria 2112
596 Ga0209998_10000855 3300027717 Bacteria 7842
597 Ga0209998_10000913 3300027717 Bacteria 7554
598 Ga0209974_10001240 3300027876 Bacteria 9154
599 Ga0209974_10099596 3300027876 Bacteria 1015
600 Ga0207428_10000130 3300027907 Bacteria 104457
601 Ga0207428_10000286 3300027907 Bacteria 68250
602 Ga0207428_10015465 3300027907 Bacteria 6601
603 Ga0207428_10110621 3300027907 Bacteria 2115
604 Ga0207428_10189886 3300027907 Bacteria 1549
605 Ga0268266_10013545 3300028379 Bacteria 7022
606 Ga0268265_10000410 3300028380 Bacteria 45939
607 Ga0268265_10509228 3300028380 Bacteria 1136
608 Ga0268265_11167409 3300028380 Bacteria 766
609 Ga0268264_10001172 3300028381 Bacteria 25487
610 Ga0268264_10132374 3300028381 Bacteria 2213
611 Ga0268264_10407382 3300028381 Bacteria 1308
612 Ga0268264_11139909 3300028381 Bacteria 789
613 Ga0268264_11217447 3300028381 Bacteria 762
614 Ga0268264_11702657 3300028381 Bacteria 641
615 Ga0307405_10016886 3300031731 Bacteria 3992
616 Ga0307413_10034670 3300031824 Bacteria 2887
617 Ga0307410_10059355 3300031852 Bacteria 2611
618 Ga0307410_10107587 3300031852 Unclassified 2012
619 Ga0307406_10061754 3300031901 Bacteria 2421
620 Ga0307407_10089475 3300031903 Bacteria 1883
621 Ga0307412_10051980 3300031911 Bacteria 2711
622 Ga0307412_10072569 3300031911 Bacteria 2353
623 Ga0307409_100085397 3300031995 Bacteria 2565
624 Ga0307409_100265543 3300031995 Unclassified 1578
625 Ga0307416_100007987 3300032002 Bacteria 6776
626 Ga0307416_100098982 3300032002 Bacteria 2531
627 Ga0307416_100213190 3300032002 Bacteria 1844
628 Ga0307416_102406911 3300032002 Bacteria 626
629 Ga0307414_10088192 3300032004 Bacteria 2295
630 Ga0307415_100043057 3300032126 Bacteria 3009
631 Ga0307415_100138449 3300032126 Bacteria 1855
632 Ga0373930_0001406 3300034816 Bacteria 3572
633 Ga0373930_0018027 3300034816 Bacteria 1353
634 Ga0373930_0018703 3300034816 Bacteria 1335
635 Ga0373948_0000715 3300034817 Bacteria 4319
636 Ga0373948_0020424 3300034817 Bacteria 1261
637 Ga0373950_0006419 3300034818 Bacteria 1792
638 Ga0373950_0008531 3300034818 Bacteria 1615
639 Ga0373950_0015153 3300034818 Bacteria 1305
640 Ga0373958_0000160 3300034819 Bacteria 7651
641 Ga0373958_0000523 3300034819 Bacteria 4788
642 Ga0373958_0036482 3300034819 Bacteria 988
643 Ga0373959_0000166 3300034820 Bacteria 14768
644 Ga0373959_0017523 3300034820 Bacteria 1338
645 Ga0373938_0000260 3300034957 Bacteria 8284
646 Ga0373938_0001185 3300034957 Bacteria 4200
647 Ga0373938_0053583 3300034957 Bacteria 927
648 Ga0373926_0000467 3300035083 Bacteria 10635
649 Ga0373928_0000257 3300035084 Bacteria 10533
650 Ga0373929_0000497 3300035085 Bacteria 7502
651 Ga0373929_0001725 3300035085 Bacteria 4109
652 Ga0373940_0002922 3300035088 Bacteria 3407
653 Ga0373944_0023150 3300035089 Bacteria 1810
654 Ga0373949_0000547 3300035090 Bacteria 12392
655 Ga0373949_0009005 3300035090 Bacteria 2186
656 Ga0373951_0001164 3300035091 Bacteria 6957
657 Ga0373951_0002297 3300035091 Bacteria 4858
658 Ga0373951_0115910 3300035091 Bacteria 725
659 Ga0373952_0000266 3300035092 Bacteria 8600
660 Ga0373952_0006102 3300035092 Bacteria 2222
661 Ga0373952_0008171 3300035092 Bacteria 1980
662 Ga0373932_0000908 3300035112 Bacteria 8652
663 Ga0373932_0002722 3300035112 Bacteria 4399
664 Ga0373932_0002850 3300035112 Bacteria 4277
665 Ga0373936_0063562 3300035113 Bacteria 1511
666 Ga0373939_0000911 3300035114 Bacteria 7343
667 Ga0373939_0019090 3300035114 Bacteria 1845
668 Ga0373941_0000037 3300035115 Bacteria 19599
669 Ga0373941_0008858 3300035115 Bacteria 2517
670 Ga0373941_0032799 3300035115 Bacteria 1557
671 Ga0373945_0004426 3300035116 Bacteria 4463
672 Ga0373945_0020567 3300035116 Bacteria 2260
673 Ga0373945_0231452 3300035116 Bacteria 776
674 Ga0373954_0099979 3300035118 Bacteria 1398
675 Ga0373956_0177943 3300035119 Bacteria 1005
676 Ga0373957_0138285 3300035120 Unclassified 995
677 Ga0373960_0000805 3300035121 Bacteria 6600
678 Ga0373960_0001073 3300035121 Bacteria 5899
679 Ga0373943_0007096 3300035170 Bacteria 5027
680 Ga0373943_0036408 3300035170 Bacteria 2356
681 Ga0373946_0007998 3300035171 Bacteria 3884
682 Ga0373946_0008924 3300035171 Bacteria 3685
683 Ga0373955_0146517 3300035172 Bacteria 1387
684 Ga0373955_0241805 3300035172 Bacteria 1081
685 Ga0373942_0000388 3300035207 Bacteria 12155
686 Ga0373942_0003774 3300035207 Bacteria 3545
687 Ga0373961_0000658 3300035241 Bacteria 12233
688 Ga0373961_0001498 3300035241 Bacteria 6828
689 Ga0373961_0080101 3300035241 Bacteria 1026
690 Ga0373962_0001121 3300035242 Bacteria 6245
691 Ga0373962_0005442 3300035242 Bacteria 3082
692 Ga0373924_0006388 3300035410 Bacteria 4223
693 Ga0373931_0001169 3300035691 Bacteria 11182
694 Ga0373931_0002000 3300035691 Bacteria 8971
695 Ga0373931_0167922 3300035691 Bacteria 1290
696 Ga0373931_0178067 3300035691 Bacteria 1257
697 Ga0373935_0075240 3300035692 Bacteria 2184
698 Ga0373935_0156250 3300035692 Bacteria 1551
699 Ga0373927_0007496 3300035695 Bacteria 7379
700 Ga0373927_0056853 3300035695 Bacteria 2530
701 Ga0373933_0064444 3300035724 Bacteria 2217
702 Ga0373947_0016221 3300035725 Bacteria 4281
703 Ga0373937_0080759 3300036401 Bacteria 3008
704 Ga0373937_0271599 3300036401 Bacteria 1600
705 Ga0373925_0010099 3300037068 Bacteria 6858
706 Ga0373925_0054869 3300037068 Bacteria 2981
707 Ga0373925_0238122 3300037068 Bacteria 1457
708 Ga0373925_0643519 3300037068 Bacteria 874
709 Ga0373925_0869152 3300037068 Bacteria 743
710 Ga0439443_020710 3300042003 Bacteria 1035
711 Ga0439463_030103 3300042016 Bacteria 1368
712 Ga0439463_107981 3300042016 Bacteria 718
713 Ga0450923_008659 3300042125 Bacteria 1758
714 Ga0439446_0073424 3300042156 Bacteria 1050
715 Ga0439459_0015768 3300042438 Bacteria 1388
716 Ga0451577_0242465 3300042876 Bacteria 1631
717 Ga0439440_0102552 3300042993 Bacteria 780
718 Ga0453684_0111442 3300044712 Bacteria 3324
719 Ga0451576_0642772 3300045051 Bacteria 1115
720 Ga0495617_010868 3300046452 Bacteria 3116
721 Ga0495592_0089707 3300046454 Bacteria 2207
722 Ga0495603_0050120 3300046455 Bacteria 2483
723 Ga0495603_0181250 3300046455 Bacteria 1218
724 Ga0495591_010442 3300046458 Bacteria 3601
725 Ga0495629_0004767 3300046459 Bacteria 10168
726 Ga0495629_0115970 3300046459 Bacteria 1866
727 Ga0495629_0497621 3300046459 Bacteria 822
728 Ga0495641_0068805 3300046461 Bacteria 1591
729 Ga0495651_0010712 3300046462 Bacteria 7051
730 Ga0495651_0402930 3300046462 Bacteria 893
731 Ga0495653_0015854 3300046463 Bacteria 6142
732 Ga0495653_0362211 3300046463 Bacteria 930
733 Ga0495580_0033904 3300046472 Bacteria 3676
734 Ga0495582_0000612 3300046473 Bacteria 19623
735 Ga0495582_0014289 3300046473 Bacteria 4366
736 Ga0495582_0064836 3300046473 Unclassified 2018
737 Ga0495639_0008830 3300046475 Bacteria 4322
738 Ga0495662_0016599 3300046476 Bacteria 3567
739 Ga0495662_0639075 3300046476 Bacteria 520
740 Ga0495584_0008866 3300046491 Bacteria 5202
741 Ga0495585_0007260 3300046492 Bacteria 6803
742 Ga0495594_0006882 3300046499 Bacteria 5846
743 Ga0495594_0059541 3300046499 Bacteria 2112
744 Ga0495594_0488192 3300046499 Unclassified 700
745 Ga0495607_0005387 3300046501 Bacteria 9181
746 Ga0495618_0198546 3300046514 Bacteria 1270
747 Ga0495628_0062639 3300046516 Bacteria 2915
748 Ga0495630_0121371 3300046517 Bacteria 1982
749 Ga0495630_0222724 3300046517 Bacteria 1440
750 Ga0495630_0487607 3300046517 Bacteria 945
751 Ga0495644_0000194 3300046523 Bacteria 28681
752 Ga0495663_0006200 3300046525 Bacteria 3301
753 Ga0495663_0018559 3300046525 Bacteria 1981
754 Ga0495666_0093005 3300046526 Bacteria 1422
755 Ga0495642_0001277 3300046528 Bacteria 11367
756 Ga0495652_0027667 3300046529 Bacteria 4994
757 Ga0495665_0008988 3300046531 Bacteria 5422
758 Ga0495586_0050687 3300046535 Bacteria 2246
759 Ga0495586_0327302 3300046535 Bacteria 879
760 Ga0495587_0014105 3300046536 Bacteria 5018
761 Ga0495598_0017364 3300046537 Bacteria 1853
762 Ga0495609_0027254 3300046538 Bacteria 2612
763 Ga0495609_0051748 3300046538 Bacteria 1828
764 Ga0495622_0025454 3300046557 Bacteria 2763
765 Ga0495622_0044804 3300046557 Bacteria 2056
766 Ga0495633_0003579 3300046558 Bacteria 10276
767 Ga0495667_0028506 3300046559 Bacteria 3759
768 Ga0495634_0406038 3300046642 Unclassified 808
769 Ga0495611_0029144 3300046648 Bacteria 2420
770 Ga0495635_0074575 3300046663 Bacteria 2324
771 Ga0495635_0100725 3300046663 Bacteria 1974
772 Ga0495635_0133259 3300046663 Bacteria 1694
773 Ga0495659_0001145 3300046664 Bacteria 9203
774 Ga0495659_0016769 3300046664 Bacteria 2419
775 Ga0495588_0035444 3300046674 Bacteria 2529
776 Ga0495588_0113353 3300046674 Bacteria 1428
777 Ga0495588_0341110 3300046674 Unclassified 788
778 Ga0495646_0080436 3300046680 Bacteria 1900
779 Ga0495647_0006635 3300046681 Bacteria 3842
780 Ga0495647_0015759 3300046681 Bacteria 2652
781 Ga0495647_0198128 3300046681 Bacteria 880
782 Ga0495658_0005405 3300046683 Bacteria 6278
783 Ga0495658_0012933 3300046683 Unclassified 4240
784 Ga0495658_0793460 3300046683 Bacteria 606
785 Ga0495669_0018964 3300046684 Bacteria 2965
786 Ga0495613_0162070 3300046689 Bacteria 1590
787 Ga0495613_0344264 3300046689 Unclassified 1025
788 Ga0495613_1097145 3300046689 Bacteria 508
789 Ga0495624_0005904 3300046690 Bacteria 8753
790 Ga0495670_0001975 3300046691 Bacteria 10074
791 Ga0495670_0621349 3300046691 Bacteria 589
792 Ga0495671_0422577 3300046692 Unclassified 638
793 Ga0495589_0036332 3300046794 Bacteria 2470
794 Ga0495600_0006963 3300046809 Bacteria 6897
795 Ga0495600_0204163 3300046809 Bacteria 1268
796 Ga0495600_0615694 3300046809 Bacteria 659
797 Ga0495581_0006224 3300047315 Bacteria 6920
798 Ga0495581_0092779 3300047315 Bacteria 1752
799 Ga0495604_0010469 3300047317 Bacteria 7351
800 Ga0495636_0022113 3300047318 Bacteria 2569
801 Ga0495674_0047890 3300047319 Bacteria 3786
802 Ga0495674_0404891 3300047319 Unclassified 1101
803 Ga0495676_0035932 3300047321 Bacteria 4142
804 Ga0495676_0089008 3300047321 Bacteria 2313
805 Ga0495680_0000399 3300047322 Bacteria 48640
806 Ga0495680_0005166 3300047322 Bacteria 12312
