F487294

General Info

Members Datasets Scaffolds Average Seq Length
977 451 1954 112

Family's Representative Sequence

Representative Sequence 3300050513|nmdc:mga0rr50_211860_c1|nmdc:mga0rr50_211860_c1_119_511
Length 130
Sequence MQPQAAAPAAAFFQTRTKMDITVQDRIRQEITDAPVVLFMKGTPVFPQCGFSAAVVQILSHMGVKFKGIDVLSDPSVRQGIKEFSNWPTIPQLYVKGEFVGGCDIIREMFETGELEQLLKEKGVALADAA

Samples

Sample ID Description Type Environment
1 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
2 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
20 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
95 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
96 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
110 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
126 3300019161 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300019162 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300019166 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300019179 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
139 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
144 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
145 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
146 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
147 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
148 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
149 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
151 3300023536 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300023539 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300023547 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300023552 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300023660 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
158 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
160 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
162 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
205 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
208 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
209 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
210 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
211 3300029276 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctcc.R1 Metatranscriptome Rhizosphere
212 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
213 3300029280 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stcc.R1 Metatranscriptome Rhizosphere
214 3300029282 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stcc.R1 Metatranscriptome Rhizosphere
215 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
216 3300031043 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
219 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
220 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
221 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
222 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
223 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
224 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
225 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
226 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
227 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
228 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
229 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
230 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
231 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
232 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
233 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
234 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
235 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
236 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
237 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
238 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
239 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
240 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
241 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
242 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
243 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
244 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
245 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
248 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
249 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
250 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
251 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
252 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
253 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
254 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
255 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
256 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
257 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
258 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
259 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
260 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
261 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
262 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
263 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
264 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
265 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
266 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
267 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
268 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
269 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
271 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
272 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
273 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
274 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
275 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
276 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
277 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
278 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
279 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
280 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
281 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
282 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
283 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
284 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
285 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
286 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
287 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
288 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
289 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
290 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
291 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
292 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
293 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
294 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
295 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
296 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
297 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
298 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
299 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
300 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
301 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
302 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
303 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
304 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
305 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
306 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
307 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
308 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
309 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
310 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
311 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
312 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
313 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
314 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
315 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
316 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
317 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
318 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
319 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
320 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
321 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
322 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
323 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
324 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
325 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
326 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
327 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
328 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
329 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
330 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
354 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
355 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
356 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
357 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
358 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
359 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
360 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
361 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
362 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
363 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
364 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
365 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
366 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
367 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
368 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
369 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
370 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
373 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
374 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
375 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
376 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
377 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
378 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
379 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
380 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
381 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
