F487300
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 978 | 316 | 978 | 600 |
Family's Representative Sequence
| Representative Sequence | 3300025913|Ga0207695_10123165|Ga0207695_101231651 |
| Length | 714 |
| Sequence | MVLTPVDWLVIGGYFALNLAIGLYYARRARGSTTEFFLSGRNVPWWLAGTSMVATTFAADTPLVVTGMVARYGIAGNWLWWNMAASGMLTVFVYARLWRRAGVMTDVEFAELRYSGKPAAFLRGFRALYLGIPINCIVMGWVNRLRDHGNLIFVDVRDRTGVTQVVFNKELNPALHEKAAHLGSEYVIAVTGLVKQREPNLVNKNIATGEIELVAQELRILNVSKTPPFLPGESVLPNEEVRLKYRYLDLRREKMQFNIELRHKVGMAIRQYLAEQGFFEIETPFMTRSTPEGARDYLVPSRVYPGSFYALPQSPQLFKQILMISGFDKYFQIVRCFRDEDLRADRQPEFTQIDLEMTFPQPDRVFEVVEGFLTAAFRAAGQEIKTPFLRMTYDQAIRKYGSDKPDLRLPAMTDVRQAFAPENLKTLNVDPRLPVVAIRIPRVGELSRKERDDIKPLFGERRNAKLFEDAKRLEKSFPEAMAKVRELSSAEPDDLLVLVAGNELPGDHPSESIVGPEVKQHDAVVYTAAGALRVALAQKYAERHDAFRRGAFHFLWVTDFPMFEWDEEGKRWAAAHHPFTSPREKDMDKLESDPAAVRALAYDVVLNGTELGSGSIRIHRQDIQKKIFHALGMSDEEAKARFGFFLEALEYGTPPHGGIALGLDRIVMILAGADSLREVIPFPKTAKAVDLMVDAPTPVSEAQLKELGISVRKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 111 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 112 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 113 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 114 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 115 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 116 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 173 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 177 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 180 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 181 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 182 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 184 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 185 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 186 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 187 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 188 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 189 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 191 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 192 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 194 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 196 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 197 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 198 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 199 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 200 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 201 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 202 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 203 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 204 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 205 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 208 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 211 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 213 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 214 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 215 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 217 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 219 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 220 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 221 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 222 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 223 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 224 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 225 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 226 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 227 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 228 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 229 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 230 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 231 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 259 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 260 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 261 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 262 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 263 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 266 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 267 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 268 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 269 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 270 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 271 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 312 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 313 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 315 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.8 |
| Metatranscriptomes | 0.2 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.2 |
| Nodule | 0 |
| Rhizoplane | 3.27 |
| Rhizosphere | 96.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_604697 | 2162886007 | Bacteria | 2970 |
| 2 | LJNas_1001039 | 3300000546 | Bacteria | 4382 |
| 3 | JGI25407J50210_10007439 | 3300003373 | Bacteria | 2743 |
| 4 | Ga0065704_10072792 | 3300005289 | Bacteria | 8004 |
| 5 | Ga0065715_10132088 | 3300005293 | Bacteria | 1979 |
| 6 | Ga0065707_10001510 | 3300005295 | Bacteria | 7379 |
| 7 | Ga0070676_10004901 | 3300005328 | Bacteria | 7090 |
| 8 | Ga0070676_10004973 | 3300005328 | Bacteria | 7037 |
| 9 | Ga0070683_100000055 | 3300005329 | Bacteria | 86882 |
| 10 | Ga0070683_100093324 | 3300005329 | Bacteria | 2827 |
| 11 | Ga0070670_100000582 | 3300005331 | Bacteria | 28880 |
| 12 | Ga0070670_100008250 | 3300005331 | Bacteria | 8871 |
| 13 | Ga0070670_100009392 | 3300005331 | Bacteria | 8349 |
| 14 | Ga0070670_100026609 | 3300005331 | Bacteria | 4977 |
| 15 | Ga0068869_100000460 | 3300005334 | Bacteria | 22453 |
| 16 | Ga0068869_100000592 | 3300005334 | Bacteria | 20323 |
| 17 | Ga0068869_100007045 | 3300005334 | Bacteria | 7160 |
| 18 | Ga0068869_100039553 | 3300005334 | Bacteria | 3367 |
| 19 | Ga0068869_100058096 | 3300005334 | Bacteria | 2827 |
| 20 | Ga0070666_10005555 | 3300005335 | Bacteria | 7737 |
| 21 | Ga0070666_10015995 | 3300005335 | Bacteria | 4793 |
| 22 | Ga0070666_10039732 | 3300005335 | Bacteria | 3137 |
| 23 | Ga0070666_10064885 | 3300005335 | Bacteria | 2477 |
| 24 | Ga0070680_100024098 | 3300005336 | Bacteria | 4856 |
| 25 | Ga0070680_100168103 | 3300005336 | Bacteria | 1844 |
| 26 | Ga0070682_100000014 | 3300005337 | Bacteria | 249552 |
| 27 | Ga0068868_100001452 | 3300005338 | Bacteria | 16351 |
| 28 | Ga0068868_100002673 | 3300005338 | Bacteria | 12360 |
| 29 | Ga0068868_100002979 | 3300005338 | Bacteria | 11762 |
| 30 | Ga0068868_100038280 | 3300005338 | Bacteria | 3722 |
| 31 | Ga0068868_100115444 | 3300005338 | Bacteria | 2186 |
| 32 | Ga0070660_100000311 | 3300005339 | Bacteria | 32366 |
| 33 | Ga0070660_100013186 | 3300005339 | Bacteria | 5923 |