807 Ga0495680_0005187 3300047322 Bacteria 12292
808 Ga0495677_0186257 3300047445 Bacteria 805
809 Ga0495679_171347 3300047446 Unclassified 577
810 Ga0495681_0173313 3300047470 Bacteria 891
811 Ga0495684_0009567 3300047471 Bacteria 7472
812 Ga0495684_0038621 3300047471 Unclassified 3660
813 Ga0495684_0153395 3300047471 Bacteria 1721
814 Ga0495684_0493756 3300047471 Bacteria 843
815 Ga0495593_0067277 3300047673 Bacteria 1865
816 Ga0495602_0044248 3300048088 Bacteria 4041
817 Ga0495602_0344008 3300048088 Bacteria 1078
818 Ga0495614_0080661 3300048089 Bacteria 1409
819 Ga0495626_0398704 3300048091 Unclassified 532
820 Ga0496100_0001568 3300048903 Bacteria 11248
821 Ga0496100_0015639 3300048903 Bacteria 4434
822 Ga0496101_0000171 3300048904 Bacteria 53757
823 Ga0496101_0000290 3300048904 Bacteria 34975
824 Ga0496101_0139232 3300048904 Bacteria 1848
825 Ga0496102_0004724 3300048905 Bacteria 11533
826 Ga0496102_0049455 3300048905 Bacteria 3825
827 Ga0496102_0148204 3300048905 Bacteria 2203
828 Ga0496102_0276915 3300048905 Bacteria 1581
829 Ga0496102_1034882 3300048905 Bacteria 741
830 Ga0496102_1366062 3300048905 Bacteria 627
831 Ga0496103_0005627 3300048906 Bacteria 7489
832 Ga0496103_0017226 3300048906 Bacteria 4321
833 Ga0496103_0092519 3300048906 Bacteria 1909
834 Ga0496103_0215207 3300048906 Bacteria 1235
835 Ga0496104_0097739 3300048907 Bacteria 2810
836 Ga0496104_0153074 3300048907 Bacteria 2213
837 Ga0496104_0305751 3300048907 Bacteria 1502
838 Ga0496104_0422784 3300048907 Bacteria 1244
839 Ga0496105_0149162 3300048908 Bacteria 1922
840 Ga0496105_0193514 3300048908 Bacteria 1662
841 Ga0496105_0215363 3300048908 Bacteria 1565
842 Ga0496105_0520577 3300048908 Bacteria 931
843 Ga0496106_0002116 3300048909 Bacteria 14844
844 Ga0496106_0096792 3300048909 Bacteria 2284
845 Ga0496106_0546469 3300048909 Unclassified 929
846 Ga0496107_0005829 3300048910 Bacteria 8433
847 Ga0496107_0009248 3300048910 Bacteria 6831
848 Ga0496107_0024003 3300048910 Bacteria 4311
849 Ga0496107_0036330 3300048910 Bacteria 3534
850 Ga0496107_0043616 3300048910 Bacteria 3222
851 Ga0496108_0003417 3300048911 Bacteria 12751
852 Ga0496108_0047350 3300048911 Bacteria 3594
853 Ga0496108_0122691 3300048911 Bacteria 2229
854 Ga0496108_0412346 3300048911 Bacteria 1180
855 Ga0496109_0000606 3300048912 Bacteria 29948
856 Ga0496109_0000714 3300048912 Bacteria 27676
857 Ga0496109_0030825 3300048912 Bacteria 4807
858 Ga0496109_0178876 3300048912 Bacteria 1991
859 Ga0496110_0011093 3300048913 Bacteria 7361
860 Ga0496110_0012732 3300048913 Bacteria 6925
861 Ga0496110_0059126 3300048913 Bacteria 3377
862 Ga0496110_0080773 3300048913 Bacteria 2898
863 Ga0496110_0083757 3300048913 Bacteria 2845
864 Ga0496111_0004865 3300048914 Bacteria 8525
865 Ga0496111_0038001 3300048914 Bacteria 3447
866 Ga0496111_0091797 3300048914 Bacteria 2225
867 Ga0496111_0224737 3300048914 Unclassified 1395
868 Ga0496112_0032467 3300048915 Bacteria 5069
869 Ga0496112_0035091 3300048915 Bacteria 4881
870 Ga0496112_0080920 3300048915 Bacteria 3212
871 Ga0496112_0440174 3300048915 Bacteria 1241
872 Ga0496113_0000399 3300048916 Bacteria 20918
873 Ga0496113_0060944 3300048916 Bacteria 2845
874 Ga0496113_0086954 3300048916 Bacteria 2402
875 Ga0496113_0131369 3300048916 Bacteria 1965
876 Ga0496114_0008317 3300048917 Bacteria 8221
877 Ga0496114_0041803 3300048917 Bacteria 3798
878 Ga0496114_0141759 3300048917 Bacteria 2081
879 Ga0496115_0001189 3300048918 Bacteria 18669
880 Ga0496115_0066251 3300048918 Bacteria 2918
881 Ga0496115_0274496 3300048918 Bacteria 1384
882 Ga0501037_0643591 3300049573 Unclassified 709
883 Ga0501039_1584911 3300049575 Bacteria 503
884 Ga0501040_0084567 3300049576 Unclassified 2201
885 Ga0501041_0130967 3300049577 Unclassified 1562
886 Ga0501042_0290666 3300049578 Unclassified 1180
887 Ga0501046_0360355 3300049580 Bacteria 1054
888 Ga0501048_0292634 3300049582 Unclassified 1158
889 Ga0501072_0065539 3300049588 Unclassified 2864
890 Ga0501072_0442010 3300049588 Bacteria 1030
891 Ga0501075_0004771 3300049591 Bacteria 9217
892 Ga0501075_0211570 3300049591 Bacteria 1479
893 Ga0501075_0622973 3300049591 Unclassified 823
894 Ga0501076_0101988 3300049592 Bacteria 2313
895 Ga0501076_0366191 3300049592 Bacteria 1184
896 Ga0501076_1103565 3300049592 Bacteria 653
897 Ga0501077_0196378 3300049593 Bacteria 1282
898 Ga0501077_0259543 3300049593 Unclassified 1105
899 Ga0501206_059139 3300049653 Unclassified 626
900 Ga0501259_174883 3300049688 Unclassified 542
901 Ga0501079_0101132 3300049741 Bacteria 2235
902 Ga0501081_0055350 3300049743 Unclassified 2741
903 Ga0501081_0636139 3300049743 Bacteria 799
904 Ga0501263_032622 3300049760 Unclassified 741
905 Ga0501035_0216737 3300049822 Bacteria 1636
906 Ga0501035_0893908 3300049822 Bacteria 704
907 Ga0501045_0352038 3300049824 Bacteria 1096
908 nmdc:mga06z11_16741_c1 3300050494 Bacteria 3309
909 nmdc:mga05p37_107155_c1 3300050507 Bacteria 3438
910 nmdc:mga05p37_21187_c1 3300050507 Bacteria 7869
911 nmdc:mga05p37_36455_c1 3300050507 Bacteria 6033
912 nmdc:mga05p37_68016_c1 3300050507 Bacteria 4381
913 nmdc:mga05p37_68397_c1 3300050507 Bacteria 4367
914 nmdc:mga09592_137533_c1 3300050508 Unclassified 2104
915 nmdc:mga09592_149462_c1 3300050508 Unclassified 2015
916 nmdc:mga09592_5261_c1 3300050508 Bacteria 10513
917 nmdc:mga0qj67_411870_c1 3300050509 Unclassified 1090
918 nmdc:mga0qj67_497989_c1 3300050509 Unclassified 980
919 nmdc:mga0qj67_61777_c1 3300050509 Bacteria 2975
920 nmdc:mga0qj67_8760_c1 3300050509 Bacteria 7508
921 nmdc:mga06r32_40386_c1 3300050510 Unclassified 4429
922 nmdc:mga06r32_594613_c1 3300050510 Bacteria 1078
923 nmdc:mga06r32_67701_c1 3300050510 Bacteria 3448
924 nmdc:mga06r32_71911_c1 3300050510 Bacteria 3348
925 nmdc:mga06r32_78506_c1 3300050510 Bacteria 3209
926 nmdc:mga08y16_1898_c1 3300050511 Bacteria 21299
927 nmdc:mga08y16_270702_c1 3300050511 Bacteria 1753
928 nmdc:mga08y16_2825_c1 3300050511 Bacteria 17843
929 nmdc:mga08y16_37906_c1 3300050511 Bacteria 5061
930 nmdc:mga08y16_38404_c1 3300050511 Bacteria 5028
931 nmdc:mga08y16_538042_c1 3300050511 Bacteria 1183
932 nmdc:mga0n895_1061_c1 3300050512 Bacteria 20040
933 nmdc:mga0n895_1241189_c1 3300050512 Unclassified 718
934 nmdc:mga0n895_20783_c1 3300050512 Bacteria 6130
935 nmdc:mga0n895_342694_c1 3300050512 Bacteria 1514
936 nmdc:mga0n895_490130_c1 3300050512 Bacteria 1239
937 nmdc:mga0n895_532164_c1 3300050512 Bacteria 1182
938 nmdc:mga0n895_62410_c1 3300050512 Bacteria 3683
939 nmdc:mga0rr50_235648_c1 3300050513 Bacteria 1516
940 nmdc:mga0rr50_573073_c1 3300050513 Bacteria 962
941 nmdc:mga0rr50_6009_c1 3300050513 Bacteria 7328
942 nmdc:mga0rr50_67477_c1 3300050513 Unclassified 2717
943 nmdc:mga0rr50_88036_c1 3300050513 Unclassified 2411
944 nmdc:mga0rr50_91648_c2 3300050513 Bacteria 1250
945 nmdc:mga08x19_1113496_c1 3300050514 Bacteria 560
946 nmdc:mga08x19_255602_c1 3300050514 Unclassified 1210
947 nmdc:mga08x19_56550_c1 3300050514 Bacteria 2532
948 nmdc:mga0a205_206857_c1 3300050515 Bacteria 1852
949 nmdc:mga0a205_217928_c1 3300050515 Bacteria 1795
950 nmdc:mga0a205_3445_c1 3300050515 Bacteria 14121
951 nmdc:mga0a205_395650_c1 3300050515 Unclassified 1246
952 nmdc:mga0a205_453771_c1 3300050515 Bacteria 1142
953 nmdc:mga0a205_560372_c1 3300050515 Bacteria 997
954 nmdc:mga0a205_633650_c1 3300050515 Bacteria 921
955 nmdc:mga0a205_64986_c1 3300050515 Bacteria 3525
956 nmdc:mga0a205_8902_c1 3300050515 Bacteria 9148
957 Ga0495595_0004854 3300053084 Bacteria 5418
958 Ga0495619_0006574 3300053085 Bacteria 7353
959 Ga0495619_0056821 3300053085 Bacteria 2595
960 Ga0500555_000392 3300053103 Bacteria 18411
961 Ga0500645_000220 3300053730 Bacteria 43452
962 Ga0500599_007074 3300053736 Unclassified 1439
963 Ga0501084_0107909 3300054114 Bacteria 2339
964 Ga0501084_0123508 3300054114 Unclassified 2177
965 Ga0590071_000291 3300059421 Bacteria 14588
966 Ga0590071_001060 3300059421 Bacteria 7446
967 Ga0590071_010104 3300059421 Bacteria 2210
968 Ga0590074_001671 3300059423 Bacteria 3617
969 Ga0590074_011851 3300059423 Bacteria 1462
970 Ga0590075_000253 3300059424 Bacteria 15075
971 Ga0590075_002771 3300059424 Bacteria 4188
972 Ga0590077_000007 3300059426 Bacteria 42591
973 Ga0590077_000399 3300059426 Bacteria 12235
974 Ga0590077_003099 3300059426 Bacteria 3483
975 Ga0590077_021208 3300059426 Unclassified 1382
976 Ga0501082_1523488 3300060353 Unclassified 584
977 Ga0530510_0177620 3300061734 Bacteria 1578

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005842 Ga0068858_100390241 Ga0068858_1003902413 115
2 3300025937 Ga0207669_10104728 Ga0207669_101047282 119
3 3300042156 Ga0439446_0073424 Ga0439446_0073424_92_502 121
4 3300059426 Ga0590077_021208 Ga0590077_021208_546_956 124
5 3300005327 Ga0070658_10348025 Ga0070658_103480251 126
6 3300025909 Ga0207705_10275569 Ga0207705_102755692 127
7 3300048905 Ga0496102_0049455 Ga0496102_0049455_3354_3740 128
8 3300005438 Ga0070701_10352389 Ga0070701_103523892 129
9 3300005545 Ga0070695_100169607 Ga0070695_1001696072 129
10 3300005518 Ga0070699_100050460 Ga0070699_1000504604 130
11 3300005536 Ga0070697_100010084 Ga0070697_1000100848 130
12 3300005549 Ga0070704_100026483 Ga0070704_1000264833 130
13 3300006852 Ga0075433_10088448 Ga0075433_100884483 130
14 3300007076 Ga0075435_100007651 Ga0075435_1000076513 130
15 3300032002 Ga0307416_102406911 Ga0307416_1024069111 130
16 3300059421 Ga0590071_000291 Ga0590071_000291_9024_9422 132
17 3300059423 Ga0590074_001671 Ga0590074_001671_1711_2109 132
18 3300059424 Ga0590075_000253 Ga0590075_000253_13501_13899 132
19 3300059426 Ga0590077_000007 Ga0590077_000007_19517_19915 132
20 3300005337 Ga0070682_100611362 Ga0070682_1006113622 133
21 3300005340 Ga0070689_100424265 Ga0070689_1004242652 133
22 3300005353 Ga0070669_100656365 Ga0070669_1006563652 133
23 3300005354 Ga0070675_100327695 Ga0070675_1003276952 133
24 3300005365 Ga0070688_100895772 Ga0070688_1008957722 133
25 3300005564 Ga0070664_100535698 Ga0070664_1005356982 133
26 3300005577 Ga0068857_100074904 Ga0068857_1000749044 133
27 3300005617 Ga0068859_100559707 Ga0068859_1005597073 133