382 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
383 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
384 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
385 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
386 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
387 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
388 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
389 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
390 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
391 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
392 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
393 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
394 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
395 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
396 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
397 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
398 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
399 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
400 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
401 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
402 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
403 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
404 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
405 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
406 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
407 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
408 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
409 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
410 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
411 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
412 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
446 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
447 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
448 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
449 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
450 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
451 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.06
Metatranscriptomes 18.42
Isolates 0.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.68
Nodule 0.1
Rhizoplane 2.25
Rhizosphere 88.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0rr50_211860_c1 3300050513 Bacteria 1596
2 Ga0006765J45826_113369 3300003161 Bacteria 543
3 Ga0006778J45830_1011108 3300003162 Bacteria 523
4 Ga0006778J45830_1012435 3300003162 Bacteria 725
5 Ga0006759J45824_1017163 3300003163 Bacteria 726
6 Ga0006770J48903_1018555 3300003305 Bacteria 631
7 Ga0006770J48903_1042342 3300003305 Bacteria 557
8 Ga0006777J48905_1013663 3300003308 Bacteria 850
9 Ga0007417J51691_1012571 3300003544 Bacteria 721
10 Ga0007417J51691_1030506 3300003544 Bacteria 712
11 Ga0007427J51700_115644 3300003559 Bacteria 684
12 Ga0006781J51513_1011663 3300003568 Bacteria 704
13 Ga0006781J51513_1017243 3300003568 Bacteria 716
14 Ga0007410J51695_1013659 3300003574 Bacteria 736
15 Ga0007410J51695_1013962 3300003574 Bacteria 859
16 Ga0007409J51694_1017153 3300003575 Bacteria 976
17 Ga0007409J51694_1032049 3300003575 Bacteria 701
18 Ga0007409J51694_1063371 3300003575 Bacteria 965
19 Ga0007416J51690_1015266 3300003577 Bacteria 710
20 Ga0007416J51690_1016742 3300003577 Bacteria 724
21 Ga0007416J51690_1050873 3300003577 Bacteria 758
22 Ga0007429J51699_1010539 3300003579 Bacteria 774
23 Ga0007429J51699_1038836 3300003579 Bacteria 856
24 Ga0007411J51799_110620 3300003611 Bacteria 722
25 Ga0032354_1008041 3300003693 Bacteria 754
26 Ga0032354_1037704 3300003693 Bacteria 701
27 Ga0006780_1001755 3300003735 Bacteria 730
28 Ga0006780_1003345 3300003735 Bacteria 943
29 Ga0058863_11567754 3300004799 Bacteria 733
30 Ga0058863_11657535 3300004799 Bacteria 811
31 Ga0058863_11890266 3300004799 Bacteria 790
32 Ga0058863_11972538 3300004799 Bacteria 568
33 Ga0058861_11895452 3300004800 Bacteria 714
34 Ga0058861_11916278 3300004800 Bacteria 652
35 Ga0058861_11923301 3300004800 Bacteria 701
36 Ga0058860_10127369 3300004801 Bacteria 549
37 Ga0058860_12093545 3300004801 Bacteria 581
38 Ga0058862_12482892 3300004803 Bacteria 760
39 Ga0065712_10260760 3300005290 Bacteria 937
40 Ga0065712_10532048 3300005290 Bacteria 629
41 Ga0070676_10095611 3300005328 Bacteria 1827
42 Ga0070683_101059478 3300005329 Bacteria 779
43 Ga0070690_100157655 3300005330 Bacteria 1553
44 Ga0070670_101036656 3300005331 Bacteria 747
45 Ga0068869_100729640 3300005334 Bacteria 847
46 Ga0070682_101421224 3300005337 Bacteria 594
47 Ga0068868_100543784 3300005338 Bacteria 1023
48 Ga0068868_101066149 3300005338 Bacteria 742
49 Ga0070689_101483366 3300005340 Bacteria 614
50 Ga0070691_10004158 3300005341 Bacteria 6571
51 Ga0070661_100916912 3300005344 Bacteria 724
52 Ga0070692_10291339 3300005345 Bacteria 993
53 Ga0070671_100187748 3300005355 Bacteria 1751
54 Ga0070671_100495037 3300005355 Bacteria 1051
55 Ga0070671_101535072 3300005355 Bacteria 590
56 Ga0070674_100005082 3300005356 Bacteria 7560
57 Ga0070709_10000635 3300005434 Bacteria 20032
58 Ga0070709_10037690 3300005434 Bacteria 2954
59 Ga0070709_11744872 3300005434 Bacteria 509
60 Ga0070714_100076330 3300005435 Bacteria 2909
61 Ga0070714_100189897 3300005435 Bacteria 1874
62 Ga0070714_100492264 3300005435 Bacteria 1168
63 Ga0070714_100588579 3300005435 Bacteria 1068
64 Ga0070714_100698881 3300005435 Bacteria 978
65 Ga0070714_100858229 3300005435 Bacteria 881
66 Ga0070714_100904416 3300005435 Bacteria 857
67 Ga0070714_101100050 3300005435 Bacteria 774
68 Ga0070714_101107666 3300005435 Bacteria 772
69 Ga0070714_101614500 3300005435 Bacteria 633
70 Ga0070713_100000821 3300005436 Bacteria 19927
71 Ga0070713_100041395 3300005436 Bacteria 3753
72 Ga0070713_100229506 3300005436 Bacteria 1687
73 Ga0070713_100258577 3300005436 Bacteria 1590
74 Ga0070713_100385231 3300005436 Bacteria 1307
75 Ga0070710_10008491 3300005437 Bacteria 5000
76 Ga0070710_10012495 3300005437 Bacteria 4218
77 Ga0070710_10029877 3300005437 Bacteria 2927
78 Ga0070710_10205839 3300005437 Bacteria 1245
79 Ga0070710_11239435 3300005437 Bacteria 553
80 Ga0070710_11358282 3300005437 Bacteria 530
81 Ga0070711_100016286 3300005439 Bacteria 4719
82 Ga0070711_100096427 3300005439 Bacteria 2142
83 Ga0070711_100316960 3300005439 Bacteria 1245
84 Ga0070711_100545067 3300005439 Bacteria 962
85 Ga0070711_101280129 3300005439 Bacteria 636
86 Ga0070705_100071960 3300005440 Bacteria 2093
87 Ga0070705_101851460 3300005440 Bacteria 513
88 Ga0070694_100436552 3300005444 Bacteria 1031
89 Ga0070708_100173246 3300005445 Bacteria 2015
90 Ga0070708_100183529 3300005445 Bacteria 1956
91 Ga0070708_100886554 3300005445 Bacteria 838
92 Ga0070681_10223641 3300005458 Bacteria 1797
93 Ga0070681_10452740 3300005458 Bacteria 1196
94 Ga0070681_10544900 3300005458 Bacteria 1074
95 Ga0070681_10717331 3300005458 Bacteria 916
96 Ga0068867_101285889 3300005459 Bacteria 675
97 Ga0070685_11568937 3300005466 Bacteria 509
98 Ga0070706_100298476 3300005467 Bacteria 1503
99 Ga0070706_100703986 3300005467 Bacteria 937
100 Ga0070707_100021107 3300005468 Bacteria 6152
101 Ga0070707_101366728 3300005468 Bacteria 675
102 Ga0070698_100028242 3300005471 Bacteria 5829
103 Ga0070698_100216304 3300005471 Bacteria 1850
104 Ga0070698_100559887 3300005471 Bacteria 1083
105 Ga0070698_100907258 3300005471 Bacteria 827
106 Ga0070698_102172030 3300005471 Bacteria 509
107 Ga0070699_100085261 3300005518 Bacteria 2757
108 Ga0070699_100295937 3300005518 Bacteria 1452
109 Ga0070699_100704111 3300005518 Bacteria 923
110 Ga0070699_100760768 3300005518 Bacteria 886
111 Ga0070699_101335433 3300005518 Bacteria 658
112 Ga0070699_101631355 3300005518 Bacteria 591
113 Ga0070679_100273198 3300005530 Bacteria 1644
114 Ga0070684_100344673 3300005535 Bacteria 1370
115 Ga0070684_100838788 3300005535 Bacteria 860
116 Ga0070684_101238175 3300005535 Bacteria 702
117 Ga0070697_100087233 3300005536 Bacteria 2576
118 Ga0070697_100224680 3300005536 Bacteria 1601
119 Ga0070697_100358772 3300005536 Bacteria 1260
120 Ga0070697_100598388 3300005536 Bacteria 969
121 Ga0070697_101051746 3300005536 Bacteria 724
122 Ga0070697_101145533 3300005536 Bacteria 693
123 Ga0068853_100075662 3300005539 Bacteria 2938
124 Ga0070672_101943208 3300005543 Bacteria 530
125 Ga0070686_101416372 3300005544 Bacteria 584
126 Ga0070695_100008965 3300005545 Bacteria 5945
127 Ga0070695_100164214 3300005545 Bacteria 1561
128 Ga0070695_100568446 3300005545 Bacteria 886
129 Ga0070695_100774792 3300005545 Bacteria 767
130 Ga0070696_100480547 3300005546 Bacteria 985
131 Ga0070696_101063119 3300005546 Bacteria 679
132 Ga0070693_100035966 3300005547 Bacteria 2750
133 Ga0070693_101669601 3300005547 Bacteria 502
134 Ga0070665_101119468 3300005548 Bacteria 799
135 Ga0070704_100495304 3300005549 Bacteria 1060
136 Ga0068855_100030001 3300005563 Bacteria 6504
137 Ga0068855_100236429 3300005563 Bacteria 2043
138 Ga0068857_100013738 3300005577 Bacteria 7055
139 Ga0068854_100126163 3300005578 Bacteria 1949
140 Ga0068856_100001161 3300005614 Bacteria 27673
141 Ga0068856_100151109 3300005614 Bacteria 2331
142 Ga0068856_100542127 3300005614 Bacteria 1184
143 Ga0068856_100559188 3300005614 Bacteria 1165
144 Ga0068856_101428538 3300005614 Bacteria 706
145 Ga0068856_101487977 3300005614 Bacteria 691
146 Ga0070702_100780031 3300005615 Bacteria 737
147 Ga0068852_100008313 3300005616 Bacteria 7637
148 Ga0068859_100909127 3300005617 Bacteria 965
149 Ga0068859_101433323 3300005617 Bacteria 762
150 Ga0068866_10258042 3300005718 Bacteria 1070
151 Ga0068861_100075036 3300005719 Bacteria 2631
152 Ga0068861_100247043 3300005719 Bacteria 1521
153 Ga0068851_10332491 3300005834 Bacteria 880
154 Ga0068860_100387354 3300005843 Bacteria 1381
155 Ga0068860_100505431 3300005843 Bacteria 1207
156 Ga0068860_101149921 3300005843 Bacteria 796
157 Ga0068862_100117623 3300005844 Bacteria 2339
158 Ga0068862_100223200 3300005844 Bacteria 1706
159 Ga0068862_100527367 3300005844 Bacteria 1125
160 Ga0068862_100856674 3300005844 Bacteria 891
161 Ga0068862_100958875 3300005844 Bacteria 844
162 Ga0081455_10184731 3300005937 Bacteria 1576
163 Ga0081538_10004148 3300005981 Bacteria 13446
164 Ga0081538_10032803 3300005981 Bacteria 3470
165 Ga0081540_1046317 3300005983 Bacteria 2197
166 Ga0070717_10004460 3300006028 Bacteria 10112
167 Ga0070717_10402771 3300006028 Bacteria 1229
168 Ga0070717_10560623 3300006028 Bacteria 1035
169 Ga0075363_100807955 3300006048 Bacteria 571