| 34 | Ga0070660_100105734 | 3300005339 | Bacteria | 2234 |
| 35 | Ga0070689_100000488 | 3300005340 | Bacteria | 23423 |
| 36 | Ga0070689_100023528 | 3300005340 | Bacteria | 4612 |
| 37 | Ga0070689_100031607 | 3300005340 | Bacteria | 4024 |
| 38 | Ga0070689_100072627 | 3300005340 | Bacteria | 2689 |
| 39 | Ga0070661_100005335 | 3300005344 | Bacteria | 8867 |
| 40 | Ga0070661_100015089 | 3300005344 | Bacteria | 5451 |
| 41 | Ga0070661_100015415 | 3300005344 | Bacteria | 5395 |
| 42 | Ga0070661_100046721 | 3300005344 | Bacteria | 3168 |
| 43 | Ga0070668_100013532 | 3300005347 | Bacteria | 6091 |
| 44 | Ga0070668_100137236 | 3300005347 | Bacteria | 1968 |
| 45 | Ga0070675_100000005 | 3300005354 | Bacteria | 295918 |
| 46 | Ga0070675_100000272 | 3300005354 | Bacteria | 34147 |
| 47 | Ga0070675_100006612 | 3300005354 | Bacteria | 8911 |
| 48 | Ga0070675_100029792 | 3300005354 | Bacteria | 4403 |
| 49 | Ga0070675_100033628 | 3300005354 | Bacteria | 4158 |
| 50 | Ga0070675_100043727 | 3300005354 | Bacteria | 3661 |
| 51 | Ga0070671_100013999 | 3300005355 | Bacteria | 6477 |
| 52 | Ga0070671_100026358 | 3300005355 | Bacteria | 4776 |
| 53 | Ga0070671_100070784 | 3300005355 | Bacteria | 2910 |
| 54 | Ga0070671_100088961 | 3300005355 | Bacteria | 2585 |
| 55 | Ga0070671_100115985 | 3300005355 | Bacteria | 2251 |
| 56 | Ga0070673_100003191 | 3300005364 | Bacteria | 10158 |
| 57 | Ga0070673_100043033 | 3300005364 | Bacteria | 3486 |
| 58 | Ga0070673_100084830 | 3300005364 | Bacteria | 2577 |
| 59 | Ga0070688_100007207 | 3300005365 | Bacteria | 5988 |
| 60 | Ga0070688_100040711 | 3300005365 | Bacteria | 2849 |
| 61 | Ga0070659_100004425 | 3300005366 | Bacteria | 10034 |
| 62 | Ga0070667_100000566 | 3300005367 | Bacteria | 36566 |
| 63 | Ga0070709_10000505 | 3300005434 | Bacteria | 23009 |
| 64 | Ga0070709_10009195 | 3300005434 | Bacteria | 5438 |
| 65 | Ga0070709_10056280 | 3300005434 | Bacteria | 2486 |
| 66 | Ga0070714_100000051 | 3300005435 | Bacteria | 110289 |
| 67 | Ga0070714_100000121 | 3300005435 | Bacteria | 62487 |
| 68 | Ga0070714_100009776 | 3300005435 | Bacteria | 7559 |
| 69 | Ga0070714_100053759 | 3300005435 | Bacteria | 3439 |
| 70 | Ga0070714_100066949 | 3300005435 | Bacteria | 3096 |
| 71 | Ga0070714_100088522 | 3300005435 | Bacteria | 2709 |
| 72 | Ga0070713_100000210 | 3300005436 | Bacteria | 38839 |
| 73 | Ga0070713_100000302 | 3300005436 | Bacteria | 32656 |
| 74 | Ga0070713_100000378 | 3300005436 | Bacteria | 28414 |
| 75 | Ga0070713_100099016 | 3300005436 | Bacteria | 2522 |
| 76 | Ga0070710_10011850 | 3300005437 | Bacteria | 4318 |
| 77 | Ga0070711_100000549 | 3300005439 | Bacteria | 19585 |
| 78 | Ga0070711_100000978 | 3300005439 | Bacteria | 15129 |
| 79 | Ga0070711_100010586 | 3300005439 | Bacteria | 5712 |
| 80 | Ga0070700_100000096 | 3300005441 | Bacteria | 58388 |
| 81 | Ga0070708_100003506 | 3300005445 | Bacteria | 12283 |
| 82 | Ga0070708_100006013 | 3300005445 | Bacteria | 9644 |
| 83 | Ga0070708_100030512 | 3300005445 | Bacteria | 4660 |
| 84 | Ga0070708_100039219 | 3300005445 | Bacteria | 4143 |
| 85 | Ga0070708_100080156 | 3300005445 | Bacteria | 2954 |
| 86 | Ga0070663_100005932 | 3300005455 | Bacteria | 7309 |
| 87 | Ga0070663_100007600 | 3300005455 | Bacteria | 6611 |
| 88 | Ga0070663_100015952 | 3300005455 | Bacteria | 4864 |
| 89 | Ga0070662_100006661 | 3300005457 | Bacteria | 7461 |
| 90 | Ga0070662_100055719 | 3300005457 | Bacteria | 2869 |
| 91 | Ga0070681_10000804 | 3300005458 | Bacteria | 26179 |
| 92 | Ga0070681_10002950 | 3300005458 | Bacteria | 15777 |
| 93 | Ga0070681_10014599 | 3300005458 | Bacteria | 7817 |
| 94 | Ga0070681_10023670 | 3300005458 | Bacteria | 6180 |
| 95 | Ga0070681_10053278 | 3300005458 | Bacteria | 4031 |
| 96 | Ga0070681_10057062 | 3300005458 | Bacteria | 3885 |
| 97 | Ga0068867_100013882 | 3300005459 | Bacteria | 5702 |
| 98 | Ga0070685_10002349 | 3300005466 | Bacteria | 9751 |
| 99 | Ga0070685_10003390 | 3300005466 | Bacteria | 8105 |
| 100 | Ga0070706_100000734 | 3300005467 | Bacteria | 37002 |
| 101 | Ga0070706_100002721 | 3300005467 | Bacteria | 17682 |
| 102 | Ga0070706_100003417 | 3300005467 | Bacteria | 15662 |
| 103 | Ga0070707_100000360 | 3300005468 | Bacteria | 44793 |
| 104 | Ga0070707_100018911 | 3300005468 | Bacteria | 6487 |
| 105 | Ga0070707_100041377 | 3300005468 | Bacteria | 4411 |
| 106 | Ga0070707_100120088 | 3300005468 | Bacteria | 2552 |
| 107 | Ga0070698_100000242 | 3300005471 | Bacteria | 54440 |
| 108 | Ga0070698_100001323 | 3300005471 | Bacteria | 27599 |
| 109 | Ga0070698_100006846 | 3300005471 | Bacteria | 12348 |
| 110 | Ga0070699_100001400 | 3300005518 | Bacteria | 22180 |
| 111 | Ga0070699_100007701 | 3300005518 | Bacteria | 9361 |
| 112 | Ga0070699_100103101 | 3300005518 | Bacteria | 2501 |
| 113 | Ga0070679_100000226 | 3300005530 | Bacteria | 46282 |
| 114 | Ga0070679_100006248 | 3300005530 | Bacteria | 11099 |
| 115 | Ga0070679_100006733 | 3300005530 | Bacteria | 10719 |
| 116 | Ga0070679_100008309 | 3300005530 | Bacteria | 9767 |
| 117 | Ga0070679_100045850 | 3300005530 | Bacteria | 4356 |
| 118 | Ga0070679_100106427 | 3300005530 | Bacteria | 2790 |
| 119 | Ga0070684_100000153 | 3300005535 | Bacteria | 47114 |
| 120 | Ga0070684_100024487 | 3300005535 | Bacteria | 5064 |
| 121 | Ga0070684_100050642 | 3300005535 | Bacteria | 3608 |
| 122 | Ga0070684_100081193 | 3300005535 | Bacteria | 2869 |
| 123 | Ga0070684_100085152 | 3300005535 | Bacteria | 2803 |
| 124 | Ga0070697_100000532 | 3300005536 | Bacteria | 28683 |
| 125 | Ga0070697_100002341 | 3300005536 | Bacteria | 14572 |
| 126 | Ga0070697_100011698 | 3300005536 | Bacteria | 6862 |
| 127 | Ga0070697_100019328 | 3300005536 | Bacteria | 5380 |
| 128 | Ga0068853_100009193 | 3300005539 | Bacteria | 7959 |
| 129 | Ga0068853_100046671 | 3300005539 | Bacteria | 3715 |
| 130 | Ga0068853_100114740 | 3300005539 | Bacteria | 2396 |
| 131 | Ga0068853_100186634 | 3300005539 | Bacteria | 1882 |
| 132 | Ga0070672_100000082 | 3300005543 | Bacteria | 44859 |
| 133 | Ga0070672_100013365 | 3300005543 | Bacteria | 5798 |
| 134 | Ga0070672_100078707 | 3300005543 | Bacteria | 2638 |
| 135 | Ga0070686_100004959 | 3300005544 | Bacteria | 7343 |
| 136 | Ga0070686_100043296 | 3300005544 | Bacteria | 2824 |
| 137 | Ga0070696_100014845 | 3300005546 | Bacteria | 5228 |
| 138 | Ga0070665_100007648 | 3300005548 | Bacteria | 10985 |
| 139 | Ga0070665_100116575 | 3300005548 | Bacteria | 2673 |
| 140 | Ga0068855_100000782 | 3300005563 | Bacteria | 39281 |
| 141 | Ga0068855_100000842 | 3300005563 | Bacteria | 37998 |
| 142 | Ga0068855_100000949 | 3300005563 | Bacteria | 36109 |
| 143 | Ga0068855_100003547 | 3300005563 | Bacteria | 19079 |
| 144 | Ga0068855_100003849 | 3300005563 | Bacteria | 18342 |
| 145 | Ga0068855_100009479 | 3300005563 | Bacteria | 11760 |
| 146 | Ga0068855_100036142 | 3300005563 | Bacteria | 5881 |