28 3300005617 Ga0068859_101475925 Ga0068859_1014759252 133
29 3300006931 Ga0097620_100559720 Ga0097620_1005597203 133
30 3300006931 Ga0097620_101475720 Ga0097620_1014757202 133
31 3300025936 Ga0207670_10282986 Ga0207670_102829862 133
32 3300026116 Ga0207674_10149810 Ga0207674_101498103 133
33 3300005290 Ga0065712_10391798 Ga0065712_103917981 134
34 3300005295 Ga0065707_10165705 Ga0065707_101657051 134
35 3300005330 Ga0070690_100011260 Ga0070690_1000112602 134
36 3300005331 Ga0070670_100016479 Ga0070670_1000164793 134
37 3300005335 Ga0070666_10004448 Ga0070666_100044486 134
38 3300005338 Ga0068868_100006142 Ga0068868_1000061423 134
39 3300005343 Ga0070687_100026514 Ga0070687_1000265142 134
40 3300005344 Ga0070661_100080981 Ga0070661_1000809812 134
41 3300005354 Ga0070675_100072645 Ga0070675_1000726453 134
42 3300005367 Ga0070667_100002774 Ga0070667_10000277414 134
43 3300005543 Ga0070672_100004109 Ga0070672_1000041094 134
44 3300005544 Ga0070686_100006599 Ga0070686_1000065995 134
45 3300005564 Ga0070664_100050415 Ga0070664_1000504152 134
46 3300005617 Ga0068859_100563060 Ga0068859_1005630602 134
47 3300005618 Ga0068864_101243077 Ga0068864_1012430772 134
48 3300005842 Ga0068858_100057653 Ga0068858_1000576532 134
49 3300006237 Ga0097621_100118819 Ga0097621_1001188192 134
50 3300006237 Ga0097621_100416233 Ga0097621_1004162332 134
51 3300006358 Ga0068871_100066546 Ga0068871_1000665463 134
52 3300006844 Ga0075428_100005542 Ga0075428_1000055427 134
53 3300006846 Ga0075430_100121353 Ga0075430_1001213532 134
54 3300006847 Ga0075431_100027965 Ga0075431_1000279653 134
55 3300006871 Ga0075434_100351532 Ga0075434_1003515322 134
56 3300006880 Ga0075429_100003277 Ga0075429_10000327710 134
57 3300006881 Ga0068865_101675208 Ga0068865_1016752082 134
58 3300006914 Ga0075436_100425788 Ga0075436_1004257882 134
59 3300006931 Ga0097620_100563091 Ga0097620_1005630912 134
60 3300007076 Ga0075435_100109402 Ga0075435_1001094022 134
61 3300009098 Ga0105245_10746672 Ga0105245_107466721 134
62 3300009147 Ga0114129_10006379 Ga0114129_1000637913 134
63 3300009147 Ga0114129_10035036 Ga0114129_100350366 134
64 3300009177 Ga0105248_10001794 Ga0105248_100017948 134
65 3300009177 Ga0105248_11010302 Ga0105248_110103022 134
66 3300011119 Ga0105246_10498358 Ga0105246_104983582 134
67 3300013296 Ga0157374_10326686 Ga0157374_103266862 134
68 3300013306 Ga0163162_10031169 Ga0163162_100311692 134
69 3300013308 Ga0157375_10024669 Ga0157375_100246693 134
70 3300014325 Ga0163163_10005666 Ga0163163_100056664 134
71 3300014325 Ga0163163_10014105 Ga0163163_100141053 134
72 3300014326 Ga0157380_11108013 Ga0157380_111080132 134
73 3300014968 Ga0157379_11612568 Ga0157379_116125681 134
74 3300014969 Ga0157376_10247032 Ga0157376_102470322 134
75 3300025903 Ga0207680_10051106 Ga0207680_100511062 134
76 3300025917 Ga0207660_10904253 Ga0207660_109042532 134
77 3300025918 Ga0207662_10103825 Ga0207662_101038251 134
78 3300025920 Ga0207649_10049764 Ga0207649_100497642 134
79 3300025925 Ga0207650_10005233 Ga0207650_100052333 134
80 3300025926 Ga0207659_10703603 Ga0207659_107036031 134
81 3300025931 Ga0207644_10162853 Ga0207644_101628532 134
82 3300025938 Ga0207704_10757743 Ga0207704_107577432 134
83 3300025940 Ga0207691_10018118 Ga0207691_100181185 134
84 3300025941 Ga0207711_10033459 Ga0207711_100334592 134
85 3300025941 Ga0207711_11129816 Ga0207711_111298161 134
86 3300025945 Ga0207679_10026036 Ga0207679_100260363 134
87 3300025960 Ga0207651_10546104 Ga0207651_105461042 134
88 3300025986 Ga0207658_10010690 Ga0207658_100106905 134
89 3300026023 Ga0207677_10066907 Ga0207677_100669072 134
90 3300026035 Ga0207703_10136077 Ga0207703_101360772 134
91 3300026035 Ga0207703_10185762 Ga0207703_101857622 134
92 3300026088 Ga0207641_10074355 Ga0207641_100743552 134
93 3300026088 Ga0207641_10142353 Ga0207641_101423532 134
94 3300026121 Ga0207683_10062420 Ga0207683_100624203 134
95 3300028381 Ga0268264_11139909 Ga0268264_111399091 134
96 3300035120 Ga0373957_0138285 Ga0373957_0138285_528_932 134
97 3300036401 Ga0373937_0080759 Ga0373937_0080759_335_739 134
98 3300046462 Ga0495651_0402930 Ga0495651_0402930_176_580 134
99 3300046473 Ga0495582_0064836 Ga0495582_0064836_1185_1589 134
100 3300046499 Ga0495594_0488192 Ga0495594_0488192_153_557 134
101 3300046674 Ga0495588_0341110 Ga0495588_0341110_85_489 134
102 3300046683 Ga0495658_0012933 Ga0495658_0012933_1735_2139 134
103 3300047471 Ga0495684_0038621 Ga0495684_0038621_238_642 134
104 3300049575 Ga0501039_1584911 Ga0501039_1584911_33_437 134
105 3300049588 Ga0501072_0442010 Ga0501072_0442010_337_741 134
106 3300049591 Ga0501075_0211570 Ga0501075_0211570_960_1364 134
107 3300049592 Ga0501076_1103565 Ga0501076_1103565_39_443 134
108 3300049593 Ga0501077_0196378 Ga0501077_0196378_226_630 134
109 3300049743 Ga0501081_0636139 Ga0501081_0636139_37_441 134
110 3300049822 Ga0501035_0893908 Ga0501035_0893908_205_609 134
111 3300049824 Ga0501045_0352038 Ga0501045_0352038_531_935 134
112 3300050507 nmdc:mga05p37_36455_c1 nmdc:mga05p37_36455_c1_2364_2768 134
113 3300050507 nmdc:mga05p37_68397_c1 nmdc:mga05p37_68397_c1_448_852 134
114 3300050508 nmdc:mga09592_5261_c1 nmdc:mga09592_5261_c1_5867_6271 134
115 3300050509 nmdc:mga0qj67_411870_c1 nmdc:mga0qj67_411870_c1_546_950 134
116 3300050509 nmdc:mga0qj67_497989_c1 nmdc:mga0qj67_497989_c1_57_461 134
117 3300050510 nmdc:mga06r32_71911_c1 nmdc:mga06r32_71911_c1_1079_1483 134
118 3300050512 nmdc:mga0n895_1241189_c1 nmdc:mga0n895_1241189_c1_259_663 134
119 3300050513 nmdc:mga0rr50_88036_c1 nmdc:mga0rr50_88036_c1_216_620 134
120 3300005290 Ga0065712_10290937 Ga0065712_102909372 135
121 3300005329 Ga0070683_100761316 Ga0070683_1007613162 135
122 3300005331 Ga0070670_100036231 Ga0070670_1000362314 135
123 3300005334 Ga0068869_100349504 Ga0068869_1003495042 135
124 3300005336 Ga0070680_100533561 Ga0070680_1005335612 135
125 3300005338 Ga0068868_100464314 Ga0068868_1004643142 135
126 3300005340 Ga0070689_100016656 Ga0070689_1000166562 135
127 3300005343 Ga0070687_100059797 Ga0070687_1000597973 135
128 3300005353 Ga0070669_100859548 Ga0070669_1008595481 135
129 3300005354 Ga0070675_100072348 Ga0070675_1000723484 135
130 3300005354 Ga0070675_100075557 Ga0070675_1000755572 135
131 3300005364 Ga0070673_101070688 Ga0070673_1010706881 135
132 3300005365 Ga0070688_100038140 Ga0070688_1000381402 135
133 3300005366 Ga0070659_100115869 Ga0070659_1001158692 135
134 3300005438 Ga0070701_10106417 Ga0070701_101064172 135
135 3300005438 Ga0070701_10647979 Ga0070701_106479791 135
136 3300005440 Ga0070705_100507414 Ga0070705_1005074142 135
137 3300005440 Ga0070705_100589355 Ga0070705_1005893551 135
138 3300005440 Ga0070705_101060205 Ga0070705_1010602052 135
139 3300005444 Ga0070694_100462166 Ga0070694_1004621662 135
140 3300005445 Ga0070708_100103463 Ga0070708_1001034633 135
141 3300005466 Ga0070685_10365854 Ga0070685_103658542 135
142 3300005468 Ga0070707_102066961 Ga0070707_1020669611 135
143 3300005471 Ga0070698_100980894 Ga0070698_1009808941 135
144 3300005518 Ga0070699_100088539 Ga0070699_1000885393 135
145 3300005544 Ga0070686_100107709 Ga0070686_1001077093 135
146 3300005546 Ga0070696_100073296 Ga0070696_1000732962 135
147 3300005547 Ga0070693_100484770 Ga0070693_1004847701 135
148 3300005564 Ga0070664_100025650 Ga0070664_1000256503 135
149 3300005578 Ga0068854_101029679 Ga0068854_1010296792 135
150 3300005616 Ga0068852_101417415 Ga0068852_1014174152 135
151 3300005617 Ga0068859_100070855 Ga0068859_1000708552 135
152 3300005618 Ga0068864_100361972 Ga0068864_1003619722 135
153 3300005719 Ga0068861_100242460 Ga0068861_1002424602 135
154 3300005842 Ga0068858_100056245 Ga0068858_1000562454 135
155 3300005985 Ga0081539_10228045 Ga0081539_102280452 135
156 3300006844 Ga0075428_100002901 Ga0075428_10000290116 135
157 3300006844 Ga0075428_100433024 Ga0075428_1004330242 135
158 3300006844 Ga0075428_101571604 Ga0075428_1015716042 135
159 3300006846 Ga0075430_100003290 Ga0075430_10000329013 135
160 3300006846 Ga0075430_100168650 Ga0075430_1001686502 135
161 3300006846 Ga0075430_100407113 Ga0075430_1004071132 135
162 3300006847 Ga0075431_100015548 Ga0075431_1000155484 135
163 3300006847 Ga0075431_100130942 Ga0075431_1001309423 135
164 3300006852 Ga0075433_10013063 Ga0075433_100130635 135
165 3300006852 Ga0075433_10380461 Ga0075433_103804612 135
166 3300006871 Ga0075434_100079657 Ga0075434_1000796571 135
167 3300006871 Ga0075434_100434827 Ga0075434_1004348272 135
168 3300006880 Ga0075429_100002327 Ga0075429_1000023272 135
169 3300006880 Ga0075429_100553821 Ga0075429_1005538212 135
170 3300006914 Ga0075436_100354863 Ga0075436_1003548632 135
171 3300006931 Ga0097620_100070854 Ga0097620_1000708542 135
172 3300007076 Ga0075435_100078508 Ga0075435_1000785083 135
173 3300009094 Ga0111539_10003937 Ga0111539_1000393719 135
174 3300009094 Ga0111539_10046672 Ga0111539_100466722 135
175 3300009147 Ga0114129_10005884 Ga0114129_1000588410 135
176 3300009147 Ga0114129_10030531 Ga0114129_100305312 135
177 3300009147 Ga0114129_10052791 Ga0114129_100527915 135
178 3300009177 Ga0105248_10836330 Ga0105248_108363301 135
179 3300009177 Ga0105248_11302388 Ga0105248_113023881 135
180 3300009553 Ga0105249_12752150 Ga0105249_127521501 135
181 3300014325 Ga0163163_10039079 Ga0163163_100390793 135
182 3300014325 Ga0163163_11609086 Ga0163163_116090862 135
183 3300014326 Ga0157380_10792656 Ga0157380_107926561 135
184 3300014745 Ga0157377_10038813 Ga0157377_100388133 135
185 3300014745 Ga0157377_10139755 Ga0157377_101397552 135
186 3300025922 Ga0207646_10317005 Ga0207646_103170052 135
187 3300025923 Ga0207681_10126211 Ga0207681_101262113 135
188 3300025925 Ga0207650_10043547 Ga0207650_100435473 135
189 3300025926 Ga0207659_10058328 Ga0207659_100583283 135
190 3300025926 Ga0207659_10084610 Ga0207659_100846103 135
191 3300025932 Ga0207690_10308483 Ga0207690_103084832 135
192 3300025940 Ga0207691_10009942 Ga0207691_100099423 135
193 3300025942 Ga0207689_10546287 Ga0207689_105462872 135
194 3300025945 Ga0207679_10020751 Ga0207679_100207514 135
