F487300

General Info

Members Datasets Scaffolds Average Seq Length
978 316 978 600

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10123165|Ga0207695_101231651
Length 714
Sequence MVLTPVDWLVIGGYFALNLAIGLYYARRARGSTTEFFLSGRNVPWWLAGTSMVATTFAADTPLVVTGMVARYGIAGNWLWWNMAASGMLTVFVYARLWRRAGVMTDVEFAELRYSGKPAAFLRGFRALYLGIPINCIVMGWVNRLRDHGNLIFVDVRDRTGVTQVVFNKELNPALHEKAAHLGSEYVIAVTGLVKQREPNLVNKNIATGEIELVAQELRILNVSKTPPFLPGESVLPNEEVRLKYRYLDLRREKMQFNIELRHKVGMAIRQYLAEQGFFEIETPFMTRSTPEGARDYLVPSRVYPGSFYALPQSPQLFKQILMISGFDKYFQIVRCFRDEDLRADRQPEFTQIDLEMTFPQPDRVFEVVEGFLTAAFRAAGQEIKTPFLRMTYDQAIRKYGSDKPDLRLPAMTDVRQAFAPENLKTLNVDPRLPVVAIRIPRVGELSRKERDDIKPLFGERRNAKLFEDAKRLEKSFPEAMAKVRELSSAEPDDLLVLVAGNELPGDHPSESIVGPEVKQHDAVVYTAAGALRVALAQKYAERHDAFRRGAFHFLWVTDFPMFEWDEEGKRWAAAHHPFTSPREKDMDKLESDPAAVRALAYDVVLNGTELGSGSIRIHRQDIQKKIFHALGMSDEEAKARFGFFLEALEYGTPPHGGIALGLDRIVMILAGADSLREVIPFPKTAKAVDLMVDAPTPVSEAQLKELGISVRKK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
111 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
112 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
113 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
114 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
115 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
177 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
178 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
179 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
182 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
183 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
184 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
185 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
186 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
187 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
188 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
189 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
190 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
191 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
192 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
193 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
196 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
197 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
198 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
199 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
204 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
205 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
206 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
207 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
208 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
209 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
210 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
214 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
215 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
216 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
217 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
219 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
220 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
221 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
222 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
223 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
224 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
225 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
226 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
227 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
230 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
231 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
232 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
233 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
234 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
235 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
236 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
237 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
238 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
239 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
240 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
241 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
242 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
243 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
244 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
245 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
246 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
247 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
248 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
249 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
250 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
251 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
252 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
253 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
254 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
257 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
258 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
259 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
262 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
263 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
264 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
265 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
266 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
267 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
268 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
269 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
270 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
271 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
286 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
287 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
288 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
289 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
290 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
291 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
292 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
293 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
294 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
295 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
296 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
297 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
298 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
299 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
300 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
303 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
304 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
305 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
306 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
307 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
308 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
309 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
310 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
311 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
312 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
313 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
314 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
315 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
316 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 3.27
Rhizosphere 96.22
Stem 0
Stem Tuber 0
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_604697 2162886007 Bacteria 2970
2 LJNas_1001039 3300000546 Bacteria 4382
3 JGI25407J50210_10007439 3300003373 Bacteria 2743
4 Ga0065704_10072792 3300005289 Bacteria 8004
5 Ga0065715_10132088 3300005293 Bacteria 1979
6 Ga0065707_10001510 3300005295 Bacteria 7379
7 Ga0070676_10004901 3300005328 Bacteria 7090
8 Ga0070676_10004973 3300005328 Bacteria 7037
9 Ga0070683_100000055 3300005329 Bacteria 86882
10 Ga0070683_100093324 3300005329 Bacteria 2827
11 Ga0070670_100000582 3300005331 Bacteria 28880
12 Ga0070670_100008250 3300005331 Bacteria 8871
13 Ga0070670_100009392 3300005331 Bacteria 8349
14 Ga0070670_100026609 3300005331 Bacteria 4977
15 Ga0068869_100000460 3300005334 Bacteria 22453
16 Ga0068869_100000592 3300005334 Bacteria 20323
17 Ga0068869_100007045 3300005334 Bacteria 7160
18 Ga0068869_100039553 3300005334 Bacteria 3367
19 Ga0068869_100058096 3300005334 Bacteria 2827
20 Ga0070666_10005555 3300005335 Bacteria 7737
21 Ga0070666_10015995 3300005335 Bacteria 4793
22 Ga0070666_10039732 3300005335 Bacteria 3137
23 Ga0070666_10064885 3300005335 Bacteria 2477
24 Ga0070680_100024098 3300005336 Bacteria 4856
25 Ga0070680_100168103 3300005336 Bacteria 1844
26 Ga0070682_100000014 3300005337 Bacteria 249552
27 Ga0068868_100001452 3300005338 Bacteria 16351
28 Ga0068868_100002673 3300005338 Bacteria 12360
29 Ga0068868_100002979 3300005338 Bacteria 11762
30 Ga0068868_100038280 3300005338 Bacteria 3722
31 Ga0068868_100115444 3300005338 Bacteria 2186
32 Ga0070660_100000311 3300005339 Bacteria 32366
33 Ga0070660_100013186 3300005339 Bacteria 5923
34 Ga0070660_100105734 3300005339 Bacteria 2234
35 Ga0070689_100000488 3300005340 Bacteria 23423
36 Ga0070689_100023528 3300005340 Bacteria 4612
37 Ga0070689_100031607 3300005340 Bacteria 4024
38 Ga0070689_100072627 3300005340 Bacteria 2689
39 Ga0070661_100005335 3300005344 Bacteria 8867
40 Ga0070661_100015089 3300005344 Bacteria 5451
41 Ga0070661_100015415 3300005344 Bacteria 5395
42 Ga0070661_100046721 3300005344 Bacteria 3168
43 Ga0070668_100013532 3300005347 Bacteria 6091
44 Ga0070668_100137236 3300005347 Bacteria 1968
45 Ga0070675_100000005 3300005354 Bacteria 295918
46 Ga0070675_100000272 3300005354 Bacteria 34147
47 Ga0070675_100006612 3300005354 Bacteria 8911
48 Ga0070675_100029792 3300005354 Bacteria 4403
49 Ga0070675_100033628 3300005354 Bacteria 4158
50 Ga0070675_100043727 3300005354 Bacteria 3661
51 Ga0070671_100013999 3300005355 Bacteria 6477
52 Ga0070671_100026358 3300005355 Bacteria 4776
53 Ga0070671_100070784 3300005355 Bacteria 2910
54 Ga0070671_100088961 3300005355 Bacteria 2585
55 Ga0070671_100115985 3300005355 Bacteria 2251
56 Ga0070673_100003191 3300005364 Bacteria 10158
57 Ga0070673_100043033 3300005364 Bacteria 3486
58 Ga0070673_100084830 3300005364 Bacteria 2577
59 Ga0070688_100007207 3300005365 Bacteria 5988
60 Ga0070688_100040711 3300005365 Bacteria 2849
61 Ga0070659_100004425 3300005366 Bacteria 10034
62 Ga0070667_100000566 3300005367 Bacteria 36566
63 Ga0070709_10000505 3300005434 Bacteria 23009
64 Ga0070709_10009195 3300005434 Bacteria 5438
65 Ga0070709_10056280 3300005434 Bacteria 2486
66 Ga0070714_100000051 3300005435 Bacteria 110289
67 Ga0070714_100000121 3300005435 Bacteria 62487
68 Ga0070714_100009776 3300005435 Bacteria 7559
69 Ga0070714_100053759 3300005435 Bacteria 3439
70 Ga0070714_100066949 3300005435 Bacteria 3096
71 Ga0070714_100088522 3300005435 Bacteria 2709
72 Ga0070713_100000210 3300005436 Bacteria 38839
73 Ga0070713_100000302 3300005436 Bacteria 32656
74 Ga0070713_100000378 3300005436 Bacteria 28414
75 Ga0070713_100099016 3300005436 Bacteria 2522
76 Ga0070710_10011850 3300005437 Bacteria 4318
77 Ga0070711_100000549 3300005439 Bacteria 19585
78 Ga0070711_100000978 3300005439 Bacteria 15129
79 Ga0070711_100010586 3300005439 Bacteria 5712
80 Ga0070700_100000096 3300005441 Bacteria 58388
81 Ga0070708_100003506 3300005445 Bacteria 12283
82 Ga0070708_100006013 3300005445 Bacteria 9644
83 Ga0070708_100030512 3300005445 Bacteria 4660
84 Ga0070708_100039219 3300005445 Bacteria 4143
85 Ga0070708_100080156 3300005445 Bacteria 2954
86 Ga0070663_100005932 3300005455 Bacteria 7309
87 Ga0070663_100007600 3300005455 Bacteria 6611
88 Ga0070663_100015952 3300005455 Bacteria 4864
89 Ga0070662_100006661 3300005457 Bacteria 7461
90 Ga0070662_100055719 3300005457 Bacteria 2869
91 Ga0070681_10000804 3300005458 Bacteria 26179
92 Ga0070681_10002950 3300005458 Bacteria 15777
93 Ga0070681_10014599 3300005458 Bacteria 7817
94 Ga0070681_10023670 3300005458 Bacteria 6180
95 Ga0070681_10053278 3300005458 Bacteria 4031
96 Ga0070681_10057062 3300005458 Bacteria 3885
97 Ga0068867_100013882 3300005459 Bacteria 5702
98 Ga0070685_10002349 3300005466 Bacteria 9751
99 Ga0070685_10003390 3300005466 Bacteria 8105
100 Ga0070706_100000734 3300005467 Bacteria 37002
101 Ga0070706_100002721 3300005467 Bacteria 17682
102 Ga0070706_100003417 3300005467 Bacteria 15662
103 Ga0070707_100000360 3300005468 Bacteria 44793
104 Ga0070707_100018911 3300005468 Bacteria 6487
105 Ga0070707_100041377 3300005468 Bacteria 4411
106 Ga0070707_100120088 3300005468 Bacteria 2552
107 Ga0070698_100000242 3300005471 Bacteria 54440
108 Ga0070698_100001323 3300005471 Bacteria 27599
109 Ga0070698_100006846 3300005471 Bacteria 12348
110 Ga0070699_100001400 3300005518 Bacteria 22180
111 Ga0070699_100007701 3300005518 Bacteria 9361
112 Ga0070699_100103101 3300005518 Bacteria 2501
113 Ga0070679_100000226 3300005530 Bacteria 46282
114 Ga0070679_100006248 3300005530 Bacteria 11099
115 Ga0070679_100006733 3300005530 Bacteria 10719
116 Ga0070679_100008309 3300005530 Bacteria 9767
117 Ga0070679_100045850 3300005530 Bacteria 4356
118 Ga0070679_100106427 3300005530 Bacteria 2790
119 Ga0070684_100000153 3300005535 Bacteria 47114
120 Ga0070684_100024487 3300005535 Bacteria 5064
121 Ga0070684_100050642 3300005535 Bacteria 3608
122 Ga0070684_100081193 3300005535 Bacteria 2869
123 Ga0070684_100085152 3300005535 Bacteria 2803
124 Ga0070697_100000532 3300005536 Bacteria 28683
125 Ga0070697_100002341 3300005536 Bacteria 14572
126 Ga0070697_100011698 3300005536 Bacteria 6862
127 Ga0070697_100019328 3300005536 Bacteria 5380
128 Ga0068853_100009193 3300005539 Bacteria 7959
129 Ga0068853_100046671 3300005539 Bacteria 3715
130 Ga0068853_100114740 3300005539 Bacteria 2396
131 Ga0068853_100186634 3300005539 Bacteria 1882
132 Ga0070672_100000082 3300005543 Bacteria 44859
133 Ga0070672_100013365 3300005543 Bacteria 5798
134 Ga0070672_100078707 3300005543 Bacteria 2638
135 Ga0070686_100004959 3300005544 Bacteria 7343
136 Ga0070686_100043296 3300005544 Bacteria 2824
137 Ga0070696_100014845 3300005546 Bacteria 5228
138 Ga0070665_100007648 3300005548 Bacteria 10985
139 Ga0070665_100116575 3300005548 Bacteria 2673
140 Ga0068855_100000782 3300005563 Bacteria 39281
141 Ga0068855_100000842 3300005563 Bacteria 37998
142 Ga0068855_100000949 3300005563 Bacteria 36109
143 Ga0068855_100003547 3300005563 Bacteria 19079
144 Ga0068855_100003849 3300005563 Bacteria 18342
145 Ga0068855_100009479 3300005563 Bacteria 11760
146 Ga0068855_100036142 3300005563 Bacteria 5881
147 Ga0068855_100053155 3300005563 Bacteria 4766
148 Ga0068855_100090519 3300005563 Bacteria 3531
149 Ga0070664_100001991 3300005564 Bacteria 16379
150 Ga0070664_100015491 3300005564 Bacteria 6237
151 Ga0070664_100029161 3300005564 Bacteria 4599
152 Ga0068857_100000775 3300005577 Bacteria 23800
153 Ga0068857_100016925 3300005577 Bacteria 6387
154 Ga0068857_100020037 3300005577 Bacteria 5880
155 Ga0068857_100064478 3300005577 Bacteria 3257
156 Ga0068854_100002592 3300005578 Bacteria 11198
157 Ga0068854_100009011 3300005578 Bacteria 6430
158 Ga0068854_100010352 3300005578 Bacteria 6044
159 Ga0068854_100057364 3300005578 Bacteria 2808
160 Ga0068856_100000437 3300005614 Bacteria 45849
161 Ga0068856_100001503 3300005614 Bacteria 24428
162 Ga0068856_100002308 3300005614 Bacteria 19646
163 Ga0068856_100002380 3300005614 Bacteria 19349
164 Ga0068856_100007577 3300005614 Bacteria 10590
165 Ga0068856_100045911 3300005614 Bacteria 4302
166 Ga0068856_100101826 3300005614 Bacteria 2865
167 Ga0068856_100136446 3300005614 Bacteria 2459
168 Ga0070702_100002922 3300005615 Bacteria 7526
169 Ga0068852_100000054 3300005616 Bacteria 78608
170 Ga0068852_100000870 3300005616 Bacteria 20006
171 Ga0068852_100003707 3300005616 Bacteria 10703
172 Ga0068852_100013502 3300005616 Bacteria 6252
173 Ga0068852_100017162 3300005616 Bacteria 5672
174 Ga0068852_100056292 3300005616 Bacteria 3398
175 Ga0068852_100086018 3300005616 Bacteria 2802
176 Ga0068859_100000298 3300005617 Bacteria 49363
177 Ga0068859_100006100 3300005617 Bacteria 12241
178 Ga0068859_100006498 3300005617 Bacteria 11865
179 Ga0068859_100009782 3300005617 Bacteria 9686
180 Ga0068859_100023095 3300005617 Bacteria 6238
181 Ga0068859_100048328 3300005617 Bacteria 4274
182 Ga0068859_100099257 3300005617 Bacteria 2967
183 Ga0068859_100110663 3300005617 Bacteria 2808
184 Ga0068864_100000097 3300005618 Bacteria 85717
185 Ga0068864_100000397 3300005618 Bacteria 37701
186 Ga0068864_100002195 3300005618 Bacteria 16100
187 Ga0068864_100062589 3300005618 Bacteria 3224
188 Ga0068866_10001978 3300005718 Bacteria 8544
189 Ga0068866_10008165 3300005718 Bacteria 4400
190 Ga0068866_10034609 3300005718 Bacteria 2461
191 Ga0068861_100009595 3300005719 Bacteria 6687
192 Ga0068861_100018277 3300005719 Bacteria 4993
193 Ga0068851_10008726 3300005834 Bacteria 4695
194 Ga0068851_10016930 3300005834 Bacteria 3495
195 Ga0068851_10051835 3300005834 Bacteria 2085
196 Ga0068870_10007784 3300005840 Bacteria 4792
197 Ga0068863_100000502 3300005841 Bacteria 39820
198 Ga0068863_100001036 3300005841 Bacteria 27797
199 Ga0068863_100013736 3300005841 Bacteria 7807
200 Ga0068863_100016274 3300005841 Bacteria 7136
201 Ga0068863_100016634 3300005841 Bacteria 7057
202 Ga0068858_100000243 3300005842 Bacteria 58808
203 Ga0068858_100003081 3300005842 Bacteria 16683
204 Ga0068858_100003082 3300005842 Bacteria 16683
205 Ga0068858_100003641 3300005842 Bacteria 15245
206 Ga0068858_100049497 3300005842 Bacteria 3892
207 Ga0068858_100097264 3300005842 Bacteria 2744
208 Ga0068858_100198842 3300005842 Bacteria 1895
209 Ga0068860_100000031 3300005843 Bacteria 255068
210 Ga0068860_100003297 3300005843 Bacteria 16609
211 Ga0068860_100004066 3300005843 Bacteria 15013
212 Ga0068860_100008019 3300005843 Bacteria 10531
213 Ga0068860_100041771 3300005843 Bacteria 4381
214 Ga0068860_100097553 3300005843 Bacteria 2802
215 Ga0068860_100146283 3300005843 Bacteria 2274
216 Ga0068862_100113094 3300005844 Bacteria 2385
217 Ga0081538_10000196 3300005981 Bacteria 66606
218 Ga0081538_10000778 3300005981 Bacteria 34784
219 Ga0081538_10001466 3300005981 Bacteria 24208
220 Ga0081538_10001685 3300005981 Bacteria 22512
221 Ga0081538_10007985 3300005981 Bacteria 9053
222 Ga0070717_10007920 3300006028 Bacteria 7914