170 Ga0075364_10717944 3300006051 Bacteria 682
171 Ga0070715_10362210 3300006163 Bacteria 795
172 Ga0070715_10619178 3300006163 Bacteria 637
173 Ga0070716_100195914 3300006173 Bacteria 1339
174 Ga0070712_100006320 3300006175 Bacteria 7346
175 Ga0070712_100031740 3300006175 Bacteria 3561
176 Ga0070712_100074398 3300006175 Bacteria 2440
177 Ga0070712_100213602 3300006175 Bacteria 1523
178 Ga0070712_100349040 3300006175 Bacteria 1210
179 Ga0070712_100374538 3300006175 Bacteria 1170
180 Ga0070712_100703633 3300006175 Bacteria 861
181 Ga0070712_100715929 3300006175 Bacteria 854
182 Ga0075362_10295729 3300006177 Bacteria 803
183 Ga0075367_10324070 3300006178 Bacteria 971
184 Ga0075366_10759646 3300006195 Bacteria 603
185 Ga0097621_101253874 3300006237 Bacteria 699
186 Ga0075430_100589847 3300006846 Bacteria 917
187 Ga0075431_100512403 3300006847 Bacteria 1190
188 Ga0075431_101810389 3300006847 Bacteria 567
189 Ga0075433_10132587 3300006852 Bacteria 2214
190 Ga0075434_100063526 3300006871 Bacteria 3675
191 Ga0075434_100286823 3300006871 Bacteria 1666
192 Ga0075434_100637628 3300006871 Bacteria 1084
193 Ga0075434_100686187 3300006871 Bacteria 1042
194 Ga0068865_100206843 3300006881 Bacteria 1527
195 Ga0068865_100211420 3300006881 Bacteria 1512
196 Ga0075436_100038092 3300006914 Bacteria 3319
197 Ga0075436_100039303 3300006914 Bacteria 3266
198 Ga0075436_100091942 3300006914 Bacteria 2109
199 Ga0075436_100191727 3300006914 Bacteria 1446
200 Ga0075436_100257429 3300006914 Bacteria 1244
201 Ga0097620_100909106 3300006931 Bacteria 965
202 Ga0097620_101433338 3300006931 Bacteria 762
203 Ga0075435_100037487 3300007076 Bacteria 3860
204 Ga0075435_100165270 3300007076 Bacteria 1866
205 Ga0075435_100227925 3300007076 Bacteria 1583
206 Ga0075435_100775169 3300007076 Bacteria 835
207 Ga0099794_10109725 3300007265 Bacteria 1382
208 Ga0099795_10019549 3300007788 Bacteria 2194
209 Ga0099795_10020870 3300007788 Bacteria 2140
210 Ga0099795_10021799 3300007788 Bacteria 2107
211 Ga0105251_10633738 3300009011 Bacteria 510
212 Ga0105240_10085497 3300009093 Bacteria 3864
213 Ga0105240_10344959 3300009093 Bacteria 1691
214 Ga0105240_10542536 3300009093 Bacteria 1288
215 Ga0105240_11986219 3300009093 Bacteria 604
216 Ga0111539_10000169 3300009094 Bacteria 75594
217 Ga0111539_10265998 3300009094 Bacteria 1996
218 Ga0111539_10774047 3300009094 Bacteria 1117
219 Ga0111539_11682942 3300009094 Bacteria 736
220 Ga0105245_10909207 3300009098 Bacteria 922
221 Ga0105245_11026994 3300009098 Bacteria 869
222 Ga0105245_11274173 3300009098 Bacteria 784
223 Ga0105245_11684619 3300009098 Bacteria 686
224 Ga0105247_10973764 3300009101 Bacteria 660
225 Ga0114129_10038268 3300009147 Bacteria 6768
226 Ga0114129_10113130 3300009147 Bacteria 3743
227 Ga0114129_10324211 3300009147 Bacteria 2047
228 Ga0114129_11857986 3300009147 Bacteria 731
229 Ga0105243_11186700 3300009148 Bacteria 776
230 Ga0105241_10041637 3300009174 Bacteria 3472
231 Ga0105241_10304995 3300009174 Bacteria 1368
232 Ga0105241_11073068 3300009174 Bacteria 757
233 Ga0105241_12492053 3300009174 Bacteria 518
234 Ga0105242_12034087 3300009176 Bacteria 617
235 Ga0105248_10786392 3300009177 Bacteria 1074
236 Ga0105248_11976181 3300009177 Bacteria 662
237 Ga0105248_13028721 3300009177 Bacteria 535
238 Ga0105237_10091545 3300009545 Bacteria 3030
239 Ga0105237_11564355 3300009545 Bacteria 666
240 Ga0105238_10026969 3300009551 Bacteria 5856
241 Ga0105238_11154419 3300009551 Bacteria 798
242 Ga0105238_12867044 3300009551 Bacteria 518
243 Ga0105249_11397965 3300009553 Bacteria 772
244 Ga0105028_110168 3300009993 Bacteria 988
245 Ga0099796_10000472 3300010159 Bacteria 6795
246 Ga0099796_10021820 3300010159 Bacteria 1978
247 Ga0099796_10045980 3300010159 Bacteria 1497
248 Ga0099796_10145079 3300010159 Bacteria 930
249 Ga0099796_10338302 3300010159 Bacteria 646
250 Ga0099796_10578491 3300010159 Bacteria 506
251 Ga0105239_10030053 3300010375 Bacteria 5975
252 Ga0105239_10678298 3300010375 Bacteria 1178
253 Ga0105239_11177934 3300010375 Bacteria 883
254 Ga0157373_10064010 3300013100 Bacteria 2603
255 Ga0157370_10057352 3300013104 Bacteria 3703
256 Ga0157369_10135886 3300013105 Bacteria 2603
257 Ga0157374_10244056 3300013296 Bacteria 1767
258 Ga0157374_11191947 3300013296 Bacteria 783
259 Ga0157374_11588891 3300013296 Bacteria 678
260 Ga0157378_10404735 3300013297 Bacteria 1346
261 Ga0157378_11191197 3300013297 Bacteria 801
262 Ga0163162_10054728 3300013306 Bacteria 4015
263 Ga0163162_10466974 3300013306 Bacteria 1393
264 Ga0163162_10803601 3300013306 Bacteria 1058
265 Ga0163162_12139302 3300013306 Bacteria 642
266 Ga0157372_10026742 3300013307 Bacteria 6279
267 Ga0157372_12679974 3300013307 Bacteria 572
268 Ga0163163_10222421 3300014325 Bacteria 1937
269 Ga0163163_10246948 3300014325 Bacteria 1835
270 Ga0163163_10283119 3300014325 Bacteria 1709
271 Ga0157380_10039355 3300014326 Bacteria 3676
272 Ga0157380_10156886 3300014326 Bacteria 1973
273 Ga0157380_12119607 3300014326 Bacteria 625
274 Ga0182008_10054407 3300014497 Bacteria 1980
275 Ga0182008_10108210 3300014497 Bacteria 1376
276 Ga0157377_11542093 3300014745 Bacteria 530
277 Ga0157379_10009278 3300014968 Bacteria 8565
278 Ga0157379_10016989 3300014968 Bacteria 6405
279 Ga0157379_10021284 3300014968 Bacteria 5739
280 Ga0157379_10215527 3300014968 Bacteria 1739
281 Ga0157379_10732185 3300014968 Bacteria 930
282 Ga0157379_10909510 3300014968 Bacteria 835
283 Ga0157379_11552680 3300014968 Bacteria 645
284 Ga0157379_12318548 3300014968 Bacteria 535
285 Ga0157376_10339242 3300014969 Bacteria 1435
286 Ga0182005_1060127 3300015265 Bacteria 1038
287 Ga0184602_113634 3300019161 Bacteria 523
288 Ga0184602_120229 3300019161 Bacteria 999
289 Ga0184602_132698 3300019161 Bacteria 576
290 Ga0184597_107591 3300019162 Bacteria 997
291 Ga0184595_123667 3300019166 Bacteria 1052
292 Ga0184593_117696 3300019179 Bacteria 568
293 Ga0184598_114645 3300019182 Bacteria 1023
294 Ga0184598_121736 3300019182 Bacteria 1077
295 Ga0184601_138778 3300019183 Bacteria 875
296 Ga0184599_106009 3300019188 Bacteria 886
297 Ga0184599_113015 3300019188 Bacteria 765
298 Ga0184600_130882 3300019190 Bacteria 727
299 Ga0184600_135270 3300019190 Bacteria 795
300 Ga0184600_147441 3300019190 Bacteria 831
301 Ga0184603_117833 3300019192 Bacteria 850
302 Ga0184603_133708 3300019192 Bacteria 718
303 Ga0197907_10128652 3300020069 Bacteria 830
304 Ga0197907_10271249 3300020069 Bacteria 671
305 Ga0197907_10419446 3300020069 Bacteria 565
306 Ga0197907_10474974 3300020069 Bacteria 766
307 Ga0197907_10572567 3300020069 Bacteria 1640
308 Ga0197907_10716682 3300020069 Bacteria 773
309 Ga0197907_11135020 3300020069 Bacteria 849
310 Ga0206356_11417481 3300020070 Bacteria 726
311 Ga0206349_1341784 3300020075 Bacteria 597
312 Ga0206349_1605969 3300020075 Bacteria 855
313 Ga0206349_1934082 3300020075 Bacteria 720
314 Ga0206355_1237966 3300020076 Bacteria 638
315 Ga0206355_1269308 3300020076 Bacteria 713
316 Ga0206355_1329367 3300020076 Bacteria 554
317 Ga0206355_1564213 3300020076 Bacteria 873
318 Ga0206355_1573981 3300020076 Bacteria 1043
319 Ga0206352_10209302 3300020078 Bacteria 581
320 Ga0206352_10572664 3300020078 Bacteria 790
321 Ga0206352_11245530 3300020078 Bacteria 1323
322 Ga0206352_11305848 3300020078 Bacteria 594
323 Ga0206350_10570192 3300020080 Bacteria 715
324 Ga0206350_10916850 3300020080 Bacteria 1114
325 Ga0206350_10999396 3300020080 Bacteria 761
326 Ga0206350_11270030 3300020080 Bacteria 731
327 Ga0206350_11482132 3300020080 Bacteria 794
328 Ga0206353_12034644 3300020082 Bacteria 534
329 Ga0154015_1079282 3300020610 Bacteria 521
330 Ga0154015_1254205 3300020610 Bacteria 545
331 Ga0154015_1282413 3300020610 Bacteria 760
332 Ga0154015_1370597 3300020610 Bacteria 829
333 Ga0213873_10030109 3300021358 Bacteria 1342
334 Ga0213873_10143894 3300021358 Bacteria 714
335 Ga0213873_10267220 3300021358 Bacteria 545
336 Ga0213872_10232935 3300021361 Bacteria 781
337 Ga0213874_10014381 3300021377 Bacteria 2068
338 Ga0213874_10359213 3300021377 Bacteria 560
339 Ga0213874_10439714 3300021377 Bacteria 513
340 Ga0213876_10012782 3300021384 Bacteria 4463
341 Ga0213876_10017949 3300021384 Bacteria 3733
342 Ga0213875_10000936 3300021388 Bacteria 20989
343 Ga0213875_10000952 3300021388 Bacteria 20715
344 Ga0213875_10048131 3300021388 Bacteria 2000
345 Ga0213875_10135590 3300021388 Bacteria 1151
346 Ga0213875_10552165 3300021388 Bacteria 555
347 Ga0213871_10222552 3300021441 Bacteria 594
348 Ga0224712_10076242 3300022467 Bacteria 1373
349 Ga0224712_10114117 3300022467 Bacteria 1162
350 Ga0224712_10136813 3300022467 Bacteria 1075
351 Ga0224712_10141144 3300022467 Bacteria 1060
352 Ga0224712_10146572 3300022467 Bacteria 1043
353 Ga0224712_10285730 3300022467 Bacteria 769
354 Ga0224712_10304785 3300022467 Bacteria 746
355 Ga0224712_10328784 3300022467 Bacteria 719
356 Ga0224712_10329704 3300022467 Bacteria 718
357 Ga0256744_130546 3300023309 Bacteria 893
358 Ga0247552_101014 3300023536 Bacteria 797
359 Ga0247555_100498 3300023539 Bacteria 1037
360 Ga0247555_100788 3300023539 Bacteria 885
361 Ga0247554_101270 3300023547 Bacteria 852
362 Ga0247551_101142 3300023552 Bacteria 858
363 Ga0247551_103646 3300023552 Bacteria 596
364 Ga0247550_100792 3300023660 Bacteria 894
365 Ga0247553_101614 3300023672 Bacteria 982
366 Ga0247553_103107 3300023672 Bacteria 798
367 Ga0247553_103843 3300023672 Bacteria 746
368 Ga0228598_1065719 3300024227 Bacteria 724
369 Ga0209675_1020657 3300025291 Bacteria 1778
370 Ga0209758_1029501 3300025297 Bacteria 2292
371 Ga0209050_1003198 3300025298 Bacteria 12404
372 Ga0207426_1029154 3300025302 Bacteria 1823
373 Ga0209257_1000766 3300025304 Bacteria 47893
374 Ga0207692_10020598 3300025898 Bacteria 3003
375 Ga0207692_10066017 3300025898 Bacteria 1890
376 Ga0207692_10094800 3300025898 Bacteria 1626
377 Ga0207692_10098330 3300025898 Bacteria 1601
378 Ga0207642_10442678 3300025899 Bacteria 786
379 Ga0207680_10156040 3300025903 Bacteria 1526
380 Ga0207685_10218181 3300025905 Bacteria 905
381 Ga0207699_10000247 3300025906 Bacteria 30409
382 Ga0207699_10020990 3300025906 Bacteria 3511
383 Ga0207699_10095561 3300025906 Bacteria 1874
384 Ga0207684_10801406 3300025910 Bacteria 796
385 Ga0207684_10978279 3300025910 Bacteria 709
386 Ga0207654_10209930 3300025911 Bacteria 1286
387 Ga0207654_10807522 3300025911 Bacteria 678
388 Ga0207707_10281946 3300025912 Bacteria 1439
389 Ga0207707_10558793 3300025912 Bacteria 972
390 Ga0207707_10603293 3300025912 Bacteria 929