195 3300025945 Ga0207679_10148976 Ga0207679_101489763 135
196 3300025960 Ga0207651_10348771 Ga0207651_103487712 135
197 3300026023 Ga0207677_10942950 Ga0207677_109429502 135
198 3300026035 Ga0207703_10047218 Ga0207703_100472184 135
199 3300026075 Ga0207708_11725404 Ga0207708_117254041 135
200 3300026095 Ga0207676_10163889 Ga0207676_101638893 135
201 3300026118 Ga0207675_100128939 Ga0207675_1001289392 135
202 3300026118 Ga0207675_100890864 Ga0207675_1008908642 135
203 3300027907 Ga0207428_10015465 Ga0207428_100154657 135
204 3300027907 Ga0207428_10189886 Ga0207428_101898862 135
205 3300031731 Ga0307405_10016886 Ga0307405_100168863 135
206 3300031824 Ga0307413_10034670 Ga0307413_100346702 135
207 3300031901 Ga0307406_10061754 Ga0307406_100617542 135
208 3300031911 Ga0307412_10051980 Ga0307412_100519802 135
209 3300031995 Ga0307409_100085397 Ga0307409_1000853973 135
210 3300032002 Ga0307416_100007987 Ga0307416_1000079873 135
211 3300032002 Ga0307416_100213190 Ga0307416_1002131902 135
212 3300032004 Ga0307414_10088192 Ga0307414_100881922 135
213 3300032126 Ga0307415_100043057 Ga0307415_1000430573 135
214 3300032126 Ga0307415_100138449 Ga0307415_1001384493 135
215 3300035172 Ga0373955_0241805 Ga0373955_0241805_154_561 135
216 3300037068 Ga0373925_0238122 Ga0373925_0238122_539_946 135
217 3300045051 Ga0451576_0642772 Ga0451576_0642772_213_632 135
218 3300046459 Ga0495629_0497621 Ga0495629_0497621_252_659 135
219 3300046517 Ga0495630_0487607 Ga0495630_0487607_416_823 135
220 3300046525 Ga0495663_0018559 Ga0495663_0018559_782_1189 135
221 3300046528 Ga0495642_0001277 Ga0495642_0001277_4766_5173 135
222 3300046537 Ga0495598_0017364 Ga0495598_0017364_1330_1737 135
223 3300046538 Ga0495609_0051748 Ga0495609_0051748_348_755 135
224 3300046664 Ga0495659_0016769 Ga0495659_0016769_1081_1488 135
225 3300046689 Ga0495613_1097145 Ga0495613_1097145_91_498 135
226 3300046691 Ga0495670_0621349 Ga0495670_0621349_73_480 135
227 3300046809 Ga0495600_0615694 Ga0495600_0615694_231_638 135
228 3300047318 Ga0495636_0022113 Ga0495636_0022113_2011_2418 135
229 3300047471 Ga0495684_0493756 Ga0495684_0493756_256_663 135
230 3300048088 Ga0495602_0344008 Ga0495602_0344008_473_880 135
231 3300048091 Ga0495626_0398704 Ga0495626_0398704_31_483 135
232 3300049573 Ga0501037_0643591 Ga0501037_0643591_53_472 135
233 3300049576 Ga0501040_0084567 Ga0501040_0084567_348_767 135
234 3300049577 Ga0501041_0130967 Ga0501041_0130967_911_1330 135
235 3300049578 Ga0501042_0290666 Ga0501042_0290666_276_695 135
236 3300049580 Ga0501046_0360355 Ga0501046_0360355_42_461 135
237 3300049582 Ga0501048_0292634 Ga0501048_0292634_566_985 135
238 3300049588 Ga0501072_0065539 Ga0501072_0065539_40_459 135
239 3300049591 Ga0501075_0004771 Ga0501075_0004771_167_586 135
240 3300049592 Ga0501076_0101988 Ga0501076_0101988_660_1079 135
241 3300049593 Ga0501077_0259543 Ga0501077_0259543_196_615 135
242 3300049653 Ga0501206_059139 Ga0501206_059139_124_531 135
243 3300049688 Ga0501259_174883 Ga0501259_174883_106_513 135
244 3300049741 Ga0501079_0101132 Ga0501079_0101132_1046_1465 135
245 3300049743 Ga0501081_0055350 Ga0501081_0055350_594_1013 135
246 3300049760 Ga0501263_032622 Ga0501263_032622_43_462 135
247 3300049822 Ga0501035_0216737 Ga0501035_0216737_1046_1465 135
248 3300050507 nmdc:mga05p37_107155_c1 nmdc:mga05p37_107155_c1_1775_2182 135
249 3300050507 nmdc:mga05p37_21187_c1 nmdc:mga05p37_21187_c1_5398_5805 135
250 3300050508 nmdc:mga09592_137533_c1 nmdc:mga09592_137533_c1_88_495 135
251 3300050509 nmdc:mga0qj67_61777_c1 nmdc:mga0qj67_61777_c1_1705_2112 135
252 3300050510 nmdc:mga06r32_67701_c1 nmdc:mga06r32_67701_c1_1902_2321 135
253 3300050510 nmdc:mga06r32_78506_c1 nmdc:mga06r32_78506_c1_200_607 135
254 3300050511 nmdc:mga08y16_270702_c1 nmdc:mga08y16_270702_c1_1044_1451 135
255 3300050511 nmdc:mga08y16_37906_c1 nmdc:mga08y16_37906_c1_3104_3511 135
256 3300050511 nmdc:mga08y16_38404_c1 nmdc:mga08y16_38404_c1_1791_2198 135
257 3300050512 nmdc:mga0n895_342694_c1 nmdc:mga0n895_342694_c1_308_715 135
258 3300050513 nmdc:mga0rr50_235648_c1 nmdc:mga0rr50_235648_c1_556_963 135
259 3300050513 nmdc:mga0rr50_67477_c1 nmdc:mga0rr50_67477_c1_551_958 135
260 3300050514 nmdc:mga08x19_1113496_c1 nmdc:mga08x19_1113496_c1_104_511 135
261 3300050515 nmdc:mga0a205_206857_c1 nmdc:mga0a205_206857_c1_1361_1768 135
262 3300050515 nmdc:mga0a205_3445_c1 nmdc:mga0a205_3445_c1_12530_12937 135
263 3300050515 nmdc:mga0a205_395650_c1 nmdc:mga0a205_395650_c1_748_1155 135
264 3300053736 Ga0500599_007074 Ga0500599_007074_495_902 135
265 3300054114 Ga0501084_0123508 Ga0501084_0123508_1172_1591 135
266 3300060353 Ga0501082_1523488 Ga0501082_1523488_108_527 135
267 3300061734 Ga0530510_0177620 Ga0530510_0177620_63_482 135
268 3300005364 Ga0070673_100531525 Ga0070673_1005315252 136
269 3300005459 Ga0068867_101055704 Ga0068867_1010557042 136
270 3300005543 Ga0070672_100545830 Ga0070672_1005458301 136
271 3300005718 Ga0068866_10245590 Ga0068866_102455902 136
272 3300005719 Ga0068861_102537982 Ga0068861_1025379821 136
273 3300006237 Ga0097621_100122171 Ga0097621_1001221714 136
274 3300006358 Ga0068871_100004086 Ga0068871_1000040864 136
275 3300006358 Ga0068871_100009359 Ga0068871_1000093598 136
276 3300009098 Ga0105245_10813127 Ga0105245_108131272 136
277 3300009176 Ga0105242_10287264 Ga0105242_102872642 136
278 3300009177 Ga0105248_10112789 Ga0105248_101127892 136
279 3300009177 Ga0105248_10959976 Ga0105248_109599761 136
280 3300014969 Ga0157376_10015817 Ga0157376_100158173 136
281 3300025899 Ga0207642_10140711 Ga0207642_101407111 136
282 3300025899 Ga0207642_10490080 Ga0207642_104900802 136
283 3300025934 Ga0207686_10337406 Ga0207686_103374062 136
284 3300025937 Ga0207669_10336251 Ga0207669_103362512 136
285 3300025940 Ga0207691_10111783 Ga0207691_101117835 136
286 3300025941 Ga0207711_10999594 Ga0207711_109995942 136
287 3300025960 Ga0207651_10531336 Ga0207651_105313362 136
288 3300025986 Ga0207658_11554878 Ga0207658_115548781 136
289 3300026088 Ga0207641_10192942 Ga0207641_101929422 136
290 3300026089 Ga0207648_11022019 Ga0207648_110220191 136
291 3300028381 Ga0268264_11217447 Ga0268264_112174472 136
292 3300035116 Ga0373945_0231452 Ga0373945_0231452_347_757 136
293 3300037068 Ga0373925_0643519 Ga0373925_0643519_287_697 136
294 3300037068 Ga0373925_0869152 Ga0373925_0869152_205_633 136
295 3300046463 Ga0495653_0362211 Ga0495653_0362211_74_502 136
296 3300046514 Ga0495618_0198546 Ga0495618_0198546_686_1114 136
297 3300046517 Ga0495630_0222724 Ga0495630_0222724_164_592 136
298 3300046535 Ga0495586_0327302 Ga0495586_0327302_329_757 136
299 3300046663 Ga0495635_0100725 Ga0495635_0100725_1411_1839 136
300 3300046681 Ga0495647_0198128 Ga0495647_0198128_210_620 136
301 3300046683 Ga0495658_0793460 Ga0495658_0793460_149_559 136
302 3300046689 Ga0495613_0344264 Ga0495613_0344264_67_477 136
303 3300047319 Ga0495674_0404891 Ga0495674_0404891_115_525 136
304 3300047322 Ga0495680_0000399 Ga0495680_0000399_17092_17520 136
305 3300047471 Ga0495684_0153395 Ga0495684_0153395_334_762 136
306 3300048903 Ga0496100_0015639 Ga0496100_0015639_1205_1615 136
307 3300048904 Ga0496101_0000290 Ga0496101_0000290_26157_26567 136
308 3300048907 Ga0496104_0153074 Ga0496104_0153074_750_1160 136
309 3300048908 Ga0496105_0215363 Ga0496105_0215363_526_936 136
310 3300048910 Ga0496107_0024003 Ga0496107_0024003_3429_3839 136
311 3300053103 Ga0500555_000392 Ga0500555_000392_8664_9104 136
312 3300053730 Ga0500645_000220 Ga0500645_000220_28967_29407 136
313 3300059421 Ga0590071_001060 Ga0590071_001060_3741_4151 136
314 3300059423 Ga0590074_011851 Ga0590074_011851_949_1359 136
315 3300059424 Ga0590075_002771 Ga0590075_002771_3023_3433 136
316 3300059426 Ga0590077_000399 Ga0590077_000399_9309_9719 136
317 3300005354 Ga0070675_101153212 Ga0070675_1011532122 137
318 3300005844 Ga0068862_100746486 Ga0068862_1007464861 137
319 3300005981 Ga0081538_10064500 Ga0081538_100645002 137
320 3300006844 Ga0075428_100124605 Ga0075428_1001246052 137
321 3300006844 Ga0075428_101196402 Ga0075428_1011964022 137
322 3300006846 Ga0075430_100019613 Ga0075430_1000196137 137
323 3300006847 Ga0075431_100067173 Ga0075431_1000671735 137
324 3300006880 Ga0075429_100539535 Ga0075429_1005395352 137
325 3300025926 Ga0207659_11588712 Ga0207659_115887121 137
326 3300026075 Ga0207708_10266025 Ga0207708_102660251 137
327 3300027665 Ga0209983_1054296 Ga0209983_10542961 137
328 3300031852 Ga0307410_10059355 Ga0307410_100593552 137
329 3300031852 Ga0307410_10107587 Ga0307410_101075872 137
330 3300031903 Ga0307407_10089475 Ga0307407_100894753 137
331 3300031911 Ga0307412_10072569 Ga0307412_100725692 137
332 3300031995 Ga0307409_100265543 Ga0307409_1002655433 137
333 3300032002 Ga0307416_100098982 Ga0307416_1000989822 137
334 3300042003 Ga0439443_020710 Ga0439443_020710_564_998 137
335 3300042125 Ga0450923_008659 Ga0450923_008659_349_783 137
336 3300049591 Ga0501075_0622973 Ga0501075_0622973_70_495 137
337 3300050508 nmdc:mga09592_149462_c1 nmdc:mga09592_149462_c1_1405_1821 137
338 3300050509 nmdc:mga0qj67_8760_c1 nmdc:mga0qj67_8760_c1_3170_3586 137
339 3300050510 nmdc:mga06r32_40386_c1 nmdc:mga06r32_40386_c1_909_1325 137
340 3300050510 nmdc:mga06r32_594613_c1 nmdc:mga06r32_594613_c1_357_773 137
341 3300059421 Ga0590071_010104 Ga0590071_010104_1270_1683 137
342 3300059426 Ga0590077_003099 Ga0590077_003099_974_1387 137
343 3300035083 Ga0373926_0000467 Ga0373926_0000467_3945_4370 138
344 3300035089 Ga0373944_0023150 Ga0373944_0023150_156_581 138
345 3300035113 Ga0373936_0063562 Ga0373936_0063562_1062_1487 138
346 3300035116 Ga0373945_0020567 Ga0373945_0020567_506_931 138
347 3300035118 Ga0373954_0099979 Ga0373954_0099979_834_1259 138
348 3300035119 Ga0373956_0177943 Ga0373956_0177943_450_875 138
349 3300035170 Ga0373943_0036408 Ga0373943_0036408_1261_1686 138
350 3300035171 Ga0373946_0007998 Ga0373946_0007998_193_618 138
351 3300035172 Ga0373955_0146517 Ga0373955_0146517_17_442 138
352 3300035410 Ga0373924_0006388 Ga0373924_0006388_2733_3158 138
353 3300035692 Ga0373935_0156250 Ga0373935_0156250_1061_1486 138