223 Ga0070717_10010141 3300006028 Bacteria 7094
224 Ga0070717_10012598 3300006028 Bacteria 6451
225 Ga0070717_10018717 3300006028 Bacteria 5416
226 Ga0070717_10020970 3300006028 Bacteria 5146
227 Ga0070717_10043179 3300006028 Bacteria 3678
228 Ga0070717_10074261 3300006028 Bacteria 2842
229 Ga0070717_10087238 3300006028 Bacteria 2628
230 Ga0070717_10089764 3300006028 Bacteria 2593
231 Ga0070715_10000755 3300006163 Bacteria 8744
232 Ga0070716_100000096 3300006173 Bacteria 34314
233 Ga0070716_100004475 3300006173 Bacteria 6684
234 Ga0070716_100005734 3300006173 Bacteria 6031
235 Ga0070716_100010911 3300006173 Bacteria 4570
236 Ga0070712_100000273 3300006175 Bacteria 28938
237 Ga0070712_100000529 3300006175 Bacteria 22056
238 Ga0070712_100001481 3300006175 Bacteria 14326
239 Ga0070712_100002426 3300006175 Bacteria 11486
240 Ga0070712_100010572 3300006175 Bacteria 5827
241 Ga0070712_100057983 3300006175 Bacteria 2722
242 Ga0070712_100065704 3300006175 Bacteria 2576
243 Ga0097621_100000431 3300006237 Bacteria 29219
244 Ga0097621_100000472 3300006237 Bacteria 28201
245 Ga0097621_100000648 3300006237 Bacteria 24592
246 Ga0097621_100007702 3300006237 Bacteria 7720
247 Ga0097621_100043545 3300006237 Bacteria 3619
248 Ga0068871_100000084 3300006358 Bacteria 53380
249 Ga0068871_100002089 3300006358 Bacteria 13517
250 Ga0068871_100003471 3300006358 Bacteria 10832
251 Ga0068871_100034049 3300006358 Bacteria 4039
252 Ga0068871_100086608 3300006358 Bacteria 2603
253 Ga0068871_100107228 3300006358 Bacteria 2346
254 Ga0075428_100041305 3300006844 Bacteria 5073
255 Ga0075428_100130455 3300006844 Bacteria 2734
256 Ga0075428_100177406 3300006844 Bacteria 2307
257 Ga0075430_100064572 3300006846 Bacteria 3075
258 Ga0075430_100081873 3300006846 Bacteria 2705
259 Ga0075433_10001602 3300006852 Bacteria 16772
260 Ga0075433_10003220 3300006852 Bacteria 12599
261 Ga0075433_10017711 3300006852 Bacteria 5909
262 Ga0075433_10031345 3300006852 Bacteria 4544
263 Ga0075433_10036428 3300006852 Bacteria 4238
264 Ga0075434_100000782 3300006871 Bacteria 25168
265 Ga0075434_100013793 3300006871 Bacteria 7705
266 Ga0075434_100022049 3300006871 Bacteria 6200
267 Ga0075429_100009133 3300006880 Bacteria 8606
268 Ga0075429_100033476 3300006880 Bacteria 4466
269 Ga0068865_100069763 3300006881 Bacteria 2488
270 Ga0075436_100018159 3300006914 Bacteria 4816
271 Ga0075436_100034899 3300006914 Bacteria 3469
272 Ga0097620_100000298 3300006931 Bacteria 49363
273 Ga0097620_100006100 3300006931 Bacteria 12241
274 Ga0097620_100006498 3300006931 Bacteria 11865
275 Ga0097620_100009783 3300006931 Bacteria 9686
276 Ga0097620_100023098 3300006931 Bacteria 6238
277 Ga0097620_100048336 3300006931 Bacteria 4274
278 Ga0097620_100099258 3300006931 Bacteria 2967
279 Ga0097620_100110666 3300006931 Bacteria 2808
280 Ga0075435_100000849 3300007076 Bacteria 19122
281 Ga0075435_100001140 3300007076 Bacteria 16947
282 Ga0075435_100015116 3300007076 Bacteria 5794
283 Ga0075435_100021210 3300007076 Bacteria 4993
284 Ga0105240_10000116 3300009093 Bacteria 165524
285 Ga0105240_10000171 3300009093 Bacteria 132604
286 Ga0105240_10002552 3300009093 Bacteria 29190
287 Ga0105240_10005889 3300009093 Bacteria 18155
288 Ga0105240_10026610 3300009093 Bacteria 7591
289 Ga0105240_10026789 3300009093 Bacteria 7561
290 Ga0105240_10040442 3300009093 Bacteria 5962
291 Ga0105240_10041785 3300009093 Bacteria 5847
292 Ga0105240_10114614 3300009093 Bacteria 3256
293 Ga0111539_10000795 3300009094 Bacteria 41114
294 Ga0111539_10018879 3300009094 Bacteria 8530
295 Ga0111539_10084133 3300009094 Bacteria 3741
296 Ga0111539_10144018 3300009094 Bacteria 2790
297 Ga0111539_10249249 3300009094 Bacteria 2068
298 Ga0105245_10001223 3300009098 Bacteria 23189
299 Ga0105245_10003105 3300009098 Bacteria 14861
300 Ga0105245_10003410 3300009098 Bacteria 14233
301 Ga0105245_10007294 3300009098 Bacteria 9682
302 Ga0105245_10041496 3300009098 Bacteria 4101
303 Ga0105247_10007911 3300009101 Bacteria 6500
304 Ga0105247_10038022 3300009101 Bacteria 2936
305 Ga0114129_10008909 3300009147 Bacteria 14308
306 Ga0114129_10026626 3300009147 Bacteria 8190
307 Ga0114129_10104089 3300009147 Bacteria 3922
308 Ga0114129_10142742 3300009147 Bacteria 3281
309 Ga0114129_10248071 3300009147 Bacteria 2391
310 Ga0105243_10025697 3300009148 Bacteria 4503
311 Ga0105241_10000061 3300009174 Bacteria 83048
312 Ga0105241_10001359 3300009174 Bacteria 18631
313 Ga0105241_10001688 3300009174 Bacteria 16784
314 Ga0105241_10002385 3300009174 Bacteria 14111
315 Ga0105241_10013412 3300009174 Bacteria 6008
316 Ga0105241_10046513 3300009174 Bacteria 3296
317 Ga0105241_10048402 3300009174 Bacteria 3235
318 Ga0105241_10065482 3300009174 Bacteria 2808
319 Ga0105241_10100604 3300009174 Bacteria 2297
320 Ga0105248_10000019 3300009177 Bacteria 285766
321 Ga0105248_10000260 3300009177 Bacteria 61933
322 Ga0105248_10008242 3300009177 Bacteria 11449
323 Ga0105248_10010198 3300009177 Bacteria 10346
324 Ga0105248_10042619 3300009177 Bacteria 5091
325 Ga0105248_10134533 3300009177 Bacteria 2789
326 Ga0105237_10005201 3300009545 Bacteria 14714
327 Ga0105237_10020862 3300009545 Bacteria 6746
328 Ga0105237_10028854 3300009545 Bacteria 5646
329 Ga0105237_10050632 3300009545 Bacteria 4173
330 Ga0105237_10095147 3300009545 Bacteria 2968
331 Ga0105238_10000024 3300009551 Bacteria 196322
332 Ga0105238_10000532 3300009551 Bacteria 39823
333 Ga0105238_10006095 3300009551 Bacteria 11959
334 Ga0105238_10009190 3300009551 Bacteria 9895
335 Ga0105238_10015185 3300009551 Bacteria 7798
336 Ga0105249_10015894 3300009553 Bacteria 6670
337 Ga0105249_10024546 3300009553 Bacteria 5419
338 Ga0105249_10051111 3300009553 Bacteria 3769
339 Ga0105249_10070577 3300009553 Bacteria 3225
340 Ga0105249_10073058 3300009553 Bacteria 3172
341 Ga0105239_10003830 3300010375 Bacteria 18277
342 Ga0105239_10006367 3300010375 Bacteria 13718
343 Ga0105239_10006871 3300010375 Bacteria 13130
344 Ga0105239_10098682 3300010375 Bacteria 3229
345 Ga0105239_10099901 3300010375 Bacteria 3208
346 Ga0105239_10106275 3300010375 Bacteria 3109
347 Ga0105239_10112059 3300010375 Bacteria 3025
348 Ga0105246_10000642 3300011119 Bacteria 19516
349 Ga0105246_10002800 3300011119 Bacteria 10555
350 Ga0157373_10005980 3300013100 Bacteria 9103
351 Ga0157371_10010303 3300013102 Bacteria 7294
352 Ga0157371_10013605 3300013102 Bacteria 6175
353 Ga0157371_10014575 3300013102 Bacteria 5926
354 Ga0157370_10000019 3300013104 Bacteria 167473
355 Ga0157370_10009377 3300013104 Bacteria 10469
356 Ga0157369_10000081 3300013105 Bacteria 132630
357 Ga0157369_10001530 3300013105 Bacteria 28340
358 Ga0157369_10005098 3300013105 Bacteria 15378
359 Ga0157369_10012364 3300013105 Bacteria 9691
360 Ga0157369_10013248 3300013105 Bacteria 9330
361 Ga0157369_10017220 3300013105 Bacteria 8121
362 Ga0157369_10021569 3300013105 Bacteria 7205
363 Ga0157369_10025320 3300013105 Bacteria 6587
364 Ga0157369_10025809 3300013105 Bacteria 6518
365 Ga0157369_10036516 3300013105 Bacteria 5382
366 Ga0157369_10043373 3300013105 Bacteria 4903
367 Ga0157369_10056365 3300013105 Bacteria 4241
368 Ga0157369_10104410 3300013105 Bacteria 3017
369 Ga0157374_10000357 3300013296 Bacteria 42343
370 Ga0157374_10001545 3300013296 Bacteria 19407
371 Ga0157374_10001876 3300013296 Bacteria 17667
372 Ga0157374_10005940 3300013296 Bacteria 10318
373 Ga0157374_10005962 3300013296 Bacteria 10307
374 Ga0157374_10010818 3300013296 Bacteria 7871
375 Ga0157374_10014703 3300013296 Bacteria 6852
376 Ga0157374_10033830 3300013296 Bacteria 4665
377 Ga0157374_10044937 3300013296 Bacteria 4085
378 Ga0157374_10117077 3300013296 Bacteria 2568
379 Ga0157374_10139086 3300013296 Bacteria 2356
380 Ga0157374_10149399 3300013296 Bacteria 2271
381 Ga0157378_10000133 3300013297 Bacteria 70888
382 Ga0157378_10000970 3300013297 Bacteria 26291
383 Ga0157378_10001618 3300013297 Bacteria 20368
384 Ga0157378_10003566 3300013297 Bacteria 13779
385 Ga0157378_10028167 3300013297 Bacteria 4955
386 Ga0157378_10041269 3300013297 Bacteria 4093
387 Ga0157378_10046773 3300013297 Bacteria 3846
388 Ga0157378_10060554 3300013297 Bacteria 3378
389 Ga0157378_10166368 3300013297 Bacteria 2066
390 Ga0163162_10012329 3300013306 Bacteria 8347
391 Ga0163162_10014559 3300013306 Bacteria 7687
392 Ga0163162_10032999 3300013306 Bacteria 5142
393 Ga0163162_10040828 3300013306 Bacteria 4641
394 Ga0157372_10000058 3300013307 Bacteria 125647
395 Ga0157372_10000544 3300013307 Bacteria 41533
396 Ga0157372_10000749 3300013307 Bacteria 35224
397 Ga0157372_10001201 3300013307 Bacteria 28017
398 Ga0157372_10004045 3300013307 Bacteria 15713
399 Ga0157372_10008156 3300013307 Bacteria 11134
400 Ga0157372_10014436 3300013307 Bacteria 8450
401 Ga0157372_10023953 3300013307 Bacteria 6623
402 Ga0157372_10032747 3300013307 Bacteria 5703
403 Ga0157372_10042443 3300013307 Bacteria 5031
404 Ga0157372_10072100 3300013307 Bacteria 3892
405 Ga0157372_10084080 3300013307 Bacteria 3606
406 Ga0157372_10125903 3300013307 Bacteria 2946
407 Ga0157375_10000001 3300013308 Bacteria 696576
408 Ga0157375_10000213 3300013308 Bacteria 53997
409 Ga0157375_10002599 3300013308 Bacteria 15674
410 Ga0157375_10012952 3300013308 Bacteria 7409
411 Ga0157375_10094309 3300013308 Bacteria 3061
412 Ga0157375_10122690 3300013308 Bacteria 2710
413 Ga0163163_10001132 3300014325 Bacteria 22642
414 Ga0163163_10053245 3300014325 Bacteria 3994
415 Ga0163163_10057806 3300014325 Bacteria 3835
416 Ga0163163_10112476 3300014325 Bacteria 2752
417 Ga0163163_10134079 3300014325 Bacteria 2517
418 Ga0163163_10136796 3300014325 Bacteria 2491
419 Ga0163163_10142638 3300014325 Bacteria 2438
420 Ga0157380_10000592 3300014326 Bacteria 22301
421 Ga0182008_10005954 3300014497 Bacteria 6874
422 Ga0157377_10028546 3300014745 Bacteria 3004
423 Ga0157379_10000201 3300014968 Bacteria 46275
424 Ga0157379_10001817 3300014968 Bacteria 17622
425 Ga0157379_10021417 3300014968 Bacteria 5722
426 Ga0157379_10024613 3300014968 Bacteria 5344
427 Ga0157379_10058186 3300014968 Bacteria 3455
428 Ga0157376_10003548 3300014969 Bacteria 10754
429 Ga0157376_10018802 3300014969 Bacteria 5309
430 Ga0157376_10029110 3300014969 Bacteria 4398
431 Ga0157376_10030563 3300014969 Bacteria 4302
432 Ga0182007_10004753 3300015262 Bacteria 6106
433 Ga0213871_10000271 3300021441 Bacteria 6422
434 Ga0224569_100199 3300022732 Bacteria 4930
435 Ga0224571_100064 3300022734 Bacteria 3813
436 Ga0224572_1000089 3300024225 Bacteria 6650
437 Ga0228598_1000974 3300024227 Bacteria 6236
438 Ga0207656_10014848 3300025321 Bacteria 3008
439 Ga0207682_10023447 3300025893 Bacteria 2438
440 Ga0207692_10001347 3300025898 Bacteria 9167
441 Ga0207692_10003571 3300025898 Bacteria 6087
442 Ga0207642_10018659 3300025899 Bacteria 2667
443 Ga0207710_10000465 3300025900 Bacteria 25953
444 Ga0207710_10009553 3300025900 Bacteria 4078
445 Ga0207680_10024457 3300025903 Bacteria 3315
446 Ga0207647_10008070 3300025904 Bacteria 7566
447 Ga0207647_10008884 3300025904 Bacteria 7166
448 Ga0207647_10010301 3300025904 Bacteria 6603
449 Ga0207699_10000959 3300025906 Bacteria 13747
450 Ga0207699_10029501 3300025906 Bacteria 3059
451 Ga0207699_10076640 3300025906 Bacteria 2060
452 Ga0207645_10011955 3300025907 Bacteria 5905
453 Ga0207645_10022633 3300025907 Bacteria 4086
454 Ga0207645_10040709 3300025907 Bacteria 2976
455 Ga0207705_10010342 3300025909 Bacteria 6787
456 Ga0207705_10080002 3300025909 Bacteria 2381
457 Ga0207705_10117065 3300025909 Bacteria 1973
458 Ga0207684_10000389 3300025910 Bacteria 59084
459 Ga0207684_10002469 3300025910 Bacteria 18630
460 Ga0207684_10008706 3300025910 Bacteria 9009
461 Ga0207654_10000024 3300025911 Bacteria 147501
462 Ga0207654_10000516 3300025911 Bacteria 22181
463 Ga0207654_10001092 3300025911 Bacteria 14709
464 Ga0207654_10011498 3300025911 Bacteria 4518
465 Ga0207654_10023388 3300025911 Bacteria 3309
466 Ga0207707_10001372 3300025912 Bacteria 22585
467 Ga0207707_10015417 3300025912 Bacteria 6657
468 Ga0207707_10026085 3300025912 Bacteria 5109
469 Ga0207707_10029783 3300025912 Bacteria 4774
470 Ga0207707_10032207 3300025912 Bacteria 4589
471 Ga0207707_10034673 3300025912 Bacteria 4415
472 Ga0207707_10045468 3300025912 Bacteria 3826
473 Ga0207707_10103251 3300025912 Bacteria 2492
474 Ga0207707_10116996 3300025912 Bacteria 2330
475 Ga0207695_10000075 3300025913 Bacteria 308496
476 Ga0207695_10000115 3300025913 Bacteria 240394
477 Ga0207695_10000466 3300025913 Bacteria 87899
478 Ga0207695_10001570 3300025913 Bacteria 37221
479 Ga0207695_10003351 3300025913 Bacteria 22654
480 Ga0207695_10027987 3300025913 Bacteria 6264
481 Ga0207695_10029663 3300025913 Bacteria 6038
482 Ga0207695_10068165 3300025913 Bacteria 3646
483 Ga0207695_10096770 3300025913 Bacteria 2953
484 Ga0207695_10123165 3300025913 Bacteria 2559
485 Ga0207671_10000032 3300025914 Bacteria 245878
486 Ga0207671_10003465 3300025914 Bacteria 15693
487 Ga0207671_10027957 3300025914 Bacteria 4215
488 Ga0207693_10000053 3300025915 Bacteria 97139
489 Ga0207693_10000187 3300025915 Bacteria 56636
490 Ga0207693_10000654 3300025915 Bacteria 31051
491 Ga0207693_10006471 3300025915 Bacteria 9706
492 Ga0207693_10006481 3300025915 Bacteria 9699
493 Ga0207693_10122674 3300025915 Bacteria 2041
494 Ga0207663_10001021 3300025916 Bacteria 12806
495 Ga0207663_10003872 3300025916 Bacteria 7387
496 Ga0207660_10059817 3300025917 Bacteria 2737
497 Ga0207662_10036360 3300025918 Bacteria 2878
498 Ga0207657_10001924 3300025919 Bacteria 22428
499 Ga0207657_10002770 3300025919 Bacteria 18869
500 Ga0207657_10003087 3300025919 Bacteria 17823
501 Ga0207657_10009971 3300025919 Bacteria 9508
502 Ga0207657_10021487 3300025919 Bacteria 6070
503 Ga0207649_10047217 3300025920 Bacteria 2649
504 Ga0207652_10003228 3300025921 Bacteria 13549
505 Ga0207652_10062779 3300025921 Bacteria 3211
506 Ga0207652_10139531 3300025921 Bacteria 2167
507 Ga0207646_10000538 3300025922 Bacteria 50371
508 Ga0207646_10001860 3300025922 Bacteria 25448
509 Ga0207646_10026366 3300025922 Bacteria 5305
510 Ga0207646_10081870 3300025922 Bacteria 2887
511 Ga0207681_10027170 3300025923 Bacteria 3698
512 Ga0207694_10000024 3300025924 Bacteria 259443
513 Ga0207694_10001795 3300025924 Bacteria 17876
514 Ga0207694_10002260 3300025924 Bacteria 15768
515 Ga0207694_10004595 3300025924 Bacteria 10748
516 Ga0207694_10034906 3300025924 Bacteria 3857
517 Ga0207694_10093687 3300025924 Bacteria 2373
518 Ga0207694_10126471 3300025924 Bacteria 2045
519 Ga0207650_10002318 3300025925 Bacteria 13264
520 Ga0207650_10004995 3300025925 Bacteria 9057
521 Ga0207650_10007585 3300025925 Bacteria 7396
522 Ga0207650_10097734 3300025925 Bacteria 2255
523 Ga0207659_10000019 3300025926 Bacteria 152016
524 Ga0207659_10000152 3300025926 Bacteria 41080
525 Ga0207659_10000181 3300025926 Bacteria 37557
526 Ga0207659_10000227 3300025926 Bacteria 34213
527 Ga0207659_10031266 3300025926 Bacteria 3642
528 Ga0207687_10003664 3300025927 Bacteria 10347
529 Ga0207687_10007174 3300025927 Bacteria 7345
530 Ga0207687_10015279 3300025927 Bacteria 5031
531 Ga0207687_10020293 3300025927 Bacteria 4408
532 Ga0207687_10030755 3300025927 Bacteria 3623
533 Ga0207687_10062808 3300025927 Bacteria 2628
534 Ga0207687_10087690 3300025927 Bacteria 2262
535 Ga0207700_10000431 3300025928 Bacteria 24658
536 Ga0207700_10011703 3300025928 Bacteria 5611
537 Ga0207700_10024720 3300025928 Bacteria 4161
538 Ga0207700_10039215 3300025928 Bacteria 3446
539 Ga0207700_10084705 3300025928 Bacteria 2486
540 Ga0207664_10000029 3300025929 Bacteria 183815
541 Ga0207664_10000112 3300025929 Bacteria 71450
542 Ga0207664_10002385 3300025929 Bacteria 12418
543 Ga0207664_10103937 3300025929 Bacteria 2351
544 Ga0207644_10008766 3300025931 Bacteria 6622
545 Ga0207644_10029068 3300025931 Bacteria 3831
546 Ga0207644_10072477 3300025931 Bacteria 2523
547 Ga0207706_10000504 3300025933 Bacteria 41549
548 Ga0207706_10004765 3300025933 Bacteria 12703
549 Ga0207706_10009892 3300025933 Bacteria 8745
550 Ga0207670_10001926 3300025936 Bacteria 10864
551 Ga0207670_10019535 3300025936 Bacteria 4140
552 Ga0207665_10000667 3300025939 Bacteria 23088
553 Ga0207665_10004411 3300025939 Bacteria 9352
554 Ga0207665_10005205 3300025939 Bacteria 8686
555 Ga0207665_10006792 3300025939 Bacteria 7582
556 Ga0207665_10026019 3300025939 Bacteria 3861
557 Ga0207665_10028783 3300025939 Bacteria 3672
558 Ga0207665_10034736 3300025939 Bacteria 3345
559 Ga0207665_10037214 3300025939 Bacteria 3238
560 Ga0207691_10001100 3300025940 Bacteria 26873
561 Ga0207691_10007240 3300025940 Bacteria 10703
562 Ga0207691_10007244 3300025940 Bacteria 10701
563 Ga0207691_10009627 3300025940 Bacteria 9271
564 Ga0207691_10044357 3300025940 Bacteria 4094
565 Ga0207691_10058456 3300025940 Bacteria 3507
566 Ga0207691_10070196 3300025940 Bacteria 3163
567 Ga0207691_10103556 3300025940 Bacteria 2538
568 Ga0207711_10000397 3300025941 Bacteria 45923
569 Ga0207711_10008275 3300025941 Bacteria 8705
570 Ga0207711_10031216 3300025941 Bacteria 4496
571 Ga0207711_10089637 3300025941 Bacteria 2702
572 Ga0207689_10001019 3300025942 Bacteria 26906
573 Ga0207689_10002617 3300025942 Bacteria 16654
574 Ga0207689_10034197 3300025942 Bacteria 4221
575 Ga0207661_10000058 3300025944 Bacteria 83169
576 Ga0207661_10000720 3300025944 Bacteria 21511
577 Ga0207661_10063054 3300025944 Bacteria 3001
578 Ga0207679_10001223 3300025945 Bacteria 16341
579 Ga0207679_10002719 3300025945 Bacteria 10935
580 Ga0207667_10000188 3300025949 Bacteria 90598
581 Ga0207667_10000475 3300025949 Bacteria 53512
582 Ga0207667_10001332 3300025949 Bacteria 30968
583 Ga0207667_10001648 3300025949 Bacteria 28133
584 Ga0207667_10003699 3300025949 Bacteria 18853
585 Ga0207667_10014978 3300025949 Bacteria 8820
586 Ga0207651_10003433 3300025960 Bacteria 7784
587 Ga0207651_10011141 3300025960 Bacteria 5019
588 Ga0207651_10074126 3300025960 Bacteria 2423
589 Ga0207651_10074738 3300025960 Bacteria 2414
590 Ga0207712_10037752 3300025961 Bacteria 3297
591 Ga0207658_10000041 3300025986 Bacteria 138200
592 Ga0207658_10008554 3300025986 Bacteria 6962
593 Ga0207658_10010154 3300025986 Bacteria 6399
594 Ga0207658_10014960 3300025986 Bacteria 5319
595 Ga0207677_10000035 3300026023 Bacteria 117469
596 Ga0207677_10000099 3300026023 Bacteria 71195
597 Ga0207677_10000965 3300026023 Bacteria 15939
598 Ga0207677_10008533 3300026023 Bacteria 5731
599 Ga0207677_10070987 3300026023 Bacteria 2456