| 147 | Ga0068855_100053155 | 3300005563 | Bacteria | 4766 |
| 148 | Ga0068855_100090519 | 3300005563 | Bacteria | 3531 |
| 149 | Ga0070664_100001991 | 3300005564 | Bacteria | 16379 |
| 150 | Ga0070664_100015491 | 3300005564 | Bacteria | 6237 |
| 151 | Ga0070664_100029161 | 3300005564 | Bacteria | 4599 |
| 152 | Ga0068857_100000775 | 3300005577 | Bacteria | 23800 |
| 153 | Ga0068857_100016925 | 3300005577 | Bacteria | 6387 |
| 154 | Ga0068857_100020037 | 3300005577 | Bacteria | 5880 |
| 155 | Ga0068857_100064478 | 3300005577 | Bacteria | 3257 |
| 156 | Ga0068854_100002592 | 3300005578 | Bacteria | 11198 |
| 157 | Ga0068854_100009011 | 3300005578 | Bacteria | 6430 |
| 158 | Ga0068854_100010352 | 3300005578 | Bacteria | 6044 |
| 159 | Ga0068854_100057364 | 3300005578 | Bacteria | 2808 |
| 160 | Ga0068856_100000437 | 3300005614 | Bacteria | 45849 |
| 161 | Ga0068856_100001503 | 3300005614 | Bacteria | 24428 |
| 162 | Ga0068856_100002308 | 3300005614 | Bacteria | 19646 |
| 163 | Ga0068856_100002380 | 3300005614 | Bacteria | 19349 |
| 164 | Ga0068856_100007577 | 3300005614 | Bacteria | 10590 |
| 165 | Ga0068856_100045911 | 3300005614 | Bacteria | 4302 |
| 166 | Ga0068856_100101826 | 3300005614 | Bacteria | 2865 |
| 167 | Ga0068856_100136446 | 3300005614 | Bacteria | 2459 |
| 168 | Ga0070702_100002922 | 3300005615 | Bacteria | 7526 |
| 169 | Ga0068852_100000054 | 3300005616 | Bacteria | 78608 |
| 170 | Ga0068852_100000870 | 3300005616 | Bacteria | 20006 |
| 171 | Ga0068852_100003707 | 3300005616 | Bacteria | 10703 |
| 172 | Ga0068852_100013502 | 3300005616 | Bacteria | 6252 |
| 173 | Ga0068852_100017162 | 3300005616 | Bacteria | 5672 |
| 174 | Ga0068852_100056292 | 3300005616 | Bacteria | 3398 |
| 175 | Ga0068852_100086018 | 3300005616 | Bacteria | 2802 |
| 176 | Ga0068859_100000298 | 3300005617 | Bacteria | 49363 |
| 177 | Ga0068859_100006100 | 3300005617 | Bacteria | 12241 |
| 178 | Ga0068859_100006498 | 3300005617 | Bacteria | 11865 |
| 179 | Ga0068859_100009782 | 3300005617 | Bacteria | 9686 |
| 180 | Ga0068859_100023095 | 3300005617 | Bacteria | 6238 |
| 181 | Ga0068859_100048328 | 3300005617 | Bacteria | 4274 |
| 182 | Ga0068859_100099257 | 3300005617 | Bacteria | 2967 |
| 183 | Ga0068859_100110663 | 3300005617 | Bacteria | 2808 |
| 184 | Ga0068864_100000097 | 3300005618 | Bacteria | 85717 |
| 185 | Ga0068864_100000397 | 3300005618 | Bacteria | 37701 |
| 186 | Ga0068864_100002195 | 3300005618 | Bacteria | 16100 |
| 187 | Ga0068864_100062589 | 3300005618 | Bacteria | 3224 |
| 188 | Ga0068866_10001978 | 3300005718 | Bacteria | 8544 |
| 189 | Ga0068866_10008165 | 3300005718 | Bacteria | 4400 |
| 190 | Ga0068866_10034609 | 3300005718 | Bacteria | 2461 |
| 191 | Ga0068861_100009595 | 3300005719 | Bacteria | 6687 |
| 192 | Ga0068861_100018277 | 3300005719 | Bacteria | 4993 |
| 193 | Ga0068851_10008726 | 3300005834 | Bacteria | 4695 |
| 194 | Ga0068851_10016930 | 3300005834 | Bacteria | 3495 |
| 195 | Ga0068851_10051835 | 3300005834 | Bacteria | 2085 |
| 196 | Ga0068870_10007784 | 3300005840 | Bacteria | 4792 |
| 197 | Ga0068863_100000502 | 3300005841 | Bacteria | 39820 |
| 198 | Ga0068863_100001036 | 3300005841 | Bacteria | 27797 |
| 199 | Ga0068863_100013736 | 3300005841 | Bacteria | 7807 |
| 200 | Ga0068863_100016274 | 3300005841 | Bacteria | 7136 |
| 201 | Ga0068863_100016634 | 3300005841 | Bacteria | 7057 |
| 202 | Ga0068858_100000243 | 3300005842 | Bacteria | 58808 |
| 203 | Ga0068858_100003081 | 3300005842 | Bacteria | 16683 |
| 204 | Ga0068858_100003082 | 3300005842 | Bacteria | 16683 |
| 205 | Ga0068858_100003641 | 3300005842 | Bacteria | 15245 |
| 206 | Ga0068858_100049497 | 3300005842 | Bacteria | 3892 |
| 207 | Ga0068858_100097264 | 3300005842 | Bacteria | 2744 |
| 208 | Ga0068858_100198842 | 3300005842 | Bacteria | 1895 |
| 209 | Ga0068860_100000031 | 3300005843 | Bacteria | 255068 |
| 210 | Ga0068860_100003297 | 3300005843 | Bacteria | 16609 |
| 211 | Ga0068860_100004066 | 3300005843 | Bacteria | 15013 |
| 212 | Ga0068860_100008019 | 3300005843 | Bacteria | 10531 |
| 213 | Ga0068860_100041771 | 3300005843 | Bacteria | 4381 |
| 214 | Ga0068860_100097553 | 3300005843 | Bacteria | 2802 |
| 215 | Ga0068860_100146283 | 3300005843 | Bacteria | 2274 |
| 216 | Ga0068862_100113094 | 3300005844 | Bacteria | 2385 |
| 217 | Ga0081538_10000196 | 3300005981 | Bacteria | 66606 |
| 218 | Ga0081538_10000778 | 3300005981 | Bacteria | 34784 |
| 219 | Ga0081538_10001466 | 3300005981 | Bacteria | 24208 |
| 220 | Ga0081538_10001685 | 3300005981 | Bacteria | 22512 |
| 221 | Ga0081538_10007985 | 3300005981 | Bacteria | 9053 |
| 222 | Ga0070717_10007920 | 3300006028 | Bacteria | 7914 |
| 223 | Ga0070717_10010141 | 3300006028 | Bacteria | 7094 |
| 224 | Ga0070717_10012598 | 3300006028 | Bacteria | 6451 |
| 225 | Ga0070717_10018717 | 3300006028 | Bacteria | 5416 |
| 226 | Ga0070717_10020970 | 3300006028 | Bacteria | 5146 |
| 227 | Ga0070717_10043179 | 3300006028 | Bacteria | 3678 |
| 228 | Ga0070717_10074261 | 3300006028 | Bacteria | 2842 |
| 229 | Ga0070717_10087238 | 3300006028 | Bacteria | 2628 |
| 230 | Ga0070717_10089764 | 3300006028 | Bacteria | 2593 |
| 231 | Ga0070715_10000755 | 3300006163 | Bacteria | 8744 |
| 232 | Ga0070716_100000096 | 3300006173 | Bacteria | 34314 |
| 233 | Ga0070716_100004475 | 3300006173 | Bacteria | 6684 |
| 234 | Ga0070716_100005734 | 3300006173 | Bacteria | 6031 |
| 235 | Ga0070716_100010911 | 3300006173 | Bacteria | 4570 |
| 236 | Ga0070712_100000273 | 3300006175 | Bacteria | 28938 |
| 237 | Ga0070712_100000529 | 3300006175 | Bacteria | 22056 |
| 238 | Ga0070712_100001481 | 3300006175 | Bacteria | 14326 |
| 239 | Ga0070712_100002426 | 3300006175 | Bacteria | 11486 |
| 240 | Ga0070712_100010572 | 3300006175 | Bacteria | 5827 |
| 241 | Ga0070712_100057983 | 3300006175 | Bacteria | 2722 |
| 242 | Ga0070712_100065704 | 3300006175 | Bacteria | 2576 |
| 243 | Ga0097621_100000431 | 3300006237 | Bacteria | 29219 |
| 244 | Ga0097621_100000472 | 3300006237 | Bacteria | 28201 |
| 245 | Ga0097621_100000648 | 3300006237 | Bacteria | 24592 |
| 246 | Ga0097621_100007702 | 3300006237 | Bacteria | 7720 |
| 247 | Ga0097621_100043545 | 3300006237 | Bacteria | 3619 |
| 248 | Ga0068871_100000084 | 3300006358 | Bacteria | 53380 |
| 249 | Ga0068871_100002089 | 3300006358 | Bacteria | 13517 |
| 250 | Ga0068871_100003471 | 3300006358 | Bacteria | 10832 |
| 251 | Ga0068871_100034049 | 3300006358 | Bacteria | 4039 |
| 252 | Ga0068871_100086608 | 3300006358 | Bacteria | 2603 |
| 253 | Ga0068871_100107228 | 3300006358 | Bacteria | 2346 |
| 254 | Ga0075428_100041305 | 3300006844 | Bacteria | 5073 |
| 255 | Ga0075428_100130455 | 3300006844 | Bacteria | 2734 |
| 256 | Ga0075428_100177406 | 3300006844 | Bacteria | 2307 |
| 257 | Ga0075430_100064572 | 3300006846 | Bacteria | 3075 |
| 258 | Ga0075430_100081873 | 3300006846 | Bacteria | 2705 |