354 3300035695 Ga0373927_0007496 Ga0373927_0007496_2186_2611 138
355 3300035724 Ga0373933_0064444 Ga0373933_0064444_945_1370 138
356 3300036401 Ga0373937_0271599 Ga0373937_0271599_841_1266 138
357 3300037068 Ga0373925_0010099 Ga0373925_0010099_4068_4493 138
358 3300046452 Ga0495617_010868 Ga0495617_010868_1380_1805 138
359 3300046454 Ga0495592_0089707 Ga0495592_0089707_939_1364 138
360 3300046455 Ga0495603_0050120 Ga0495603_0050120_1480_1905 138
361 3300046458 Ga0495591_010442 Ga0495591_010442_1366_1791 138
362 3300046459 Ga0495629_0115970 Ga0495629_0115970_885_1310 138
363 3300046461 Ga0495641_0068805 Ga0495641_0068805_309_734 138
364 3300046462 Ga0495651_0010712 Ga0495651_0010712_3355_3780 138
365 3300046463 Ga0495653_0015854 Ga0495653_0015854_4480_4905 138
366 3300046472 Ga0495580_0033904 Ga0495580_0033904_1113_1538 138
367 3300046473 Ga0495582_0014289 Ga0495582_0014289_2554_2979 138
368 3300046475 Ga0495639_0008830 Ga0495639_0008830_2329_2754 138
369 3300046476 Ga0495662_0016599 Ga0495662_0016599_398_823 138
370 3300046491 Ga0495584_0008866 Ga0495584_0008866_374_799 138
371 3300046492 Ga0495585_0007260 Ga0495585_0007260_645_1070 138
372 3300046499 Ga0495594_0006882 Ga0495594_0006882_1713_2138 138
373 3300046501 Ga0495607_0005387 Ga0495607_0005387_2276_2701 138
374 3300046516 Ga0495628_0062639 Ga0495628_0062639_2163_2588 138
375 3300046517 Ga0495630_0121371 Ga0495630_0121371_1222_1647 138
376 3300046523 Ga0495644_0000194 Ga0495644_0000194_6859_7284 138
377 3300046525 Ga0495663_0006200 Ga0495663_0006200_2749_3174 138
378 3300046526 Ga0495666_0093005 Ga0495666_0093005_663_1088 138
379 3300046529 Ga0495652_0027667 Ga0495652_0027667_2098_2523 138
380 3300046531 Ga0495665_0008988 Ga0495665_0008988_2377_2802 138
381 3300046535 Ga0495586_0050687 Ga0495586_0050687_1082_1507 138
382 3300046536 Ga0495587_0014105 Ga0495587_0014105_4554_4979 138
383 3300046538 Ga0495609_0027254 Ga0495609_0027254_2036_2461 138
384 3300046557 Ga0495622_0025454 Ga0495622_0025454_248_673 138
385 3300046558 Ga0495633_0003579 Ga0495633_0003579_1368_1793 138
386 3300046559 Ga0495667_0028506 Ga0495667_0028506_2661_3086 138
387 3300046642 Ga0495634_0406038 Ga0495634_0406038_136_561 138
388 3300046648 Ga0495611_0029144 Ga0495611_0029144_1974_2399 138
389 3300046663 Ga0495635_0074575 Ga0495635_0074575_671_1096 138
390 3300046664 Ga0495659_0001145 Ga0495659_0001145_6964_7389 138
391 3300046674 Ga0495588_0113353 Ga0495588_0113353_437_862 138
392 3300046680 Ga0495646_0080436 Ga0495646_0080436_248_673 138
393 3300046681 Ga0495647_0006635 Ga0495647_0006635_1081_1506 138
394 3300046689 Ga0495613_0162070 Ga0495613_0162070_560_985 138
395 3300046690 Ga0495624_0005904 Ga0495624_0005904_2283_2708 138
396 3300046691 Ga0495670_0001975 Ga0495670_0001975_7377_7802 138
397 3300046692 Ga0495671_0422577 Ga0495671_0422577_148_573 138
398 3300046794 Ga0495589_0036332 Ga0495589_0036332_47_472 138
399 3300046809 Ga0495600_0006963 Ga0495600_0006963_2738_3163 138
400 3300047315 Ga0495581_0006224 Ga0495581_0006224_3444_3869 138
401 3300047317 Ga0495604_0010469 Ga0495604_0010469_4353_4778 138
402 3300047319 Ga0495674_0047890 Ga0495674_0047890_309_734 138
403 3300047321 Ga0495676_0089008 Ga0495676_0089008_558_983 138
404 3300047322 Ga0495680_0005166 Ga0495680_0005166_9208_9633 138
405 3300047446 Ga0495679_171347 Ga0495679_171347_26_451 138
406 3300047470 Ga0495681_0173313 Ga0495681_0173313_51_476 138
407 3300047471 Ga0495684_0009567 Ga0495684_0009567_5373_5798 138
408 3300047673 Ga0495593_0067277 Ga0495593_0067277_436_861 138
409 3300048088 Ga0495602_0044248 Ga0495602_0044248_125_550 138
410 3300048089 Ga0495614_0080661 Ga0495614_0080661_550_975 138
411 3300053084 Ga0495595_0004854 Ga0495595_0004854_2595_3020 138
412 3300053085 Ga0495619_0056821 Ga0495619_0056821_1216_1641 138
413 3300005330 Ga0070690_100014607 Ga0070690_1000146075 139
414 3300005334 Ga0068869_100040493 Ga0068869_1000404933 139
415 3300005335 Ga0070666_10035676 Ga0070666_100356763 139
416 3300005337 Ga0070682_100142101 Ga0070682_1001421012 139
417 3300005338 Ga0068868_100139984 Ga0068868_1001399842 139
418 3300005343 Ga0070687_100140458 Ga0070687_1001404582 139
419 3300005347 Ga0070668_100214715 Ga0070668_1002147152 139
420 3300005355 Ga0070671_100088410 Ga0070671_1000884103 139
421 3300005356 Ga0070674_100223669 Ga0070674_1002236692 139
422 3300005364 Ga0070673_100153938 Ga0070673_1001539383 139
423 3300005366 Ga0070659_100123226 Ga0070659_1001232263 139
424 3300005406 Ga0070703_10169907 Ga0070703_101699072 139
425 3300005434 Ga0070709_10003045 Ga0070709_100030453 139
426 3300005435 Ga0070714_100006355 Ga0070714_1000063553 139
427 3300005436 Ga0070713_100043968 Ga0070713_1000439683 139
428 3300005437 Ga0070710_10031314 Ga0070710_100313143 139
429 3300005438 Ga0070701_10166036 Ga0070701_101660362 139
430 3300005439 Ga0070711_100035477 Ga0070711_1000354773 139
431 3300005440 Ga0070705_100079927 Ga0070705_1000799273 139
432 3300005457 Ga0070662_101230873 Ga0070662_1012308732 139
433 3300005459 Ga0068867_101045807 Ga0068867_1010458071 139
434 3300005466 Ga0070685_10097202 Ga0070685_100972023 139
435 3300005535 Ga0070684_100344868 Ga0070684_1003448682 139
436 3300005535 Ga0070684_100757528 Ga0070684_1007575282 139
437 3300005543 Ga0070672_101071143 Ga0070672_1010711432 139
438 3300005544 Ga0070686_100008864 Ga0070686_1000088645 139
439 3300005547 Ga0070693_100100354 Ga0070693_1001003542 139
440 3300005548 Ga0070665_100095421 Ga0070665_1000954213 139
441 3300005564 Ga0070664_100384557 Ga0070664_1003845572 139
442 3300005614 Ga0068856_100233439 Ga0068856_1002334392 139
443 3300005615 Ga0070702_100473936 Ga0070702_1004739362 139
444 3300005617 Ga0068859_100181871 Ga0068859_1001818713 139
445 3300005618 Ga0068864_100096129 Ga0068864_1000961293 139
446 3300005718 Ga0068866_10199047 Ga0068866_101990472 139
447 3300005719 Ga0068861_101580011 Ga0068861_1015800111 139
448 3300005843 Ga0068860_100381469 Ga0068860_1003814693 139
449 3300005844 Ga0068862_101550222 Ga0068862_1015502222 139
450 3300005937 Ga0081455_10605103 Ga0081455_106051031 139
451 3300006028 Ga0070717_10058028 Ga0070717_100580283 139
452 3300006163 Ga0070715_10028782 Ga0070715_100287822 139
453 3300006173 Ga0070716_100003613 Ga0070716_1000036133 139
454 3300006175 Ga0070712_100151630 Ga0070712_1001516303 139
455 3300006237 Ga0097621_100076553 Ga0097621_1000765533 139
456 3300006358 Ga0068871_100058785 Ga0068871_1000587853 139
457 3300006852 Ga0075433_10082863 Ga0075433_100828633 139
458 3300006852 Ga0075433_10426270 Ga0075433_104262702 139
459 3300006852 Ga0075433_10552178 Ga0075433_105521782 139
460 3300006871 Ga0075434_100098341 Ga0075434_1000983412 139
461 3300006914 Ga0075436_100030775 Ga0075436_1000307752 139
462 3300006914 Ga0075436_100580529 Ga0075436_1005805292 139
463 3300006931 Ga0097620_100181878 Ga0097620_1001818783 139
464 3300007076 Ga0075435_100029012 Ga0075435_1000290121 139
465 3300007076 Ga0075435_100191013 Ga0075435_1001910132 139
466 3300007076 Ga0075435_100314289 Ga0075435_1003142892 139
467 3300009011 Ga0105251_10010416 Ga0105251_100104165 139
468 3300009092 Ga0105250_10154115 Ga0105250_101541152 139
469 3300009094 Ga0111539_10470087 Ga0111539_104700872 139
470 3300009098 Ga0105245_11012962 Ga0105245_110129622 139
471 3300009147 Ga0114129_10009653 Ga0114129_100096535 139
472 3300009148 Ga0105243_10093512 Ga0105243_100935123 139
473 3300009177 Ga0105248_10031696 Ga0105248_100316964 139
474 3300009551 Ga0105238_10070681 Ga0105238_100706813 139
475 3300010375 Ga0105239_11418221 Ga0105239_114182212 139
476 3300012492 Ga0157335_1003155 Ga0157335_10031552 139
477 3300012502 Ga0157347_1001471 Ga0157347_10014712 139
478 3300012512 Ga0157327_1009899 Ga0157327_10098992 139
479 3300013296 Ga0157374_10468874 Ga0157374_104688742 139
480 3300013296 Ga0157374_11098293 Ga0157374_110982931 139
481 3300013296 Ga0157374_11217466 Ga0157374_112174661 139
482 3300013297 Ga0157378_10176862 Ga0157378_101768623 139
483 3300013306 Ga0163162_10078121 Ga0163162_100781213 139
484 3300013306 Ga0163162_10223407 Ga0163162_102234073 139
485 3300013308 Ga0157375_10168969 Ga0157375_101689693 139
486 3300014325 Ga0163163_10244548 Ga0163163_102445483 139
487 3300014745 Ga0157377_10094013 Ga0157377_100940131 139
488 3300014968 Ga0157379_10201412 Ga0157379_102014122 139
489 3300014968 Ga0157379_10207352 Ga0157379_102073522 139
490 3300017792 Ga0163161_10768627 Ga0163161_107686272 139
491 3300025735 Ga0207713_1061561 Ga0207713_10615612 139
492 3300025898 Ga0207692_10015940 Ga0207692_100159403 139
493 3300025899 Ga0207642_10120835 Ga0207642_101208351 139
494 3300025900 Ga0207710_10024606 Ga0207710_100246062 139
495 3300025901 Ga0207688_10028735 Ga0207688_100287353 139
496 3300025905 Ga0207685_10002707 Ga0207685_100027073 139
497 3300025906 Ga0207699_10001859 Ga0207699_100018593 139
498 3300025915 Ga0207693_10036145 Ga0207693_100361453 139
499 3300025916 Ga0207663_10019234 Ga0207663_100192343 139
500 3300025916 Ga0207663_10135741 Ga0207663_101357412 139
501 3300025918 Ga0207662_10037005 Ga0207662_100370052 139
502 3300025923 Ga0207681_10230035 Ga0207681_102300353 139
503 3300025924 Ga0207694_10168251 Ga0207694_101682512 139
504 3300025927 Ga0207687_10015275 Ga0207687_100152753 139
505 3300025927 Ga0207687_10754400 Ga0207687_107544002 139
506 3300025928 Ga0207700_10031736 Ga0207700_100317363 139
507 3300025929 Ga0207664_10014021 Ga0207664_100140213 139
508 3300025931 Ga0207644_10020295 Ga0207644_100202953 139
509 3300025932 Ga0207690_10059770 Ga0207690_100597702 139
510 3300025933 Ga0207706_10737080 Ga0207706_107370802 139
511 3300025934 Ga0207686_10133387 Ga0207686_101333872 139
512 3300025935 Ga0207709_10069957 Ga0207709_100699573 139
513 3300025937 Ga0207669_10346884 Ga0207669_103468842 139
514 3300025938 Ga0207704_10129753 Ga0207704_101297533 139
515 3300025939 Ga0207665_10010796 Ga0207665_100107966 139
516 3300025940 Ga0207691_10093609 Ga0207691_100936092 139
517 3300025941 Ga0207711_10011217 Ga0207711_100112175 139
518 3300025942 Ga0207689_10054554 Ga0207689_100545543 139