600 Ga0207703_10000046 3300026035 Bacteria 154474
601 Ga0207703_10000432 3300026035 Bacteria 44074
602 Ga0207703_10014240 3300026035 Bacteria 6204
603 Ga0207703_10038882 3300026035 Bacteria 3800
604 Ga0207703_10161138 3300026035 Bacteria 1965
605 Ga0207639_10000753 3300026041 Bacteria 22068
606 Ga0207639_10013041 3300026041 Bacteria 5802
607 Ga0207639_10029778 3300026041 Bacteria 4000
608 Ga0207639_10037881 3300026041 Bacteria 3584
609 Ga0207639_10051911 3300026041 Bacteria 3121
610 Ga0207639_10098426 3300026041 Bacteria 2358
611 Ga0207678_10001085 3300026067 Bacteria 24934
612 Ga0207678_10008829 3300026067 Bacteria 8872
613 Ga0207708_10000034 3300026075 Bacteria 144931
614 Ga0207708_10000401 3300026075 Bacteria 34234
615 Ga0207708_10017646 3300026075 Bacteria 5374
616 Ga0207702_10000457 3300026078 Bacteria 46125
617 Ga0207702_10000536 3300026078 Bacteria 42507
618 Ga0207702_10006374 3300026078 Bacteria 10185
619 Ga0207702_10009621 3300026078 Bacteria 8112
620 Ga0207702_10012397 3300026078 Bacteria 7100
621 Ga0207702_10014432 3300026078 Bacteria 6558
622 Ga0207702_10016867 3300026078 Bacteria 6046
623 Ga0207641_10000030 3300026088 Bacteria 224468
624 Ga0207641_10000223 3300026088 Bacteria 72954
625 Ga0207641_10002614 3300026088 Bacteria 16521
626 Ga0207641_10042648 3300026088 Bacteria 3807
627 Ga0207641_10044327 3300026088 Bacteria 3741
628 Ga0207648_10005961 3300026089 Bacteria 12186
629 Ga0207648_10009848 3300026089 Bacteria 9116
630 Ga0207648_10011357 3300026089 Bacteria 8394
631 Ga0207648_10026574 3300026089 Bacteria 5142
632 Ga0207676_10000013 3300026095 Bacteria 343067
633 Ga0207676_10000256 3300026095 Bacteria 46055
634 Ga0207676_10001520 3300026095 Bacteria 17130
635 Ga0207676_10023229 3300026095 Bacteria 4571
636 Ga0207676_10048758 3300026095 Bacteria 3290
637 Ga0207676_10056450 3300026095 Bacteria 3087
638 Ga0207676_10074449 3300026095 Bacteria 2736
639 Ga0207674_10000165 3300026116 Bacteria 79381
640 Ga0207674_10001042 3300026116 Bacteria 36044
641 Ga0207674_10001306 3300026116 Bacteria 32571
642 Ga0207674_10010324 3300026116 Bacteria 10587
643 Ga0207674_10020151 3300026116 Bacteria 7212
644 Ga0207674_10027669 3300026116 Bacteria 5993
645 Ga0207674_10032217 3300026116 Bacteria 5500
646 Ga0207674_10051442 3300026116 Bacteria 4204
647 Ga0207674_10070173 3300026116 Bacteria 3522
648 Ga0207675_100005264 3300026118 Bacteria 12444
649 Ga0207675_100025155 3300026118 Bacteria 5540
650 Ga0207675_100102638 3300026118 Bacteria 2695
651 Ga0207675_100186455 3300026118 Bacteria 1988
652 Ga0207683_10001542 3300026121 Bacteria 20766
653 Ga0207683_10005395 3300026121 Bacteria 10958
654 Ga0207683_10031790 3300026121 Bacteria 4583
655 Ga0207683_10093318 3300026121 Bacteria 2682
656 Ga0207698_10000011 3300026142 Bacteria 260352
657 Ga0207698_10001094 3300026142 Bacteria 15780
658 Ga0207698_10011250 3300026142 Bacteria 5792
659 Ga0207428_10010477 3300027907 Bacteria 8275
660 Ga0268266_10013040 3300028379 Bacteria 7166
661 Ga0268266_10084031 3300028379 Bacteria 2779
662 Ga0268265_10012948 3300028380 Bacteria 5661
663 Ga0268265_10015661 3300028380 Bacteria 5192
664 Ga0268265_10065825 3300028380 Bacteria 2799
665 Ga0268265_10106397 3300028380 Bacteria 2279
666 Ga0268264_10000240 3300028381 Bacteria 104362
667 Ga0268264_10001181 3300028381 Bacteria 25304
668 Ga0268264_10010333 3300028381 Bacteria 7722
669 Ga0268264_10013030 3300028381 Bacteria 6835
670 Ga0268264_10017223 3300028381 Bacteria 5919
671 Ga0268264_10032829 3300028381 Bacteria 4260
672 Ga0268264_10087216 3300028381 Bacteria 2683
673 Ga0268264_10132466 3300028381 Bacteria 2212
674 Ga0268264_10156111 3300028381 Bacteria 2051
675 Ga0265318_10004034 3300028577 Bacteria 7210
676 Ga0265336_10000952 3300028666 Bacteria 14535
677 Ga0265336_10009982 3300028666 Bacteria 3261
678 Ga0265338_10000759 3300028800 Bacteria 55072
679 Ga0265338_10004331 3300028800 Bacteria 19251
680 Ga0265338_10017201 3300028800 Bacteria 7811
681 Ga0265338_10021457 3300028800 Bacteria 6734
682 Ga0265762_1000798 3300030760 Bacteria 5619
683 Ga0265760_10000370 3300031090 Bacteria 12538
684 Ga0265330_10000216 3300031235 Bacteria 44839
685 Ga0265330_10000495 3300031235 Bacteria 26302
686 Ga0265330_10002597 3300031235 Bacteria 9814
687 Ga0265330_10004042 3300031235 Bacteria 7527
688 Ga0265330_10006442 3300031235 Bacteria 5802
689 Ga0265330_10006808 3300031235 Bacteria 5626
690 Ga0265330_10016996 3300031235 Bacteria 3354
691 Ga0265330_10022103 3300031235 Bacteria 2898
692 Ga0265332_10013037 3300031238 Bacteria 3685
693 Ga0265328_10001519 3300031239 Bacteria 10728
694 Ga0265328_10011587 3300031239 Bacteria 3518
695 Ga0265320_10031605 3300031240 Bacteria 2718
696 Ga0265325_10000217 3300031241 Bacteria 40450
697 Ga0265325_10000249 3300031241 Bacteria 38332
698 Ga0265325_10018324 3300031241 Bacteria 3882
699 Ga0265329_10005123 3300031242 Bacteria 5340
700 Ga0265329_10005902 3300031242 Bacteria 4909
701 Ga0265329_10006092 3300031242 Bacteria 4815
702 Ga0265329_10006526 3300031242 Bacteria 4618
703 Ga0265340_10000990 3300031247 Bacteria 16230
704 Ga0265340_10035867 3300031247 Bacteria 2461
705 Ga0265339_10000023 3300031249 Bacteria 169980
706 Ga0265339_10001829 3300031249 Bacteria 15602
707 Ga0265339_10005819 3300031249 Bacteria 8179
708 Ga0265339_10008925 3300031249 Bacteria 6343
709 Ga0265339_10012233 3300031249 Bacteria 5248
710 Ga0265331_10000183 3300031250 Bacteria 76963
711 Ga0265316_10000148 3300031344 Bacteria 76964
712 Ga0265316_10000390 3300031344 Bacteria 50094
713 Ga0265316_10002993 3300031344 Bacteria 17278
714 Ga0265316_10011773 3300031344 Bacteria 7868
715 Ga0265316_10023297 3300031344 Bacteria 5204
716 Ga0265316_10029989 3300031344 Bacteria 4465
717 Ga0265316_10041160 3300031344 Bacteria 3700
718 Ga0265316_10070533 3300031344 Bacteria 2695
719 Ga0265313_10002347 3300031595 Bacteria 16523
720 Ga0265313_10002475 3300031595 Bacteria 15921
721 Ga0265314_10000239 3300031711 Bacteria 80839
722 Ga0265314_10000699 3300031711 Bacteria 40640
723 Ga0265314_10000984 3300031711 Bacteria 33551
724 Ga0265314_10014008 3300031711 Bacteria 6446
725 Ga0265314_10019828 3300031711 Bacteria 5200
726 Ga0265342_10001352 3300031712 Bacteria 22957
727 Ga0265342_10001442 3300031712 Bacteria 22142
728 Ga0265342_10001956 3300031712 Bacteria 18426
729 Ga0265342_10005484 3300031712 Bacteria 9656
730 Ga0265342_10007130 3300031712 Bacteria 8227
731 Ga0265342_10037573 3300031712 Bacteria 2952
732 Ga0307405_10097846 3300031731 Bacteria 1960
733 Ga0307413_10003211 3300031824 Bacteria 6837
734 Ga0307410_10000548 3300031852 Bacteria 15471
735 Ga0307407_10008476 3300031903 Bacteria 4724
736 Ga0307407_10056938 3300031903 Bacteria 2266
737 Ga0307412_10005543 3300031911 Bacteria 7090
738 Ga0307409_100002046 3300031995 Bacteria 10357
739 Ga0307409_100013197 3300031995 Bacteria 5304
740 Ga0307409_100031021 3300031995 Bacteria 3850
741 Ga0307409_100055966 3300031995 Bacteria 3049
742 Ga0307416_100000683 3300032002 Bacteria 17650
743 Ga0307416_100002239 3300032002 Bacteria 11007
744 Ga0307416_100012525 3300032002 Bacteria 5718
745 Ga0307416_100014062 3300032002 Bacteria 5466
746 Ga0307416_100030511 3300032002 Bacteria 4046
747 Ga0307411_10005339 3300032005 Bacteria 6296
748 Ga0307415_100002658 3300032126 Bacteria 8921
749 Ga0307415_100004748 3300032126 Bacteria 7112
750 Ga0307415_100106050 3300032126 Bacteria 2074
751 Ga0316214_1000994 3300033545 Bacteria 3154
752 Ga0373926_0016950 3300035083 Bacteria 2496
753 Ga0373945_0000791 3300035116 Bacteria 9249
754 Ga0373945_0013509 3300035116 Bacteria 2727
755 Ga0373956_0017899 3300035119 Bacteria 2995
756 Ga0373943_0001897 3300035170 Bacteria 9455
757 Ga0373946_0005289 3300035171 Bacteria 4655
758 Ga0373955_0000430 3300035172 Bacteria 17725
759 Ga0373924_0003014 3300035410 Bacteria 5733
760 Ga0373935_0015517 3300035692 Bacteria 4605
761 Ga0373935_0059823 3300035692 Bacteria 2436
762 Ga0373927_0000070 3300035695 Bacteria 73849
763 Ga0373927_0085522 3300035695 Bacteria 2047
764 Ga0373933_0056789 3300035724 Bacteria 2351
765 Ga0373947_0001681 3300035725 Bacteria 13546
766 Ga0373947_0055668 3300035725 Bacteria 2389
767 Ga0373937_0000772 3300036401 Bacteria 27672
768 Ga0373937_0008811 3300036401 Bacteria 8753
769 Ga0373937_0014967 3300036401 Bacteria 6853
770 Ga0373937_0028217 3300036401 Bacteria 5078
771 Ga0373937_0127643 3300036401 Bacteria 2373
772 Ga0373937_0129814 3300036401 Bacteria 2353
773 Ga0373937_0140408 3300036401 Bacteria 2260
774 Ga0316582_0051099 3300036647 Bacteria 2622
775 Ga0373925_0001143 3300037068 Bacteria 23596
776 Ga0373925_0007680 3300037068 Bacteria 7856
777 Ga0373925_0009291 3300037068 Bacteria 7156
778 Ga0373925_0031504 3300037068 Bacteria 3898
779 Ga0373925_0063287 3300037068 Bacteria 2783
780 Ga0373925_0080608 3300037068 Bacteria 2474
781 Ga0395898_0101689 3300037466 Bacteria 2760
782 Ga0395905_0011711 3300037471 Bacteria 8466
783 Ga0436360_0812878 3300039438 Bacteria 9343
784 Ga0436361_0445142 3300039447 Bacteria 7168
785 Ga0436363_0811887 3300039450 Bacteria 4303
786 Ga0436362_0197917 3300039453 Bacteria 3369
787 Ga0451577_0000053 3300042876 Bacteria 279563
788 Ga0451577_0000294 3300042876 Bacteria 97046
789 Ga0451577_0000658 3300042876 Bacteria 54482
790 Ga0451577_0001280 3300042876 Bacteria 34616
791 Ga0466963_0007935 3300044694 Bacteria 6355
792 Ga0466963_0085991 3300044694 Bacteria 2136
793 Ga0453684_0000103 3300044712 Bacteria 366458
794 Ga0453684_0000104 3300044712 Bacteria 365431
795 Ga0453684_0000208 3300044712 Bacteria 255911
796 Ga0453684_0015233 3300044712 Bacteria 12193
797 Ga0453684_0155408 3300044712 Bacteria 2713
798 Ga0453684_0156897 3300044712 Bacteria 2697
799 Ga0453684_0246806 3300044712 Bacteria 2052
800 Ga0466957_0001064 3300044842 Bacteria 14145
801 Ga0466959_0018815 3300045049 Bacteria 5074
802 Ga0451576_0002362 3300045051 Bacteria 28450
803 Ga0451576_0009935 3300045051 Bacteria 10980
804 Ga0451576_0028875 3300045051 Bacteria 5941
805 Ga0451576_0053000 3300045051 Bacteria 4251
806 Ga0451576_0074357 3300045051 Bacteria 3536
807 Ga0466967_0001326 3300045976 Bacteria 14177
808 Ga0466967_0003357 3300045976 Bacteria 10410
809 Ga0466967_0121565 3300045976 Bacteria 2413
810 Ga0495603_0043373 3300046455 Bacteria 2686
811 Ga0495629_0004294 3300046459 Bacteria 10683
812 Ga0495638_0061240 3300046460 Bacteria 2326
813 Ga0495651_0004718 3300046462 Bacteria 10432
814 Ga0495580_0000196 3300046472 Bacteria 46289
815 Ga0495580_0000848 3300046472 Bacteria 26484
816 Ga0495580_0006140 3300046472 Bacteria 9824
817 Ga0495580_0008930 3300046472 Bacteria 7926
818 Ga0495580_0021801 3300046472 Bacteria 4724
819 Ga0495639_0044778 3300046475 Bacteria 2001
820 Ga0495664_0033834 3300046477 Bacteria 3005
821 Ga0495585_0034587 3300046492 Bacteria 2857
822 Ga0495594_0017951 3300046499 Bacteria 3744
823 Ga0495620_0010132 3300046515 Bacteria 4981
824 Ga0495630_0022152 3300046517 Bacteria 4694
825 Ga0495644_0015793 3300046523 Bacteria 2893
826 Ga0495665_0041908 3300046531 Bacteria 2437
827 Ga0495587_0046695 3300046536 Bacteria 2569
828 Ga0495587_0047676 3300046536 Bacteria 2540
829 Ga0495609_0006375 3300046538 Bacteria 6022
830 Ga0495621_0000671 3300046539 Bacteria 8661
831 Ga0495621_0006888 3300046539 Bacteria 3341
832 Ga0495621_0016009 3300046539 Bacteria 2399
833 Ga0495633_0038924 3300046558 Bacteria 2270
834 Ga0495635_0032266 3300046663 Bacteria 3634
835 Ga0495659_0001886 3300046664 Bacteria 6919
836 Ga0495659_0003052 3300046664 Bacteria 5374
837 Ga0495657_0054595 3300046675 Bacteria 2668
838 Ga0495623_0029630 3300046679 Bacteria 3522
839 Ga0495658_0032708 3300046683 Bacteria 2842
840 Ga0495613_0076543 3300046689 Bacteria 2435
841 Ga0495581_0014727 3300047315 Bacteria 4537
842 Ga0495674_0007954 3300047319 Bacteria 10121
843 Ga0495602_0026743 3300048088 Bacteria 5560
844 Ga0496101_0056460 3300048904 Bacteria 2839
845 Ga0496102_0005785 3300048905 Bacteria 10509
846 Ga0496102_0158381 3300048905 Bacteria 2129
847 Ga0496103_0004124 3300048906 Bacteria 8821
848 Ga0496104_0030065 3300048907 Bacteria 5045
849 Ga0496104_0031520 3300048907 Bacteria 4931
850 Ga0496104_0096075 3300048907 Bacteria 2835
851 Ga0496104_0200606 3300048907 Bacteria 1907
852 Ga0496105_0007966 3300048908 Bacteria 8238
853 Ga0496105_0014515 3300048908 Bacteria 6270
854 Ga0496106_0063713 3300048909 Bacteria 2803
855 Ga0496108_0031332 3300048911 Bacteria 4412
856 Ga0496108_0115665 3300048911 Bacteria 2297
857 Ga0496109_0000381 3300048912 Bacteria 40340
858 Ga0496109_0105099 3300048912 Bacteria 2622
859 Ga0496109_0105507 3300048912 Bacteria 2617
860 Ga0496110_0000862 3300048913 Bacteria 21421
861 Ga0496110_0005513 3300048913 Bacteria 9932
862 Ga0496110_0018500 3300048913 Bacteria 5842
863 Ga0496110_0085458 3300048913 Bacteria 2816
864 Ga0496111_0002956 3300048914 Bacteria 10401
865 Ga0496111_0021817 3300048914 Bacteria 4474
866 Ga0496112_0000155 3300048915 Bacteria 43076
867 Ga0496112_0003539 3300048915 Bacteria 12966
868 Ga0496112_0006599 3300048915 Bacteria 10211
869 Ga0496112_0014512 3300048915 Bacteria 7315
870 Ga0496112_0014861 3300048915 Bacteria 7242
871 Ga0496112_0027695 3300048915 Bacteria 5465
872 Ga0496112_0084871 3300048915 Bacteria 3133
873 Ga0496113_0003008 3300048916 Bacteria 9983
874 Ga0496113_0064984 3300048916 Bacteria 2760
875 Ga0496115_0001879 3300048918 Bacteria 15050
876 Ga0496126_0074144 3300048929 Bacteria 3023
877 Ga0501032_0066449 3300049569 Bacteria 2410
878 Ga0501033_0001466 3300049570 Bacteria 20890
879 Ga0501034_0021241 3300049571 Bacteria 6621
880 Ga0501034_0030656 3300049571 Bacteria 5465
881 Ga0501034_0035712 3300049571 Bacteria 5038
882 Ga0501036_0002139 3300049572 Bacteria 15413
883 Ga0501036_0008849 3300049572 Bacteria 8266
884 Ga0501037_0000070 3300049573 Bacteria 94985
885 Ga0501037_0004528 3300049573 Bacteria 10101
886 Ga0501038_0000082 3300049574 Bacteria 80551
887 Ga0501039_0000077 3300049575 Bacteria 74065
888 Ga0501039_0004672 3300049575 Bacteria 10360
889 Ga0501039_0019334 3300049575 Bacteria 5221
890 Ga0501039_0061470 3300049575 Bacteria 2909
891 Ga0501039_0067587 3300049575 Bacteria 2775
892 Ga0501040_0000048 3300049576 Bacteria 55371
893 Ga0501040_0000330 3300049576 Bacteria 27805
894 Ga0501041_0000007 3300049577 Bacteria 64272
895 Ga0501041_0003269 3300049577 Bacteria 9316
896 Ga0501041_0024740 3300049577 Bacteria 3605
897 Ga0501042_0000011 3300049578 Bacteria 56069
898 Ga0501042_0001198 3300049578 Bacteria 15016
899 Ga0501042_0066931 3300049578 Bacteria 2568
900 Ga0501043_0000208 3300049579 Bacteria 53881
901 Ga0501046_0000089 3300049580 Bacteria 99031
902 Ga0501046_0069001 3300049580 Bacteria 2751
903 Ga0501047_0000237 3300049581 Bacteria 65237
904 Ga0501047_0009879 3300049581 Bacteria 9020
905 Ga0501048_0037208 3300049582 Bacteria 3494
906 Ga0501048_0047617 3300049582 Bacteria 3059
907 Ga0501067_0002232 3300049583 Bacteria 10694
908 Ga0501068_0000856 3300049584 Bacteria 15851
909 Ga0501069_0000139 3300049585 Bacteria 31998
910 Ga0501069_0003510 3300049585 Bacteria 8074
911 Ga0501070_0000234 3300049586 Bacteria 52540
912 Ga0501071_0068948 3300049587 Bacteria 2574
913 Ga0501072_0001511 3300049588 Bacteria 17432
914 Ga0501072_0001977 3300049588 Bacteria 15271
915 Ga0501072_0013236 3300049588 Bacteria 6319
916 Ga0501072_0059457 3300049588 Bacteria 3013
917 Ga0501073_0001338 3300049589 Bacteria 18161
918 Ga0501073_0015703 3300049589 Bacteria 5491
919 Ga0501074_0000002 3300049590 Bacteria 121767
920 Ga0501075_0000782 3300049591 Bacteria 19882
921 Ga0501076_0000167 3300049592 Bacteria 38185
922 Ga0501076_0000246 3300049592 Bacteria 33219
923 Ga0501077_0000090 3300049593 Bacteria 46393
924 Ga0501077_0001464 3300049593 Bacteria 14196
925 Ga0501077_0013555 3300049593 Bacteria 5112
926 Ga0501079_0129424 3300049741 Bacteria 1964
927 Ga0501080_0001053 3300049742 Bacteria 22707
928 Ga0501080_0022833 3300049742 Bacteria 5798
929 Ga0501081_0000112 3300049743 Bacteria 34866
930 Ga0501081_0000598 3300049743 Bacteria 20594
931 Ga0501081_0023338 3300049743 Bacteria 4145
932 Ga0501083_0033740 3300049744 Bacteria 3502
933 Ga0501035_0006035 3300049822 Bacteria 11406
934 Ga0501035_0065057 3300049822 Bacteria 3239
935 Ga0501044_0004943 3300049823 Bacteria 14909
936 Ga0501044_0006636 3300049823 Bacteria 12758
937 Ga0501045_0008702 3300049824 Bacteria 7079
938 Ga0501045_0046589 3300049824 Bacteria 3157
939 Ga0501045_0094387 3300049824 Bacteria 2213
940 nmdc:mga05p37_1051_c1 3300050507 Bacteria 25770
941 nmdc:mga05p37_1788_c1 3300050507 Bacteria 25109
942 nmdc:mga05p37_276725_c1 3300050507 Bacteria 2004
943 nmdc:mga05p37_321673_c1 3300050507 Bacteria 1831
944 nmdc:mga05p37_51424_c1 3300050507 Bacteria 5067
945 nmdc:mga05p37_84214_c1 3300050507 Bacteria 3917
946 nmdc:mga09592_28247_c1 3300050508 Bacteria 4660
947 nmdc:mga0qj67_108404_c1 3300050509 Bacteria 2241
948 nmdc:mga0qj67_2704_c1 3300050509 Bacteria 12711
949 nmdc:mga08y16_26215_c1 3300050511 Bacteria 6147
950 nmdc:mga08y16_37306_c1 3300050511 Bacteria 5105
951 nmdc:mga08y16_39505_c1 3300050511 Bacteria 4951
952 nmdc:mga08y16_524_c1 3300050511 Bacteria 35438
953 nmdc:mga0n895_1225_c1 3300050512 Bacteria 18962
954 nmdc:mga0n895_145662_c1 3300050512 Bacteria 2398
955 nmdc:mga0n895_157977_c1 3300050512 Bacteria 2299
956 nmdc:mga0n895_1771_c1 3300050512 Bacteria 16368
957 nmdc:mga0n895_3475_c1 3300050512 Bacteria 12714
958 nmdc:mga0rr50_1542_c1 3300050513 Bacteria 12694
959 nmdc:mga0rr50_3136_c1 3300050513 Bacteria 9440
960 nmdc:mga0rr50_45969_c1 3300050513 Bacteria 3212
961 nmdc:mga0rr50_73200_c1 3300050513 Bacteria 2619
962 nmdc:mga08x19_3059_c1 3300050514 Bacteria 10053
963 nmdc:mga08x19_45101_c1 3300050514 Bacteria 2817
964 nmdc:mga08x19_50237_c1 3300050514 Bacteria 2676
965 nmdc:mga08x19_9570_c1 3300050514 Bacteria 5800
966 nmdc:mga0a205_10374_c1 3300050515 Bacteria 8561
967 nmdc:mga0a205_1296_c1 3300050515 Bacteria 21017
968 nmdc:mga0a205_3935_c2 3300050515 Bacteria 11335
969 Ga0500641_0000225 3300053096 Bacteria 21193
970 Ga0500568_0014356 3300053139 Bacteria 3579
971 Ga0501084_0000332 3300054114 Bacteria 36149
972 Ga0501084_0003965 3300054114 Bacteria 12057
973 Ga0501084_0021307 3300054114 Bacteria 5402
974 Ga0590075_000898 3300059424 Bacteria 7757
975 Ga0501082_0000241 3300060353 Bacteria 47793
976 Ga0501082_0000888 3300060353 Bacteria 26405
977 Ga0501082_0050102 3300060353 Bacteria 3601
978 Ga0530510_0001350 3300061734 Bacteria 16417