| 259 | Ga0075433_10001602 | 3300006852 | Bacteria | 16772 |
| 260 | Ga0075433_10003220 | 3300006852 | Bacteria | 12599 |
| 261 | Ga0075433_10017711 | 3300006852 | Bacteria | 5909 |
| 262 | Ga0075433_10031345 | 3300006852 | Bacteria | 4544 |
| 263 | Ga0075433_10036428 | 3300006852 | Bacteria | 4238 |
| 264 | Ga0075434_100000782 | 3300006871 | Bacteria | 25168 |
| 265 | Ga0075434_100013793 | 3300006871 | Bacteria | 7705 |
| 266 | Ga0075434_100022049 | 3300006871 | Bacteria | 6200 |
| 267 | Ga0075429_100009133 | 3300006880 | Bacteria | 8606 |
| 268 | Ga0075429_100033476 | 3300006880 | Bacteria | 4466 |
| 269 | Ga0068865_100069763 | 3300006881 | Bacteria | 2488 |
| 270 | Ga0075436_100018159 | 3300006914 | Bacteria | 4816 |
| 271 | Ga0075436_100034899 | 3300006914 | Bacteria | 3469 |
| 272 | Ga0097620_100000298 | 3300006931 | Bacteria | 49363 |
| 273 | Ga0097620_100006100 | 3300006931 | Bacteria | 12241 |
| 274 | Ga0097620_100006498 | 3300006931 | Bacteria | 11865 |
| 275 | Ga0097620_100009783 | 3300006931 | Bacteria | 9686 |
| 276 | Ga0097620_100023098 | 3300006931 | Bacteria | 6238 |
| 277 | Ga0097620_100048336 | 3300006931 | Bacteria | 4274 |
| 278 | Ga0097620_100099258 | 3300006931 | Bacteria | 2967 |
| 279 | Ga0097620_100110666 | 3300006931 | Bacteria | 2808 |
| 280 | Ga0075435_100000849 | 3300007076 | Bacteria | 19122 |
| 281 | Ga0075435_100001140 | 3300007076 | Bacteria | 16947 |
| 282 | Ga0075435_100015116 | 3300007076 | Bacteria | 5794 |
| 283 | Ga0075435_100021210 | 3300007076 | Bacteria | 4993 |
| 284 | Ga0105240_10000116 | 3300009093 | Bacteria | 165524 |
| 285 | Ga0105240_10000171 | 3300009093 | Bacteria | 132604 |
| 286 | Ga0105240_10002552 | 3300009093 | Bacteria | 29190 |
| 287 | Ga0105240_10005889 | 3300009093 | Bacteria | 18155 |
| 288 | Ga0105240_10026610 | 3300009093 | Bacteria | 7591 |
| 289 | Ga0105240_10026789 | 3300009093 | Bacteria | 7561 |
| 290 | Ga0105240_10040442 | 3300009093 | Bacteria | 5962 |
| 291 | Ga0105240_10041785 | 3300009093 | Bacteria | 5847 |
| 292 | Ga0105240_10114614 | 3300009093 | Bacteria | 3256 |
| 293 | Ga0111539_10000795 | 3300009094 | Bacteria | 41114 |
| 294 | Ga0111539_10018879 | 3300009094 | Bacteria | 8530 |
| 295 | Ga0111539_10084133 | 3300009094 | Bacteria | 3741 |
| 296 | Ga0111539_10144018 | 3300009094 | Bacteria | 2790 |
| 297 | Ga0111539_10249249 | 3300009094 | Bacteria | 2068 |
| 298 | Ga0105245_10001223 | 3300009098 | Bacteria | 23189 |
| 299 | Ga0105245_10003105 | 3300009098 | Bacteria | 14861 |
| 300 | Ga0105245_10003410 | 3300009098 | Bacteria | 14233 |
| 301 | Ga0105245_10007294 | 3300009098 | Bacteria | 9682 |
| 302 | Ga0105245_10041496 | 3300009098 | Bacteria | 4101 |
| 303 | Ga0105247_10007911 | 3300009101 | Bacteria | 6500 |
| 304 | Ga0105247_10038022 | 3300009101 | Bacteria | 2936 |
| 305 | Ga0114129_10008909 | 3300009147 | Bacteria | 14308 |
| 306 | Ga0114129_10026626 | 3300009147 | Bacteria | 8190 |
| 307 | Ga0114129_10104089 | 3300009147 | Bacteria | 3922 |
| 308 | Ga0114129_10142742 | 3300009147 | Bacteria | 3281 |
| 309 | Ga0114129_10248071 | 3300009147 | Bacteria | 2391 |
| 310 | Ga0105243_10025697 | 3300009148 | Bacteria | 4503 |
| 311 | Ga0105241_10000061 | 3300009174 | Bacteria | 83048 |
| 312 | Ga0105241_10001359 | 3300009174 | Bacteria | 18631 |
| 313 | Ga0105241_10001688 | 3300009174 | Bacteria | 16784 |
| 314 | Ga0105241_10002385 | 3300009174 | Bacteria | 14111 |
| 315 | Ga0105241_10013412 | 3300009174 | Bacteria | 6008 |
| 316 | Ga0105241_10046513 | 3300009174 | Bacteria | 3296 |
| 317 | Ga0105241_10048402 | 3300009174 | Bacteria | 3235 |
| 318 | Ga0105241_10065482 | 3300009174 | Bacteria | 2808 |
| 319 | Ga0105241_10100604 | 3300009174 | Bacteria | 2297 |
| 320 | Ga0105248_10000019 | 3300009177 | Bacteria | 285766 |
| 321 | Ga0105248_10000260 | 3300009177 | Bacteria | 61933 |
| 322 | Ga0105248_10008242 | 3300009177 | Bacteria | 11449 |
| 323 | Ga0105248_10010198 | 3300009177 | Bacteria | 10346 |
| 324 | Ga0105248_10042619 | 3300009177 | Bacteria | 5091 |
| 325 | Ga0105248_10134533 | 3300009177 | Bacteria | 2789 |
| 326 | Ga0105237_10005201 | 3300009545 | Bacteria | 14714 |
| 327 | Ga0105237_10020862 | 3300009545 | Bacteria | 6746 |
| 328 | Ga0105237_10028854 | 3300009545 | Bacteria | 5646 |
| 329 | Ga0105237_10050632 | 3300009545 | Bacteria | 4173 |
| 330 | Ga0105237_10095147 | 3300009545 | Bacteria | 2968 |
| 331 | Ga0105238_10000024 | 3300009551 | Bacteria | 196322 |
| 332 | Ga0105238_10000532 | 3300009551 | Bacteria | 39823 |
| 333 | Ga0105238_10006095 | 3300009551 | Bacteria | 11959 |
| 334 | Ga0105238_10009190 | 3300009551 | Bacteria | 9895 |
| 335 | Ga0105238_10015185 | 3300009551 | Bacteria | 7798 |
| 336 | Ga0105249_10015894 | 3300009553 | Bacteria | 6670 |
| 337 | Ga0105249_10024546 | 3300009553 | Bacteria | 5419 |
| 338 | Ga0105249_10051111 | 3300009553 | Bacteria | 3769 |
| 339 | Ga0105249_10070577 | 3300009553 | Bacteria | 3225 |
| 340 | Ga0105249_10073058 | 3300009553 | Bacteria | 3172 |
| 341 | Ga0105239_10003830 | 3300010375 | Bacteria | 18277 |
| 342 | Ga0105239_10006367 | 3300010375 | Bacteria | 13718 |
| 343 | Ga0105239_10006871 | 3300010375 | Bacteria | 13130 |
| 344 | Ga0105239_10098682 | 3300010375 | Bacteria | 3229 |
| 345 | Ga0105239_10099901 | 3300010375 | Bacteria | 3208 |
| 346 | Ga0105239_10106275 | 3300010375 | Bacteria | 3109 |
| 347 | Ga0105239_10112059 | 3300010375 | Bacteria | 3025 |
| 348 | Ga0105246_10000642 | 3300011119 | Bacteria | 19516 |
| 349 | Ga0105246_10002800 | 3300011119 | Bacteria | 10555 |
| 350 | Ga0157373_10005980 | 3300013100 | Bacteria | 9103 |
| 351 | Ga0157371_10010303 | 3300013102 | Bacteria | 7294 |
| 352 | Ga0157371_10013605 | 3300013102 | Bacteria | 6175 |
| 353 | Ga0157371_10014575 | 3300013102 | Bacteria | 5926 |
| 354 | Ga0157370_10000019 | 3300013104 | Bacteria | 167473 |
| 355 | Ga0157370_10009377 | 3300013104 | Bacteria | 10469 |
| 356 | Ga0157369_10000081 | 3300013105 | Bacteria | 132630 |
| 357 | Ga0157369_10001530 | 3300013105 | Bacteria | 28340 |
| 358 | Ga0157369_10005098 | 3300013105 | Bacteria | 15378 |
| 359 | Ga0157369_10012364 | 3300013105 | Bacteria | 9691 |
| 360 | Ga0157369_10013248 | 3300013105 | Bacteria | 9330 |
| 361 | Ga0157369_10017220 | 3300013105 | Bacteria | 8121 |
| 362 | Ga0157369_10021569 | 3300013105 | Bacteria | 7205 |
| 363 | Ga0157369_10025320 | 3300013105 | Bacteria | 6587 |
| 364 | Ga0157369_10025809 | 3300013105 | Bacteria | 6518 |
| 365 | Ga0157369_10036516 | 3300013105 | Bacteria | 5382 |
| 366 | Ga0157369_10043373 | 3300013105 | Bacteria | 4903 |
| 367 | Ga0157369_10056365 | 3300013105 | Bacteria | 4241 |
| 368 | Ga0157369_10104410 | 3300013105 | Bacteria | 3017 |
| 369 | Ga0157374_10000357 | 3300013296 | Bacteria | 42343 |
| 370 | Ga0157374_10001545 | 3300013296 | Bacteria | 19407 |