519 3300025944 Ga0207661_10849638 Ga0207661_108496382 139
520 3300025945 Ga0207679_10339848 Ga0207679_103398482 139
521 3300025960 Ga0207651_10171106 Ga0207651_101711062 139
522 3300025961 Ga0207712_10472090 Ga0207712_104720902 139
523 3300025972 Ga0207668_10183651 Ga0207668_101836512 139
524 3300026035 Ga0207703_10119645 Ga0207703_101196452 139
525 3300026067 Ga0207678_10007714 Ga0207678_100077145 139
526 3300026088 Ga0207641_10124275 Ga0207641_101242753 139
527 3300026088 Ga0207641_11771034 Ga0207641_117710342 139
528 3300026089 Ga0207648_10475622 Ga0207648_104756222 139
529 3300026121 Ga0207683_10005584 Ga0207683_100055844 139
530 3300027907 Ga0207428_10110621 Ga0207428_101106213 139
531 3300028379 Ga0268266_10013545 Ga0268266_100135454 139
532 3300028380 Ga0268265_10509228 Ga0268265_105092282 139
533 3300028381 Ga0268264_10132374 Ga0268264_101323742 139
534 3300034816 Ga0373930_0018027 Ga0373930_0018027_693_1121 139
535 3300034818 Ga0373950_0015153 Ga0373950_0015153_115_543 139
536 3300034819 Ga0373958_0036482 Ga0373958_0036482_354_782 139
537 3300034820 Ga0373959_0017523 Ga0373959_0017523_506_934 139
538 3300034957 Ga0373938_0053583 Ga0373938_0053583_485_913 139
539 3300035091 Ga0373951_0115910 Ga0373951_0115910_222_650 139
540 3300035092 Ga0373952_0006102 Ga0373952_0006102_554_982 139
541 3300035112 Ga0373932_0002850 Ga0373932_0002850_1444_1872 139
542 3300035115 Ga0373941_0032799 Ga0373941_0032799_359_787 139
543 3300035116 Ga0373945_0004426 Ga0373945_0004426_26_445 139
544 3300035170 Ga0373943_0007096 Ga0373943_0007096_4267_4686 139
545 3300035171 Ga0373946_0008924 Ga0373946_0008924_3174_3593 139
546 3300035241 Ga0373961_0080101 Ga0373961_0080101_392_820 139
547 3300035242 Ga0373962_0005442 Ga0373962_0005442_2577_3005 139
548 3300035691 Ga0373931_0002000 Ga0373931_0002000_5027_5455 139
549 3300035691 Ga0373931_0178067 Ga0373931_0178067_739_1167 139
550 3300035692 Ga0373935_0075240 Ga0373935_0075240_59_478 139
551 3300035695 Ga0373927_0056853 Ga0373927_0056853_492_911 139
552 3300035725 Ga0373947_0016221 Ga0373947_0016221_604_1023 139
553 3300037068 Ga0373925_0054869 Ga0373925_0054869_564_983 139
554 3300046455 Ga0495603_0181250 Ga0495603_0181250_564_983 139
555 3300046459 Ga0495629_0004767 Ga0495629_0004767_9070_9489 139
556 3300046473 Ga0495582_0000612 Ga0495582_0000612_18554_18973 139
557 3300046476 Ga0495662_0639075 Ga0495662_0639075_84_503 139
558 3300046499 Ga0495594_0059541 Ga0495594_0059541_1015_1434 139
559 3300046557 Ga0495622_0044804 Ga0495622_0044804_574_993 139
560 3300046663 Ga0495635_0133259 Ga0495635_0133259_156_575 139
561 3300046674 Ga0495588_0035444 Ga0495588_0035444_969_1388 139
562 3300046681 Ga0495647_0015759 Ga0495647_0015759_1743_2162 139
563 3300046683 Ga0495658_0005405 Ga0495658_0005405_1894_2313 139
564 3300046809 Ga0495600_0204163 Ga0495600_0204163_347_766 139
565 3300047315 Ga0495581_0092779 Ga0495581_0092779_61_480 139
566 3300047321 Ga0495676_0035932 Ga0495676_0035932_1459_1878 139
567 3300047322 Ga0495680_0005187 Ga0495680_0005187_10390_10809 139
568 3300048904 Ga0496101_0139232 Ga0496101_0139232_180_608 139
569 3300048905 Ga0496102_0148204 Ga0496102_0148204_134_562 139
570 3300048905 Ga0496102_0276915 Ga0496102_0276915_133_561 139
571 3300048905 Ga0496102_1366062 Ga0496102_1366062_180_608 139
572 3300048906 Ga0496103_0017226 Ga0496103_0017226_1072_1500 139
573 3300048906 Ga0496103_0215207 Ga0496103_0215207_507_935 139
574 3300048907 Ga0496104_0305751 Ga0496104_0305751_275_703 139
575 3300048907 Ga0496104_0422784 Ga0496104_0422784_325_753 139
576 3300048908 Ga0496105_0149162 Ga0496105_0149162_322_750 139
577 3300048908 Ga0496105_0520577 Ga0496105_0520577_39_467 139
578 3300048909 Ga0496106_0546469 Ga0496106_0546469_322_750 139
579 3300048910 Ga0496107_0043616 Ga0496107_0043616_1456_1884 139
580 3300048911 Ga0496108_0122691 Ga0496108_0122691_1480_1908 139
581 3300048912 Ga0496109_0030825 Ga0496109_0030825_2082_2510 139
582 3300048912 Ga0496109_0178876 Ga0496109_0178876_492_920 139
583 3300048913 Ga0496110_0059126 Ga0496110_0059126_1477_1905 139
584 3300048913 Ga0496110_0083757 Ga0496110_0083757_20_448 139
585 3300048914 Ga0496111_0038001 Ga0496111_0038001_95_523 139
586 3300048914 Ga0496111_0091797 Ga0496111_0091797_1333_1761 139
587 3300048915 Ga0496112_0032467 Ga0496112_0032467_3141_3569 139
588 3300048915 Ga0496112_0440174 Ga0496112_0440174_322_750 139
589 3300048916 Ga0496113_0060944 Ga0496113_0060944_931_1359 139
590 3300048917 Ga0496114_0041803 Ga0496114_0041803_465_893 139
591 3300048917 Ga0496114_0141759 Ga0496114_0141759_1353_1781 139
592 3300048918 Ga0496115_0066251 Ga0496115_0066251_1456_1884 139
593 3300048918 Ga0496115_0274496 Ga0496115_0274496_492_920 139
594 3300050507 nmdc:mga05p37_68016_c1 nmdc:mga05p37_68016_c1_1042_1461 139
595 3300050511 nmdc:mga08y16_538042_c1 nmdc:mga08y16_538042_c1_598_1026 139
596 3300050512 nmdc:mga0n895_20783_c1 nmdc:mga0n895_20783_c1_144_563 139
597 3300050512 nmdc:mga0n895_62410_c1 nmdc:mga0n895_62410_c1_2746_3174 139
598 3300050513 nmdc:mga0rr50_91648_c2 nmdc:mga0rr50_91648_c2_642_1070 139
599 3300050514 nmdc:mga08x19_56550_c1 nmdc:mga08x19_56550_c1_888_1316 139
600 3300050515 nmdc:mga0a205_453771_c1 nmdc:mga0a205_453771_c1_254_682 139
601 3300050515 nmdc:mga0a205_633650_c1 nmdc:mga0a205_633650_c1_252_680 139
602 3300050515 nmdc:mga0a205_8902_c1 nmdc:mga0a205_8902_c1_3174_3593 139
603 3300053085 Ga0495619_0006574 Ga0495619_0006574_2790_3209 139
604 3300000042 ARSoilYngRDRAFT_c00080 ARSoilYngRDRAFT_000805 140
605 3300000043 ARcpr5yngRDRAFT_c000055 ARcpr5yngRDRAFT_0000555 140
606 3300000044 ARSoilOldRDRAFT_c000003 ARSoilOldRDRAFT_00000358 140
607 3300000045 ARCol0oldRDRAFT_c00230 ARCol0oldRDRAFT_002303 140
608 3300000652 ARCol0yngRDRAFT_1000007 ARCol0yngRDRAFT_10000075 140
609 3300001977 JGI24746J21847_1002009 JGI24746J21847_10020093 140
610 3300001989 JGI24739J22299_10000900 JGI24739J22299_100009003 140
611 3300001990 JGI24737J22298_10000509 JGI24737J22298_100005098 140
612 3300001990 JGI24737J22298_10023381 JGI24737J22298_100233811 140
613 3300002073 JGI24745J21846_1000354 JGI24745J21846_10003543 140
614 3300002074 JGI24748J21848_1001508 JGI24748J21848_10015083 140
615 3300002075 JGI24738J21930_10000120 JGI24738J21930_100001207 140
616 3300002076 JGI24749J21850_1003005 JGI24749J21850_10030053 140
617 3300002077 JGI24744J21845_10004657 JGI24744J21845_100046572 140
618 3300002126 JGI24035J26624_1000291 JGI24035J26624_10002914 140
619 3300002239 JGI24034J26672_10000187 JGI24034J26672_100001876 140
620 3300002244 JGI24742J22300_10000029 JGI24742J22300_1000002916 140
621 3300002459 JGI24751J29686_10046468 JGI24751J29686_100464681 140
622 3300003349 JGI26129J50193_1005105 JGI26129J50193_10051051 140
623 3300005276 Ga0065717_1002770 Ga0065717_10027702 140
624 3300005290 Ga0065712_10000690 Ga0065712_100006905 140
625 3300005290 Ga0065712_10001626 Ga0065712_100016263 140
626 3300005290 Ga0065712_10091644 Ga0065712_100916443 140
627 3300005293 Ga0065715_10001262 Ga0065715_100012627 140
628 3300005293 Ga0065715_10147791 Ga0065715_101477912 140
629 3300005328 Ga0070676_10003502 Ga0070676_100035028 140
630 3300005328 Ga0070676_11216047 Ga0070676_112160471 140
631 3300005329 Ga0070683_100000116 Ga0070683_10000011626 140
632 3300005330 Ga0070690_100066294 Ga0070690_1000662943 140
633 3300005331 Ga0070670_100006964 Ga0070670_1000069649 140
634 3300005333 Ga0070677_10000097 Ga0070677_1000009726 140
635 3300005334 Ga0068869_100064378 Ga0068869_1000643783 140
636 3300005335 Ga0070666_10003937 Ga0070666_100039377 140
637 3300005335 Ga0070666_10418473 Ga0070666_104184732 140
638 3300005336 Ga0070680_100001035 Ga0070680_10000103514 140
639 3300005337 Ga0070682_100001635 Ga0070682_1000016354 140
640 3300005338 Ga0068868_100060353 Ga0068868_1000603533 140
641 3300005339 Ga0070660_100034100 Ga0070660_1000341003 140
642 3300005340 Ga0070689_100099054 Ga0070689_1000990543 140
643 3300005341 Ga0070691_10000048 Ga0070691_1000004820 140
644 3300005343 Ga0070687_100017362 Ga0070687_1000173623 140
645 3300005344 Ga0070661_100000228 Ga0070661_10000022840 140
646 3300005344 Ga0070661_100676567 Ga0070661_1006765672 140
647 3300005344 Ga0070661_101077346 Ga0070661_1010773461 140
648 3300005345 Ga0070692_10000050 Ga0070692_100000503 140
649 3300005347 Ga0070668_100010524 Ga0070668_1000105242 140
650 3300005347 Ga0070668_100125603 Ga0070668_1001256033 140
651 3300005353 Ga0070669_100031291 Ga0070669_1000312912 140
652 3300005354 Ga0070675_100000503 Ga0070675_10000050317 140
653 3300005355 Ga0070671_100000720 Ga0070671_1000007209 140
654 3300005355 Ga0070671_100078879 Ga0070671_1000788793 140
655 3300005356 Ga0070674_100000570 Ga0070674_10000057010 140
656 3300005364 Ga0070673_100000045 Ga0070673_10000004521 140
657 3300005365 Ga0070688_100000308 Ga0070688_10000030819 140
658 3300005365 Ga0070688_100069017 Ga0070688_1000690172 140
659 3300005365 Ga0070688_100099040 Ga0070688_1000990402 140
660 3300005366 Ga0070659_100000183 Ga0070659_10000018342 140
661 3300005367 Ga0070667_100003874 Ga0070667_10000387412 140
662 3300005367 Ga0070667_100263573 Ga0070667_1002635733 140
663 3300005406 Ga0070703_10005702 Ga0070703_100057023 140
664 3300005438 Ga0070701_10326768 Ga0070701_103267682 140
665 3300005440 Ga0070705_100001770 Ga0070705_10000177012 140
666 3300005440 Ga0070705_100480256 Ga0070705_1004802562 140
667 3300005441 Ga0070700_100000239 Ga0070700_10000023926 140
668 3300005444 Ga0070694_100003730 Ga0070694_1000037305 140
669 3300005445 Ga0070708_100030075 Ga0070708_1000300753 140
670 3300005445 Ga0070708_101952936 Ga0070708_1019529361 140
671 3300005455 Ga0070663_100000328 Ga0070663_10000032810 140
672 3300005456 Ga0070678_100000576 Ga0070678_10000057610 140
673 3300005457 Ga0070662_100011223 Ga0070662_1000112234 140
674 3300005457 Ga0070662_100056064 Ga0070662_1000560642 140
675 3300005458 Ga0070681_10078407 Ga0070681_100784073 140
676 3300005459 Ga0068867_100000160 Ga0068867_1000001603 140
677 3300005466 Ga0070685_10003069 Ga0070685_100030695 140
678 3300005468 Ga0070707_100889470 Ga0070707_1008894702 140