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036401 Ga0373937_0014967 Ga0373937_0014967_5295_6842 473
2 3300035692 Ga0373935_0059823 Ga0373935_0059823_28_1596 480
3 3300013297 Ga0157378_10046773 Ga0157378_100467732 500
4 3300046462 Ga0495651_0004718 Ga0495651_0004718_2354_4054 529
5 3300048911 Ga0496108_0115665 Ga0496108_0115665_536_2263 533
6 3300009094 Ga0111539_10018879 Ga0111539_100188797 540
7 3300025939 Ga0207665_10037214 Ga0207665_100372142 540
8 3300050511 nmdc:mga08y16_37306_c1 nmdc:mga08y16_37306_c1_2274_3965 540
9 3300014497 Ga0182008_10005954 Ga0182008_100059542 543
10 3300048909 Ga0496106_0063713 Ga0496106_0063713_805_2541 543
11 3300048911 Ga0496108_0031332 Ga0496108_0031332_1389_3125 543
12 3300048912 Ga0496109_0105507 Ga0496109_0105507_617_2353 543
13 3300005334 Ga0068869_100007045 Ga0068869_1000070454 545
14 3300005335 Ga0070666_10039732 Ga0070666_100397323 545
15 3300005340 Ga0070689_100031607 Ga0070689_1000316073 545
16 3300005344 Ga0070661_100015089 Ga0070661_1000150893 545
17 3300005365 Ga0070688_100007207 Ga0070688_1000072072 545
18 3300005455 Ga0070663_100015952 Ga0070663_1000159524 545
19 3300005466 Ga0070685_10003390 Ga0070685_100033907 545
20 3300005535 Ga0070684_100085152 Ga0070684_1000851521 545
21 3300005543 Ga0070672_100078707 Ga0070672_1000787071 545
22 3300005544 Ga0070686_100004959 Ga0070686_1000049596 545
23 3300005564 Ga0070664_100029161 Ga0070664_1000291613 545
24 3300005577 Ga0068857_100064478 Ga0068857_1000644784 545
25 3300005615 Ga0070702_100002922 Ga0070702_1000029221 545
26 3300005616 Ga0068852_100017162 Ga0068852_1000171622 545
27 3300005617 Ga0068859_100110663 Ga0068859_1001106631 545
28 3300005834 Ga0068851_10016930 Ga0068851_100169302 545
29 3300005843 Ga0068860_100041771 Ga0068860_1000417714 545
30 3300005843 Ga0068860_100097553 Ga0068860_1000975533 545
31 3300006173 Ga0070716_100004475 Ga0070716_1000044753 545
32 3300006175 Ga0070712_100010572 Ga0070712_1000105722 545
33 3300006881 Ga0068865_100069763 Ga0068865_1000697632 545
34 3300006931 Ga0097620_100110666 Ga0097620_1001106661 545
35 3300009098 Ga0105245_10041496 Ga0105245_100414962 545
36 3300009101 Ga0105247_10007911 Ga0105247_100079116 545
37 3300009174 Ga0105241_10013412 Ga0105241_100134126 545
38 3300010375 Ga0105239_10112059 Ga0105239_101120591 545
39 3300011119 Ga0105246_10002800 Ga0105246_100028003 545
40 3300013102 Ga0157371_10010303 Ga0157371_100103032 545
41 3300013307 Ga0157372_10084080 Ga0157372_100840802 545
42 3300014325 Ga0163163_10001132 Ga0163163_1000113222 545
43 3300025321 Ga0207656_10014848 Ga0207656_100148482 545
44 3300025903 Ga0207680_10024457 Ga0207680_100244572 545
45 3300025906 Ga0207699_10000959 Ga0207699_100009595 545
46 3300025940 Ga0207691_10070196 Ga0207691_100701961 545
47 3300025986 Ga0207658_10014960 Ga0207658_100149604 545
48 3300026035 Ga0207703_10038882 Ga0207703_100388823 545
49 3300026116 Ga0207674_10027669 Ga0207674_100276691 545
50 3300028381 Ga0268264_10013030 Ga0268264_100130306 545
51 3300048905 Ga0496102_0158381 Ga0496102_0158381_189_1928 545
52 3300048912 Ga0496109_0000381 Ga0496109_0000381_5546_7285 545
53 3300048913 Ga0496110_0005513 Ga0496110_0005513_5559_7298 545
54 3300048915 Ga0496112_0000155 Ga0496112_0000155_35793_37532 545
55 3300048916 Ga0496113_0003008 Ga0496113_0003008_3040_4779 545
56 3300005536 Ga0070697_100019328 Ga0070697_1000193282 546
57 3300025910 Ga0207684_10002469 Ga0207684_100024697 546
58 3300025922 Ga0207646_10000538 Ga0207646_100005389 546
59 3300026023 Ga0207677_10070987 Ga0207677_100709872 546
60 3300036401 Ga0373937_0127643 Ga0373937_0127643_25_1794 546
61 3300005335 Ga0070666_10064885 Ga0070666_100648851 547
62 3300005843 Ga0068860_100146283 Ga0068860_1001462831 547
63 3300025927 Ga0207687_10062808 Ga0207687_100628082 547
64 3300005338 Ga0068868_100002979 Ga0068868_1000029798 548
65 3300005347 Ga0070668_100013532 Ga0070668_1000135324 548
66 3300005439 Ga0070711_100000978 Ga0070711_1000009786 548
67 3300005457 Ga0070662_100006661 Ga0070662_1000066611 548
68 3300005457 Ga0070662_100055719 Ga0070662_1000557191 548
69 3300005459 Ga0068867_100013882 Ga0068867_1000138825 548
70 3300005530 Ga0070679_100008309 Ga0070679_1000083095 548
71 3300005544 Ga0070686_100043296 Ga0070686_1000432962 548
72 3300005563 Ga0068855_100000782 Ga0068855_10000078235 548
73 3300005563 Ga0068855_100003547 Ga0068855_10000354710 548
74 3300005563 Ga0068855_100053155 Ga0068855_1000531552 548
75 3300005564 Ga0070664_100001991 Ga0070664_1000019919 548
76 3300005577 Ga0068857_100000775 Ga0068857_10000077513 548
77 3300005614 Ga0068856_100002380 Ga0068856_1000023805 548
78 3300005614 Ga0068856_100007577 Ga0068856_1000075772 548
79 3300005616 Ga0068852_100056292 Ga0068852_1000562923 548
80 3300005617 Ga0068859_100000298 Ga0068859_10000029831 548
81 3300005618 Ga0068864_100002195 Ga0068864_1000021955 548
82 3300005718 Ga0068866_10008165 Ga0068866_100081656 548
83 3300005841 Ga0068863_100016274 Ga0068863_1000162745 548
84 3300005842 Ga0068858_100049497 Ga0068858_1000494972 548
85 3300006237 Ga0097621_100007702 Ga0097621_1000077024 548
86 3300006237 Ga0097621_100043545 Ga0097621_1000435452 548
87 3300006358 Ga0068871_100086608 Ga0068871_1000866081 548
88 3300006931 Ga0097620_100000298 Ga0097620_10000029831 548
89 3300009174 Ga0105241_10048402 Ga0105241_100484022 548
90 3300013100 Ga0157373_10005980 Ga0157373_100059807 548
91 3300013105 Ga0157369_10104410 Ga0157369_101044104 548
92 3300013296 Ga0157374_10001545 Ga0157374_1000154513 548
93 3300013296 Ga0157374_10001876 Ga0157374_1000187611 548
94 3300013297 Ga0157378_10000133 Ga0157378_1000013332 548
95 3300013297 Ga0157378_10000970 Ga0157378_1000097012 548
96 3300013307 Ga0157372_10000749 Ga0157372_1000074921 548
97 3300014969 Ga0157376_10030563 Ga0157376_100305632 548
98 3300025899 Ga0207642_10018659 Ga0207642_100186592 548
99 3300025912 Ga0207707_10045468 Ga0207707_100454682 548
100 3300025924 Ga0207694_10126471 Ga0207694_101264711 548
101 3300025925 Ga0207650_10097734 Ga0207650_100977341 548
102 3300025939 Ga0207665_10034736 Ga0207665_100347361 548
103 3300025949 Ga0207667_10001648 Ga0207667_1000164822 548
104 3300026023 Ga0207677_10000965 Ga0207677_100009652 548
105 3300026023 Ga0207677_10008533 Ga0207677_100085334 548
106 3300026078 Ga0207702_10006374 Ga0207702_100063742 548
107 3300026078 Ga0207702_10012397 Ga0207702_100123972 548
108 3300026088 Ga0207641_10044327 Ga0207641_100443272 548
109 3300026089 Ga0207648_10005961 Ga0207648_1000596111 548
110 3300026089 Ga0207648_10026574 Ga0207648_100265742 548
111 3300026116 Ga0207674_10000165 Ga0207674_1000016557 548
112 3300028381 Ga0268264_10132466 Ga0268264_101324661 548
113 3300036401 Ga0373937_0008811 Ga0373937_0008811_435_2219 548
114 3300037068 Ga0373925_0031504 Ga0373925_0031504_124_1893 548
115 3300039438 Ga0436360_0812878 Ga0436360_0812878_4071_5834 548
116 3300039447 Ga0436361_0445142 Ga0436361_0445142_2884_4647 548
117 3300044694 Ga0466963_0085991 Ga0466963_0085991_103_1893 548
118 3300046472 Ga0495580_0000196 Ga0495580_0000196_18621_20390 548
119 3300046536 Ga0495587_0047676 Ga0495587_0047676_727_2511 548
120 3300048915 Ga0496112_0006599 Ga0496112_0006599_948_2726 548
121 3300050514 nmdc:mga08x19_45101_c1 nmdc:mga08x19_45101_c1_45_1823 548
122 3300005437 Ga0070710_10011850 Ga0070710_100118504 549
123 3300005719 Ga0068861_100018277 Ga0068861_1000182772 549
124 3300006028 Ga0070717_10020970 Ga0070717_100209702 549
125 3300009093 Ga0105240_10114614 Ga0105240_101146141 549
126 3300013307 Ga0157372_10032747 Ga0157372_100327474 549
127 3300013308 Ga0157375_10094309 Ga0157375_100943092 549
128 3300025904 Ga0207647_10010301 Ga0207647_100103013 549
129 3300025929 Ga0207664_10103937 Ga0207664_101039371 549
130 3300026118 Ga0207675_100025155 Ga0207675_1000251552 549
131 3300025898 Ga0207692_10001347 Ga0207692_100013472 550
132 3300050511 nmdc:mga08y16_39505_c1 nmdc:mga08y16_39505_c1_499_2190 550
133 3300022734 Ga0224571_100064 Ga0224571_1000642 556
134 3300036401 Ga0373937_0140408 Ga0373937_0140408_265_2007 558
135 3300006175 Ga0070712_100001481 Ga0070712_1000014818 559
136 3300006175 Ga0070712_100065704 Ga0070712_1000657042 559
137 3300025915 Ga0207693_10006481 Ga0207693_100064814 559
138 3300025915 Ga0207693_10122674 Ga0207693_101226741 559
139 3300031711 Ga0265314_10000699 Ga0265314_100006993 559
140 3300046455 Ga0495603_0043373 Ga0495603_0043373_472_2247 559
141 3300046472 Ga0495580_0000848 Ga0495580_0000848_3969_5750 559
142 3300046472 Ga0495580_0008930 Ga0495580_0008930_1268_3043 559
143 3300050515 nmdc:mga0a205_3935_c2 nmdc:mga0a205_3935_c2_8683_10458 559
144 3300005539 Ga0068853_100186634 Ga0068853_1001866341 560
145 3300005354 Ga0070675_100000272 Ga0070675_10000027211 561
146 3300005355 Ga0070671_100026358 Ga0070671_1000263582 561
147 3300005466 Ga0070685_10002349 Ga0070685_100023495 561
148 3300009094 Ga0111539_10249249 Ga0111539_102492492 561
149 3300013297 Ga0157378_10060554 Ga0157378_100605543 561
150 3300022732 Ga0224569_100199 Ga0224569_1001995 561
151 3300025926 Ga0207659_10000152 Ga0207659_100001528 561
152 3300025926 Ga0207659_10031266 Ga0207659_100312662 561
153 3300025960 Ga0207651_10011141 Ga0207651_100111413 561
154 3300026118 Ga0207675_100186455 Ga0207675_1001864552 561
155 3300028380 Ga0268265_10065825 Ga0268265_100658252 561
156 3300037466 Ga0395898_0101689 Ga0395898_0101689_939_2738 561
157 3300039450 Ga0436363_0811887 Ga0436363_0811887_105_1922 561
158 3300039453 Ga0436362_0197917 Ga0436362_0197917_1117_2934 561
159 3300005434 Ga0070709_10056280 Ga0070709_100562801 562
160 3300005435 Ga0070714_100000051 Ga0070714_100000051111 562
161 3300005435 Ga0070714_100009776 Ga0070714_1000097767 562
162 3300005436 Ga0070713_100000378 Ga0070713_10000037810 562
163 3300005439 Ga0070711_100000549 Ga0070711_1000005494 562
164 3300005445 Ga0070708_100039219 Ga0070708_1000392194 562
165 3300006028 Ga0070717_10012598 Ga0070717_100125982 562
166 3300006028 Ga0070717_10074261 Ga0070717_100742614 562
167 3300006175 Ga0070712_100000273 Ga0070712_10000027317 562
168 3300006175 Ga0070712_100057983 Ga0070712_1000579832 562
169 3300009093 Ga0105240_10040442 Ga0105240_100404425 562
170 3300013307 Ga0157372_10014436 Ga0157372_100144365 562
171 3300025916 Ga0207663_10003872 Ga0207663_100038721 562
172 3300025929 Ga0207664_10000029 Ga0207664_1000002980 562
173 3300025939 Ga0207665_10005205 Ga0207665_100052057 562
174 3300030760 Ga0265762_1000798 Ga0265762_10007982 562
175 3300031090 Ga0265760_10000370 Ga0265760_100003709 562
176 3300031235 Ga0265330_10002597 Ga0265330_100025972 562
177 3300031241 Ga0265325_10018324 Ga0265325_100183242 562
178 3300031249 Ga0265339_10012233 Ga0265339_100122334 562
179 3300031711 Ga0265314_10019828 Ga0265314_100198282 562
180 3300033545 Ga0316214_1000994 Ga0316214_10009942 562
181 3300035083 Ga0373926_0016950 Ga0373926_0016950_265_2082 562
182 3300035116 Ga0373945_0000791 Ga0373945_0000791_6789_8606 562
183 3300035116 Ga0373945_0013509 Ga0373945_0013509_743_2560 562
184 3300035119 Ga0373956_0017899 Ga0373956_0017899_1155_2972 562
185 3300035170 Ga0373943_0001897 Ga0373943_0001897_1584_3401 562
186 3300035171 Ga0373946_0005289 Ga0373946_0005289_1927_3744 562
187 3300035692 Ga0373935_0015517 Ga0373935_0015517_799_2616 562
188 3300035695 Ga0373927_0000070 Ga0373927_0000070_53814_55631 562
189 3300035695 Ga0373927_0085522 Ga0373927_0085522_219_2036 562
190 3300035725 Ga0373947_0001681 Ga0373947_0001681_4288_6105 562
191 3300037068 Ga0373925_0001143 Ga0373925_0001143_21692_23509 562
192 3300046472 Ga0495580_0006140 Ga0495580_0006140_4231_6048 562
193 3300046477 Ga0495664_0033834 Ga0495664_0033834_248_2065 562
194 3300046517 Ga0495630_0022152 Ga0495630_0022152_1773_3590 562
195 3300047319 Ga0495674_0007954 Ga0495674_0007954_6385_8202 562
196 3300048918 Ga0496115_0001879 Ga0496115_0001879_4407_6224 562
197 3300050512 nmdc:mga0n895_1225_c1 nmdc:mga0n895_1225_c1_4322_6139 563
198 3300050513 nmdc:mga0rr50_1542_c1 nmdc:mga0rr50_1542_c1_6810_8627 563
199 3300050514 nmdc:mga08x19_50237_c1 nmdc:mga08x19_50237_c1_453_2270 563
200 3300050515 nmdc:mga0a205_1296_c1 nmdc:mga0a205_1296_c1_6460_8277 563
201 3300005328 Ga0070676_10004901 Ga0070676_100049015 564
202 3300005334 Ga0068869_100058096 Ga0068869_1000580963 564
203 3300005335 Ga0070666_10005555 Ga0070666_100055553 564
204 3300005339 Ga0070660_100105734 Ga0070660_1001057341 564
205 3300005366 Ga0070659_100004425 Ga0070659_1000044256 564
206 3300005435 Ga0070714_100053759 Ga0070714_1000537593 564
207 3300005445 Ga0070708_100006013 Ga0070708_1000060136 564
208 3300005455 Ga0070663_100007600 Ga0070663_1000076003 564
209 3300005467 Ga0070706_100003417 Ga0070706_1000034176 564
210 3300005530 Ga0070679_100006248 Ga0070679_1000062483 564
211 3300005536 Ga0070697_100000532 Ga0070697_10000053216 564
212 3300005539 Ga0068853_100114740 Ga0068853_1001147402 564
213 3300005578 Ga0068854_100009011 Ga0068854_1000090112 564
214 3300005614 Ga0068856_100045911 Ga0068856_1000459114 564
215 3300006028 Ga0070717_10010141 Ga0070717_100101413 564
216 3300006173 Ga0070716_100010911 Ga0070716_1000109112 564
217 3300009093 Ga0105240_10005889 Ga0105240_100058895 564
218 3300009101 Ga0105247_10038022 Ga0105247_100380223 564
219 3300009148 Ga0105243_10025697 Ga0105243_100256973 564
220 3300009174 Ga0105241_10046513 Ga0105241_100465133 564
221 3300009174 Ga0105241_10065482 Ga0105241_100654822 564
222 3300009551 Ga0105238_10000532 Ga0105238_100005326 564
223 3300009553 Ga0105249_10015894 Ga0105249_100158942 564
224 3300013102 Ga0157371_10013605 Ga0157371_100136055 564
225 3300013105 Ga0157369_10001530 Ga0157369_1000153024 564
226 3300013105 Ga0157369_10005098 Ga0157369_100050985 564
227 3300013105 Ga0157369_10025320 Ga0157369_100253202 564
228 3300013105 Ga0157369_10025809 Ga0157369_100258095 564
229 3300013105 Ga0157369_10036516 Ga0157369_100365164 564
230 3300013296 Ga0157374_10000357 Ga0157374_1000035710 564
231 3300013296 Ga0157374_10005940 Ga0157374_100059406 564
232 3300013296 Ga0157374_10044937 Ga0157374_100449373 564
233 3300013296 Ga0157374_10117077 Ga0157374_101170772 564
234 3300013297 Ga0157378_10166368 Ga0157378_101663681 564
235 3300013306 Ga0163162_10014559 Ga0163162_100145595 564
236 3300013307 Ga0157372_10000544 Ga0157372_1000054428 564
237 3300013308 Ga0157375_10122690 Ga0157375_101226903 564
238 3300014325 Ga0163163_10112476 Ga0163163_101124762 564
239 3300014968 Ga0157379_10024613 Ga0157379_100246131 564
240 3300025910 Ga0207684_10008706 Ga0207684_100087068 564
241 3300025911 Ga0207654_10011498 Ga0207654_100114981 564
242 3300025917 Ga0207660_10059817 Ga0207660_100598171 564
243 3300025919 Ga0207657_10003087 Ga0207657_100030876 564
244 3300025921 Ga0207652_10139531 Ga0207652_101395311 564
245 3300025927 Ga0207687_10020293 Ga0207687_100202933 564
246 3300025949 Ga0207667_10014978 Ga0207667_100149789 564