| 371 | Ga0157374_10001876 | 3300013296 | Bacteria | 17667 |
| 372 | Ga0157374_10005940 | 3300013296 | Bacteria | 10318 |
| 373 | Ga0157374_10005962 | 3300013296 | Bacteria | 10307 |
| 374 | Ga0157374_10010818 | 3300013296 | Bacteria | 7871 |
| 375 | Ga0157374_10014703 | 3300013296 | Bacteria | 6852 |
| 376 | Ga0157374_10033830 | 3300013296 | Bacteria | 4665 |
| 377 | Ga0157374_10044937 | 3300013296 | Bacteria | 4085 |
| 378 | Ga0157374_10117077 | 3300013296 | Bacteria | 2568 |
| 379 | Ga0157374_10139086 | 3300013296 | Bacteria | 2356 |
| 380 | Ga0157374_10149399 | 3300013296 | Bacteria | 2271 |
| 381 | Ga0157378_10000133 | 3300013297 | Bacteria | 70888 |
| 382 | Ga0157378_10000970 | 3300013297 | Bacteria | 26291 |
| 383 | Ga0157378_10001618 | 3300013297 | Bacteria | 20368 |
| 384 | Ga0157378_10003566 | 3300013297 | Bacteria | 13779 |
| 385 | Ga0157378_10028167 | 3300013297 | Bacteria | 4955 |
| 386 | Ga0157378_10041269 | 3300013297 | Bacteria | 4093 |
| 387 | Ga0157378_10046773 | 3300013297 | Bacteria | 3846 |
| 388 | Ga0157378_10060554 | 3300013297 | Bacteria | 3378 |
| 389 | Ga0157378_10166368 | 3300013297 | Bacteria | 2066 |
| 390 | Ga0163162_10012329 | 3300013306 | Bacteria | 8347 |
| 391 | Ga0163162_10014559 | 3300013306 | Bacteria | 7687 |
| 392 | Ga0163162_10032999 | 3300013306 | Bacteria | 5142 |
| 393 | Ga0163162_10040828 | 3300013306 | Bacteria | 4641 |
| 394 | Ga0157372_10000058 | 3300013307 | Bacteria | 125647 |
| 395 | Ga0157372_10000544 | 3300013307 | Bacteria | 41533 |
| 396 | Ga0157372_10000749 | 3300013307 | Bacteria | 35224 |
| 397 | Ga0157372_10001201 | 3300013307 | Bacteria | 28017 |
| 398 | Ga0157372_10004045 | 3300013307 | Bacteria | 15713 |
| 399 | Ga0157372_10008156 | 3300013307 | Bacteria | 11134 |
| 400 | Ga0157372_10014436 | 3300013307 | Bacteria | 8450 |
| 401 | Ga0157372_10023953 | 3300013307 | Bacteria | 6623 |
| 402 | Ga0157372_10032747 | 3300013307 | Bacteria | 5703 |
| 403 | Ga0157372_10042443 | 3300013307 | Bacteria | 5031 |
| 404 | Ga0157372_10072100 | 3300013307 | Bacteria | 3892 |
| 405 | Ga0157372_10084080 | 3300013307 | Bacteria | 3606 |
| 406 | Ga0157372_10125903 | 3300013307 | Bacteria | 2946 |
| 407 | Ga0157375_10000001 | 3300013308 | Bacteria | 696576 |
| 408 | Ga0157375_10000213 | 3300013308 | Bacteria | 53997 |
| 409 | Ga0157375_10002599 | 3300013308 | Bacteria | 15674 |
| 410 | Ga0157375_10012952 | 3300013308 | Bacteria | 7409 |
| 411 | Ga0157375_10094309 | 3300013308 | Bacteria | 3061 |
| 412 | Ga0157375_10122690 | 3300013308 | Bacteria | 2710 |
| 413 | Ga0163163_10001132 | 3300014325 | Bacteria | 22642 |
| 414 | Ga0163163_10053245 | 3300014325 | Bacteria | 3994 |
| 415 | Ga0163163_10057806 | 3300014325 | Bacteria | 3835 |
| 416 | Ga0163163_10112476 | 3300014325 | Bacteria | 2752 |
| 417 | Ga0163163_10134079 | 3300014325 | Bacteria | 2517 |
| 418 | Ga0163163_10136796 | 3300014325 | Bacteria | 2491 |
| 419 | Ga0163163_10142638 | 3300014325 | Bacteria | 2438 |
| 420 | Ga0157380_10000592 | 3300014326 | Bacteria | 22301 |
| 421 | Ga0182008_10005954 | 3300014497 | Bacteria | 6874 |
| 422 | Ga0157377_10028546 | 3300014745 | Bacteria | 3004 |
| 423 | Ga0157379_10000201 | 3300014968 | Bacteria | 46275 |
| 424 | Ga0157379_10001817 | 3300014968 | Bacteria | 17622 |
| 425 | Ga0157379_10021417 | 3300014968 | Bacteria | 5722 |
| 426 | Ga0157379_10024613 | 3300014968 | Bacteria | 5344 |
| 427 | Ga0157379_10058186 | 3300014968 | Bacteria | 3455 |
| 428 | Ga0157376_10003548 | 3300014969 | Bacteria | 10754 |
| 429 | Ga0157376_10018802 | 3300014969 | Bacteria | 5309 |
| 430 | Ga0157376_10029110 | 3300014969 | Bacteria | 4398 |
| 431 | Ga0157376_10030563 | 3300014969 | Bacteria | 4302 |
| 432 | Ga0182007_10004753 | 3300015262 | Bacteria | 6106 |
| 433 | Ga0213871_10000271 | 3300021441 | Bacteria | 6422 |
| 434 | Ga0224569_100199 | 3300022732 | Bacteria | 4930 |
| 435 | Ga0224571_100064 | 3300022734 | Bacteria | 3813 |
| 436 | Ga0224572_1000089 | 3300024225 | Bacteria | 6650 |
| 437 | Ga0228598_1000974 | 3300024227 | Bacteria | 6236 |
| 438 | Ga0207656_10014848 | 3300025321 | Bacteria | 3008 |
| 439 | Ga0207682_10023447 | 3300025893 | Bacteria | 2438 |
| 440 | Ga0207692_10001347 | 3300025898 | Bacteria | 9167 |
| 441 | Ga0207692_10003571 | 3300025898 | Bacteria | 6087 |
| 442 | Ga0207642_10018659 | 3300025899 | Bacteria | 2667 |
| 443 | Ga0207710_10000465 | 3300025900 | Bacteria | 25953 |
| 444 | Ga0207710_10009553 | 3300025900 | Bacteria | 4078 |
| 445 | Ga0207680_10024457 | 3300025903 | Bacteria | 3315 |
| 446 | Ga0207647_10008070 | 3300025904 | Bacteria | 7566 |
| 447 | Ga0207647_10008884 | 3300025904 | Bacteria | 7166 |
| 448 | Ga0207647_10010301 | 3300025904 | Bacteria | 6603 |
| 449 | Ga0207699_10000959 | 3300025906 | Bacteria | 13747 |
| 450 | Ga0207699_10029501 | 3300025906 | Bacteria | 3059 |
| 451 | Ga0207699_10076640 | 3300025906 | Bacteria | 2060 |
| 452 | Ga0207645_10011955 | 3300025907 | Bacteria | 5905 |
| 453 | Ga0207645_10022633 | 3300025907 | Bacteria | 4086 |
| 454 | Ga0207645_10040709 | 3300025907 | Bacteria | 2976 |
| 455 | Ga0207705_10010342 | 3300025909 | Bacteria | 6787 |
| 456 | Ga0207705_10080002 | 3300025909 | Bacteria | 2381 |
| 457 | Ga0207705_10117065 | 3300025909 | Bacteria | 1973 |
| 458 | Ga0207684_10000389 | 3300025910 | Bacteria | 59084 |
| 459 | Ga0207684_10002469 | 3300025910 | Bacteria | 18630 |
| 460 | Ga0207684_10008706 | 3300025910 | Bacteria | 9009 |
| 461 | Ga0207654_10000024 | 3300025911 | Bacteria | 147501 |
| 462 | Ga0207654_10000516 | 3300025911 | Bacteria | 22181 |
| 463 | Ga0207654_10001092 | 3300025911 | Bacteria | 14709 |
| 464 | Ga0207654_10011498 | 3300025911 | Bacteria | 4518 |
| 465 | Ga0207654_10023388 | 3300025911 | Bacteria | 3309 |
| 466 | Ga0207707_10001372 | 3300025912 | Bacteria | 22585 |
| 467 | Ga0207707_10015417 | 3300025912 | Bacteria | 6657 |
| 468 | Ga0207707_10026085 | 3300025912 | Bacteria | 5109 |
| 469 | Ga0207707_10029783 | 3300025912 | Bacteria | 4774 |
| 470 | Ga0207707_10032207 | 3300025912 | Bacteria | 4589 |
| 471 | Ga0207707_10034673 | 3300025912 | Bacteria | 4415 |
| 472 | Ga0207707_10045468 | 3300025912 | Bacteria | 3826 |
| 473 | Ga0207707_10103251 | 3300025912 | Bacteria | 2492 |
| 474 | Ga0207707_10116996 | 3300025912 | Bacteria | 2330 |
| 475 | Ga0207695_10000075 | 3300025913 | Bacteria | 308496 |
| 476 | Ga0207695_10000115 | 3300025913 | Bacteria | 240394 |
| 477 | Ga0207695_10000466 | 3300025913 | Bacteria | 87899 |
| 478 | Ga0207695_10001570 | 3300025913 | Bacteria | 37221 |
| 479 | Ga0207695_10003351 | 3300025913 | Bacteria | 22654 |
| 480 | Ga0207695_10027987 | 3300025913 | Bacteria | 6264 |
| 481 | Ga0207695_10029663 | 3300025913 | Bacteria | 6038 |
| 482 | Ga0207695_10068165 | 3300025913 | Bacteria | 3646 |
| 483 | Ga0207695_10096770 | 3300025913 | Bacteria | 2953 |