679 3300005518 Ga0070699_100197400 Ga0070699_1001974003 140
680 3300005530 Ga0070679_100005744 Ga0070679_1000057444 140
681 3300005530 Ga0070679_100454183 Ga0070679_1004541832 140
682 3300005535 Ga0070684_100000352 Ga0070684_10000035227 140
683 3300005535 Ga0070684_101032443 Ga0070684_1010324432 140
684 3300005536 Ga0070697_100463412 Ga0070697_1004634122 140
685 3300005539 Ga0068853_100000902 Ga0068853_1000009027 140
686 3300005543 Ga0070672_100000016 Ga0070672_10000001623 140
687 3300005544 Ga0070686_100006337 Ga0070686_1000063375 140
688 3300005545 Ga0070695_100001458 Ga0070695_1000014584 140
689 3300005545 Ga0070695_100004098 Ga0070695_1000040983 140
690 3300005546 Ga0070696_100006179 Ga0070696_1000061794 140
691 3300005546 Ga0070696_100019661 Ga0070696_1000196613 140
692 3300005547 Ga0070693_100002786 Ga0070693_1000027865 140
693 3300005549 Ga0070704_100014046 Ga0070704_1000140463 140
694 3300005563 Ga0068855_100003504 Ga0068855_1000035049 140
695 3300005564 Ga0070664_100000067 Ga0070664_10000006727 140
696 3300005577 Ga0068857_100003331 Ga0068857_1000033315 140
697 3300005578 Ga0068854_100000131 Ga0068854_1000001313 140
698 3300005578 Ga0068854_100832197 Ga0068854_1008321972 140
699 3300005578 Ga0068854_101423473 Ga0068854_1014234731 140
700 3300005614 Ga0068856_100002341 Ga0068856_10000234112 140
701 3300005615 Ga0070702_100001107 Ga0070702_1000011076 140
702 3300005617 Ga0068859_100003592 Ga0068859_1000035928 140
703 3300005617 Ga0068859_100245070 Ga0068859_1002450703 140
704 3300005618 Ga0068864_100000234 Ga0068864_10000023447 140
705 3300005618 Ga0068864_100059635 Ga0068864_1000596353 140
706 3300005718 Ga0068866_10000552 Ga0068866_100005529 140
707 3300005719 Ga0068861_100000241 Ga0068861_1000002418 140
708 3300005840 Ga0068870_10000009 Ga0068870_1000000977 140
709 3300005841 Ga0068863_100003248 Ga0068863_10000324811 140
710 3300005842 Ga0068858_100001548 Ga0068858_1000015489 140
711 3300005842 Ga0068858_100060688 Ga0068858_1000606883 140
712 3300005843 Ga0068860_100001050 Ga0068860_10000105011 140
713 3300005843 Ga0068860_100094121 Ga0068860_1000941213 140
714 3300005843 Ga0068860_100450495 Ga0068860_1004504952 140
715 3300005844 Ga0068862_100001143 Ga0068862_1000011438 140
716 3300005844 Ga0068862_100034581 Ga0068862_1000345813 140
717 3300006178 Ga0075367_10024435 Ga0075367_100244353 140
718 3300006237 Ga0097621_100000569 Ga0097621_10000056912 140
719 3300006358 Ga0068871_100000012 Ga0068871_100000012102 140
720 3300006852 Ga0075433_10009693 Ga0075433_100096933 140
721 3300006871 Ga0075434_100001007 Ga0075434_10000100710 140
722 3300006871 Ga0075434_100434757 Ga0075434_1004347572 140
723 3300006881 Ga0068865_100000209 Ga0068865_10000020920 140
724 3300006914 Ga0075436_100429462 Ga0075436_1004294621 140
725 3300006931 Ga0097620_100003592 Ga0097620_1000035928 140
726 3300006931 Ga0097620_100245065 Ga0097620_1002450653 140
727 3300007076 Ga0075435_100003730 Ga0075435_1000037303 140
728 3300007076 Ga0075435_100636847 Ga0075435_1006368472 140
729 3300009036 Ga0105244_10013466 Ga0105244_100134663 140
730 3300009092 Ga0105250_10046130 Ga0105250_100461302 140
731 3300009092 Ga0105250_10166835 Ga0105250_101668352 140
732 3300009093 Ga0105240_10073250 Ga0105240_100732504 140
733 3300009094 Ga0111539_10000941 Ga0111539_100009418 140
734 3300009094 Ga0111539_10001081 Ga0111539_1000108126 140
735 3300009098 Ga0105245_10001284 Ga0105245_100012849 140
736 3300009101 Ga0105247_10003522 Ga0105247_100035226 140
737 3300009101 Ga0105247_10086947 Ga0105247_100869473 140
738 3300009148 Ga0105243_10003373 Ga0105243_100033734 140
739 3300009174 Ga0105241_10000053 Ga0105241_1000005341 140
740 3300009176 Ga0105242_10000492 Ga0105242_1000049210 140
741 3300009176 Ga0105242_10090793 Ga0105242_100907933 140
742 3300009177 Ga0105248_10000934 Ga0105248_100009348 140
743 3300009177 Ga0105248_10015418 Ga0105248_100154183 140
744 3300009545 Ga0105237_10014650 Ga0105237_100146506 140
745 3300009545 Ga0105237_10209046 Ga0105237_102090463 140
746 3300009551 Ga0105238_10121677 Ga0105238_101216772 140
747 3300009553 Ga0105249_10003582 Ga0105249_100035825 140
748 3300009553 Ga0105249_10033319 Ga0105249_100333193 140
749 3300010375 Ga0105239_10016523 Ga0105239_100165238 140
750 3300011119 Ga0105246_10000055 Ga0105246_1000005520 140
751 3300011119 Ga0105246_11642420 Ga0105246_116424201 140
752 3300012490 Ga0157322_1003269 Ga0157322_10032692 140
753 3300012492 Ga0157335_1001325 Ga0157335_10013252 140
754 3300012494 Ga0157341_1000580 Ga0157341_10005803 140
755 3300012503 Ga0157313_1000610 Ga0157313_10006103 140
756 3300012507 Ga0157342_1003586 Ga0157342_10035862 140
757 3300012515 Ga0157338_1003272 Ga0157338_10032722 140
758 3300013100 Ga0157373_10006564 Ga0157373_100065643 140
759 3300013102 Ga0157371_10098837 Ga0157371_100988373 140
760 3300013296 Ga0157374_10001308 Ga0157374_100013087 140
761 3300013297 Ga0157378_10000986 Ga0157378_1000098613 140
762 3300013306 Ga0163162_10002432 Ga0163162_100024328 140
763 3300013306 Ga0163162_10116324 Ga0163162_101163243 140
764 3300013307 Ga0157372_10031748 Ga0157372_100317484 140
765 3300013308 Ga0157375_10000933 Ga0157375_1000093311 140
766 3300013308 Ga0157375_10041036 Ga0157375_100410365 140
767 3300014325 Ga0163163_10009027 Ga0163163_100090274 140
768 3300014325 Ga0163163_11171643 Ga0163163_111716432 140
769 3300014326 Ga0157380_10000821 Ga0157380_100008215 140
770 3300014745 Ga0157377_10002329 Ga0157377_100023297 140
771 3300014745 Ga0157377_10371856 Ga0157377_103718562 140
772 3300014968 Ga0157379_10000679 Ga0157379_1000067923 140
773 3300014968 Ga0157379_10056130 Ga0157379_100561301 140
774 3300014969 Ga0157376_10000527 Ga0157376_1000052711 140
775 3300017792 Ga0163161_10000770 Ga0163161_100007709 140
776 3300025271 Ga0207666_1000026 Ga0207666_10000268 140
777 3300025271 Ga0207666_1003755 Ga0207666_10037551 140
778 3300025290 Ga0207673_1001793 Ga0207673_10017933 140
779 3300025315 Ga0207697_10000245 Ga0207697_1000024521 140
780 3300025315 Ga0207697_10042301 Ga0207697_100423012 140
781 3300025728 Ga0207655_1107185 Ga0207655_11071852 140
782 3300025885 Ga0207653_10013162 Ga0207653_100131622 140
783 3300025893 Ga0207682_10000029 Ga0207682_1000002940 140
784 3300025899 Ga0207642_10001640 Ga0207642_100016403 140
785 3300025900 Ga0207710_10127543 Ga0207710_101275432 140
786 3300025901 Ga0207688_10000084 Ga0207688_100000848 140
787 3300025901 Ga0207688_10065550 Ga0207688_100655501 140
788 3300025903 Ga0207680_10001429 Ga0207680_100014297 140
789 3300025903 Ga0207680_10622693 Ga0207680_106226931 140
790 3300025904 Ga0207647_10001299 Ga0207647_100012991 140
791 3300025904 Ga0207647_10018094 Ga0207647_100180945 140
792 3300025907 Ga0207645_10000090 Ga0207645_1000009055 140
793 3300025908 Ga0207643_10000044 Ga0207643_1000004433 140
794 3300025911 Ga0207654_10000143 Ga0207654_100001439 140
795 3300025912 Ga0207707_10000580 Ga0207707_1000058016 140
796 3300025912 Ga0207707_10107069 Ga0207707_101070693 140
797 3300025913 Ga0207695_10065947 Ga0207695_100659473 140
798 3300025914 Ga0207671_10014374 Ga0207671_100143744 140
799 3300025917 Ga0207660_10000653 Ga0207660_1000065312 140
800 3300025917 Ga0207660_10192390 Ga0207660_101923902 140
801 3300025918 Ga0207662_10000104 Ga0207662_1000010436 140
802 3300025918 Ga0207662_10012668 Ga0207662_100126683 140
803 3300025919 Ga0207657_10011813 Ga0207657_100118138 140
804 3300025919 Ga0207657_10048554 Ga0207657_100485543 140
805 3300025920 Ga0207649_10000057 Ga0207649_100000577 140
806 3300025921 Ga0207652_10001436 Ga0207652_1000143612 140
807 3300025921 Ga0207652_10204797 Ga0207652_102047971 140
808 3300025922 Ga0207646_10201309 Ga0207646_102013093 140
809 3300025923 Ga0207681_10000154 Ga0207681_1000015428 140
810 3300025923 Ga0207681_10085889 Ga0207681_100858893 140
811 3300025924 Ga0207694_10137941 Ga0207694_101379413 140
812 3300025925 Ga0207650_10001069 Ga0207650_1000106921 140
813 3300025925 Ga0207650_10121055 Ga0207650_101210553 140
814 3300025926 Ga0207659_10000028 Ga0207659_10000028127 140
815 3300025927 Ga0207687_10000249 Ga0207687_1000024926 140
816 3300025931 Ga0207644_10002109 Ga0207644_100021097 140
817 3300025931 Ga0207644_10149049 Ga0207644_101490492 140
818 3300025932 Ga0207690_10000225 Ga0207690_100002255 140
819 3300025932 Ga0207690_10094151 Ga0207690_100941513 140
820 3300025932 Ga0207690_10421438 Ga0207690_104214381 140
821 3300025933 Ga0207706_10001675 Ga0207706_100016758 140
822 3300025933 Ga0207706_10259347 Ga0207706_102593473 140
823 3300025934 Ga0207686_10001701 Ga0207686_1000170112 140
824 3300025935 Ga0207709_10000291 Ga0207709_100002914 140
825 3300025935 Ga0207709_10218038 Ga0207709_102180381 140
826 3300025936 Ga0207670_10000463 Ga0207670_100004639 140
827 3300025936 Ga0207670_10007249 Ga0207670_100072493 140
828 3300025936 Ga0207670_10103898 Ga0207670_101038983 140
829 3300025937 Ga0207669_10000019 Ga0207669_1000001972 140
830 3300025937 Ga0207669_10615491 Ga0207669_106154911 140
831 3300025938 Ga0207704_10000230 Ga0207704_100002307 140
832 3300025938 Ga0207704_10022698 Ga0207704_100226983 140
833 3300025940 Ga0207691_10000882 Ga0207691_1000088221 140
834 3300025940 Ga0207691_10291881 Ga0207691_102918812 140
835 3300025941 Ga0207711_10001381 Ga0207711_100013814 140
836 3300025941 Ga0207711_10040118 Ga0207711_100401184 140
837 3300025942 Ga0207689_10000228 Ga0207689_1000022822 140
838 3300025942 Ga0207689_10115647 Ga0207689_101156472 140
839 3300025944 Ga0207661_10000107 Ga0207661_1000010741 140
840 3300025944 Ga0207661_10503205 Ga0207661_105032052 140
841 3300025945 Ga0207679_10000026 Ga0207679_1000002675 140
842 3300025945 Ga0207679_10124099 Ga0207679_101240993 140
843 3300025949 Ga0207667_10007642 Ga0207667_100076423 140
844 3300025960 Ga0207651_10000069 Ga0207651_1000006927 140
845 3300025960 Ga0207651_10349307 Ga0207651_103493072 140
846 3300025961 Ga0207712_10000242 Ga0207712_100002429 140
847 3300025961 Ga0207712_10067736 Ga0207712_100677362 140
848 3300025972 Ga0207668_10000049 Ga0207668_1000004947 140