391 Ga0207707_11154389 3300025912 Bacteria 629
392 Ga0207695_10617233 3300025913 Bacteria 965
393 Ga0207671_10052710 3300025914 Bacteria 3015
394 Ga0207693_10002332 3300025915 Bacteria 16498
395 Ga0207693_10003094 3300025915 Bacteria 14333
396 Ga0207693_10010567 3300025915 Bacteria 7489
397 Ga0207693_10085264 3300025915 Bacteria 2475
398 Ga0207693_10129256 3300025915 Bacteria 1986
399 Ga0207693_10138992 3300025915 Bacteria 1910
400 Ga0207693_10167203 3300025915 Bacteria 1732
401 Ga0207693_11206471 3300025915 Bacteria 570
402 Ga0207693_11370214 3300025915 Bacteria 526
403 Ga0207663_10132708 3300025916 Bacteria 1723
404 Ga0207663_10398791 3300025916 Bacteria 1052
405 Ga0207663_10428857 3300025916 Bacteria 1016
406 Ga0207663_10510141 3300025916 Bacteria 935
407 Ga0207662_10217782 3300025918 Bacteria 1242
408 Ga0207646_10009818 3300025922 Bacteria 9423
409 Ga0207681_10444607 3300025923 Bacteria 1054
410 Ga0207694_10013968 3300025924 Bacteria 6055
411 Ga0207650_11121842 3300025925 Bacteria 669
412 Ga0207687_11913991 3300025927 Bacteria 507
413 Ga0207700_10000005 3300025928 Bacteria 394836
414 Ga0207700_10020490 3300025928 Bacteria 4493
415 Ga0207700_10181916 3300025928 Bacteria 1761
416 Ga0207700_10226404 3300025928 Bacteria 1588
417 Ga0207700_10315886 3300025928 Bacteria 1353
418 Ga0207700_10343593 3300025928 Bacteria 1298
419 Ga0207700_10753910 3300025928 Bacteria 870
420 Ga0207700_10874461 3300025928 Bacteria 804
421 Ga0207664_10093531 3300025929 Bacteria 2469
422 Ga0207664_10158288 3300025929 Bacteria 1930
423 Ga0207664_10190510 3300025929 Bacteria 1765
424 Ga0207664_10357174 3300025929 Bacteria 1294
425 Ga0207664_10381612 3300025929 Bacteria 1251
426 Ga0207664_10905619 3300025929 Bacteria 792
427 Ga0207644_11680741 3300025931 Bacteria 532
428 Ga0207709_11749958 3300025935 Bacteria 517
429 Ga0207670_11207142 3300025936 Bacteria 640
430 Ga0207669_10037511 3300025937 Bacteria 2781
431 Ga0207704_10179339 3300025938 Bacteria 1529
432 Ga0207665_10479408 3300025939 Bacteria 958
433 Ga0207665_10640959 3300025939 Bacteria 832
434 Ga0207665_10811867 3300025939 Bacteria 739
435 Ga0207679_10192120 3300025945 Bacteria 1698
436 Ga0207667_10024010 3300025949 Bacteria 6706
437 Ga0207667_10027776 3300025949 Bacteria 6154
438 Ga0207667_10547453 3300025949 Bacteria 1171
439 Ga0207712_11122745 3300025961 Bacteria 700
440 Ga0207640_10156038 3300025981 Bacteria 1682
441 Ga0207703_10282343 3300026035 Bacteria 1508
442 Ga0207703_12410480 3300026035 Bacteria 502
443 Ga0207639_10467662 3300026041 Bacteria 1147
444 Ga0207708_10304889 3300026075 Bacteria 1296
445 Ga0207708_10587154 3300026075 Bacteria 942
446 Ga0207702_10000159 3300026078 Bacteria 79906
447 Ga0207702_10002973 3300026078 Bacteria 15782
448 Ga0207702_10008489 3300026078 Bacteria 8662
449 Ga0207702_11035209 3300026078 Bacteria 815
450 Ga0207702_11298073 3300026078 Bacteria 722
451 Ga0207702_11695343 3300026078 Bacteria 625
452 Ga0207641_11538025 3300026088 Bacteria 667
453 Ga0207641_12177659 3300026088 Bacteria 555
454 Ga0207648_10215910 3300026089 Bacteria 1703
455 Ga0207674_10004151 3300026116 Bacteria 17513
456 Ga0207675_100093083 3300026118 Bacteria 2834
457 Ga0207675_100326974 3300026118 Bacteria 1498
458 Ga0207683_10150621 3300026121 Bacteria 2099
459 Ga0207698_10022996 3300026142 Bacteria 4348
460 Ga0209179_1007928 3300027512 Bacteria 1771
461 Ga0209179_1035413 3300027512 Bacteria 1037
462 Ga0209179_1054597 3300027512 Bacteria 861
463 Ga0207428_10000072 3300027907 Bacteria 143629
464 Ga0268266_11326204 3300028379 Bacteria 695
465 Ga0268265_10023906 3300028380 Bacteria 4315
466 Ga0268265_10111622 3300028380 Bacteria 2233
467 Ga0268265_10162321 3300028380 Bacteria 1900
468 Ga0268265_10906074 3300028380 Bacteria 866
469 Ga0268265_10919510 3300028380 Bacteria 860
470 Ga0265336_10006985 3300028666 Bacteria 4039
471 Ga0307517_10619643 3300028786 Bacteria 530
472 Ga0307515_10519231 3300028794 Bacteria 801
473 Ga0265338_10094486 3300028800 Bacteria 2459
474 Ga0265338_10640391 3300028800 Bacteria 737
475 Ga0311004_138321 3300029276 Bacteria 727
476 Ga0311001_1031055 3300029277 Bacteria 804
477 Ga0311001_1053164 3300029277 Bacteria 818
478 Ga0311011_123107 3300029280 Bacteria 793
479 Ga0311003_121913 3300029282 Bacteria 512
480 Ga0311003_125087 3300029282 Bacteria 688
481 Ga0310981_1100149 3300029285 Bacteria 906
482 Ga0265779_102877 3300031043 Bacteria 847
483 Ga0265760_10147372 3300031090 Bacteria 770
484 Ga0265330_10393931 3300031235 Bacteria 586
485 Ga0265332_10467078 3300031238 Bacteria 522
486 Ga0265320_10000034 3300031240 Bacteria 141117
487 Ga0265320_10489657 3300031240 Bacteria 543
488 Ga0265325_10003456 3300031241 Bacteria 10309
489 Ga0265340_10515205 3300031247 Bacteria 526
490 Ga0265339_10004743 3300031249 Bacteria 9212
491 Ga0265331_10030793 3300031250 Bacteria 2669
492 Ga0265331_10148437 3300031250 Bacteria 1065
493 Ga0265327_10001626 3300031251 Bacteria 27106
494 Ga0265316_10027435 3300031344 Bacteria 4715
495 Ga0265316_10136588 3300031344 Bacteria 1844
496 Ga0265316_10491317 3300031344 Bacteria 877
497 Ga0265316_10519972 3300031344 Bacteria 849
498 Ga0307513_10016496 3300031456 Bacteria 8901
499 Ga0307408_100204395 3300031548 Bacteria 1601
500 Ga0265313_10000684 3300031595 Bacteria 34937
501 Ga0265313_10007140 3300031595 Bacteria 7692
502 Ga0265313_10070804 3300031595 Bacteria 1606
503 Ga0307508_10427071 3300031616 Bacteria 917
504 Ga0316575_10323763 3300031665 Bacteria 654
505 Ga0265314_10015934 3300031711 Bacteria 5951
506 Ga0265314_10088368 3300031711 Bacteria 2024
507 Ga0265314_10660798 3300031711 Bacteria 532
508 Ga0265342_10078969 3300031712 Bacteria 1904
509 Ga0316578_10044225 3300031728 Bacteria 2590
510 Ga0307413_10077843 3300031824 Bacteria 2113
511 Ga0307413_11996917 3300031824 Bacteria 523
512 Ga0307410_10641133 3300031852 Bacteria 890
513 Ga0307410_11487594 3300031852 Bacteria 596
514 Ga0307406_10038109 3300031901 Bacteria 2974
515 Ga0307406_10333586 3300031901 Bacteria 1178
516 Ga0307407_10177005 3300031903 Bacteria 1410
517 Ga0307407_10856505 3300031903 Bacteria 695
518 Ga0307407_11137281 3300031903 Bacteria 608
519 Ga0307412_11096624 3300031911 Bacteria 708
520 Ga0307409_100133000 3300031995 Bacteria 2129
521 Ga0307409_102822639 3300031995 Bacteria 513
522 Ga0307416_100769971 3300032002 Bacteria 1056
523 Ga0307416_101414738 3300032002 Bacteria 801
524 Ga0307416_103096560 3300032002 Bacteria 556
525 Ga0307414_10322700 3300032004 Bacteria 1315
526 Ga0307414_10561240 3300032004 Bacteria 1019
527 Ga0307411_10198149 3300032005 Bacteria 1540
528 Ga0307411_10442367 3300032005 Bacteria 1085
529 Ga0316053_102069 3300032120 Bacteria 1111
530 Ga0316053_103113 3300032120 Bacteria 970
531 Ga0316053_110947 3300032120 Bacteria 636
532 Ga0316053_117627 3300032120 Bacteria 543
533 Ga0316593_10129243 3300032168 Bacteria 910
534 Ga0316596_1058159 3300033541 Bacteria 1029
535 Ga0373926_0015194 3300035083 Bacteria 2624
536 Ga0373926_0183675 3300035083 Bacteria 802
537 Ga0373934_0035323 3300035086 Bacteria 1966
538 Ga0373940_0165416 3300035088 Bacteria 712
539 Ga0373944_0016729 3300035089 Bacteria 2073
540 Ga0373944_0363269 3300035089 Bacteria 553
541 Ga0373944_0363442 3300035089 Bacteria 553
542 Ga0373923_0084479 3300035111 Bacteria 1381
543 Ga0373941_0127197 3300035115 Bacteria 914
544 Ga0373941_0457170 3300035115 Bacteria 537
545 Ga0373945_0180681 3300035116 Bacteria 868
546 Ga0373953_0019784 3300035117 Bacteria 2509
547 Ga0373953_0077549 3300035117 Bacteria 1378
548 Ga0373954_0010039 3300035118 Bacteria 4171
549 Ga0373956_0087853 3300035119 Bacteria 1432
550 Ga0373956_0127179 3300035119 Bacteria 1192
551 Ga0373956_0335079 3300035119 Bacteria 721
552 Ga0373957_0161180 3300035120 Bacteria 924
553 Ga0373957_0431881 3300035120 Bacteria 569
554 Ga0373943_0059797 3300035170 Bacteria 1900
555 Ga0373955_0075448 3300035172 Bacteria 1895
556 Ga0373955_0172695 3300035172 Bacteria 1280
557 Ga0373955_0174102 3300035172 Bacteria 1275
558 Ga0373962_0293809 3300035242 Bacteria 575
559 Ga0316574_0612504 3300035398 Bacteria 672
560 Ga0373924_0104733 3300035410 Bacteria 1219
561 Ga0373931_0097171 3300035691 Bacteria 1651
562 Ga0373931_0196407 3300035691 Bacteria 1203
563 Ga0373931_0199961 3300035691 Bacteria 1193
564 Ga0373931_1275228 3300035691 Bacteria 505
565 Ga0373935_0010364 3300035692 Bacteria 5592
566 Ga0373935_0147724 3300035692 Bacteria 1593
567 Ga0373935_0727911 3300035692 Bacteria 730
568 Ga0373927_0049908 3300035695 Bacteria 2705
569 Ga0373927_0173705 3300035695 Bacteria 1413
570 Ga0373927_0713551 3300035695 Bacteria 662
571 Ga0373927_0750034 3300035695 Bacteria 645
572 Ga0373933_0163461 3300035724 Bacteria 1414
573 Ga0373933_0174584 3300035724 Bacteria 1368
574 Ga0373933_0300533 3300035724 Bacteria 1039
575 Ga0373947_0147669 3300035725 Bacteria 1513
576 Ga0373947_0342789 3300035725 Bacteria 1002
577 Ga0373947_0474870 3300035725 Bacteria 848
578 Ga0373947_0625816 3300035725 Bacteria 734
579 Ga0373937_0036655 3300036401 Bacteria 4469
580 Ga0373937_0055971 3300036401 Bacteria 3621
581 Ga0373937_0107030 3300036401 Bacteria 2599
582 Ga0373937_0135948 3300036401 Bacteria 2299
583 Ga0373937_0262429 3300036401 Bacteria 1629
584 Ga0373937_0274164 3300036401 Bacteria 1592
585 Ga0373937_0384417 3300036401 Bacteria 1331
586 Ga0373937_0619290 3300036401 Bacteria 1027
587 Ga0265778_018018 3300036457 Bacteria 856
588 Ga0265778_031076 3300036457 Bacteria 691
589 Ga0310112_031287 3300036458 Bacteria 731
590 Ga0316582_1032615 3300036647 Bacteria 561
591 Ga0316584_0038621 3300036712 Bacteria 3552
592 Ga0316584_0228026 3300036712 Bacteria 1366
593 Ga0373925_0125830 3300037068 Bacteria 1994
594 Ga0373925_0411053 3300037068 Bacteria 1104
595 Ga0373925_0420945 3300037068 Bacteria 1091
596 Ga0373925_0559447 3300037068 Bacteria 941
597 Ga0373925_0725941 3300037068 Bacteria 819
598 Ga0373925_0853558 3300037068 Bacteria 750
599 Ga0395900_0207605 3300037418 Bacteria 1979
600 Ga0395900_0716946 3300037418 Bacteria 933
601 Ga0395900_0798671 3300037418 Bacteria 872
602 Ga0395900_1540991 3300037418 Bacteria 576
603 Ga0395905_0340766 3300037471 Bacteria 1390
604 Ga0395905_1151906 3300037471 Bacteria 679
605 Ga0436364_0107232 3300037853 Bacteria 4053
606 Ga0436364_0124117 3300037853 Bacteria 666
607 Ga0436364_0152010 3300037853 Bacteria 1024
608 Ga0436364_0494738 3300037853 Bacteria 915
609 Ga0436364_0635032 3300037853 Bacteria 2911
610 Ga0436364_0820937 3300037853 Bacteria 2157
611 Ga0436364_0917165 3300037853 Bacteria 1079