| 484 | Ga0207695_10123165 | 3300025913 | Bacteria | 2559 |
| 485 | Ga0207671_10000032 | 3300025914 | Bacteria | 245878 |
| 486 | Ga0207671_10003465 | 3300025914 | Bacteria | 15693 |
| 487 | Ga0207671_10027957 | 3300025914 | Bacteria | 4215 |
| 488 | Ga0207693_10000053 | 3300025915 | Bacteria | 97139 |
| 489 | Ga0207693_10000187 | 3300025915 | Bacteria | 56636 |
| 490 | Ga0207693_10000654 | 3300025915 | Bacteria | 31051 |
| 491 | Ga0207693_10006471 | 3300025915 | Bacteria | 9706 |
| 492 | Ga0207693_10006481 | 3300025915 | Bacteria | 9699 |
| 493 | Ga0207693_10122674 | 3300025915 | Bacteria | 2041 |
| 494 | Ga0207663_10001021 | 3300025916 | Bacteria | 12806 |
| 495 | Ga0207663_10003872 | 3300025916 | Bacteria | 7387 |
| 496 | Ga0207660_10059817 | 3300025917 | Bacteria | 2737 |
| 497 | Ga0207662_10036360 | 3300025918 | Bacteria | 2878 |
| 498 | Ga0207657_10001924 | 3300025919 | Bacteria | 22428 |
| 499 | Ga0207657_10002770 | 3300025919 | Bacteria | 18869 |
| 500 | Ga0207657_10003087 | 3300025919 | Bacteria | 17823 |
| 501 | Ga0207657_10009971 | 3300025919 | Bacteria | 9508 |
| 502 | Ga0207657_10021487 | 3300025919 | Bacteria | 6070 |
| 503 | Ga0207649_10047217 | 3300025920 | Bacteria | 2649 |
| 504 | Ga0207652_10003228 | 3300025921 | Bacteria | 13549 |
| 505 | Ga0207652_10062779 | 3300025921 | Bacteria | 3211 |
| 506 | Ga0207652_10139531 | 3300025921 | Bacteria | 2167 |
| 507 | Ga0207646_10000538 | 3300025922 | Bacteria | 50371 |
| 508 | Ga0207646_10001860 | 3300025922 | Bacteria | 25448 |
| 509 | Ga0207646_10026366 | 3300025922 | Bacteria | 5305 |
| 510 | Ga0207646_10081870 | 3300025922 | Bacteria | 2887 |
| 511 | Ga0207681_10027170 | 3300025923 | Bacteria | 3698 |
| 512 | Ga0207694_10000024 | 3300025924 | Bacteria | 259443 |
| 513 | Ga0207694_10001795 | 3300025924 | Bacteria | 17876 |
| 514 | Ga0207694_10002260 | 3300025924 | Bacteria | 15768 |
| 515 | Ga0207694_10004595 | 3300025924 | Bacteria | 10748 |
| 516 | Ga0207694_10034906 | 3300025924 | Bacteria | 3857 |
| 517 | Ga0207694_10093687 | 3300025924 | Bacteria | 2373 |
| 518 | Ga0207694_10126471 | 3300025924 | Bacteria | 2045 |
| 519 | Ga0207650_10002318 | 3300025925 | Bacteria | 13264 |
| 520 | Ga0207650_10004995 | 3300025925 | Bacteria | 9057 |
| 521 | Ga0207650_10007585 | 3300025925 | Bacteria | 7396 |
| 522 | Ga0207650_10097734 | 3300025925 | Bacteria | 2255 |
| 523 | Ga0207659_10000019 | 3300025926 | Bacteria | 152016 |
| 524 | Ga0207659_10000152 | 3300025926 | Bacteria | 41080 |
| 525 | Ga0207659_10000181 | 3300025926 | Bacteria | 37557 |
| 526 | Ga0207659_10000227 | 3300025926 | Bacteria | 34213 |
| 527 | Ga0207659_10031266 | 3300025926 | Bacteria | 3642 |
| 528 | Ga0207687_10003664 | 3300025927 | Bacteria | 10347 |
| 529 | Ga0207687_10007174 | 3300025927 | Bacteria | 7345 |
| 530 | Ga0207687_10015279 | 3300025927 | Bacteria | 5031 |
| 531 | Ga0207687_10020293 | 3300025927 | Bacteria | 4408 |
| 532 | Ga0207687_10030755 | 3300025927 | Bacteria | 3623 |
| 533 | Ga0207687_10062808 | 3300025927 | Bacteria | 2628 |
| 534 | Ga0207687_10087690 | 3300025927 | Bacteria | 2262 |
| 535 | Ga0207700_10000431 | 3300025928 | Bacteria | 24658 |
| 536 | Ga0207700_10011703 | 3300025928 | Bacteria | 5611 |
| 537 | Ga0207700_10024720 | 3300025928 | Bacteria | 4161 |
| 538 | Ga0207700_10039215 | 3300025928 | Bacteria | 3446 |
| 539 | Ga0207700_10084705 | 3300025928 | Bacteria | 2486 |
| 540 | Ga0207664_10000029 | 3300025929 | Bacteria | 183815 |
| 541 | Ga0207664_10000112 | 3300025929 | Bacteria | 71450 |
| 542 | Ga0207664_10002385 | 3300025929 | Bacteria | 12418 |
| 543 | Ga0207664_10103937 | 3300025929 | Bacteria | 2351 |
| 544 | Ga0207644_10008766 | 3300025931 | Bacteria | 6622 |
| 545 | Ga0207644_10029068 | 3300025931 | Bacteria | 3831 |
| 546 | Ga0207644_10072477 | 3300025931 | Bacteria | 2523 |
| 547 | Ga0207706_10000504 | 3300025933 | Bacteria | 41549 |
| 548 | Ga0207706_10004765 | 3300025933 | Bacteria | 12703 |
| 549 | Ga0207706_10009892 | 3300025933 | Bacteria | 8745 |
| 550 | Ga0207670_10001926 | 3300025936 | Bacteria | 10864 |
| 551 | Ga0207670_10019535 | 3300025936 | Bacteria | 4140 |
| 552 | Ga0207665_10000667 | 3300025939 | Bacteria | 23088 |
| 553 | Ga0207665_10004411 | 3300025939 | Bacteria | 9352 |
| 554 | Ga0207665_10005205 | 3300025939 | Bacteria | 8686 |
| 555 | Ga0207665_10006792 | 3300025939 | Bacteria | 7582 |
| 556 | Ga0207665_10026019 | 3300025939 | Bacteria | 3861 |
| 557 | Ga0207665_10028783 | 3300025939 | Bacteria | 3672 |
| 558 | Ga0207665_10034736 | 3300025939 | Bacteria | 3345 |
| 559 | Ga0207665_10037214 | 3300025939 | Bacteria | 3238 |
| 560 | Ga0207691_10001100 | 3300025940 | Bacteria | 26873 |
| 561 | Ga0207691_10007240 | 3300025940 | Bacteria | 10703 |
| 562 | Ga0207691_10007244 | 3300025940 | Bacteria | 10701 |
| 563 | Ga0207691_10009627 | 3300025940 | Bacteria | 9271 |
| 564 | Ga0207691_10044357 | 3300025940 | Bacteria | 4094 |
| 565 | Ga0207691_10058456 | 3300025940 | Bacteria | 3507 |
| 566 | Ga0207691_10070196 | 3300025940 | Bacteria | 3163 |
| 567 | Ga0207691_10103556 | 3300025940 | Bacteria | 2538 |
| 568 | Ga0207711_10000397 | 3300025941 | Bacteria | 45923 |
| 569 | Ga0207711_10008275 | 3300025941 | Bacteria | 8705 |
| 570 | Ga0207711_10031216 | 3300025941 | Bacteria | 4496 |
| 571 | Ga0207711_10089637 | 3300025941 | Bacteria | 2702 |
| 572 | Ga0207689_10001019 | 3300025942 | Bacteria | 26906 |
| 573 | Ga0207689_10002617 | 3300025942 | Bacteria | 16654 |
| 574 | Ga0207689_10034197 | 3300025942 | Bacteria | 4221 |
| 575 | Ga0207661_10000058 | 3300025944 | Bacteria | 83169 |
| 576 | Ga0207661_10000720 | 3300025944 | Bacteria | 21511 |
| 577 | Ga0207661_10063054 | 3300025944 | Bacteria | 3001 |
| 578 | Ga0207679_10001223 | 3300025945 | Bacteria | 16341 |
| 579 | Ga0207679_10002719 | 3300025945 | Bacteria | 10935 |
| 580 | Ga0207667_10000188 | 3300025949 | Bacteria | 90598 |
| 581 | Ga0207667_10000475 | 3300025949 | Bacteria | 53512 |
| 582 | Ga0207667_10001332 | 3300025949 | Bacteria | 30968 |
| 583 | Ga0207667_10001648 | 3300025949 | Bacteria | 28133 |
| 584 | Ga0207667_10003699 | 3300025949 | Bacteria | 18853 |
| 585 | Ga0207667_10014978 | 3300025949 | Bacteria | 8820 |
| 586 | Ga0207651_10003433 | 3300025960 | Bacteria | 7784 |
| 587 | Ga0207651_10011141 | 3300025960 | Bacteria | 5019 |
| 588 | Ga0207651_10074126 | 3300025960 | Bacteria | 2423 |
| 589 | Ga0207651_10074738 | 3300025960 | Bacteria | 2414 |
| 590 | Ga0207712_10037752 | 3300025961 | Bacteria | 3297 |
| 591 | Ga0207658_10000041 | 3300025986 | Bacteria | 138200 |
| 592 | Ga0207658_10008554 | 3300025986 | Bacteria | 6962 |
| 593 | Ga0207658_10010154 | 3300025986 | Bacteria | 6399 |
| 594 | Ga0207658_10014960 | 3300025986 | Bacteria | 5319 |
| 595 | Ga0207677_10000035 | 3300026023 | Bacteria | 117469 |
| 596 | Ga0207677_10000099 | 3300026023 | Bacteria | 71195 |