247 3300026041 Ga0207639_10037881 Ga0207639_100378811 564
248 3300026067 Ga0207678_10001085 Ga0207678_100010859 564
249 3300026116 Ga0207674_10070173 Ga0207674_100701732 564
250 3300028800 Ga0265338_10000759 Ga0265338_1000075927 564
251 3300028800 Ga0265338_10021457 Ga0265338_100214576 564
252 3300031235 Ga0265330_10000495 Ga0265330_1000049519 564
253 3300031241 Ga0265325_10000217 Ga0265325_1000021710 564
254 3300031249 Ga0265339_10005819 Ga0265339_100058196 564
255 3300031249 Ga0265339_10008925 Ga0265339_100089253 564
256 3300031344 Ga0265316_10000390 Ga0265316_100003902 564
257 3300031344 Ga0265316_10029989 Ga0265316_100299892 564
258 3300031595 Ga0265313_10002475 Ga0265313_100024757 564
259 3300031712 Ga0265342_10001956 Ga0265342_1000195610 564
260 3300031712 Ga0265342_10037573 Ga0265342_100375733 564
261 3300031995 Ga0307409_100013197 Ga0307409_1000131973 564
262 3300035172 Ga0373955_0000430 Ga0373955_0000430_15603_17381 564
263 3300035725 Ga0373947_0055668 Ga0373947_0055668_433_2244 564
264 3300036401 Ga0373937_0000772 Ga0373937_0000772_21600_23378 564
265 3300037068 Ga0373925_0007680 Ga0373925_0007680_2701_4479 564
266 3300045976 Ga0466967_0001326 Ga0466967_0001326_11939_13759 564
267 3300046683 Ga0495658_0032708 Ga0495658_0032708_650_2428 564
268 3300048088 Ga0495602_0026743 Ga0495602_0026743_1316_3148 564
269 3300048905 Ga0496102_0005785 Ga0496102_0005785_5463_7271 564
270 3300048906 Ga0496103_0004124 Ga0496103_0004124_5900_7708 564
271 3300048907 Ga0496104_0031520 Ga0496104_0031520_2840_4672 564
272 3300048907 Ga0496104_0096075 Ga0496104_0096075_203_2011 564
273 3300048907 Ga0496104_0200606 Ga0496104_0200606_54_1862 564
274 3300048913 Ga0496110_0018500 Ga0496110_0018500_248_2029 564
275 3300048914 Ga0496111_0002956 Ga0496111_0002956_8422_10203 564
276 3300048915 Ga0496112_0003539 Ga0496112_0003539_9509_11341 564
277 3300005435 Ga0070714_100088522 Ga0070714_1000885221 565
278 3300006028 Ga0070717_10087238 Ga0070717_100872381 565
279 3300009093 Ga0105240_10026789 Ga0105240_100267892 565
280 3300013307 Ga0157372_10001201 Ga0157372_1000120119 565
281 3300003373 JGI25407J50210_10007439 JGI25407J50210_100074392 566
282 3300005338 Ga0068868_100038280 Ga0068868_1000382802 566
283 3300005981 Ga0081538_10000196 Ga0081538_1000019620 566
284 3300006871 Ga0075434_100013793 Ga0075434_1000137935 566
285 3300007076 Ga0075435_100000849 Ga0075435_10000084913 566
286 3300009094 Ga0111539_10084133 Ga0111539_100841331 566
287 3300009553 Ga0105249_10070577 Ga0105249_100705773 566
288 3300009553 Ga0105249_10073058 Ga0105249_100730583 566
289 3300010375 Ga0105239_10106275 Ga0105239_101062752 566
290 3300025942 Ga0207689_10034197 Ga0207689_100341975 566
291 3300025961 Ga0207712_10037752 Ga0207712_100377521 566
292 3300046492 Ga0495585_0034587 Ga0495585_0034587_574_2319 566
293 3300046515 Ga0495620_0010132 Ga0495620_0010132_1590_3335 566
294 3300046523 Ga0495644_0015793 Ga0495644_0015793_542_2287 566
295 3300046538 Ga0495609_0006375 Ga0495609_0006375_4028_5773 566
296 3300048913 Ga0496110_0000862 Ga0496110_0000862_547_2292 566
297 3300048914 Ga0496111_0021817 Ga0496111_0021817_1398_3143 566
298 3300049569 Ga0501032_0066449 Ga0501032_0066449_135_1865 566
299 3300049575 Ga0501039_0067587 Ga0501039_0067587_206_1936 566
300 3300049580 Ga0501046_0069001 Ga0501046_0069001_967_2697 566
301 3300049583 Ga0501067_0002232 Ga0501067_0002232_7459_9204 566
302 3300049585 Ga0501069_0003510 Ga0501069_0003510_829_2574 566
303 3300049588 Ga0501072_0059457 Ga0501072_0059457_1148_2878 566
304 3300049589 Ga0501073_0015703 Ga0501073_0015703_1457_3157 566
305 3300049593 Ga0501077_0013555 Ga0501077_0013555_1289_3019 566
306 3300050507 nmdc:mga05p37_1051_c1 nmdc:mga05p37_1051_c1_21476_23197 566
307 3300050507 nmdc:mga05p37_1788_c1 nmdc:mga05p37_1788_c1_19898_21598 566
308 3300050507 nmdc:mga05p37_84214_c1 nmdc:mga05p37_84214_c1_1808_3571 566
309 3300050508 nmdc:mga09592_28247_c1 nmdc:mga09592_28247_c1_926_2647 566
310 3300050509 nmdc:mga0qj67_2704_c1 nmdc:mga0qj67_2704_c1_900_2621 566
311 3300050511 nmdc:mga08y16_26215_c1 nmdc:mga08y16_26215_c1_1153_2898 566
312 3300050512 nmdc:mga0n895_145662_c1 nmdc:mga0n895_145662_c1_606_2306 566
313 3300050512 nmdc:mga0n895_3475_c1 nmdc:mga0n895_3475_c1_8690_10453 566
314 3300050513 nmdc:mga0rr50_3136_c1 nmdc:mga0rr50_3136_c1_4337_6100 566
315 3300050513 nmdc:mga0rr50_73200_c1 nmdc:mga0rr50_73200_c1_104_1804 566
316 3300050514 nmdc:mga08x19_3059_c1 nmdc:mga08x19_3059_c1_2510_4273 566
317 3300050515 nmdc:mga0a205_10374_c1 nmdc:mga0a205_10374_c1_4640_6340 566
318 3300054114 Ga0501084_0003965 Ga0501084_0003965_1116_2846 566
319 3300060353 Ga0501082_0050102 Ga0501082_0050102_108_1838 566
320 3300061734 Ga0530510_0001350 Ga0530510_0001350_5178_6908 566
321 3300014968 Ga0157379_10058186 Ga0157379_100581864 567
322 3300025926 Ga0207659_10000181 Ga0207659_1000018139 567
323 3300005435 Ga0070714_100000121 Ga0070714_10000012122 568
324 3300005535 Ga0070684_100024487 Ga0070684_1000244872 568
325 3300005841 Ga0068863_100013736 Ga0068863_1000137363 568
326 3300014325 Ga0163163_10142638 Ga0163163_101426382 568
327 3300025929 Ga0207664_10000112 Ga0207664_1000011220 568
328 3300026088 Ga0207641_10042648 Ga0207641_100426482 568
329 3300026116 Ga0207674_10051442 Ga0207674_100514422 568
330 3300036401 Ga0373937_0129814 Ga0373937_0129814_160_1986 568
331 3300037471 Ga0395905_0011711 Ga0395905_0011711_1985_3802 568
332 3300046539 Ga0495621_0006888 Ga0495621_0006888_160_1890 568
333 3300048912 Ga0496109_0105099 Ga0496109_0105099_555_2381 568
334 3300048915 Ga0496112_0014512 Ga0496112_0014512_153_1979 568
335 3300005338 Ga0068868_100115444 Ga0068868_1001154442 569
336 3300013296 Ga0157374_10149399 Ga0157374_101493992 569
337 3300014325 Ga0163163_10134079 Ga0163163_101340792 569
338 3300049571 Ga0501034_0035712 Ga0501034_0035712_1054_2817 569
339 3300049581 Ga0501047_0009879 Ga0501047_0009879_5625_7388 569
340 3300049823 Ga0501044_0006636 Ga0501044_0006636_10139_11902 569
341 3300005336 Ga0070680_100024098 Ga0070680_1000240983 570
342 3300005530 Ga0070679_100006733 Ga0070679_1000067332 570
343 3300005530 Ga0070679_100106427 Ga0070679_1001064272 570
344 3300005578 Ga0068854_100057364 Ga0068854_1000573642 570
345 3300025912 Ga0207707_10103251 Ga0207707_101032512 570
346 3300035410 Ga0373924_0003014 Ga0373924_0003014_3773_5557 570
347 3300044842 Ga0466957_0001064 Ga0466957_0001064_8035_9819 570
348 3300045976 Ga0466967_0003357 Ga0466967_0003357_528_2312 570
349 3300046531 Ga0495665_0041908 Ga0495665_0041908_265_2049 570
350 3300046675 Ga0495657_0054595 Ga0495657_0054595_130_1914 570
351 3300047315 Ga0495581_0014727 Ga0495581_0014727_756_2540 570
352 3300048913 Ga0496110_0085458 Ga0496110_0085458_825_2609 570
353 3300048915 Ga0496112_0027695 Ga0496112_0027695_724_2508 570
354 3300048915 Ga0496112_0084871 Ga0496112_0084871_624_2408 570
355 3300005354 Ga0070675_100000005 Ga0070675_10000000591 571
356 3300005439 Ga0070711_100010586 Ga0070711_1000105863 571
357 3300005441 Ga0070700_100000096 Ga0070700_10000009626 571
358 3300005578 Ga0068854_100010352 Ga0068854_1000103522 571
359 3300006173 Ga0070716_100000096 Ga0070716_10000009611 571
360 3300006175 Ga0070712_100002426 Ga0070712_1000024266 571
361 3300006852 Ga0075433_10003220 Ga0075433_100032203 571
362 3300025915 Ga0207693_10006471 Ga0207693_100064714 571
363 3300025919 Ga0207657_10002770 Ga0207657_100027707 571
364 3300025926 Ga0207659_10000019 Ga0207659_10000019119 571
365 3300025928 Ga0207700_10084705 Ga0207700_100847052 571
366 3300025939 Ga0207665_10000667 Ga0207665_1000066711 571
367 3300026075 Ga0207708_10000034 Ga0207708_1000003480 571
368 3300005334 Ga0068869_100039553 Ga0068869_1000395533 572
369 3300005347 Ga0070668_100137236 Ga0070668_1001372362 572
370 3300005535 Ga0070684_100050642 Ga0070684_1000506422 572
371 3300005577 Ga0068857_100016925 Ga0068857_1000169253 572
372 3300005981 Ga0081538_10001685 Ga0081538_1000168521 572
373 3300005981 Ga0081538_10007985 Ga0081538_100079853 572
374 3300006844 Ga0075428_100177406 Ga0075428_1001774062 572
375 3300006846 Ga0075430_100064572 Ga0075430_1000645722 572
376 3300006880 Ga0075429_100009133 Ga0075429_1000091337 572
377 3300009094 Ga0111539_10000795 Ga0111539_100007959 572
378 3300010375 Ga0105239_10098682 Ga0105239_100986823 572
379 3300025909 Ga0207705_10080002 Ga0207705_100800021 572
380 3300025927 Ga0207687_10007174 Ga0207687_100071745 572
381 3300025944 Ga0207661_10063054 Ga0207661_100630542 572
382 3300026075 Ga0207708_10000401 Ga0207708_1000040114 572
383 3300026089 Ga0207648_10011357 Ga0207648_100113572 572
384 3300026095 Ga0207676_10048758 Ga0207676_100487582 572
385 3300026116 Ga0207674_10020151 Ga0207674_100201515 572
386 3300031824 Ga0307413_10003211 Ga0307413_100032117 572
387 3300031911 Ga0307412_10005543 Ga0307412_100055437 572
388 3300031995 Ga0307409_100031021 Ga0307409_1000310213 572
389 3300032126 Ga0307415_100002658 Ga0307415_1000026588 572
390 3300049570 Ga0501033_0001466 Ga0501033_0001466_11811_13550 572
391 3300049571 Ga0501034_0021241 Ga0501034_0021241_3854_5593 572
392 3300049571 Ga0501034_0030656 Ga0501034_0030656_248_1987 572
393 3300049572 Ga0501036_0002139 Ga0501036_0002139_8979_10718 572
394 3300049572 Ga0501036_0008849 Ga0501036_0008849_1631_3370 572
395 3300049573 Ga0501037_0000070 Ga0501037_0000070_22151_23890 572
396 3300049573 Ga0501037_0004528 Ga0501037_0004528_2554_4293 572
397 3300049574 Ga0501038_0000082 Ga0501038_0000082_54109_55848 572
398 3300049575 Ga0501039_0000077 Ga0501039_0000077_27570_29309 572
399 3300049575 Ga0501039_0004672 Ga0501039_0004672_5681_7420 572
400 3300049575 Ga0501039_0061470 Ga0501039_0061470_111_1850 572
401 3300049576 Ga0501040_0000048 Ga0501040_0000048_27793_29532 572
402 3300049576 Ga0501040_0000330 Ga0501040_0000330_24170_25909 572
403 3300049577 Ga0501041_0000007 Ga0501041_0000007_17473_19212 572
404 3300049577 Ga0501041_0003269 Ga0501041_0003269_1281_3020 572
405 3300049578 Ga0501042_0000011 Ga0501042_0000011_53994_55733 572
406 3300049578 Ga0501042_0001198 Ga0501042_0001198_3027_4766 572
407 3300049579 Ga0501043_0000208 Ga0501043_0000208_46017_47756 572
408 3300049580 Ga0501046_0000089 Ga0501046_0000089_54049_55788 572
409 3300049581 Ga0501047_0000237 Ga0501047_0000237_33044_34783 572
410 3300049582 Ga0501048_0037208 Ga0501048_0037208_373_2112 572
411 3300049584 Ga0501068_0000856 Ga0501068_0000856_11693_13432 572
412 3300049585 Ga0501069_0000139 Ga0501069_0000139_15319_17058 572
413 3300049586 Ga0501070_0000234 Ga0501070_0000234_46598_48337 572
414 3300049587 Ga0501071_0068948 Ga0501071_0068948_455_2203 572
415 3300049588 Ga0501072_0001511 Ga0501072_0001511_15595_17334 572
416 3300049588 Ga0501072_0001977 Ga0501072_0001977_5071_6810 572
417 3300049589 Ga0501073_0001338 Ga0501073_0001338_14788_16527 572
418 3300049590 Ga0501074_0000002 Ga0501074_0000002_55906_57645 572
419 3300049591 Ga0501075_0000782 Ga0501075_0000782_15723_17462 572
420 3300049592 Ga0501076_0000167 Ga0501076_0000167_36348_38087 572
421 3300049592 Ga0501076_0000246 Ga0501076_0000246_7662_9401 572
422 3300049593 Ga0501077_0000090 Ga0501077_0000090_17398_19137 572
423 3300049593 Ga0501077_0001464 Ga0501077_0001464_5469_7208 572
424 3300049742 Ga0501080_0001053 Ga0501080_0001053_9294_11033 572
425 3300049742 Ga0501080_0022833 Ga0501080_0022833_789_2528 572
426 3300049743 Ga0501081_0000112 Ga0501081_0000112_27642_29381 572
427 3300049743 Ga0501081_0000598 Ga0501081_0000598_17473_19212 572
428 3300049743 Ga0501081_0023338 Ga0501081_0023338_1139_2878 572
429 3300049744 Ga0501083_0033740 Ga0501083_0033740_487_2226 572
430 3300049822 Ga0501035_0006035 Ga0501035_0006035_5071_6810 572
431 3300049822 Ga0501035_0065057 Ga0501035_0065057_1402_3141 572
432 3300049823 Ga0501044_0004943 Ga0501044_0004943_3888_5627 572
433 3300049824 Ga0501045_0008702 Ga0501045_0008702_4060_5799 572
434 3300049824 Ga0501045_0046589 Ga0501045_0046589_121_1860 572
435 3300054114 Ga0501084_0000332 Ga0501084_0000332_23080_24819 572
436 3300054114 Ga0501084_0021307 Ga0501084_0021307_2319_4058 572
437 3300060353 Ga0501082_0000241 Ga0501082_0000241_44757_46496 572
438 3300060353 Ga0501082_0000888 Ga0501082_0000888_21652_23391 572
439 3300005328 Ga0070676_10004973 Ga0070676_100049733 573
440 3300005354 Ga0070675_100029792 Ga0070675_1000297922 573
441 3300005434 Ga0070709_10000505 Ga0070709_1000050514 573
442 3300005436 Ga0070713_100000210 Ga0070713_10000021022 573
443 3300005563 Ga0068855_100036142 Ga0068855_1000361422 573
444 3300005618 Ga0068864_100062589 Ga0068864_1000625892 573
445 3300005718 Ga0068866_10001978 Ga0068866_100019782 573
446 3300005842 Ga0068858_100198842 Ga0068858_1001988421 573
447 3300009177 Ga0105248_10134533 Ga0105248_101345331 573
448 3300013306 Ga0163162_10040828 Ga0163162_100408282 573
449 3300014325 Ga0163163_10057806 Ga0163163_100578062 573
450 3300014969 Ga0157376_10029110 Ga0157376_100291102 573
451 3300025900 Ga0207710_10009553 Ga0207710_100095533 573
452 3300025904 Ga0207647_10008070 Ga0207647_100080701 573
453 3300025907 Ga0207645_10022633 Ga0207645_100226332 573
454 3300025915 Ga0207693_10000654 Ga0207693_100006545 573
455 3300025919 Ga0207657_10009971 Ga0207657_100099718 573
456 3300025923 Ga0207681_10027170 Ga0207681_100271701 573
457 3300025925 Ga0207650_10007585 Ga0207650_100075856 573
458 3300025928 Ga0207700_10000431 Ga0207700_1000043122 573
459 3300025931 Ga0207644_10029068 Ga0207644_100290682 573
460 3300025933 Ga0207706_10004765 Ga0207706_100047656 573
461 3300025936 Ga0207670_10019535 Ga0207670_100195354 573
462 3300025939 Ga0207665_10026019 Ga0207665_100260192 573
463 3300025941 Ga0207711_10008275 Ga0207711_100082756 573
464 3300025942 Ga0207689_10001019 Ga0207689_100010197 573
465 3300025944 Ga0207661_10000720 Ga0207661_1000072019 573
466 3300025945 Ga0207679_10002719 Ga0207679_100027196 573
467 3300025960 Ga0207651_10003433 Ga0207651_100034333 573
468 3300026035 Ga0207703_10161138 Ga0207703_101611381 573
469 3300026067 Ga0207678_10008829 Ga0207678_100088297 573
470 3300026088 Ga0207641_10000030 Ga0207641_10000030192 573
471 3300026089 Ga0207648_10009848 Ga0207648_100098488 573
472 3300026095 Ga0207676_10000256 Ga0207676_100002567 573
473 3300026095 Ga0207676_10074449 Ga0207676_100744492 573
474 3300026118 Ga0207675_100102638 Ga0207675_1001026382 573
475 3300026121 Ga0207683_10005395 Ga0207683_100053951 573
476 3300028379 Ga0268266_10013040 Ga0268266_100130401 573
477 3300028380 Ga0268265_10015661 Ga0268265_100156614 573
478 3300031852 Ga0307410_10000548 Ga0307410_1000054815 573
479 3300031903 Ga0307407_10056938 Ga0307407_100569382 573
480 3300031995 Ga0307409_100002046 Ga0307409_1000020464 573
481 3300032002 Ga0307416_100002239 Ga0307416_1000022395 573
482 3300032002 Ga0307416_100014062 Ga0307416_1000140622 573
483 3300036401 Ga0373937_0028217 Ga0373937_0028217_2508_4235 573
484 3300000546 LJNas_1001039 LJNas_10010394 574