612 Ga0436364_0955632 3300037853 Bacteria 12912
613 Ga0436364_0992577 3300037853 Bacteria 61189
614 Ga0436364_1273280 3300037853 Bacteria 1084
615 Ga0436364_1325716 3300037853 Bacteria 29512
616 Ga0400483_035672 3300039062 Bacteria 10436
617 Ga0400483_040634 3300039062 Bacteria 6524
618 Ga0400483_110392 3300039062 Bacteria 37401
619 Ga0400483_162576 3300039062 Bacteria 1371
620 Ga0400483_183320 3300039062 Bacteria 6606
621 Ga0400483_193625 3300039062 Bacteria 8230
622 Ga0436365_0100754 3300039437 Bacteria 1694
623 Ga0436365_0173685 3300039437 Bacteria 1287
624 Ga0436365_0267096 3300039437 Bacteria 1220
625 Ga0436365_0293773 3300039437 Bacteria 521
626 Ga0436365_0364228 3300039437 Bacteria 842
627 Ga0436365_0376694 3300039437 Bacteria 6274
628 Ga0436365_0380682 3300039437 Bacteria 1274
629 Ga0436365_0475470 3300039437 Bacteria 1333
630 Ga0436365_0578833 3300039437 Bacteria 16736
631 Ga0436365_1351316 3300039437 Bacteria 518
632 Ga0436365_1402836 3300039437 Bacteria 892
633 Ga0436365_1538308 3300039437 Bacteria 6489
634 Ga0436365_1840201 3300039437 Bacteria 1652
635 Ga0436365_1857359 3300039437 Bacteria 625
636 Ga0436360_0014261 3300039438 Bacteria 959
637 Ga0436360_0024550 3300039438 Bacteria 527
638 Ga0436360_0361518 3300039438 Bacteria 2506
639 Ga0436360_0391913 3300039438 Bacteria 688
640 Ga0436360_0490029 3300039438 Bacteria 883
641 Ga0436360_0533670 3300039438 Bacteria 773
642 Ga0436360_0553874 3300039438 Bacteria 1189
643 Ga0436360_0561465 3300039438 Bacteria 3508
644 Ga0436360_0572148 3300039438 Bacteria 772
645 Ga0436360_0576109 3300039438 Bacteria 592
646 Ga0436360_0698116 3300039438 Bacteria 1714
647 Ga0436360_0702207 3300039438 Bacteria 1945
648 Ga0436360_0739006 3300039438 Bacteria 809
649 Ga0436360_1072902 3300039438 Bacteria 670
650 Ga0436360_1145124 3300039438 Bacteria 1248
651 Ga0436360_1169877 3300039438 Bacteria 1430
652 Ga0436360_1174101 3300039438 Bacteria 2111
653 Ga0436361_0003327 3300039447 Bacteria 1411
654 Ga0436361_0253762 3300039447 Bacteria 572
655 Ga0436361_0405123 3300039447 Bacteria 632
656 Ga0436361_0425469 3300039447 Bacteria 2317
657 Ga0436361_0984265 3300039447 Bacteria 4036
658 Ga0436363_0494978 3300039450 Bacteria 822
659 Ga0436363_0638497 3300039450 Bacteria 1393
660 Ga0436363_1229966 3300039450 Bacteria 502
661 Ga0436363_1577646 3300039450 Bacteria 4559
662 Ga0436363_1625974 3300039450 Bacteria 800
663 Ga0436362_0410910 3300039453 Bacteria 506
664 Ga0436362_0452787 3300039453 Bacteria 838
665 Ga0436362_0472865 3300039453 Bacteria 949
666 Ga0436362_0597650 3300039453 Bacteria 695
667 Ga0436362_1051301 3300039453 Bacteria 556
668 Ga0436362_1068357 3300039453 Bacteria 1999
669 Ga0436362_1092587 3300039453 Bacteria 1824
670 Ga0436362_1291248 3300039453 Bacteria 1399
671 Ga0451807_0328312 3300041486 Bacteria 632
672 Ga0451833_0732293 3300041491 Bacteria 502
673 Ga0451839_0176171 3300041496 Bacteria 673
674 Ga0439435_0111060 3300042436 Bacteria 851
675 Ga0439460_0097548 3300042461 Bacteria 941
676 Ga0439460_0140667 3300042461 Bacteria 800
677 Ga0439460_0225916 3300042461 Bacteria 643
678 Ga0450918_034001 3300042531 Bacteria 905
679 Ga0451577_0289675 3300042876 Bacteria 1484
680 Ga0466963_0245406 3300044694 Bacteria 1256
681 Ga0453684_0006779 3300044712 Bacteria 21552
682 Ga0453684_0037239 3300044712 Bacteria 6680
683 Ga0453684_0610362 3300044712 Bacteria 1195
684 Ga0466959_1017666 3300045049 Bacteria 552
685 Ga0451576_0001200 3300045051 Bacteria 46344
686 Ga0451576_0008100 3300045051 Bacteria 12386
687 Ga0451576_2310719 3300045051 Bacteria 551
688 Ga0466958_0595503 3300045836 Bacteria 719
689 Ga0466967_0324479 3300045976 Bacteria 1485
690 Ga0466967_0538680 3300045976 Bacteria 1148
691 Ga0495592_0224270 3300046454 Bacteria 1255
692 Ga0495592_0760139 3300046454 Bacteria 578
693 Ga0495629_0769023 3300046459 Bacteria 637
694 Ga0495638_0203489 3300046460 Bacteria 1116
695 Ga0495651_0356097 3300046462 Bacteria 966
696 Ga0495651_0807242 3300046462 Bacteria 579
697 Ga0495580_0047718 3300046472 Bacteria 3035
698 Ga0495580_0101709 3300046472 Bacteria 1998
699 Ga0495580_1089978 3300046472 Bacteria 505
700 Ga0495639_0014253 3300046475 Bacteria 3440
701 Ga0495594_0057864 3300046499 Bacteria 2141
702 Ga0495630_0299030 3300046517 Bacteria 1230
703 Ga0495666_0436578 3300046526 Bacteria 587
704 Ga0495665_0509240 3300046531 Bacteria 606
705 Ga0495640_0226852 3300046533 Bacteria 1176
706 Ga0495640_0233823 3300046533 Bacteria 1155
707 Ga0495586_0194122 3300046535 Bacteria 1150
708 Ga0495667_0100154 3300046559 Bacteria 1875
709 Ga0495667_0337151 3300046559 Bacteria 953
710 Ga0495635_0033432 3300046663 Bacteria 3567
711 Ga0495635_0202518 3300046663 Bacteria 1346
712 Ga0495657_0158185 3300046675 Bacteria 1403
713 Ga0495599_0189513 3300046678 Bacteria 1266
714 Ga0495623_0119445 3300046679 Bacteria 1588
715 Ga0495680_0075366 3300047322 Bacteria 2560
716 Ga0495684_0393144 3300047471 Bacteria 975
717 Ga0495686_0294419 3300047472 Bacteria 898
718 Ga0495602_0624961 3300048088 Bacteria 738
719 Ga0496100_0608337 3300048903 Bacteria 849
720 Ga0496100_0850022 3300048903 Bacteria 716
721 Ga0496102_0209792 3300048905 Bacteria 1836
722 Ga0496102_0247621 3300048905 Bacteria 1680
723 Ga0496103_0047181 3300048906 Bacteria 2661
724 Ga0496103_0443512 3300048906 Bacteria 833
725 Ga0496104_0066495 3300048907 Bacteria 3423
726 Ga0496104_0518424 3300048907 Bacteria 1103
727 Ga0496105_1329558 3300048908 Bacteria 523
728 Ga0496106_0102060 3300048909 Bacteria 2225
729 Ga0496107_0109749 3300048910 Bacteria 2027
730 Ga0496107_0591171 3300048910 Bacteria 821
731 Ga0496108_0126414 3300048911 Bacteria 2195
732 Ga0496109_0996933 3300048912 Bacteria 775
733 Ga0496109_1265017 3300048912 Bacteria 674
734 Ga0496110_0170595 3300048913 Bacteria 1974
735 Ga0496111_0503087 3300048914 Bacteria 892
736 Ga0496111_0546956 3300048914 Bacteria 850
737 Ga0496112_0451978 3300048915 Bacteria 1222
738 Ga0496113_0072518 3300048916 Bacteria 2621
739 Ga0496113_0084990 3300048916 Bacteria 2430
740 Ga0501309_043441 3300049129 Bacteria 691
741 Ga0501305_063414 3300049161 Bacteria 640
742 Ga0501305_114624 3300049161 Bacteria 513
743 Ga0501307_022550 3300049162 Bacteria 829
744 Ga0501312_032710 3300049528 Bacteria 822
745 Ga0501318_032514 3300049534 Bacteria 716
746 Ga0501325_034973 3300049541 Bacteria 591
747 Ga0501330_012650 3300049546 Bacteria 620
748 Ga0501335_039487 3300049551 Bacteria 553
749 Ga0501338_10224 3300049554 Bacteria 631
750 Ga0501032_0002358 3300049569 Bacteria 14796
751 Ga0501033_0016156 3300049570 Bacteria 5652
752 Ga0501033_0159514 3300049570 Bacteria 1624
753 Ga0501033_0377347 3300049570 Bacteria 991
754 Ga0501034_0069173 3300049571 Bacteria 3541
755 Ga0501034_0071182 3300049571 Bacteria 3487
756 Ga0501034_0179122 3300049571 Bacteria 2085
757 Ga0501034_1019725 3300049571 Bacteria 711
758 Ga0501036_0008712 3300049572 Bacteria 8321
759 Ga0501036_0738604 3300049572 Bacteria 812
760 Ga0501036_0918543 3300049572 Bacteria 718
761 Ga0501037_0000785 3300049573 Bacteria 23911
762 Ga0501037_0051448 3300049573 Bacteria 3013
763 Ga0501037_0941327 3300049573 Bacteria 565
764 Ga0501037_1094692 3300049573 Bacteria 516
765 Ga0501038_0001615 3300049574 Bacteria 20948
766 Ga0501038_0066062 3300049574 Bacteria 3081
767 Ga0501038_0072500 3300049574 Bacteria 2918
768 Ga0501038_0472949 3300049574 Bacteria 961
769 Ga0501039_0001268 3300049575 Bacteria 18468
770 Ga0501039_0227570 3300049575 Bacteria 1466
771 Ga0501040_0452131 3300049576 Bacteria 925
772 Ga0501040_0599870 3300049576 Bacteria 795
773 Ga0501040_1168523 3300049576 Bacteria 558
774 Ga0501041_0030588 3300049577 Bacteria 3250
775 Ga0501041_0108513 3300049577 Bacteria 1721
776 Ga0501041_0398226 3300049577 Bacteria 872
777 Ga0501042_0015555 3300049578 Bacteria 5211
778 Ga0501043_0002273 3300049579 Bacteria 16341
779 Ga0501043_0156541 3300049579 Bacteria 1782
780 Ga0501043_0238421 3300049579 Bacteria 1403
781 Ga0501043_0453847 3300049579 Bacteria 963
782 Ga0501046_0002264 3300049580 Bacteria 18161
783 Ga0501046_0021881 3300049580 Bacteria 5271
784 Ga0501046_0354762 3300049580 Bacteria 1064
785 Ga0501046_0406465 3300049580 Bacteria 983
786 Ga0501047_0008134 3300049581 Bacteria 9898
787 Ga0501047_0030166 3300049581 Bacteria 5228
788 Ga0501047_0056543 3300049581 Bacteria 3794
789 Ga0501047_0264542 3300049581 Bacteria 1567
790 Ga0501047_0354396 3300049581 Bacteria 1304
791 Ga0501047_0935022 3300049581 Bacteria 680
792 Ga0501047_1290571 3300049581 Bacteria 544
793 Ga0501048_0032045 3300049582 Bacteria 3800
794 Ga0501048_0051700 3300049582 Bacteria 2924
795 Ga0501048_0818833 3300049582 Bacteria 669
796 Ga0501067_0632886 3300049583 Bacteria 600
797 Ga0501068_0021508 3300049584 Bacteria 3766
798 Ga0501068_0058650 3300049584 Bacteria 2336
799 Ga0501069_0000429 3300049585 Bacteria 19098
800 Ga0501069_0099369 3300049585 Bacteria 1651
801 Ga0501069_0858166 3300049585 Bacteria 551
802 Ga0501070_0006112 3300049586 Bacteria 10263
803 Ga0501070_0173619 3300049586 Bacteria 1775
804 Ga0501071_0050291 3300049587 Bacteria 3002
805 Ga0501071_0476252 3300049587 Bacteria 957
806 Ga0501072_0016964 3300049588 Bacteria 5596
807 Ga0501072_0394232 3300049588 Bacteria 1098
808 Ga0501073_0022408 3300049589 Bacteria 4548
809 Ga0501073_0025480 3300049589 Bacteria 4241
810 Ga0501074_0006905 3300049590 Bacteria 8196
811 Ga0501074_0303323 3300049590 Bacteria 1134
812 Ga0501074_0494624 3300049590 Bacteria 867
813 Ga0501075_0087772 3300049591 Bacteria 2357
814 Ga0501076_0052792 3300049592 Bacteria 3220
815 Ga0501076_0066286 3300049592 Bacteria 2882
816 Ga0501076_0491758 3300049592 Bacteria 1011
817 Ga0501077_0213426 3300049593 Bacteria 1226
818 Ga0501077_0345714 3300049593 Bacteria 949
819 Ga0501250_046044 3300049680 Bacteria 656
820 Ga0501250_085386 3300049680 Bacteria 543
821 Ga0501245_114851 3300049708 Bacteria 561
822 Ga0501079_0133831 3300049741 Bacteria 1930
823 Ga0501079_0143316 3300049741 Bacteria 1861
824 Ga0501079_0374717 3300049741 Bacteria 1116
825 Ga0501079_0817958 3300049741 Bacteria 734
826 Ga0501080_0004541 3300049742 Bacteria 12373
827 Ga0501080_0011613 3300049742 Bacteria 8065
828 Ga0501080_0111088 3300049742 Bacteria 2540
829 Ga0501080_0986532 3300049742 Bacteria 731
830 Ga0501081_0514897 3300049743 Bacteria 892
831 Ga0501081_0928419 3300049743 Bacteria 657
832 Ga0501081_1195123 3300049743 Bacteria 576
833 Ga0501083_0002945 3300049744 Bacteria 11794
834 Ga0501083_0028601 3300049744 Bacteria 3841
835 Ga0501083_0064436 3300049744 Bacteria 2442
836 Ga0501083_0292932 3300049744 Bacteria 1059