| 597 | Ga0207677_10000965 | 3300026023 | Bacteria | 15939 |
| 598 | Ga0207677_10008533 | 3300026023 | Bacteria | 5731 |
| 599 | Ga0207677_10070987 | 3300026023 | Bacteria | 2456 |
| 600 | Ga0207703_10000046 | 3300026035 | Bacteria | 154474 |
| 601 | Ga0207703_10000432 | 3300026035 | Bacteria | 44074 |
| 602 | Ga0207703_10014240 | 3300026035 | Bacteria | 6204 |
| 603 | Ga0207703_10038882 | 3300026035 | Bacteria | 3800 |
| 604 | Ga0207703_10161138 | 3300026035 | Bacteria | 1965 |
| 605 | Ga0207639_10000753 | 3300026041 | Bacteria | 22068 |
| 606 | Ga0207639_10013041 | 3300026041 | Bacteria | 5802 |
| 607 | Ga0207639_10029778 | 3300026041 | Bacteria | 4000 |
| 608 | Ga0207639_10037881 | 3300026041 | Bacteria | 3584 |
| 609 | Ga0207639_10051911 | 3300026041 | Bacteria | 3121 |
| 610 | Ga0207639_10098426 | 3300026041 | Bacteria | 2358 |
| 611 | Ga0207678_10001085 | 3300026067 | Bacteria | 24934 |
| 612 | Ga0207678_10008829 | 3300026067 | Bacteria | 8872 |
| 613 | Ga0207708_10000034 | 3300026075 | Bacteria | 144931 |
| 614 | Ga0207708_10000401 | 3300026075 | Bacteria | 34234 |
| 615 | Ga0207708_10017646 | 3300026075 | Bacteria | 5374 |
| 616 | Ga0207702_10000457 | 3300026078 | Bacteria | 46125 |
| 617 | Ga0207702_10000536 | 3300026078 | Bacteria | 42507 |
| 618 | Ga0207702_10006374 | 3300026078 | Bacteria | 10185 |
| 619 | Ga0207702_10009621 | 3300026078 | Bacteria | 8112 |
| 620 | Ga0207702_10012397 | 3300026078 | Bacteria | 7100 |
| 621 | Ga0207702_10014432 | 3300026078 | Bacteria | 6558 |
| 622 | Ga0207702_10016867 | 3300026078 | Bacteria | 6046 |
| 623 | Ga0207641_10000030 | 3300026088 | Bacteria | 224468 |
| 624 | Ga0207641_10000223 | 3300026088 | Bacteria | 72954 |
| 625 | Ga0207641_10002614 | 3300026088 | Bacteria | 16521 |
| 626 | Ga0207641_10042648 | 3300026088 | Bacteria | 3807 |
| 627 | Ga0207641_10044327 | 3300026088 | Bacteria | 3741 |
| 628 | Ga0207648_10005961 | 3300026089 | Bacteria | 12186 |
| 629 | Ga0207648_10009848 | 3300026089 | Bacteria | 9116 |
| 630 | Ga0207648_10011357 | 3300026089 | Bacteria | 8394 |
| 631 | Ga0207648_10026574 | 3300026089 | Bacteria | 5142 |
| 632 | Ga0207676_10000013 | 3300026095 | Bacteria | 343067 |
| 633 | Ga0207676_10000256 | 3300026095 | Bacteria | 46055 |
| 634 | Ga0207676_10001520 | 3300026095 | Bacteria | 17130 |
| 635 | Ga0207676_10023229 | 3300026095 | Bacteria | 4571 |
| 636 | Ga0207676_10048758 | 3300026095 | Bacteria | 3290 |
| 637 | Ga0207676_10056450 | 3300026095 | Bacteria | 3087 |
| 638 | Ga0207676_10074449 | 3300026095 | Bacteria | 2736 |
| 639 | Ga0207674_10000165 | 3300026116 | Bacteria | 79381 |
| 640 | Ga0207674_10001042 | 3300026116 | Bacteria | 36044 |
| 641 | Ga0207674_10001306 | 3300026116 | Bacteria | 32571 |
| 642 | Ga0207674_10010324 | 3300026116 | Bacteria | 10587 |
| 643 | Ga0207674_10020151 | 3300026116 | Bacteria | 7212 |
| 644 | Ga0207674_10027669 | 3300026116 | Bacteria | 5993 |
| 645 | Ga0207674_10032217 | 3300026116 | Bacteria | 5500 |
| 646 | Ga0207674_10051442 | 3300026116 | Bacteria | 4204 |
| 647 | Ga0207674_10070173 | 3300026116 | Bacteria | 3522 |
| 648 | Ga0207675_100005264 | 3300026118 | Bacteria | 12444 |
| 649 | Ga0207675_100025155 | 3300026118 | Bacteria | 5540 |
| 650 | Ga0207675_100102638 | 3300026118 | Bacteria | 2695 |
| 651 | Ga0207675_100186455 | 3300026118 | Bacteria | 1988 |
| 652 | Ga0207683_10001542 | 3300026121 | Bacteria | 20766 |
| 653 | Ga0207683_10005395 | 3300026121 | Bacteria | 10958 |
| 654 | Ga0207683_10031790 | 3300026121 | Bacteria | 4583 |
| 655 | Ga0207683_10093318 | 3300026121 | Bacteria | 2682 |
| 656 | Ga0207698_10000011 | 3300026142 | Bacteria | 260352 |
| 657 | Ga0207698_10001094 | 3300026142 | Bacteria | 15780 |
| 658 | Ga0207698_10011250 | 3300026142 | Bacteria | 5792 |
| 659 | Ga0207428_10010477 | 3300027907 | Bacteria | 8275 |
| 660 | Ga0268266_10013040 | 3300028379 | Bacteria | 7166 |
| 661 | Ga0268266_10084031 | 3300028379 | Bacteria | 2779 |
| 662 | Ga0268265_10012948 | 3300028380 | Bacteria | 5661 |
| 663 | Ga0268265_10015661 | 3300028380 | Bacteria | 5192 |
| 664 | Ga0268265_10065825 | 3300028380 | Bacteria | 2799 |
| 665 | Ga0268265_10106397 | 3300028380 | Bacteria | 2279 |
| 666 | Ga0268264_10000240 | 3300028381 | Bacteria | 104362 |
| 667 | Ga0268264_10001181 | 3300028381 | Bacteria | 25304 |
| 668 | Ga0268264_10010333 | 3300028381 | Bacteria | 7722 |
| 669 | Ga0268264_10013030 | 3300028381 | Bacteria | 6835 |
| 670 | Ga0268264_10017223 | 3300028381 | Bacteria | 5919 |
| 671 | Ga0268264_10032829 | 3300028381 | Bacteria | 4260 |
| 672 | Ga0268264_10087216 | 3300028381 | Bacteria | 2683 |
| 673 | Ga0268264_10132466 | 3300028381 | Bacteria | 2212 |
| 674 | Ga0268264_10156111 | 3300028381 | Bacteria | 2051 |
| 675 | Ga0265318_10004034 | 3300028577 | Bacteria | 7210 |
| 676 | Ga0265336_10000952 | 3300028666 | Bacteria | 14535 |
| 677 | Ga0265336_10009982 | 3300028666 | Bacteria | 3261 |
| 678 | Ga0265338_10000759 | 3300028800 | Bacteria | 55072 |
| 679 | Ga0265338_10004331 | 3300028800 | Bacteria | 19251 |
| 680 | Ga0265338_10017201 | 3300028800 | Bacteria | 7811 |
| 681 | Ga0265338_10021457 | 3300028800 | Bacteria | 6734 |
| 682 | Ga0265762_1000798 | 3300030760 | Bacteria | 5619 |
| 683 | Ga0265760_10000370 | 3300031090 | Bacteria | 12538 |
| 684 | Ga0265330_10000216 | 3300031235 | Bacteria | 44839 |
| 685 | Ga0265330_10000495 | 3300031235 | Bacteria | 26302 |
| 686 | Ga0265330_10002597 | 3300031235 | Bacteria | 9814 |
| 687 | Ga0265330_10004042 | 3300031235 | Bacteria | 7527 |
| 688 | Ga0265330_10006442 | 3300031235 | Bacteria | 5802 |
| 689 | Ga0265330_10006808 | 3300031235 | Bacteria | 5626 |
| 690 | Ga0265330_10016996 | 3300031235 | Bacteria | 3354 |
| 691 | Ga0265330_10022103 | 3300031235 | Bacteria | 2898 |
| 692 | Ga0265332_10013037 | 3300031238 | Bacteria | 3685 |
| 693 | Ga0265328_10001519 | 3300031239 | Bacteria | 10728 |
| 694 | Ga0265328_10011587 | 3300031239 | Bacteria | 3518 |
| 695 | Ga0265320_10031605 | 3300031240 | Bacteria | 2718 |
| 696 | Ga0265325_10000217 | 3300031241 | Bacteria | 40450 |
| 697 | Ga0265325_10000249 | 3300031241 | Bacteria | 38332 |
| 698 | Ga0265325_10018324 | 3300031241 | Bacteria | 3882 |
| 699 | Ga0265329_10005123 | 3300031242 | Bacteria | 5340 |
| 700 | Ga0265329_10005902 | 3300031242 | Bacteria | 4909 |
| 701 | Ga0265329_10006092 | 3300031242 | Bacteria | 4815 |
| 702 | Ga0265329_10006526 | 3300031242 | Bacteria | 4618 |
| 703 | Ga0265340_10000990 | 3300031247 | Bacteria | 16230 |
| 704 | Ga0265340_10035867 | 3300031247 | Bacteria | 2461 |
| 705 | Ga0265339_10000023 | 3300031249 | Bacteria | 169980 |
| 706 | Ga0265339_10001829 | 3300031249 | Bacteria | 15602 |
| 707 | Ga0265339_10005819 | 3300031249 | Bacteria | 8179 |
| 708 | Ga0265339_10008925 | 3300031249 | Bacteria | 6343 |
| 709 | Ga0265339_10012233 | 3300031249 | Bacteria | 5248 |