485 3300005355 Ga0070671_100070784 Ga0070671_1000707842 574
486 3300005434 Ga0070709_10009195 Ga0070709_100091953 574
487 3300005436 Ga0070713_100000302 Ga0070713_1000003028 574
488 3300005436 Ga0070713_100099016 Ga0070713_1000990162 574
489 3300005445 Ga0070708_100003506 Ga0070708_1000035069 574
490 3300005445 Ga0070708_100080156 Ga0070708_1000801561 574
491 3300005467 Ga0070706_100000734 Ga0070706_10000073438 574
492 3300005467 Ga0070706_100002721 Ga0070706_10000272110 574
493 3300005468 Ga0070707_100000360 Ga0070707_10000036029 574
494 3300005468 Ga0070707_100018911 Ga0070707_1000189115 574
495 3300005471 Ga0070698_100001323 Ga0070698_10000132322 574
496 3300005471 Ga0070698_100006846 Ga0070698_1000068462 574
497 3300005518 Ga0070699_100001400 Ga0070699_1000014009 574
498 3300005536 Ga0070697_100002341 Ga0070697_1000023418 574
499 3300005536 Ga0070697_100011698 Ga0070697_1000116984 574
500 3300005548 Ga0070665_100007648 Ga0070665_1000076482 574
501 3300005614 Ga0068856_100002308 Ga0068856_1000023082 574
502 3300006028 Ga0070717_10007920 Ga0070717_100079204 574
503 3300006163 Ga0070715_10000755 Ga0070715_100007554 574
504 3300009093 Ga0105240_10026610 Ga0105240_100266101 574
505 3300013105 Ga0157369_10012364 Ga0157369_100123645 574
506 3300013296 Ga0157374_10010818 Ga0157374_100108184 574
507 3300013307 Ga0157372_10072100 Ga0157372_100721002 574
508 3300014325 Ga0163163_10053245 Ga0163163_100532452 574
509 3300015262 Ga0182007_10004753 Ga0182007_100047534 574
510 3300024225 Ga0224572_1000089 Ga0224572_10000897 574
511 3300024227 Ga0228598_1000974 Ga0228598_10009746 574
512 3300025904 Ga0207647_10008884 Ga0207647_100088843 574
513 3300025906 Ga0207699_10076640 Ga0207699_100766401 574
514 3300025910 Ga0207684_10000389 Ga0207684_1000038911 574
515 3300025912 Ga0207707_10015417 Ga0207707_100154175 574
516 3300025912 Ga0207707_10032207 Ga0207707_100322072 574
517 3300025913 Ga0207695_10123165 Ga0207695_101231651 574
518 3300025915 Ga0207693_10000053 Ga0207693_1000005369 574
519 3300025922 Ga0207646_10001860 Ga0207646_1000186021 574
520 3300025922 Ga0207646_10026366 Ga0207646_100263663 574
521 3300025928 Ga0207700_10011703 Ga0207700_100117033 574
522 3300025929 Ga0207664_10002385 Ga0207664_100023853 574
523 3300025931 Ga0207644_10072477 Ga0207644_100724772 574
524 3300025939 Ga0207665_10006792 Ga0207665_100067923 574
525 3300025939 Ga0207665_10028783 Ga0207665_100287832 574
526 3300026078 Ga0207702_10000536 Ga0207702_100005365 574
527 3300042876 Ga0451577_0000294 Ga0451577_0000294_69574_71502 574
528 3300044712 Ga0453684_0000104 Ga0453684_0000104_170010_171938 574
529 3300045051 Ga0451576_0028875 Ga0451576_0028875_520_2448 574
530 3300046472 Ga0495580_0021801 Ga0495580_0021801_1968_3908 574
531 3300048904 Ga0496101_0056460 Ga0496101_0056460_841_2679 574
532 3300048907 Ga0496104_0030065 Ga0496104_0030065_2938_4776 574
533 3300048908 Ga0496105_0007966 Ga0496105_0007966_870_2708 574
534 3300048915 Ga0496112_0014861 Ga0496112_0014861_1266_3047 574
535 3300048916 Ga0496113_0064984 Ga0496113_0064984_607_2445 574
536 3300048929 Ga0496126_0074144 Ga0496126_0074144_787_2625 574
537 3300050514 nmdc:mga08x19_9570_c1 nmdc:mga08x19_9570_c1_1664_3481 574
538 3300006237 Ga0097621_100000431 Ga0097621_10000043117 575
539 3300006852 Ga0075433_10001602 Ga0075433_100016028 575
540 3300006871 Ga0075434_100000782 Ga0075434_10000078218 575
541 3300006914 Ga0075436_100034899 Ga0075436_1000348992 575
542 3300007076 Ga0075435_100001140 Ga0075435_1000011408 575
543 3300009098 Ga0105245_10001223 Ga0105245_1000122318 575
544 3300009147 Ga0114129_10104089 Ga0114129_101040892 575
545 3300009177 Ga0105248_10042619 Ga0105248_100426191 575
546 3300013297 Ga0157378_10001618 Ga0157378_1000161811 575
547 3300021441 Ga0213871_10000271 Ga0213871_100002713 575
548 3300028381 Ga0268264_10087216 Ga0268264_100872162 575
549 3300031249 Ga0265339_10000023 Ga0265339_1000002370 575
550 3300031344 Ga0265316_10023297 Ga0265316_100232972 575
551 3300031344 Ga0265316_10070533 Ga0265316_100705332 575
552 3300031712 Ga0265342_10001352 Ga0265342_100013523 575
553 3300037068 Ga0373925_0009291 Ga0373925_0009291_3457_5307 575
554 3300045049 Ga0466959_0018815 Ga0466959_0018815_1612_3465 575
555 3300046664 Ga0495659_0003052 Ga0495659_0003052_3114_4979 575
556 3300049578 Ga0501042_0066931 Ga0501042_0066931_463_2214 575
557 3300005329 Ga0070683_100000055 Ga0070683_10000005533 576
558 3300005329 Ga0070683_100093324 Ga0070683_1000933241 576
559 3300005331 Ga0070670_100000582 Ga0070670_10000058221 576
560 3300005334 Ga0068869_100000592 Ga0068869_1000005923 576
561 3300005338 Ga0068868_100001452 Ga0068868_1000014527 576
562 3300005339 Ga0070660_100000311 Ga0070660_10000031117 576
563 3300005344 Ga0070661_100005335 Ga0070661_1000053355 576
564 3300005344 Ga0070661_100015415 Ga0070661_1000154153 576
565 3300005355 Ga0070671_100013999 Ga0070671_1000139995 576
566 3300005367 Ga0070667_100000566 Ga0070667_10000056624 576
567 3300005445 Ga0070708_100030512 Ga0070708_1000305125 576
568 3300005458 Ga0070681_10000804 Ga0070681_1000080417 576
569 3300005458 Ga0070681_10002950 Ga0070681_1000295012 576
570 3300005458 Ga0070681_10057062 Ga0070681_100570622 576
571 3300005530 Ga0070679_100000226 Ga0070679_1000002269 576
572 3300005535 Ga0070684_100000153 Ga0070684_10000015319 576
573 3300005535 Ga0070684_100081193 Ga0070684_1000811931 576
574 3300005539 Ga0068853_100009193 Ga0068853_1000091936 576
575 3300005539 Ga0068853_100046671 Ga0068853_1000466713 576
576 3300005548 Ga0070665_100116575 Ga0070665_1001165752 576
577 3300005563 Ga0068855_100000842 Ga0068855_1000008422 576
578 3300005563 Ga0068855_100000949 Ga0068855_1000009495 576
579 3300005563 Ga0068855_100003849 Ga0068855_1000038497 576
580 3300005563 Ga0068855_100009479 Ga0068855_1000094799 576
581 3300005563 Ga0068855_100090519 Ga0068855_1000905192 576
582 3300005577 Ga0068857_100020037 Ga0068857_1000200372 576
583 3300005578 Ga0068854_100002592 Ga0068854_1000025926 576
584 3300005614 Ga0068856_100000437 Ga0068856_10000043713 576
585 3300005614 Ga0068856_100001503 Ga0068856_10000150313 576
586 3300005614 Ga0068856_100101826 Ga0068856_1001018262 576
587 3300005614 Ga0068856_100136446 Ga0068856_1001364462 576
588 3300005616 Ga0068852_100000054 Ga0068852_10000005458 576
589 3300005616 Ga0068852_100000870 Ga0068852_10000087011 576
590 3300005616 Ga0068852_100003707 Ga0068852_1000037076 576
591 3300005616 Ga0068852_100013502 Ga0068852_1000135027 576
592 3300005616 Ga0068852_100086018 Ga0068852_1000860183 576
593 3300005617 Ga0068859_100006498 Ga0068859_1000064984 576
594 3300005617 Ga0068859_100099257 Ga0068859_1000992572 576
595 3300005618 Ga0068864_100000397 Ga0068864_10000039723 576
596 3300005718 Ga0068866_10034609 Ga0068866_100346092 576
597 3300005834 Ga0068851_10008726 Ga0068851_100087261 576
598 3300005834 Ga0068851_10051835 Ga0068851_100518351 576
599 3300005841 Ga0068863_100000502 Ga0068863_10000050221 576
600 3300005842 Ga0068858_100003082 Ga0068858_10000308210 576
601 3300005842 Ga0068858_100097264 Ga0068858_1000972642 576
602 3300005843 Ga0068860_100000031 Ga0068860_100000031171 576
603 3300005981 Ga0081538_10000778 Ga0081538_1000077824 576
604 3300005981 Ga0081538_10001466 Ga0081538_1000146617 576
605 3300006028 Ga0070717_10018717 Ga0070717_100187173 576
606 3300006028 Ga0070717_10043179 Ga0070717_100431794 576
607 3300006028 Ga0070717_10089764 Ga0070717_100897641 576
608 3300006173 Ga0070716_100005734 Ga0070716_1000057342 576
609 3300006175 Ga0070712_100000529 Ga0070712_10000052919 576
610 3300006237 Ga0097621_100000472 Ga0097621_10000047215 576
611 3300006237 Ga0097621_100000648 Ga0097621_10000064817 576
612 3300006358 Ga0068871_100000084 Ga0068871_10000008436 576
613 3300006358 Ga0068871_100003471 Ga0068871_1000034715 576
614 3300006914 Ga0075436_100018159 Ga0075436_1000181593 576
615 3300006931 Ga0097620_100006498 Ga0097620_1000064984 576
616 3300006931 Ga0097620_100099258 Ga0097620_1000992582 576
617 3300009093 Ga0105240_10000116 Ga0105240_1000011658 576
618 3300009093 Ga0105240_10000171 Ga0105240_1000017154 576
619 3300009093 Ga0105240_10002552 Ga0105240_1000255210 576
620 3300009093 Ga0105240_10041785 Ga0105240_100417852 576
621 3300009098 Ga0105245_10003105 Ga0105245_1000310514 576
622 3300009098 Ga0105245_10007294 Ga0105245_100072942 576
623 3300009174 Ga0105241_10000061 Ga0105241_1000006134 576
624 3300009174 Ga0105241_10001359 Ga0105241_1000135914 576
625 3300009174 Ga0105241_10001688 Ga0105241_100016889 576
626 3300009174 Ga0105241_10002385 Ga0105241_100023853 576
627 3300009174 Ga0105241_10100604 Ga0105241_101006042 576
628 3300009177 Ga0105248_10000019 Ga0105248_10000019181 576
629 3300009177 Ga0105248_10008242 Ga0105248_100082426 576
630 3300009177 Ga0105248_10010198 Ga0105248_100101982 576
631 3300009545 Ga0105237_10005201 Ga0105237_1000520110 576
632 3300009545 Ga0105237_10020862 Ga0105237_100208622 576
633 3300009545 Ga0105237_10050632 Ga0105237_100506322 576
634 3300009551 Ga0105238_10000024 Ga0105238_1000002498 576
635 3300009551 Ga0105238_10006095 Ga0105238_100060952 576
636 3300009551 Ga0105238_10015185 Ga0105238_100151852 576
637 3300009553 Ga0105249_10051111 Ga0105249_100511112 576
638 3300010375 Ga0105239_10003830 Ga0105239_1000383015 576
639 3300010375 Ga0105239_10006367 Ga0105239_100063672 576
640 3300010375 Ga0105239_10006871 Ga0105239_100068714 576
641 3300010375 Ga0105239_10099901 Ga0105239_100999012 576
642 3300011119 Ga0105246_10000642 Ga0105246_1000064210 576
643 3300013102 Ga0157371_10014575 Ga0157371_100145752 576
644 3300013104 Ga0157370_10000019 Ga0157370_1000001991 576
645 3300013104 Ga0157370_10009377 Ga0157370_100093779 576
646 3300013105 Ga0157369_10000081 Ga0157369_1000008160 576
647 3300013105 Ga0157369_10017220 Ga0157369_1001722010 576
648 3300013105 Ga0157369_10021569 Ga0157369_100215695 576
649 3300013105 Ga0157369_10043373 Ga0157369_100433734 576
650 3300013105 Ga0157369_10056365 Ga0157369_100563652 576
651 3300013296 Ga0157374_10005962 Ga0157374_100059623 576
652 3300013296 Ga0157374_10033830 Ga0157374_100338304 576
653 3300013296 Ga0157374_10139086 Ga0157374_101390862 576
654 3300013297 Ga0157378_10003566 Ga0157378_100035666 576
655 3300013297 Ga0157378_10028167 Ga0157378_100281672 576
656 3300013297 Ga0157378_10041269 Ga0157378_100412692 576
657 3300013306 Ga0163162_10012329 Ga0163162_100123292 576
658 3300013307 Ga0157372_10000058 Ga0157372_1000005848 576
659 3300013307 Ga0157372_10004045 Ga0157372_1000404512 576
660 3300013307 Ga0157372_10008156 Ga0157372_100081562 576
661 3300013307 Ga0157372_10023953 Ga0157372_100239534 576
662 3300013307 Ga0157372_10042443 Ga0157372_100424433 576
663 3300013307 Ga0157372_10125903 Ga0157372_101259032 576
664 3300013308 Ga0157375_10002599 Ga0157375_100025994 576
665 3300014968 Ga0157379_10001817 Ga0157379_1000181712 576
666 3300014969 Ga0157376_10003548 Ga0157376_100035489 576
667 3300025898 Ga0207692_10003571 Ga0207692_100035712 576
668 3300025900 Ga0207710_10000465 Ga0207710_1000046516 576
669 3300025906 Ga0207699_10029501 Ga0207699_100295012 576
670 3300025907 Ga0207645_10011955 Ga0207645_100119554 576
671 3300025909 Ga0207705_10010342 Ga0207705_100103423 576
672 3300025909 Ga0207705_10117065 Ga0207705_101170651 576
673 3300025911 Ga0207654_10000024 Ga0207654_1000002430 576
674 3300025911 Ga0207654_10000516 Ga0207654_1000051610 576
675 3300025911 Ga0207654_10001092 Ga0207654_100010928 576
676 3300025911 Ga0207654_10023388 Ga0207654_100233882 576
677 3300025912 Ga0207707_10001372 Ga0207707_1000137211 576
678 3300025912 Ga0207707_10026085 Ga0207707_100260856 576
679 3300025912 Ga0207707_10116996 Ga0207707_101169961 576
680 3300025913 Ga0207695_10000075 Ga0207695_1000007586 576
681 3300025913 Ga0207695_10000115 Ga0207695_10000115110 576
682 3300025913 Ga0207695_10000466 Ga0207695_1000046634 576
683 3300025913 Ga0207695_10001570 Ga0207695_1000157026 576
684 3300025913 Ga0207695_10003351 Ga0207695_1000335113 576
685 3300025913 Ga0207695_10029663 Ga0207695_100296633 576
686 3300025913 Ga0207695_10068165 Ga0207695_100681653 576
687 3300025913 Ga0207695_10096770 Ga0207695_100967702 576
688 3300025914 Ga0207671_10000032 Ga0207671_10000032123 576
689 3300025914 Ga0207671_10003465 Ga0207671_100034658 576
690 3300025914 Ga0207671_10027957 Ga0207671_100279572 576
691 3300025915 Ga0207693_10000187 Ga0207693_100001878 576
692 3300025916 Ga0207663_10001021 Ga0207663_100010214 576
693 3300025919 Ga0207657_10001924 Ga0207657_100019247 576
694 3300025921 Ga0207652_10003228 Ga0207652_100032289 576
695 3300025924 Ga0207694_10000024 Ga0207694_10000024154 576
696 3300025924 Ga0207694_10001795 Ga0207694_1000179510 576
697 3300025924 Ga0207694_10002260 Ga0207694_1000226012 576
698 3300025924 Ga0207694_10004595 Ga0207694_100045958 576
699 3300025924 Ga0207694_10093687 Ga0207694_100936871 576
700 3300025925 Ga0207650_10002318 Ga0207650_100023185 576
701 3300025927 Ga0207687_10015279 Ga0207687_100152792 576
702 3300025927 Ga0207687_10030755 Ga0207687_100307552 576
703 3300025927 Ga0207687_10087690 Ga0207687_100876902 576
704 3300025928 Ga0207700_10024720 Ga0207700_100247203 576
705 3300025928 Ga0207700_10039215 Ga0207700_100392153 576
706 3300025931 Ga0207644_10008766 Ga0207644_100087664 576
707 3300025933 Ga0207706_10000504 Ga0207706_1000050434 576
708 3300025933 Ga0207706_10009892 Ga0207706_100098924 576
709 3300025939 Ga0207665_10004411 Ga0207665_100044112 576
710 3300025940 Ga0207691_10007244 Ga0207691_100072445 576
711 3300025941 Ga0207711_10000397 Ga0207711_100003977 576
712 3300025941 Ga0207711_10031216 Ga0207711_100312162 576
713 3300025941 Ga0207711_10089637 Ga0207711_100896372 576
714 3300025942 Ga0207689_10002617 Ga0207689_1000261714 576
715 3300025944 Ga0207661_10000058 Ga0207661_1000005859 576
716 3300025945 Ga0207679_10001223 Ga0207679_1000122316 576
717 3300025949 Ga0207667_10000188 Ga0207667_1000018830 576
718 3300025949 Ga0207667_10000475 Ga0207667_1000047518 576
719 3300025949 Ga0207667_10001332 Ga0207667_100013324 576
720 3300025949 Ga0207667_10003699 Ga0207667_1000369910 576
721 3300025986 Ga0207658_10000041 Ga0207658_1000004142 576
722 3300025986 Ga0207658_10010154 Ga0207658_100101543 576
723 3300026023 Ga0207677_10000099 Ga0207677_1000009946 576
724 3300026035 Ga0207703_10000432 Ga0207703_1000043224 576
725 3300026041 Ga0207639_10000753 Ga0207639_1000075313 576
726 3300026041 Ga0207639_10013041 Ga0207639_100130412 576
727 3300026041 Ga0207639_10051911 Ga0207639_100519112 576
728 3300026041 Ga0207639_10098426 Ga0207639_100984261 576
729 3300026078 Ga0207702_10000457 Ga0207702_1000045716 576
730 3300026078 Ga0207702_10009621 Ga0207702_100096212 576
731 3300026078 Ga0207702_10014432 Ga0207702_100144322 576
732 3300026078 Ga0207702_10016867 Ga0207702_100168676 576
733 3300026088 Ga0207641_10000223 Ga0207641_1000022310 576