837 Ga0501083_0296332 3300049744 Bacteria 1052
838 Ga0501083_0743702 3300049744 Bacteria 638
839 Ga0501083_0924328 3300049744 Bacteria 568
840 Ga0501035_0001739 3300049822 Bacteria 21999
841 Ga0501035_0029099 3300049822 Bacteria 5038
842 Ga0501035_0439173 3300049822 Bacteria 1081
843 Ga0501035_0937969 3300049822 Bacteria 683
844 Ga0501035_1185234 3300049822 Bacteria 593
845 Ga0501044_0024561 3300049823 Bacteria 6394
846 Ga0501044_0181659 3300049823 Bacteria 2070
847 Ga0501044_0281805 3300049823 Bacteria 1595
848 Ga0501044_0514658 3300049823 Bacteria 1097
849 Ga0501044_0519385 3300049823 Bacteria 1091
850 Ga0501044_0757569 3300049823 Bacteria 853
851 Ga0501044_1346746 3300049823 Bacteria 580
852 Ga0501044_1472106 3300049823 Bacteria 546
853 Ga0501045_0085069 3300049824 Bacteria 2334
854 Ga0501045_0684841 3300049824 Bacteria 757
855 Ga0501045_1180626 3300049824 Bacteria 559
856 nmdc:mga03683_56195_c1 3300050489 Bacteria 1654
857 nmdc:mga03683_621130_c1 3300050489 Bacteria 530
858 nmdc:mga06z11_442020_c1 3300050494 Bacteria 785
859 nmdc:mga07m45_882378_c1 3300050496 Bacteria 512
860 nmdc:mga05p37_114730_c1 3300050507 Bacteria 3311
861 nmdc:mga05p37_247428_c1 3300050507 Bacteria 2140
862 nmdc:mga09592_1713022_c1 3300050508 Bacteria 506
863 nmdc:mga0qj67_268151_c1 3300050509 Bacteria 1384
864 nmdc:mga06r32_1075733_c1 3300050510 Bacteria 754
865 nmdc:mga06r32_1447777_c1 3300050510 Bacteria 628
866 nmdc:mga06r32_197609_c1 3300050510 Bacteria 1998
867 nmdc:mga08y16_38_c1 3300050511 Bacteria 135093
868 nmdc:mga08y16_610624_c1 3300050511 Bacteria 1098
869 nmdc:mga0n895_653458_c1 3300050512 Bacteria 1050
870 nmdc:mga0n895_722414_c1 3300050512 Bacteria 991
871 nmdc:mga0n895_742664_c1 3300050512 Bacteria 975
872 nmdc:mga0rr50_198406_c1 3300050513 Bacteria 1648
873 nmdc:mga0rr50_19863_c1 3300050513 Bacteria 4546
874 nmdc:mga0rr50_874630_c1 3300050513 Bacteria 766
875 nmdc:mga08x19_163348_c1 3300050514 Bacteria 1513
876 nmdc:mga08x19_188959_c1 3300050514 Bacteria 1408
877 nmdc:mga08x19_39313_c1 3300050514 Bacteria 3007
878 nmdc:mga08x19_667236_c1 3300050514 Bacteria 738
879 nmdc:mga08x19_69_c1 3300050514 Bacteria 100711
880 nmdc:mga08x19_9966_c1 3300050514 Bacteria 5696
881 nmdc:mga0a205_578690_c1 3300050515 Bacteria 977
882 Ga0495601_0011414 3300053077 Bacteria 5312
883 Ga0495601_0064822 3300053077 Bacteria 2324
884 Ga0495612_0094828 3300053078 Bacteria 1267
885 Ga0495595_0030639 3300053084 Bacteria 2414
886 Ga0495619_0026689 3300053085 Bacteria 3717
887 Ga0495619_0235236 3300053085 Bacteria 1269
888 Ga0500578_0269571 3300053086 Bacteria 1019
889 Ga0500643_016289 3300053087 Bacteria 2521
890 Ga0500646_0051199 3300053090 Bacteria 1192
891 Ga0500641_0092679 3300053096 Bacteria 1290
892 Ga0500650_0180055 3300053098 Bacteria 969
893 Ga0500555_011750 3300053103 Bacteria 2517
894 Ga0500556_0006240 3300053104 Bacteria 3380
895 Ga0500595_000884 3300053119 Bacteria 17086
896 Ga0500642_0000418 3300053130 Bacteria 13832
897 Ga0500642_0003023 3300053130 Bacteria 5018
898 Ga0500652_342080 3300053131 Bacteria 568
899 Ga0500658_0012908 3300053134 Bacteria 3086
900 Ga0500568_0151572 3300053139 Bacteria 857
901 Ga0500588_0279107 3300053146 Bacteria 630
902 Ga0500604_0001152 3300053151 Bacteria 7350
903 Ga0500604_0246011 3300053151 Bacteria 618
904 Ga0500616_0009252 3300053153 Bacteria 6005
905 Ga0500633_0125633 3300053160 Bacteria 956
906 Ga0500634_0319505 3300053161 Bacteria 607
907 Ga0500637_0003194 3300053178 Bacteria 7508
908 Ga0500609_002178 3300053731 Bacteria 2799
909 Ga0500587_045057 3300053739 Bacteria 642
910 Ga0501084_0009704 3300054114 Bacteria 7961
911 Ga0501084_0015059 3300054114 Bacteria 6413
912 Ga0501084_0116364 3300054114 Bacteria 2247
913 Ga0590071_064635 3300059421 Bacteria 897
914 Ga0590074_053171 3300059423 Bacteria 744
915 Ga0590075_014374 3300059424 Bacteria 1935
916 Ga0590075_072420 3300059424 Bacteria 891
917 Ga0587066_202861 3300059490 Bacteria 523
918 Ga0587070_084677 3300059491 Bacteria 702
919 Ga0587073_0063124 3300059492 Bacteria 875
920 Ga0587073_0101694 3300059492 Bacteria 748
921 Ga0587073_0169635 3300059492 Bacteria 632
922 Ga0587077_230262 3300059493 Bacteria 527
923 Ga0587080_047234 3300059503 Bacteria 803
924 Ga0587080_080557 3300059503 Bacteria 667
925 Ga0587082_143134 3300059504 Bacteria 559
926 Ga0587082_169533 3300059504 Bacteria 528
927 Ga0587083_0078064 3300059505 Bacteria 783
928 Ga0587083_0106002 3300059505 Bacteria 707
929 Ga0587085_053115 3300059506 Bacteria 744
930 Ga0587086_108405 3300059507 Bacteria 519
931 Ga0587088_153628 3300059508 Bacteria 559
932 Ga0587090_055622 3300059510 Bacteria 737
933 Ga0587091_074155 3300059511 Bacteria 751
934 Ga0587091_139252 3300059511 Bacteria 606
935 Ga0587094_045240 3300059513 Bacteria 730
936 Ga0587095_029003 3300059514 Bacteria 565
937 Ga0587106_054127 3300059605 Bacteria 719
938 Ga0587106_110333 3300059605 Bacteria 572
939 Ga0587106_118435 3300059605 Bacteria 559
940 Ga0587125_039064 3300059607 Bacteria 635
941 Ga0587129_021808 3300059608 Bacteria 572
942 Ga0587131_020918 3300059609 Bacteria 539
943 Ga0587109_098190 3300059624 Bacteria 670
944 Ga0587109_212564 3300059624 Bacteria 509
945 Ga0587115_014990 3300059626 Bacteria 1021
946 Ga0587122_007379 3300059628 Bacteria 974
947 Ga0587122_042900 3300059628 Bacteria 567
948 Ga0587128_015296 3300059630 Bacteria 1110
949 Ga0587128_125565 3300059630 Bacteria 563
950 Ga0587128_159993 3300059630 Bacteria 519
951 Ga0587067_087043 3300059640 Bacteria 701
952 Ga0587067_121305 3300059640 Bacteria 628
953 Ga0587068_066769 3300059641 Bacteria 702
954 Ga0587069_100708 3300059642 Bacteria 590
955 Ga0587072_058951 3300059643 Bacteria 786
956 Ga0587072_168056 3300059643 Bacteria 540
957 Ga0587075_020623 3300059644 Bacteria 975
958 Ga0587075_136449 3300059644 Bacteria 520
959 Ga0587076_144067 3300059645 Bacteria 573
960 Ga0587078_013659 3300059646 Bacteria 964
961 Ga0587078_021061 3300059646 Bacteria 824
962 Ga0587107_119020 3300059652 Bacteria 543
963 Ga0587110_048135 3300059654 Bacteria 564
964 Ga0587124_044109 3300059660 Bacteria 528
965 Ga0587111_0097436 3300060346 Bacteria 728
966 Ga0501082_0007064 3300060353 Bacteria 9687
967 Ga0501082_0020189 3300060353 Bacteria 5742
968 Ga0501082_0029977 3300060353 Bacteria 4687
969 Ga0530510_0003678 3300061734 Bacteria 10552
970 Ga0530510_0710796 3300061734 Bacteria 766
971 Ga0530510_0908924 3300061734 Bacteria 673
972 Ga0530510_1198798 3300061734 Bacteria 582
973 2842333558 2842333319 Bacteria 8899485
974 2842777944 2842775625 Bacteria 5587290
975 2883358471 2883354860 Bacteria 5865246
976 2883578439 2883577096 Bacteria 4709178
977 2894774388 2894772417 Bacteria 5305674
978 nmdc:mga0rr50_211860_c1
979 Ga0006765J45826_113369
980 Ga0006778J45830_1011108
981 Ga0006778J45830_1012435
982 Ga0006759J45824_1017163
983 Ga0006770J48903_1018555
984 Ga0006770J48903_1042342
985 Ga0006777J48905_1013663
986 Ga0007417J51691_1012571
987 Ga0007417J51691_1030506
988 Ga0007427J51700_115644
989 Ga0006781J51513_1011663
990 Ga0006781J51513_1017243
991 Ga0007410J51695_1013659
992 Ga0007410J51695_1013962
993 Ga0007409J51694_1017153
994 Ga0007409J51694_1032049
995 Ga0007409J51694_1063371
996 Ga0007416J51690_1015266
997 Ga0007416J51690_1016742
998 Ga0007416J51690_1050873
999 Ga0007429J51699_1010539
1000 Ga0007429J51699_1038836
1001 Ga0007411J51799_110620
1002 Ga0032354_1008041
1003 Ga0032354_1037704
1004 Ga0006780_1001755
1005 Ga0006780_1003345
1006 Ga0058863_11567754
1007 Ga0058863_11657535
1008 Ga0058863_11890266
1009 Ga0058863_11972538
1010 Ga0058861_11895452
1011 Ga0058861_11916278
1012 Ga0058861_11923301
1013 Ga0058860_10127369
1014 Ga0058860_12093545
1015 Ga0058862_12482892
1016 Ga0065712_10260760
1017 Ga0065712_10532048
1018 Ga0070676_10095611
1019 Ga0070683_101059478
1020 Ga0070690_100157655
1021 Ga0070670_101036656
1022 Ga0068869_100729640
1023 Ga0070682_101421224
1024 Ga0068868_100543784
1025 Ga0068868_101066149
1026 Ga0070689_101483366
1027 Ga0070691_10004158
1028 Ga0070661_100916912
1029 Ga0070692_10291339
1030 Ga0070671_100187748
1031 Ga0070671_100495037
1032 Ga0070671_101535072
1033 Ga0070674_100005082
1034 Ga0070709_10000635
1035 Ga0070709_10037690
1036 Ga0070709_11744872
1037 Ga0070714_100076330
1038 Ga0070714_100189897
1039 Ga0070714_100492264
1040 Ga0070714_100588579
1041 Ga0070714_100698881
1042 Ga0070714_100858229
1043 Ga0070714_100904416
1044 Ga0070714_101100050
1045 Ga0070714_101107666
1046 Ga0070714_101614500
1047 Ga0070713_100000821
1048 Ga0070713_100041395
1049 Ga0070713_100229506
1050 Ga0070713_100258577
1051 Ga0070713_100385231
1052 Ga0070710_10008491
1053 Ga0070710_10012495
1054 Ga0070710_10029877
1055 Ga0070710_10205839
1056 Ga0070710_11239435
1057 Ga0070710_11358282
1058 Ga0070711_100016286
1059 Ga0070711_100096427
1060 Ga0070711_100316960
1061 Ga0070711_100545067
1062 Ga0070711_101280129
1063 Ga0070705_100071960
1064 Ga0070705_101851460
1065 Ga0070694_100436552
1066 Ga0070708_100173246
1067 Ga0070708_100183529
1068 Ga0070708_100886554
1069 Ga0070681_10223641
1070 Ga0070681_10452740
1071 Ga0070681_10544900
1072 Ga0070681_10717331
1073 Ga0068867_101285889
1074 Ga0070685_11568937
1075 Ga0070706_100298476
1076 Ga0070706_100703986
1077 Ga0070707_100021107
1078 Ga0070707_101366728
1079 Ga0070698_100028242
1080 Ga0070698_100216304
1081 Ga0070698_100559887
1082 Ga0070698_100907258
1083 Ga0070698_102172030
1084 Ga0070699_100085261
1085 Ga0070699_100295937
1086 Ga0070699_100704111
1087 Ga0070699_100760768
1088 Ga0070699_101335433
1089 Ga0070699_101631355
1090 Ga0070679_100273198
1091 Ga0070684_100344673
1092 Ga0070684_100838788
1093 Ga0070684_101238175
1094 Ga0070697_100087233
1095 Ga0070697_100224680
1096 Ga0070697_100358772
1097 Ga0070697_100598388
1098 Ga0070697_101051746
1099 Ga0070697_101145533
1100 Ga0068853_100075662
1101 Ga0070672_101943208
1102 Ga0070686_101416372
1103 Ga0070695_100008965
1104 Ga0070695_100164214
1105 Ga0070695_100568446
1106 Ga0070695_100774792
1107 Ga0070696_100480547
1108 Ga0070696_101063119
1109 Ga0070693_100035966
1110 Ga0070693_101669601
1111 Ga0070665_101119468
1112 Ga0070704_100495304
1113 Ga0068855_100030001
1114 Ga0068855_100236429
1115 Ga0068857_100013738
1116 Ga0068854_100126163
1117 Ga0068856_100001161
1118 Ga0068856_100151109
1119 Ga0068856_100542127
1120 Ga0068856_100559188
1121 Ga0068856_101428538
1122 Ga0068856_101487977
1123 Ga0070702_100780031
1124 Ga0068852_100008313
1125 Ga0068859_100909127
1126 Ga0068859_101433323
1127 Ga0068866_10258042
1128 Ga0068861_100075036