849 3300025981 Ga0207640_10000301 Ga0207640_100003017 140
850 3300025986 Ga0207658_10033574 Ga0207658_100335743 140
851 3300025986 Ga0207658_10728510 Ga0207658_107285102 140
852 3300026023 Ga0207677_10033906 Ga0207677_100339063 140
853 3300026023 Ga0207677_10863146 Ga0207677_108631461 140
854 3300026035 Ga0207703_10002075 Ga0207703_100020759 140
855 3300026035 Ga0207703_10128659 Ga0207703_101286593 140
856 3300026041 Ga0207639_10000413 Ga0207639_1000041321 140
857 3300026041 Ga0207639_10631383 Ga0207639_106313832 140
858 3300026067 Ga0207678_10000920 Ga0207678_1000092021 140
859 3300026067 Ga0207678_10419719 Ga0207678_104197192 140
860 3300026075 Ga0207708_10002680 Ga0207708_100026805 140
861 3300026075 Ga0207708_10002682 Ga0207708_100026828 140
862 3300026078 Ga0207702_10002075 Ga0207702_1000207510 140
863 3300026088 Ga0207641_10000542 Ga0207641_1000054234 140
864 3300026089 Ga0207648_10002093 Ga0207648_100020939 140
865 3300026089 Ga0207648_10051099 Ga0207648_100510993 140
866 3300026095 Ga0207676_10000511 Ga0207676_1000051114 140
867 3300026095 Ga0207676_11263867 Ga0207676_112638672 140
868 3300026116 Ga0207674_10000882 Ga0207674_1000088229 140
869 3300026118 Ga0207675_100001599 Ga0207675_1000015998 140
870 3300026118 Ga0207675_100032967 Ga0207675_1000329674 140
871 3300026121 Ga0207683_10000653 Ga0207683_1000065311 140
872 3300026142 Ga0207698_10003176 Ga0207698_100031765 140
873 3300026142 Ga0207698_10756239 Ga0207698_107562392 140
874 3300027364 Ga0209967_1001141 Ga0209967_10011413 140
875 3300027543 Ga0209999_1003610 Ga0209999_10036103 140
876 3300027617 Ga0210002_1000267 Ga0210002_10002672 140
877 3300027665 Ga0209983_1013876 Ga0209983_10138762 140
878 3300027682 Ga0209971_1011327 Ga0209971_10113273 140
879 3300027717 Ga0209998_10000855 Ga0209998_100008555 140
880 3300027717 Ga0209998_10000913 Ga0209998_100009134 140
881 3300027876 Ga0209974_10001240 Ga0209974_100012405 140
882 3300027876 Ga0209974_10099596 Ga0209974_100995962 140
883 3300027907 Ga0207428_10000130 Ga0207428_1000013076 140
884 3300027907 Ga0207428_10000286 Ga0207428_1000028662 140
885 3300028380 Ga0268265_10000410 Ga0268265_100004107 140
886 3300028380 Ga0268265_11167409 Ga0268265_111674092 140
887 3300028381 Ga0268264_10001172 Ga0268264_1000117215 140
888 3300028381 Ga0268264_10407382 Ga0268264_104073821 140
889 3300028381 Ga0268264_11702657 Ga0268264_117026571 140
890 3300034816 Ga0373930_0001406 Ga0373930_0001406_2197_2619 140
891 3300034816 Ga0373930_0018703 Ga0373930_0018703_79_501 140
892 3300034817 Ga0373948_0000715 Ga0373948_0000715_2354_2776 140
893 3300034817 Ga0373948_0020424 Ga0373948_0020424_599_1021 140
894 3300034818 Ga0373950_0006419 Ga0373950_0006419_470_892 140
895 3300034818 Ga0373950_0008531 Ga0373950_0008531_167_589 140
896 3300034819 Ga0373958_0000160 Ga0373958_0000160_1581_2003 140
897 3300034819 Ga0373958_0000523 Ga0373958_0000523_24_446 140
898 3300034820 Ga0373959_0000166 Ga0373959_0000166_147_569 140
899 3300034957 Ga0373938_0000260 Ga0373938_0000260_5514_5936 140
900 3300034957 Ga0373938_0001185 Ga0373938_0001185_3730_4152 140
901 3300035084 Ga0373928_0000257 Ga0373928_0000257_9034_9456 140
902 3300035085 Ga0373929_0000497 Ga0373929_0000497_1573_1995 140
903 3300035085 Ga0373929_0001725 Ga0373929_0001725_2535_2957 140
904 3300035088 Ga0373940_0002922 Ga0373940_0002922_1829_2251 140
905 3300035090 Ga0373949_0000547 Ga0373949_0000547_6240_6662 140
906 3300035090 Ga0373949_0009005 Ga0373949_0009005_522_944 140
907 3300035091 Ga0373951_0001164 Ga0373951_0001164_197_619 140
908 3300035091 Ga0373951_0002297 Ga0373951_0002297_2472_2894 140
909 3300035092 Ga0373952_0000266 Ga0373952_0000266_8031_8453 140
910 3300035092 Ga0373952_0008171 Ga0373952_0008171_1512_1934 140
911 3300035112 Ga0373932_0000908 Ga0373932_0000908_1414_1836 140
912 3300035112 Ga0373932_0002722 Ga0373932_0002722_2354_2776 140
913 3300035114 Ga0373939_0000911 Ga0373939_0000911_6801_7223 140
914 3300035114 Ga0373939_0019090 Ga0373939_0019090_901_1323 140
915 3300035115 Ga0373941_0000037 Ga0373941_0000037_5196_5618 140
916 3300035115 Ga0373941_0008858 Ga0373941_0008858_1770_2192 140
917 3300035121 Ga0373960_0000805 Ga0373960_0000805_3797_4219 140
918 3300035121 Ga0373960_0001073 Ga0373960_0001073_380_802 140
919 3300035207 Ga0373942_0000388 Ga0373942_0000388_3449_3871 140
920 3300035207 Ga0373942_0003774 Ga0373942_0003774_1757_2179 140
921 3300035241 Ga0373961_0000658 Ga0373961_0000658_9471_9893 140
922 3300035241 Ga0373961_0001498 Ga0373961_0001498_1253_1675 140
923 3300035242 Ga0373962_0001121 Ga0373962_0001121_4581_5003 140
924 3300035691 Ga0373931_0001169 Ga0373931_0001169_6475_6897 140
925 3300035691 Ga0373931_0167922 Ga0373931_0167922_424_846 140
926 3300042016 Ga0439463_030103 Ga0439463_030103_14_436 140
927 3300042016 Ga0439463_107981 Ga0439463_107981_203_625 140
928 3300042438 Ga0439459_0015768 Ga0439459_0015768_329_751 140
929 3300042876 Ga0451577_0242465 Ga0451577_0242465_239_661 140
930 3300042993 Ga0439440_0102552 Ga0439440_0102552_280_702 140
931 3300044712 Ga0453684_0111442 Ga0453684_0111442_964_1386 140
932 3300046684 Ga0495669_0018964 Ga0495669_0018964_553_975 140
933 3300047445 Ga0495677_0186257 Ga0495677_0186257_229_651 140
934 3300048903 Ga0496100_0001568 Ga0496100_0001568_2023_2445 140
935 3300048904 Ga0496101_0000171 Ga0496101_0000171_51221_51643 140
936 3300048905 Ga0496102_0004724 Ga0496102_0004724_2953_3375 140
937 3300048905 Ga0496102_1034882 Ga0496102_1034882_24_446 140
938 3300048906 Ga0496103_0005627 Ga0496103_0005627_4115_4537 140
939 3300048906 Ga0496103_0092519 Ga0496103_0092519_1435_1857 140
940 3300048907 Ga0496104_0097739 Ga0496104_0097739_910_1332 140
941 3300048908 Ga0496105_0193514 Ga0496105_0193514_903_1325 140
942 3300048909 Ga0496106_0002116 Ga0496106_0002116_5193_5615 140
943 3300048909 Ga0496106_0096792 Ga0496106_0096792_950_1372 140
944 3300048910 Ga0496107_0005829 Ga0496107_0005829_2103_2525 140
945 3300048910 Ga0496107_0009248 Ga0496107_0009248_3081_3503 140
946 3300048910 Ga0496107_0036330 Ga0496107_0036330_50_472 140
947 3300048911 Ga0496108_0003417 Ga0496108_0003417_3105_3527 140
948 3300048911 Ga0496108_0047350 Ga0496108_0047350_2122_2544 140
949 3300048911 Ga0496108_0412346 Ga0496108_0412346_276_698 140
950 3300048912 Ga0496109_0000606 Ga0496109_0000606_15843_16265 140
951 3300048912 Ga0496109_0000714 Ga0496109_0000714_16403_16825 140
952 3300048913 Ga0496110_0011093 Ga0496110_0011093_521_943 140
953 3300048913 Ga0496110_0012732 Ga0496110_0012732_5584_6006 140
954 3300048913 Ga0496110_0080773 Ga0496110_0080773_183_605 140
955 3300048914 Ga0496111_0004865 Ga0496111_0004865_513_935 140
956 3300048914 Ga0496111_0224737 Ga0496111_0224737_747_1169 140
957 3300048915 Ga0496112_0035091 Ga0496112_0035091_3799_4221 140
958 3300048915 Ga0496112_0080920 Ga0496112_0080920_1899_2321 140
959 3300048916 Ga0496113_0000399 Ga0496113_0000399_11943_12365 140
960 3300048916 Ga0496113_0086954 Ga0496113_0086954_1528_1950 140
961 3300048916 Ga0496113_0131369 Ga0496113_0131369_750_1172 140
962 3300048917 Ga0496114_0008317 Ga0496114_0008317_13_435 140
963 3300048918 Ga0496115_0001189 Ga0496115_0001189_11241_11663 140
964 3300049592 Ga0501076_0366191 Ga0501076_0366191_13_435 140
965 3300050494 nmdc:mga06z11_16741_c1 nmdc:mga06z11_16741_c1_875_1297 140
966 3300050511 nmdc:mga08y16_1898_c1 nmdc:mga08y16_1898_c1_3314_3736 140
967 3300050511 nmdc:mga08y16_2825_c1 nmdc:mga08y16_2825_c1_3448_3870 140
968 3300050512 nmdc:mga0n895_1061_c1 nmdc:mga0n895_1061_c1_13242_13664 140
969 3300050512 nmdc:mga0n895_490130_c1 nmdc:mga0n895_490130_c1_730_1152 140
970 3300050512 nmdc:mga0n895_532164_c1 nmdc:mga0n895_532164_c1_588_1010 140
971 3300050513 nmdc:mga0rr50_573073_c1 nmdc:mga0rr50_573073_c1_358_780 140
972 3300050513 nmdc:mga0rr50_6009_c1 nmdc:mga0rr50_6009_c1_3965_4387 140
973 3300050514 nmdc:mga08x19_255602_c1 nmdc:mga08x19_255602_c1_513_935 140
974 3300050515 nmdc:mga0a205_217928_c1 nmdc:mga0a205_217928_c1_967_1389 140
975 3300050515 nmdc:mga0a205_560372_c1 nmdc:mga0a205_560372_c1_411_833 140
976 3300050515 nmdc:mga0a205_64986_c1 nmdc:mga0a205_64986_c1_2295_2717 140
977 3300054114 Ga0501084_0107909 Ga0501084_0107909_558_980 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01878

EVE

EVE domain

13

143

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zce-assembly1.cif.gz_A x-ray crystal structure of protein atu2648 from agrobacterium tumefaciens. northeast structural genomics consortium target atr33. 0.9467 1 138
2gbs-assembly1.cif.gz_A nmr structure of rpa0253 from rhodopseudomonas palustris. northeast structural genomics consortium target rpr3 0.9309 1 137
1zce-assembly1.cif.gz_A x-ray crystal structure of protein atu2648 from agrobacterium tumefaciens. northeast structural genomics consortium target atr33. 0.9273 1 138
2gbs-assembly1.cif.gz_A nmr structure of rpa0253 from rhodopseudomonas palustris. northeast structural genomics consortium target rpr3 0.8994 1 137
2eve-assembly1.cif.gz_A x-ray crystal structure of protein pspto5229 from pseudomonas syringae. northeast structural genomics consortium target psr62 0.8979 2 136
ID Description Score Start End Superfamily
1zceA00 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9248 1 138 3.10.590.10
af_O94645_8_177_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.893 1 140 3.10.590.10
af_A4ICC8_1_164_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.8898 1 136 3.10.590.10
af_O94645_8_177_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.8869 1 140 3.10.590.10
af_Q9ZVK5_4_152_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.8783 2 138 3.10.590.10
ID Description Score Start End GO Terms
AF-A0A2V5ZYM0-F1-model_v4 EVE domain-containing protein 0.9918 91 136
AF-A0A4Q5RA21-F1-model_v4 EVE domain-containing protein 0.9872 68 137
AF-A0A4Q5ZQM4-F1-model_v4 deleted 0.9723 31 139
AF-A0A382GXA6-F1-model_v4 EVE domain-containing protein 0.9704 43 138 GO:0005634
AF-A0A3D2RC19-F1-model_v4 deleted 0.9696 33 136

Feature Viewer

pLDDT pTM Quality
88.68 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map