734 3300026095 Ga0207676_10001520 Ga0207676_1000152010 576
735 3300026116 Ga0207674_10001042 Ga0207674_1000104224 576
736 3300026116 Ga0207674_10001306 Ga0207674_1000130615 576
737 3300026116 Ga0207674_10032217 Ga0207674_100322171 576
738 3300026121 Ga0207683_10001542 Ga0207683_100015425 576
739 3300026142 Ga0207698_10000011 Ga0207698_10000011120 576
740 3300026142 Ga0207698_10001094 Ga0207698_100010946 576
741 3300026142 Ga0207698_10011250 Ga0207698_100112504 576
742 3300028379 Ga0268266_10084031 Ga0268266_100840312 576
743 3300028381 Ga0268264_10000240 Ga0268264_1000024073 576
744 3300028577 Ga0265318_10004034 Ga0265318_100040344 576
745 3300028666 Ga0265336_10000952 Ga0265336_100009529 576
746 3300028666 Ga0265336_10009982 Ga0265336_100099821 576
747 3300028800 Ga0265338_10004331 Ga0265338_1000433114 576
748 3300028800 Ga0265338_10017201 Ga0265338_100172013 576
749 3300031235 Ga0265330_10000216 Ga0265330_100002166 576
750 3300031235 Ga0265330_10006442 Ga0265330_100064425 576
751 3300031235 Ga0265330_10016996 Ga0265330_100169963 576
752 3300031239 Ga0265328_10001519 Ga0265328_100015196 576
753 3300031241 Ga0265325_10000249 Ga0265325_1000024921 576
754 3300031242 Ga0265329_10006526 Ga0265329_100065261 576
755 3300031247 Ga0265340_10000990 Ga0265340_100009906 576
756 3300031249 Ga0265339_10001829 Ga0265339_1000182912 576
757 3300031344 Ga0265316_10002993 Ga0265316_1000299313 576
758 3300031344 Ga0265316_10011773 Ga0265316_100117735 576
759 3300031344 Ga0265316_10041160 Ga0265316_100411602 576
760 3300031595 Ga0265313_10002347 Ga0265313_100023476 576
761 3300031711 Ga0265314_10000239 Ga0265314_1000023941 576
762 3300031711 Ga0265314_10014008 Ga0265314_100140084 576
763 3300031712 Ga0265342_10001442 Ga0265342_1000144214 576
764 3300031712 Ga0265342_10005484 Ga0265342_1000548411 576
765 3300037068 Ga0373925_0063287 Ga0373925_0063287_173_2068 576
766 3300037068 Ga0373925_0080608 Ga0373925_0080608_507_2360 576
767 3300044694 Ga0466963_0007935 Ga0466963_0007935_323_2197 576
768 3300045976 Ga0466967_0121565 Ga0466967_0121565_146_2020 576
769 3300046475 Ga0495639_0044778 Ga0495639_0044778_75_1904 576
770 3300046536 Ga0495587_0046695 Ga0495587_0046695_284_2164 576
771 3300046663 Ga0495635_0032266 Ga0495635_0032266_184_2064 576
772 3300046679 Ga0495623_0029630 Ga0495623_0029630_389_2269 576
773 3300048908 Ga0496105_0014515 Ga0496105_0014515_3142_5040 576
774 3300005334 Ga0068869_100000460 Ga0068869_1000004605 577
775 3300005617 Ga0068859_100048328 Ga0068859_1000483282 577
776 3300005842 Ga0068858_100003081 Ga0068858_1000030817 577
777 3300006931 Ga0097620_100048336 Ga0097620_1000483364 577
778 3300009545 Ga0105237_10095147 Ga0105237_100951473 577
779 3300013105 Ga0157369_10013248 Ga0157369_100132486 577
780 3300013296 Ga0157374_10014703 Ga0157374_100147033 577
781 3300014968 Ga0157379_10021417 Ga0157379_100214171 577
782 3300025913 Ga0207695_10027987 Ga0207695_100279873 577
783 3300026035 Ga0207703_10014240 Ga0207703_100142404 577
784 3300028381 Ga0268264_10032829 Ga0268264_100328292 577
785 3300035724 Ga0373933_0056789 Ga0373933_0056789_322_2223 577
786 3300044712 Ga0453684_0155408 Ga0453684_0155408_599_2347 577
787 3300005337 Ga0070682_100000014 Ga0070682_10000001436 578
788 3300005338 Ga0068868_100002673 Ga0068868_1000026737 578
789 3300005340 Ga0070689_100000488 Ga0070689_10000048816 578
790 3300005435 Ga0070714_100066949 Ga0070714_1000669491 578
791 3300005543 Ga0070672_100000082 Ga0070672_1000000829 578
792 3300005618 Ga0068864_100000097 Ga0068864_10000009752 578
793 3300005840 Ga0068870_10007784 Ga0068870_100077844 578
794 3300005842 Ga0068858_100000243 Ga0068858_10000024316 578
795 3300009098 Ga0105245_10003410 Ga0105245_100034106 578
796 3300013308 Ga0157375_10000001 Ga0157375_1000000159 578
797 3300025927 Ga0207687_10003664 Ga0207687_100036648 578
798 3300025936 Ga0207670_10001926 Ga0207670_1000192610 578
799 3300025940 Ga0207691_10001100 Ga0207691_100011009 578
800 3300026023 Ga0207677_10000035 Ga0207677_1000003557 578
801 3300026035 Ga0207703_10000046 Ga0207703_1000004688 578
802 3300026095 Ga0207676_10000013 Ga0207676_10000013275 578
803 3300005339 Ga0070660_100013186 Ga0070660_1000131863 579
804 3300005458 Ga0070681_10014599 Ga0070681_100145995 579
805 3300005530 Ga0070679_100045850 Ga0070679_1000458503 579
806 3300025912 Ga0207707_10029783 Ga0207707_100297833 579
807 3300025919 Ga0207657_10021487 Ga0207657_100214874 579
808 3300025921 Ga0207652_10062779 Ga0207652_100627792 579
809 3300036647 Ga0316582_0051099 Ga0316582_0051099_441_2189 579
810 3300031242 Ga0265329_10005123 Ga0265329_100051235 581
811 3300005335 Ga0070666_10015995 Ga0070666_100159954 582
812 3300005344 Ga0070661_100046721 Ga0070661_1000467213 582
813 3300005617 Ga0068859_100006100 Ga0068859_1000061007 582
814 3300005617 Ga0068859_100023095 Ga0068859_1000230955 582
815 3300005841 Ga0068863_100001036 Ga0068863_1000010366 582
816 3300005842 Ga0068858_100003641 Ga0068858_1000036412 582
817 3300005843 Ga0068860_100003297 Ga0068860_1000032974 582
818 3300005843 Ga0068860_100004066 Ga0068860_10000406612 582
819 3300006358 Ga0068871_100002089 Ga0068871_1000020898 582
820 3300006931 Ga0097620_100006100 Ga0097620_1000061004 582
821 3300006931 Ga0097620_100023098 Ga0097620_1000230985 582
822 3300009177 Ga0105248_10000260 Ga0105248_1000026010 582
823 3300013306 Ga0163162_10032999 Ga0163162_100329995 582
824 3300013308 Ga0157375_10000213 Ga0157375_100002139 582
825 3300014745 Ga0157377_10028546 Ga0157377_100285462 582
826 3300014968 Ga0157379_10000201 Ga0157379_1000020117 582
827 3300014969 Ga0157376_10018802 Ga0157376_100188023 582
828 3300025920 Ga0207649_10047217 Ga0207649_100472172 582
829 3300025940 Ga0207691_10007240 Ga0207691_100072402 582
830 3300025986 Ga0207658_10008554 Ga0207658_100085545 582
831 3300026088 Ga0207641_10002614 Ga0207641_1000261410 582
832 3300028381 Ga0268264_10001181 Ga0268264_1000118111 582
833 3300028381 Ga0268264_10010333 Ga0268264_100103332 582
834 3300006844 Ga0075428_100130455 Ga0075428_1001304552 585
835 3300009147 Ga0114129_10248071 Ga0114129_102480712 585
836 3300031235 Ga0265330_10006808 Ga0265330_100068083 585
837 3300031242 Ga0265329_10005902 Ga0265329_100059022 585
838 3300031247 Ga0265340_10035867 Ga0265340_100358672 585
839 3300044712 Ga0453684_0156897 Ga0453684_0156897_378_2147 585
840 3300050507 nmdc:mga05p37_321673_c1 nmdc:mga05p37_321673_c1_54_1820 585
841 3300006358 Ga0068871_100034049 Ga0068871_1000340492 586
842 3300025893 Ga0207682_10023447 Ga0207682_100234471 586
843 3300025940 Ga0207691_10103556 Ga0207691_101035562 586
844 3300032002 Ga0307416_100030511 Ga0307416_1000305112 586
845 3300006844 Ga0075428_100041305 Ga0075428_1000413054 587
846 3300014326 Ga0157380_10000592 Ga0157380_1000059211 587
847 3300031731 Ga0307405_10097846 Ga0307405_100978462 587
848 3300046689 Ga0495613_0076543 Ga0495613_0076543_376_2142 587
849 3300049575 Ga0501039_0019334 Ga0501039_0019334_814_2580 587
850 3300049577 Ga0501041_0024740 Ga0501041_0024740_548_2314 587
851 3300049582 Ga0501048_0047617 Ga0501048_0047617_345_2111 587
852 3300049588 Ga0501072_0013236 Ga0501072_0013236_1130_2896 587
853 3300049741 Ga0501079_0129424 Ga0501079_0129424_75_1841 587
854 3300049824 Ga0501045_0094387 Ga0501045_0094387_202_1968 587
855 3300005458 Ga0070681_10053278 Ga0070681_100532782 588
856 3300009545 Ga0105237_10028854 Ga0105237_100288541 588
857 3300026041 Ga0207639_10029778 Ga0207639_100297781 588
858 3300031235 Ga0265330_10004042 Ga0265330_100040425 588
859 3300031235 Ga0265330_10022103 Ga0265330_100221033 588
860 3300031238 Ga0265332_10013037 Ga0265332_100130371 588
861 3300031239 Ga0265328_10011587 Ga0265328_100115873 588
862 3300031240 Ga0265320_10031605 Ga0265320_100316051 588
863 3300031242 Ga0265329_10006092 Ga0265329_100060924 588
864 3300031250 Ga0265331_10000183 Ga0265331_1000018326 588
865 3300031344 Ga0265316_10000148 Ga0265316_1000014826 588
866 3300031711 Ga0265314_10000984 Ga0265314_1000098426 588
867 3300031712 Ga0265342_10007130 Ga0265342_100071302 588
868 3300044712 Ga0453684_0015233 Ga0453684_0015233_1424_3214 588
869 3300046460 Ga0495638_0061240 Ga0495638_0061240_136_1920 588
870 3300053096 Ga0500641_0000225 Ga0500641_0000225_9153_10928 588
871 3300053139 Ga0500568_0014356 Ga0500568_0014356_1622_3406 588
872 3300005331 Ga0070670_100008250 Ga0070670_1000082505 589
873 3300005455 Ga0070663_100005932 Ga0070663_1000059323 589
874 3300005564 Ga0070664_100015491 Ga0070664_1000154916 589
875 3300009551 Ga0105238_10009190 Ga0105238_100091909 589
876 3300014325 Ga0163163_10136796 Ga0163163_101367961 589
877 3300025924 Ga0207694_10034906 Ga0207694_100349063 589
878 3300025925 Ga0207650_10004995 Ga0207650_100049955 589
879 3300025960 Ga0207651_10074738 Ga0207651_100747382 589
880 3300026121 Ga0207683_10093318 Ga0207683_100933182 589
881 3300042876 Ga0451577_0000053 Ga0451577_0000053_173183_174979 589
882 3300042876 Ga0451577_0000658 Ga0451577_0000658_32874_34670 589
883 3300042876 Ga0451577_0001280 Ga0451577_0001280_24353_26149 589
884 3300044712 Ga0453684_0000103 Ga0453684_0000103_260078_261874 589
885 3300044712 Ga0453684_0000208 Ga0453684_0000208_31277_33073 589
886 3300044712 Ga0453684_0246806 Ga0453684_0246806_49_1845 589
887 3300045051 Ga0451576_0002362 Ga0451576_0002362_10688_12484 589
888 3300005293 Ga0065715_10132088 Ga0065715_101320881 590
889 3300005331 Ga0070670_100026609 Ga0070670_1000266092 590
890 3300005364 Ga0070673_100003191 Ga0070673_1000031917 590
891 3300005468 Ga0070707_100120088 Ga0070707_1001200882 590
892 3300005543 Ga0070672_100013365 Ga0070672_1000133654 590
893 3300005844 Ga0068862_100113094 Ga0068862_1001130942 590
894 3300006846 Ga0075430_100081873 Ga0075430_1000818732 590
895 3300006880 Ga0075429_100033476 Ga0075429_1000334764 590
896 3300009094 Ga0111539_10144018 Ga0111539_101440182 590
897 3300009147 Ga0114129_10008909 Ga0114129_1000890911 590
898 3300025940 Ga0207691_10009627 Ga0207691_100096277 590
899 3300026095 Ga0207676_10023229 Ga0207676_100232294 590
900 3300028380 Ga0268265_10106397 Ga0268265_101063972 590
901 3300031903 Ga0307407_10008476 Ga0307407_100084762 590
902 3300031995 Ga0307409_100055966 Ga0307409_1000559661 590
903 3300032002 Ga0307416_100000683 Ga0307416_1000006835 590
904 3300032002 Ga0307416_100012525 Ga0307416_1000125254 590
905 3300032005 Ga0307411_10005339 Ga0307411_100053393 590
906 3300032126 Ga0307415_100004748 Ga0307415_1000047487 590
907 3300032126 Ga0307415_100106050 Ga0307415_1001060502 590
908 3300046558 Ga0495633_0038924 Ga0495633_0038924_466_2244 590
909 3300050507 nmdc:mga05p37_51424_c1 nmdc:mga05p37_51424_c1_611_2386 590
910 3300050509 nmdc:mga0qj67_108404_c1 nmdc:mga0qj67_108404_c1_368_2143 590
911 3300050511 nmdc:mga08y16_524_c1 nmdc:mga08y16_524_c1_21845_23623 590
912 3300059424 Ga0590075_000898 Ga0590075_000898_855_2630 590
913 2162886007 SwRhRL2b_contig_604697 SwRhRL2b_0947.00001260 591
914 3300005289 Ga0065704_10072792 Ga0065704_100727927 591
915 3300005295 Ga0065707_10001510 Ga0065707_100015103 591
916 3300005331 Ga0070670_100009392 Ga0070670_1000093928 591
917 3300005336 Ga0070680_100168103 Ga0070680_1001681031 591
918 3300005340 Ga0070689_100023528 Ga0070689_1000235284 591
919 3300005340 Ga0070689_100072627 Ga0070689_1000726272 591
920 3300005354 Ga0070675_100006612 Ga0070675_1000066124 591
921 3300005354 Ga0070675_100033628 Ga0070675_1000336284 591
922 3300005354 Ga0070675_100043727 Ga0070675_1000437274 591
923 3300005355 Ga0070671_100088961 Ga0070671_1000889612 591
924 3300005355 Ga0070671_100115985 Ga0070671_1001159852 591
925 3300005364 Ga0070673_100043033 Ga0070673_1000430332 591
926 3300005364 Ga0070673_100084830 Ga0070673_1000848301 591
927 3300005365 Ga0070688_100040711 Ga0070688_1000407112 591
928 3300005458 Ga0070681_10023670 Ga0070681_100236702 591
929 3300005468 Ga0070707_100041377 Ga0070707_1000413772 591
930 3300005471 Ga0070698_100000242 Ga0070698_10000024211 591
931 3300005518 Ga0070699_100007701 Ga0070699_10000770110 591
932 3300005518 Ga0070699_100103101 Ga0070699_1001031012 591
933 3300005546 Ga0070696_100014845 Ga0070696_1000148454 591
934 3300005617 Ga0068859_100009782 Ga0068859_1000097827 591
935 3300005719 Ga0068861_100009595 Ga0068861_1000095951 591
936 3300005841 Ga0068863_100016634 Ga0068863_1000166345 591
937 3300005843 Ga0068860_100008019 Ga0068860_1000080197 591
938 3300006358 Ga0068871_100107228 Ga0068871_1001072282 591
939 3300006852 Ga0075433_10017711 Ga0075433_100177113 591
940 3300006852 Ga0075433_10031345 Ga0075433_100313454 591
941 3300006852 Ga0075433_10036428 Ga0075433_100364284 591
942 3300006871 Ga0075434_100022049 Ga0075434_1000220492 591
943 3300006931 Ga0097620_100009783 Ga0097620_1000097837 591
944 3300007076 Ga0075435_100015116 Ga0075435_1000151162 591
945 3300007076 Ga0075435_100021210 Ga0075435_1000212102 591
946 3300009147 Ga0114129_10026626 Ga0114129_100266264 591
947 3300009147 Ga0114129_10142742 Ga0114129_101427423 591
948 3300009553 Ga0105249_10024546 Ga0105249_100245464 591
949 3300013308 Ga0157375_10012952 Ga0157375_100129523 591
950 3300025907 Ga0207645_10040709 Ga0207645_100407092 591
951 3300025912 Ga0207707_10034673 Ga0207707_100346732 591
952 3300025918 Ga0207662_10036360 Ga0207662_100363602 591
953 3300025922 Ga0207646_10081870 Ga0207646_100818702 591
954 3300025926 Ga0207659_10000227 Ga0207659_1000022712 591
955 3300025940 Ga0207691_10044357 Ga0207691_100443572 591
956 3300025940 Ga0207691_10058456 Ga0207691_100584562 591
957 3300025960 Ga0207651_10074126 Ga0207651_100741261 591
958 3300026075 Ga0207708_10017646 Ga0207708_100176466 591
959 3300026095 Ga0207676_10056450 Ga0207676_100564502 591
960 3300026116 Ga0207674_10010324 Ga0207674_1001032411 591
961 3300026118 Ga0207675_100005264 Ga0207675_1000052642 591
962 3300026121 Ga0207683_10031790 Ga0207683_100317902 591
963 3300027907 Ga0207428_10010477 Ga0207428_100104776 591
964 3300028380 Ga0268265_10012948 Ga0268265_100129486 591
965 3300028381 Ga0268264_10017223 Ga0268264_100172234 591
966 3300028381 Ga0268264_10156111 Ga0268264_101561112 591
967 3300045051 Ga0451576_0009935 Ga0451576_0009935_5142_6917 591
968 3300045051 Ga0451576_0053000 Ga0451576_0053000_2412_4187 591
969 3300045051 Ga0451576_0074357 Ga0451576_0074357_1456_3231 591
970 3300046459 Ga0495629_0004294 Ga0495629_0004294_8416_10209 591
971 3300046499 Ga0495594_0017951 Ga0495594_0017951_617_2392 591
972 3300046539 Ga0495621_0000671 Ga0495621_0000671_3767_5542 591
973 3300046539 Ga0495621_0016009 Ga0495621_0016009_80_1855 591
974 3300046664 Ga0495659_0001886 Ga0495659_0001886_3364_5139 591
975 3300050507 nmdc:mga05p37_276725_c1 nmdc:mga05p37_276725_c1_166_1941 591
976 3300050512 nmdc:mga0n895_157977_c1 nmdc:mga0n895_157977_c1_412_2187 591
977 3300050512 nmdc:mga0n895_1771_c1 nmdc:mga0n895_1771_c1_10835_12610 591
978 3300050513 nmdc:mga0rr50_45969_c1 nmdc:mga0rr50_45969_c1_510_2285 591