1129 Ga0068861_100247043
1130 Ga0068851_10332491
1131 Ga0068860_100387354
1132 Ga0068860_100505431
1133 Ga0068860_101149921
1134 Ga0068862_100117623
1135 Ga0068862_100223200
1136 Ga0068862_100527367
1137 Ga0068862_100856674
1138 Ga0068862_100958875
1139 Ga0081455_10184731
1140 Ga0081538_10004148
1141 Ga0081538_10032803
1142 Ga0081540_1046317
1143 Ga0070717_10004460
1144 Ga0070717_10402771
1145 Ga0070717_10560623
1146 Ga0075363_100807955
1147 Ga0075364_10717944
1148 Ga0070715_10362210
1149 Ga0070715_10619178
1150 Ga0070716_100195914
1151 Ga0070712_100006320
1152 Ga0070712_100031740
1153 Ga0070712_100074398
1154 Ga0070712_100213602
1155 Ga0070712_100349040
1156 Ga0070712_100374538
1157 Ga0070712_100703633
1158 Ga0070712_100715929
1159 Ga0075362_10295729
1160 Ga0075367_10324070
1161 Ga0075366_10759646
1162 Ga0097621_101253874
1163 Ga0075430_100589847
1164 Ga0075431_100512403
1165 Ga0075431_101810389
1166 Ga0075433_10132587
1167 Ga0075434_100063526
1168 Ga0075434_100286823
1169 Ga0075434_100637628
1170 Ga0075434_100686187
1171 Ga0068865_100206843
1172 Ga0068865_100211420
1173 Ga0075436_100038092
1174 Ga0075436_100039303
1175 Ga0075436_100091942
1176 Ga0075436_100191727
1177 Ga0075436_100257429
1178 Ga0097620_100909106
1179 Ga0097620_101433338
1180 Ga0075435_100037487
1181 Ga0075435_100165270
1182 Ga0075435_100227925
1183 Ga0075435_100775169
1184 Ga0099794_10109725
1185 Ga0099795_10019549
1186 Ga0099795_10020870
1187 Ga0099795_10021799
1188 Ga0105251_10633738
1189 Ga0105240_10085497
1190 Ga0105240_10344959
1191 Ga0105240_10542536
1192 Ga0105240_11986219
1193 Ga0111539_10000169
1194 Ga0111539_10265998
1195 Ga0111539_10774047
1196 Ga0111539_11682942
1197 Ga0105245_10909207
1198 Ga0105245_11026994
1199 Ga0105245_11274173
1200 Ga0105245_11684619
1201 Ga0105247_10973764
1202 Ga0114129_10038268
1203 Ga0114129_10113130
1204 Ga0114129_10324211
1205 Ga0114129_11857986
1206 Ga0105243_11186700
1207 Ga0105241_10041637
1208 Ga0105241_10304995
1209 Ga0105241_11073068
1210 Ga0105241_12492053
1211 Ga0105242_12034087
1212 Ga0105248_10786392
1213 Ga0105248_11976181
1214 Ga0105248_13028721
1215 Ga0105237_10091545
1216 Ga0105237_11564355
1217 Ga0105238_10026969
1218 Ga0105238_11154419
1219 Ga0105238_12867044
1220 Ga0105249_11397965
1221 Ga0105028_110168
1222 Ga0099796_10000472
1223 Ga0099796_10021820
1224 Ga0099796_10045980
1225 Ga0099796_10145079
1226 Ga0099796_10338302
1227 Ga0099796_10578491
1228 Ga0105239_10030053
1229 Ga0105239_10678298
1230 Ga0105239_11177934
1231 Ga0157373_10064010
1232 Ga0157370_10057352
1233 Ga0157369_10135886
1234 Ga0157374_10244056
1235 Ga0157374_11191947
1236 Ga0157374_11588891
1237 Ga0157378_10404735
1238 Ga0157378_11191197
1239 Ga0163162_10054728
1240 Ga0163162_10466974
1241 Ga0163162_10803601
1242 Ga0163162_12139302
1243 Ga0157372_10026742
1244 Ga0157372_12679974
1245 Ga0163163_10222421
1246 Ga0163163_10246948
1247 Ga0163163_10283119
1248 Ga0157380_10039355
1249 Ga0157380_10156886
1250 Ga0157380_12119607
1251 Ga0182008_10054407
1252 Ga0182008_10108210
1253 Ga0157377_11542093
1254 Ga0157379_10009278
1255 Ga0157379_10016989
1256 Ga0157379_10021284
1257 Ga0157379_10215527
1258 Ga0157379_10732185
1259 Ga0157379_10909510
1260 Ga0157379_11552680
1261 Ga0157379_12318548
1262 Ga0157376_10339242
1263 Ga0182005_1060127
1264 Ga0184602_113634
1265 Ga0184602_120229
1266 Ga0184602_132698
1267 Ga0184597_107591
1268 Ga0184595_123667
1269 Ga0184593_117696
1270 Ga0184598_114645
1271 Ga0184598_121736
1272 Ga0184601_138778
1273 Ga0184599_106009
1274 Ga0184599_113015
1275 Ga0184600_130882
1276 Ga0184600_135270
1277 Ga0184600_147441
1278 Ga0184603_117833
1279 Ga0184603_133708
1280 Ga0197907_10128652
1281 Ga0197907_10271249
1282 Ga0197907_10419446
1283 Ga0197907_10474974
1284 Ga0197907_10572567
1285 Ga0197907_10716682
1286 Ga0197907_11135020
1287 Ga0206356_11417481
1288 Ga0206349_1341784
1289 Ga0206349_1605969
1290 Ga0206349_1934082
1291 Ga0206355_1237966
1292 Ga0206355_1269308
1293 Ga0206355_1329367
1294 Ga0206355_1564213
1295 Ga0206355_1573981
1296 Ga0206352_10209302
1297 Ga0206352_10572664
1298 Ga0206352_11245530
1299 Ga0206352_11305848
1300 Ga0206350_10570192
1301 Ga0206350_10916850
1302 Ga0206350_10999396
1303 Ga0206350_11270030
1304 Ga0206350_11482132
1305 Ga0206353_12034644
1306 Ga0154015_1079282
1307 Ga0154015_1254205
1308 Ga0154015_1282413
1309 Ga0154015_1370597
1310 Ga0213873_10030109
1311 Ga0213873_10143894
1312 Ga0213873_10267220
1313 Ga0213872_10232935
1314 Ga0213874_10014381
1315 Ga0213874_10359213
1316 Ga0213874_10439714
1317 Ga0213876_10012782
1318 Ga0213876_10017949
1319 Ga0213875_10000936
1320 Ga0213875_10000952
1321 Ga0213875_10048131
1322 Ga0213875_10135590
1323 Ga0213875_10552165
1324 Ga0213871_10222552
1325 Ga0224712_10076242
1326 Ga0224712_10114117
1327 Ga0224712_10136813
1328 Ga0224712_10141144
1329 Ga0224712_10146572
1330 Ga0224712_10285730
1331 Ga0224712_10304785
1332 Ga0224712_10328784
1333 Ga0224712_10329704
1334 Ga0256744_130546
1335 Ga0247552_101014
1336 Ga0247555_100498
1337 Ga0247555_100788
1338 Ga0247554_101270
1339 Ga0247551_101142
1340 Ga0247551_103646
1341 Ga0247550_100792
1342 Ga0247553_101614
1343 Ga0247553_103107
1344 Ga0247553_103843
1345 Ga0228598_1065719
1346 Ga0209675_1020657
1347 Ga0209758_1029501
1348 Ga0209050_1003198
1349 Ga0207426_1029154
1350 Ga0209257_1000766
1351 Ga0207692_10020598
1352 Ga0207692_10066017
1353 Ga0207692_10094800
1354 Ga0207692_10098330
1355 Ga0207642_10442678
1356 Ga0207680_10156040
1357 Ga0207685_10218181
1358 Ga0207699_10000247
1359 Ga0207699_10020990
1360 Ga0207699_10095561
1361 Ga0207684_10801406
1362 Ga0207684_10978279
1363 Ga0207654_10209930
1364 Ga0207654_10807522
1365 Ga0207707_10281946
1366 Ga0207707_10558793
1367 Ga0207707_10603293
1368 Ga0207707_11154389
1369 Ga0207695_10617233
1370 Ga0207671_10052710
1371 Ga0207693_10002332
1372 Ga0207693_10003094
1373 Ga0207693_10010567
1374 Ga0207693_10085264
1375 Ga0207693_10129256
1376 Ga0207693_10138992
1377 Ga0207693_10167203
1378 Ga0207693_11206471
1379 Ga0207693_11370214
1380 Ga0207663_10132708
1381 Ga0207663_10398791
1382 Ga0207663_10428857
1383 Ga0207663_10510141
1384 Ga0207662_10217782
1385 Ga0207646_10009818
1386 Ga0207681_10444607
1387 Ga0207694_10013968
1388 Ga0207650_11121842
1389 Ga0207687_11913991
1390 Ga0207700_10000005
1391 Ga0207700_10020490
1392 Ga0207700_10181916
1393 Ga0207700_10226404
1394 Ga0207700_10315886
1395 Ga0207700_10343593
1396 Ga0207700_10753910
1397 Ga0207700_10874461
1398 Ga0207664_10093531
1399 Ga0207664_10158288
1400 Ga0207664_10190510
1401 Ga0207664_10357174
1402 Ga0207664_10381612
1403 Ga0207664_10905619
1404 Ga0207644_11680741
1405 Ga0207709_11749958
1406 Ga0207670_11207142
1407 Ga0207669_10037511
1408 Ga0207704_10179339
1409 Ga0207665_10479408
1410 Ga0207665_10640959
1411 Ga0207665_10811867
1412 Ga0207679_10192120
1413 Ga0207667_10024010
1414 Ga0207667_10027776
1415 Ga0207667_10547453
1416 Ga0207712_11122745
1417 Ga0207640_10156038
1418 Ga0207703_10282343
1419 Ga0207703_12410480
1420 Ga0207639_10467662
1421 Ga0207708_10304889
1422 Ga0207708_10587154
1423 Ga0207702_10000159
1424 Ga0207702_10002973
1425 Ga0207702_10008489
1426 Ga0207702_11035209
1427 Ga0207702_11298073
1428 Ga0207702_11695343
1429 Ga0207641_11538025
1430 Ga0207641_12177659
1431 Ga0207648_10215910
1432 Ga0207674_10004151
1433 Ga0207675_100093083
1434 Ga0207675_100326974
1435 Ga0207683_10150621
1436 Ga0207698_10022996
1437 Ga0209179_1007928
1438 Ga0209179_1035413
1439 Ga0209179_1054597
1440 Ga0207428_10000072
1441 Ga0268266_11326204
1442 Ga0268265_10023906
1443 Ga0268265_10111622
1444 Ga0268265_10162321
1445 Ga0268265_10906074
1446 Ga0268265_10919510
1447 Ga0265336_10006985
1448 Ga0307517_10619643
1449 Ga0307515_10519231
1450 Ga0265338_10094486
1451 Ga0265338_10640391
1452 Ga0311004_138321
1453 Ga0311001_1031055
1454 Ga0311001_1053164
1455 Ga0311011_123107
1456 Ga0311003_121913
1457 Ga0311003_125087
1458 Ga0310981_1100149
1459 Ga0265779_102877
1460 Ga0265760_10147372
1461 Ga0265330_10393931
1462 Ga0265332_10467078
1463 Ga0265320_10000034
1464 Ga0265320_10489657
1465 Ga0265325_10003456
1466 Ga0265340_10515205
1467 Ga0265339_10004743
1468 Ga0265331_10030793
1469 Ga0265331_10148437
1470 Ga0265327_10001626
1471 Ga0265316_10027435
1472 Ga0265316_10136588
1473 Ga0265316_10491317
1474 Ga0265316_10519972
1475 Ga0307513_10016496
1476 Ga0307408_100204395
1477 Ga0265313_10000684
1478 Ga0265313_10007140
1479 Ga0265313_10070804
1480 Ga0307508_10427071
1481 Ga0316575_10323763
1482 Ga0265314_10015934
1483 Ga0265314_10088368
1484 Ga0265314_10660798
1485 Ga0265342_10078969
1486 Ga0316578_10044225
1487 Ga0307413_10077843
1488 Ga0307413_11996917
1489 Ga0307410_10641133
1490 Ga0307410_11487594
1491 Ga0307406_10038109
1492 Ga0307406_10333586
1493 Ga0307407_10177005
1494 Ga0307407_10856505
1495 Ga0307407_11137281
1496 Ga0307412_11096624
1497 Ga0307409_100133000
1498 Ga0307409_102822639
1499 Ga0307416_100769971
1500 Ga0307416_101414738
1501 Ga0307416_103096560
1502 Ga0307414_10322700
1503 Ga0307414_10561240
1504 Ga0307411_10198149
1505 Ga0307411_10442367
1506 Ga0316053_102069
1507 Ga0316053_103113
1508 Ga0316053_110947
1509 Ga0316053_117627
1510 Ga0316593_10129243
1511 Ga0316596_1058159
1512 Ga0373926_0015194
1513 Ga0373926_0183675
1514 Ga0373934_0035323
1515 Ga0373940_0165416
1516 Ga0373944_0016729
1517 Ga0373944_0363269
1518 Ga0373944_0363442
1519 Ga0373923_0084479
1520 Ga0373941_0127197
1521 Ga0373941_0457170
1522 Ga0373945_0180681
1523 Ga0373953_0019784
1524 Ga0373953_0077549
1525 Ga0373954_0010039
1526 Ga0373956_0087853
1527 Ga0373956_0127179
1528 Ga0373956_0335079
1529 Ga0373957_0161180
1530 Ga0373957_0431881
1531 Ga0373943_0059797
1532 Ga0373955_0075448
1533 Ga0373955_0172695
1534 Ga0373955_0174102
1535 Ga0373962_0293809
1536 Ga0316574_0612504
1537 Ga0373924_0104733
1538 Ga0373931_0097171
1539 Ga0373931_0196407
1540 Ga0373931_0199961
1541 Ga0373931_1275228
1542 Ga0373935_0010364
1543 Ga0373935_0147724
1544 Ga0373935_0727911
1545 Ga0373927_0049908
1546 Ga0373927_0173705
1547 Ga0373927_0713551
1548 Ga0373927_0750034
1549 Ga0373933_0163461
1550 Ga0373933_0174584
1551 Ga0373933_0300533
1552 Ga0373947_0147669
1553 Ga0373947_0342789
1554 Ga0373947_0474870
1555 Ga0373947_0625816
1556 Ga0373937_0036655
1557 Ga0373937_0055971
1558 Ga0373937_0107030
1559 Ga0373937_0135948
1560 Ga0373937_0262429
1561 Ga0373937_0274164
1562 Ga0373937_0384417
1563 Ga0373937_0619290
1564 Ga0265778_018018
1565 Ga0265778_031076
1566 Ga0310112_031287
1567 Ga0316582_1032615
1568 Ga0316584_0038621
1569 Ga0316584_0228026