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00152

tRNA-synt_2

tRNA synthetases class II (D, K and N)

238

686

0.99

PF00474

SSF

Sodium:solute symporter family

36

138

0.92

PF01336

tRNA_anti-codon

OB-fold nucleic acid binding domain

136

221

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wom-assembly1.cif.gz_B crystal structure of aspartyl-trna ligase from elizabethkingia sp. 0.9529 10 591
6hhx-assembly1.cif.gz_A structure of t. thermophilus asprs in complex with 5'-o-(n-(l-aspartyl)-sulfamoyl)cytidine 0.9528 10 591
6sjc-assembly1.cif.gz_A structure of t. thermophilus asprs in complex with 5'-o-(n-(l-aspartyl)-sulfamoyl)adenosine 0.9523 10 591
7ap4-assembly1.cif.gz_A thermus thermophilus aspartyl-trna synthetase in complex with compound asps7hmdda 0.9503 10 591
1l0w-assembly1.cif.gz_B aspartyl-trna synthetase-1 from space-grown crystals 0.9494 9 591
ID Description Score Start End Superfamily
1c0aA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9764 9 114 2.40.50.140
1c0aA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9675 9 114 2.40.50.140
1l0wB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9658 9 116 2.40.50.140
4o2dB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9615 10 114 2.40.50.140
af_A0A0R0FYI1_245_329_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9521 430 516 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A7X7FD61-F1-model_v4 deleted 0.9864 429 590
AF-A0A3D2RF65-F1-model_v4 Aspartate--tRNA ligase 0.986 432 591 GO:0004815
GO:0005524
GO:0006422
AF-A0A382LAP6-F1-model_v4 Aminoacyl-transfer RNA synthetases class-II family profile domain-containing protein 0.9847 482 590 GO:0004815
GO:0005524
GO:0006422
AF-A0A2T4RXQ7-F1-model_v4 Aspartate--tRNA ligase (EC 6.1.1.12) 0.9843 128 259 GO:0004815
GO:0005524
GO:0005737
GO:0006422
GO:0016740
AF-A0A7C7QCQ7-F1-model_v4 Aminoacyl-tRNA synthetase class II (D/K/N) domain-containing protein 0.9841 438 591 GO:0004815
GO:0005524
GO:0006422

Feature Viewer

pLDDT pTM Quality
91.29 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map