1570 Ga0373925_0125830
1571 Ga0373925_0411053
1572 Ga0373925_0420945
1573 Ga0373925_0559447
1574 Ga0373925_0725941
1575 Ga0373925_0853558
1576 Ga0395900_0207605
1577 Ga0395900_0716946
1578 Ga0395900_0798671
1579 Ga0395900_1540991
1580 Ga0395905_0340766
1581 Ga0395905_1151906
1582 Ga0436364_0107232
1583 Ga0436364_0124117
1584 Ga0436364_0152010
1585 Ga0436364_0494738
1586 Ga0436364_0635032
1587 Ga0436364_0820937
1588 Ga0436364_0917165
1589 Ga0436364_0955632
1590 Ga0436364_0992577
1591 Ga0436364_1273280
1592 Ga0436364_1325716
1593 Ga0400483_035672
1594 Ga0400483_040634
1595 Ga0400483_110392
1596 Ga0400483_162576
1597 Ga0400483_183320
1598 Ga0400483_193625
1599 Ga0436365_0100754
1600 Ga0436365_0173685
1601 Ga0436365_0267096
1602 Ga0436365_0293773
1603 Ga0436365_0364228
1604 Ga0436365_0376694
1605 Ga0436365_0380682
1606 Ga0436365_0475470
1607 Ga0436365_0578833
1608 Ga0436365_1351316
1609 Ga0436365_1402836
1610 Ga0436365_1538308
1611 Ga0436365_1840201
1612 Ga0436365_1857359
1613 Ga0436360_0014261
1614 Ga0436360_0024550
1615 Ga0436360_0361518
1616 Ga0436360_0391913
1617 Ga0436360_0490029
1618 Ga0436360_0533670
1619 Ga0436360_0553874
1620 Ga0436360_0561465
1621 Ga0436360_0572148
1622 Ga0436360_0576109
1623 Ga0436360_0698116
1624 Ga0436360_0702207
1625 Ga0436360_0739006
1626 Ga0436360_1072902
1627 Ga0436360_1145124
1628 Ga0436360_1169877
1629 Ga0436360_1174101
1630 Ga0436361_0003327
1631 Ga0436361_0253762
1632 Ga0436361_0405123
1633 Ga0436361_0425469
1634 Ga0436361_0984265
1635 Ga0436363_0494978
1636 Ga0436363_0638497
1637 Ga0436363_1229966
1638 Ga0436363_1577646
1639 Ga0436363_1625974
1640 Ga0436362_0410910
1641 Ga0436362_0452787
1642 Ga0436362_0472865
1643 Ga0436362_0597650
1644 Ga0436362_1051301
1645 Ga0436362_1068357
1646 Ga0436362_1092587
1647 Ga0436362_1291248
1648 Ga0451807_0328312
1649 Ga0451833_0732293
1650 Ga0451839_0176171
1651 Ga0439435_0111060
1652 Ga0439460_0097548
1653 Ga0439460_0140667
1654 Ga0439460_0225916
1655 Ga0450918_034001
1656 Ga0451577_0289675
1657 Ga0466963_0245406
1658 Ga0453684_0006779
1659 Ga0453684_0037239
1660 Ga0453684_0610362
1661 Ga0466959_1017666
1662 Ga0451576_0001200
1663 Ga0451576_0008100
1664 Ga0451576_2310719
1665 Ga0466958_0595503
1666 Ga0466967_0324479
1667 Ga0466967_0538680
1668 Ga0495592_0224270
1669 Ga0495592_0760139
1670 Ga0495629_0769023
1671 Ga0495638_0203489
1672 Ga0495651_0356097
1673 Ga0495651_0807242
1674 Ga0495580_0047718
1675 Ga0495580_0101709
1676 Ga0495580_1089978
1677 Ga0495639_0014253
1678 Ga0495594_0057864
1679 Ga0495630_0299030
1680 Ga0495666_0436578
1681 Ga0495665_0509240
1682 Ga0495640_0226852
1683 Ga0495640_0233823
1684 Ga0495586_0194122
1685 Ga0495667_0100154
1686 Ga0495667_0337151
1687 Ga0495635_0033432
1688 Ga0495635_0202518
1689 Ga0495657_0158185
1690 Ga0495599_0189513
1691 Ga0495623_0119445
1692 Ga0495680_0075366
1693 Ga0495684_0393144
1694 Ga0495686_0294419
1695 Ga0495602_0624961
1696 Ga0496100_0608337
1697 Ga0496100_0850022
1698 Ga0496102_0209792
1699 Ga0496102_0247621
1700 Ga0496103_0047181
1701 Ga0496103_0443512
1702 Ga0496104_0066495
1703 Ga0496104_0518424
1704 Ga0496105_1329558
1705 Ga0496106_0102060
1706 Ga0496107_0109749
1707 Ga0496107_0591171
1708 Ga0496108_0126414
1709 Ga0496109_0996933
1710 Ga0496109_1265017
1711 Ga0496110_0170595
1712 Ga0496111_0503087
1713 Ga0496111_0546956
1714 Ga0496112_0451978
1715 Ga0496113_0072518
1716 Ga0496113_0084990
1717 Ga0501309_043441
1718 Ga0501305_063414
1719 Ga0501305_114624
1720 Ga0501307_022550
1721 Ga0501312_032710
1722 Ga0501318_032514
1723 Ga0501325_034973
1724 Ga0501330_012650
1725 Ga0501335_039487
1726 Ga0501338_10224
1727 Ga0501032_0002358
1728 Ga0501033_0016156
1729 Ga0501033_0159514
1730 Ga0501033_0377347
1731 Ga0501034_0069173
1732 Ga0501034_0071182
1733 Ga0501034_0179122
1734 Ga0501034_1019725
1735 Ga0501036_0008712
1736 Ga0501036_0738604
1737 Ga0501036_0918543
1738 Ga0501037_0000785
1739 Ga0501037_0051448
1740 Ga0501037_0941327
1741 Ga0501037_1094692
1742 Ga0501038_0001615
1743 Ga0501038_0066062
1744 Ga0501038_0072500
1745 Ga0501038_0472949
1746 Ga0501039_0001268
1747 Ga0501039_0227570
1748 Ga0501040_0452131
1749 Ga0501040_0599870
1750 Ga0501040_1168523
1751 Ga0501041_0030588
1752 Ga0501041_0108513
1753 Ga0501041_0398226
1754 Ga0501042_0015555
1755 Ga0501043_0002273
1756 Ga0501043_0156541
1757 Ga0501043_0238421
1758 Ga0501043_0453847
1759 Ga0501046_0002264
1760 Ga0501046_0021881
1761 Ga0501046_0354762
1762 Ga0501046_0406465
1763 Ga0501047_0008134
1764 Ga0501047_0030166
1765 Ga0501047_0056543
1766 Ga0501047_0264542
1767 Ga0501047_0354396
1768 Ga0501047_0935022
1769 Ga0501047_1290571
1770 Ga0501048_0032045
1771 Ga0501048_0051700
1772 Ga0501048_0818833
1773 Ga0501067_0632886
1774 Ga0501068_0021508
1775 Ga0501068_0058650
1776 Ga0501069_0000429
1777 Ga0501069_0099369
1778 Ga0501069_0858166
1779 Ga0501070_0006112
1780 Ga0501070_0173619
1781 Ga0501071_0050291
1782 Ga0501071_0476252
1783 Ga0501072_0016964
1784 Ga0501072_0394232
1785 Ga0501073_0022408
1786 Ga0501073_0025480
1787 Ga0501074_0006905
1788 Ga0501074_0303323
1789 Ga0501074_0494624
1790 Ga0501075_0087772
1791 Ga0501076_0052792
1792 Ga0501076_0066286
1793 Ga0501076_0491758
1794 Ga0501077_0213426
1795 Ga0501077_0345714
1796 Ga0501250_046044
1797 Ga0501250_085386
1798 Ga0501245_114851
1799 Ga0501079_0133831
1800 Ga0501079_0143316
1801 Ga0501079_0374717
1802 Ga0501079_0817958
1803 Ga0501080_0004541
1804 Ga0501080_0011613
1805 Ga0501080_0111088
1806 Ga0501080_0986532
1807 Ga0501081_0514897
1808 Ga0501081_0928419
1809 Ga0501081_1195123
1810 Ga0501083_0002945
1811 Ga0501083_0028601
1812 Ga0501083_0064436
1813 Ga0501083_0292932
1814 Ga0501083_0296332
1815 Ga0501083_0743702
1816 Ga0501083_0924328
1817 Ga0501035_0001739
1818 Ga0501035_0029099
1819 Ga0501035_0439173
1820 Ga0501035_0937969
1821 Ga0501035_1185234
1822 Ga0501044_0024561
1823 Ga0501044_0181659
1824 Ga0501044_0281805
1825 Ga0501044_0514658
1826 Ga0501044_0519385
1827 Ga0501044_0757569
1828 Ga0501044_1346746
1829 Ga0501044_1472106
1830 Ga0501045_0085069
1831 Ga0501045_0684841
1832 Ga0501045_1180626
1833 nmdc:mga03683_56195_c1
1834 nmdc:mga03683_621130_c1
1835 nmdc:mga06z11_442020_c1
1836 nmdc:mga07m45_882378_c1
1837 nmdc:mga05p37_114730_c1
1838 nmdc:mga05p37_247428_c1
1839 nmdc:mga09592_1713022_c1
1840 nmdc:mga0qj67_268151_c1
1841 nmdc:mga06r32_1075733_c1
1842 nmdc:mga06r32_1447777_c1
1843 nmdc:mga06r32_197609_c1
1844 nmdc:mga08y16_38_c1
1845 nmdc:mga08y16_610624_c1
1846 nmdc:mga0n895_653458_c1
1847 nmdc:mga0n895_722414_c1
1848 nmdc:mga0n895_742664_c1
1849 nmdc:mga0rr50_198406_c1
1850 nmdc:mga0rr50_19863_c1
1851 nmdc:mga0rr50_874630_c1
1852 nmdc:mga08x19_163348_c1
1853 nmdc:mga08x19_188959_c1
1854 nmdc:mga08x19_39313_c1
1855 nmdc:mga08x19_667236_c1
1856 nmdc:mga08x19_69_c1
1857 nmdc:mga08x19_9966_c1
1858 nmdc:mga0a205_578690_c1
1859 Ga0495601_0011414
1860 Ga0495601_0064822
1861 Ga0495612_0094828
1862 Ga0495595_0030639
1863 Ga0495619_0026689
1864 Ga0495619_0235236
1865 Ga0500578_0269571
1866 Ga0500643_016289
1867 Ga0500646_0051199
1868 Ga0500641_0092679
1869 Ga0500650_0180055
1870 Ga0500555_011750
1871 Ga0500556_0006240
1872 Ga0500595_000884
1873 Ga0500642_0000418
1874 Ga0500642_0003023
1875 Ga0500652_342080
1876 Ga0500658_0012908
1877 Ga0500568_0151572
1878 Ga0500588_0279107
1879 Ga0500604_0001152
1880 Ga0500604_0246011
1881 Ga0500616_0009252
1882 Ga0500633_0125633
1883 Ga0500634_0319505
1884 Ga0500637_0003194
1885 Ga0500609_002178
1886 Ga0500587_045057
1887 Ga0501084_0009704
1888 Ga0501084_0015059
1889 Ga0501084_0116364
1890 Ga0590071_064635
1891 Ga0590074_053171
1892 Ga0590075_014374
1893 Ga0590075_072420
1894 Ga0587066_202861
1895 Ga0587070_084677
1896 Ga0587073_0063124
1897 Ga0587073_0101694
1898 Ga0587073_0169635
1899 Ga0587077_230262
1900 Ga0587080_047234
1901 Ga0587080_080557
1902 Ga0587082_143134
1903 Ga0587082_169533
1904 Ga0587083_0078064
1905 Ga0587083_0106002
1906 Ga0587085_053115
1907 Ga0587086_108405
1908 Ga0587088_153628
1909 Ga0587090_055622
1910 Ga0587091_074155
1911 Ga0587091_139252
1912 Ga0587094_045240
1913 Ga0587095_029003
1914 Ga0587106_054127
1915 Ga0587106_110333
1916 Ga0587106_118435
1917 Ga0587125_039064
1918 Ga0587129_021808
1919 Ga0587131_020918
1920 Ga0587109_098190
1921 Ga0587109_212564
1922 Ga0587115_014990
1923 Ga0587122_007379
1924 Ga0587122_042900
1925 Ga0587128_015296
1926 Ga0587128_125565
1927 Ga0587128_159993
1928 Ga0587067_087043
1929 Ga0587067_121305
1930 Ga0587068_066769
1931 Ga0587069_100708
1932 Ga0587072_058951
1933 Ga0587072_168056
1934 Ga0587075_020623
1935 Ga0587075_136449
1936 Ga0587076_144067
1937 Ga0587078_013659
1938 Ga0587078_021061
1939 Ga0587107_119020
1940 Ga0587110_048135
1941 Ga0587124_044109
1942 Ga0587111_0097436
1943 Ga0501082_0007064
1944 Ga0501082_0020189
1945 Ga0501082_0029977
1946 Ga0530510_0003678
1947 Ga0530510_0710796
1948 Ga0530510_0908924
1949 Ga0530510_1198798
1950 2842333558
1951 2842777944
1952 2883358471
1953 2883578439
1954 2894774388

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00462

Glutaredoxin

Glutaredoxin

36

100

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gx8-assembly1.cif.gz_A structural and biochemical characterization of yeast monothiol glutaredoxin grx5 0.9671 3 106
2mma-assembly1.cif.gz_A nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana 0.9568 1 104
2wul-assembly1.cif.gz_D crystal structure of the human glutaredoxin 5 with bound glutathione in an fes cluster 0.9443 5 109
2wci-assembly1.cif.gz_A structure of e. coli monothiol glutaredoxin grx4 homodimer 0.9427 1 104
5y4u-assembly1.cif.gz_A crystal structure of grx domain of grx3 from saccharomyces cerevisiae 0.9298 8 101
ID Description Score Start End Superfamily
af_C6KSR7_119_214_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9939 8 99 3.40.30.10
af_K7UQQ8_80_167_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.989 10 95 3.40.30.10
af_O97232_76_171_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9866 9 99 3.40.30.10
af_B6TEC7_84_191_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9856 9 103 3.40.30.10
2wemC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9846 9 103 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A6P1G956-F1-model_v4 Glutaredoxin 1.004 5 104 GO:0015036
GO:0046872
GO:0051537
AF-A0A3D4E5J8-F1-model_v4 Glutaredoxin 1.002 1 106 GO:0015036
GO:0046872
GO:0051537
AF-A0A2M8GR93-F1-model_v4 deleted 1.002 1 104
AF-A0A7Z3DX47-F1-model_v4 Glutaredoxin 1.002 7 106 GO:0015036
GO:0046872
GO:0051537
AF-A0A8A7CKN3-F1-model_v4 deleted 1.001 5 109

Map