| 710 | Ga0265331_10000183 | 3300031250 | Bacteria | 76963 |
| 711 | Ga0265316_10000148 | 3300031344 | Bacteria | 76964 |
| 712 | Ga0265316_10000390 | 3300031344 | Bacteria | 50094 |
| 713 | Ga0265316_10002993 | 3300031344 | Bacteria | 17278 |
| 714 | Ga0265316_10011773 | 3300031344 | Bacteria | 7868 |
| 715 | Ga0265316_10023297 | 3300031344 | Bacteria | 5204 |
| 716 | Ga0265316_10029989 | 3300031344 | Bacteria | 4465 |
| 717 | Ga0265316_10041160 | 3300031344 | Bacteria | 3700 |
| 718 | Ga0265316_10070533 | 3300031344 | Bacteria | 2695 |
| 719 | Ga0265313_10002347 | 3300031595 | Bacteria | 16523 |
| 720 | Ga0265313_10002475 | 3300031595 | Bacteria | 15921 |
| 721 | Ga0265314_10000239 | 3300031711 | Bacteria | 80839 |
| 722 | Ga0265314_10000699 | 3300031711 | Bacteria | 40640 |
| 723 | Ga0265314_10000984 | 3300031711 | Bacteria | 33551 |
| 724 | Ga0265314_10014008 | 3300031711 | Bacteria | 6446 |
| 725 | Ga0265314_10019828 | 3300031711 | Bacteria | 5200 |
| 726 | Ga0265342_10001352 | 3300031712 | Bacteria | 22957 |
| 727 | Ga0265342_10001442 | 3300031712 | Bacteria | 22142 |
| 728 | Ga0265342_10001956 | 3300031712 | Bacteria | 18426 |
| 729 | Ga0265342_10005484 | 3300031712 | Bacteria | 9656 |
| 730 | Ga0265342_10007130 | 3300031712 | Bacteria | 8227 |
| 731 | Ga0265342_10037573 | 3300031712 | Bacteria | 2952 |
| 732 | Ga0307405_10097846 | 3300031731 | Bacteria | 1960 |
| 733 | Ga0307413_10003211 | 3300031824 | Bacteria | 6837 |
| 734 | Ga0307410_10000548 | 3300031852 | Bacteria | 15471 |
| 735 | Ga0307407_10008476 | 3300031903 | Bacteria | 4724 |
| 736 | Ga0307407_10056938 | 3300031903 | Bacteria | 2266 |
| 737 | Ga0307412_10005543 | 3300031911 | Bacteria | 7090 |
| 738 | Ga0307409_100002046 | 3300031995 | Bacteria | 10357 |
| 739 | Ga0307409_100013197 | 3300031995 | Bacteria | 5304 |
| 740 | Ga0307409_100031021 | 3300031995 | Bacteria | 3850 |
| 741 | Ga0307409_100055966 | 3300031995 | Bacteria | 3049 |
| 742 | Ga0307416_100000683 | 3300032002 | Bacteria | 17650 |
| 743 | Ga0307416_100002239 | 3300032002 | Bacteria | 11007 |
| 744 | Ga0307416_100012525 | 3300032002 | Bacteria | 5718 |
| 745 | Ga0307416_100014062 | 3300032002 | Bacteria | 5466 |
| 746 | Ga0307416_100030511 | 3300032002 | Bacteria | 4046 |
| 747 | Ga0307411_10005339 | 3300032005 | Bacteria | 6296 |
| 748 | Ga0307415_100002658 | 3300032126 | Bacteria | 8921 |
| 749 | Ga0307415_100004748 | 3300032126 | Bacteria | 7112 |
| 750 | Ga0307415_100106050 | 3300032126 | Bacteria | 2074 |
| 751 | Ga0316214_1000994 | 3300033545 | Bacteria | 3154 |
| 752 | Ga0373926_0016950 | 3300035083 | Bacteria | 2496 |
| 753 | Ga0373945_0000791 | 3300035116 | Bacteria | 9249 |
| 754 | Ga0373945_0013509 | 3300035116 | Bacteria | 2727 |
| 755 | Ga0373956_0017899 | 3300035119 | Bacteria | 2995 |
| 756 | Ga0373943_0001897 | 3300035170 | Bacteria | 9455 |
| 757 | Ga0373946_0005289 | 3300035171 | Bacteria | 4655 |
| 758 | Ga0373955_0000430 | 3300035172 | Bacteria | 17725 |
| 759 | Ga0373924_0003014 | 3300035410 | Bacteria | 5733 |
| 760 | Ga0373935_0015517 | 3300035692 | Bacteria | 4605 |
| 761 | Ga0373935_0059823 | 3300035692 | Bacteria | 2436 |
| 762 | Ga0373927_0000070 | 3300035695 | Bacteria | 73849 |
| 763 | Ga0373927_0085522 | 3300035695 | Bacteria | 2047 |
| 764 | Ga0373933_0056789 | 3300035724 | Bacteria | 2351 |
| 765 | Ga0373947_0001681 | 3300035725 | Bacteria | 13546 |
| 766 | Ga0373947_0055668 | 3300035725 | Bacteria | 2389 |
| 767 | Ga0373937_0000772 | 3300036401 | Bacteria | 27672 |
| 768 | Ga0373937_0008811 | 3300036401 | Bacteria | 8753 |
| 769 | Ga0373937_0014967 | 3300036401 | Bacteria | 6853 |
| 770 | Ga0373937_0028217 | 3300036401 | Bacteria | 5078 |
| 771 | Ga0373937_0127643 | 3300036401 | Bacteria | 2373 |
| 772 | Ga0373937_0129814 | 3300036401 | Bacteria | 2353 |
| 773 | Ga0373937_0140408 | 3300036401 | Bacteria | 2260 |
| 774 | Ga0316582_0051099 | 3300036647 | Bacteria | 2622 |
| 775 | Ga0373925_0001143 | 3300037068 | Bacteria | 23596 |
| 776 | Ga0373925_0007680 | 3300037068 | Bacteria | 7856 |
| 777 | Ga0373925_0009291 | 3300037068 | Bacteria | 7156 |
| 778 | Ga0373925_0031504 | 3300037068 | Bacteria | 3898 |
| 779 | Ga0373925_0063287 | 3300037068 | Bacteria | 2783 |
| 780 | Ga0373925_0080608 | 3300037068 | Bacteria | 2474 |
| 781 | Ga0395898_0101689 | 3300037466 | Bacteria | 2760 |
| 782 | Ga0395905_0011711 | 3300037471 | Bacteria | 8466 |
| 783 | Ga0436360_0812878 | 3300039438 | Bacteria | 9343 |
| 784 | Ga0436361_0445142 | 3300039447 | Bacteria | 7168 |
| 785 | Ga0436363_0811887 | 3300039450 | Bacteria | 4303 |
| 786 | Ga0436362_0197917 | 3300039453 | Bacteria | 3369 |
| 787 | Ga0451577_0000053 | 3300042876 | Bacteria | 279563 |
| 788 | Ga0451577_0000294 | 3300042876 | Bacteria | 97046 |
| 789 | Ga0451577_0000658 | 3300042876 | Bacteria | 54482 |
| 790 | Ga0451577_0001280 | 3300042876 | Bacteria | 34616 |
| 791 | Ga0466963_0007935 | 3300044694 | Bacteria | 6355 |
| 792 | Ga0466963_0085991 | 3300044694 | Bacteria | 2136 |
| 793 | Ga0453684_0000103 | 3300044712 | Bacteria | 366458 |
| 794 | Ga0453684_0000104 | 3300044712 | Bacteria | 365431 |
| 795 | Ga0453684_0000208 | 3300044712 | Bacteria | 255911 |
| 796 | Ga0453684_0015233 | 3300044712 | Bacteria | 12193 |
| 797 | Ga0453684_0155408 | 3300044712 | Bacteria | 2713 |
| 798 | Ga0453684_0156897 | 3300044712 | Bacteria | 2697 |
| 799 | Ga0453684_0246806 | 3300044712 | Bacteria | 2052 |
| 800 | Ga0466957_0001064 | 3300044842 | Bacteria | 14145 |
| 801 | Ga0466959_0018815 | 3300045049 | Bacteria | 5074 |
| 802 | Ga0451576_0002362 | 3300045051 | Bacteria | 28450 |
| 803 | Ga0451576_0009935 | 3300045051 | Bacteria | 10980 |
| 804 | Ga0451576_0028875 | 3300045051 | Bacteria | 5941 |
| 805 | Ga0451576_0053000 | 3300045051 | Bacteria | 4251 |
| 806 | Ga0451576_0074357 | 3300045051 | Bacteria | 3536 |
| 807 | Ga0466967_0001326 | 3300045976 | Bacteria | 14177 |
| 808 | Ga0466967_0003357 | 3300045976 | Bacteria | 10410 |
| 809 | Ga0466967_0121565 | 3300045976 | Bacteria | 2413 |
| 810 | Ga0495603_0043373 | 3300046455 | Bacteria | 2686 |
| 811 | Ga0495629_0004294 | 3300046459 | Bacteria | 10683 |
| 812 | Ga0495638_0061240 | 3300046460 | Bacteria | 2326 |
| 813 | Ga0495651_0004718 | 3300046462 | Bacteria | 10432 |
| 814 | Ga0495580_0000196 | 3300046472 | Bacteria | 46289 |
| 815 | Ga0495580_0000848 | 3300046472 | Bacteria | 26484 |
| 816 | Ga0495580_0006140 | 3300046472 | Bacteria | 9824 |
| 817 | Ga0495580_0008930 | 3300046472 | Bacteria | 7926 |
| 818 | Ga0495580_0021801 | 3300046472 | Bacteria | 4724 |
| 819 | Ga0495639_0044778 | 3300046475 | Bacteria | 2001 |
| 820 | Ga0495664_0033834 | 3300046477 | Bacteria | 3005 |
| 821 | Ga0495585_0034587 | 3300046492 | Bacteria | 2857 |
| 822 | Ga0495594_0017951 | 3300046499 | Bacteria | 3744 |
| 823 | Ga0495620_0010132 | 3300046515 | Bacteria | 4981 |
| 824 | Ga0495630_0022152 | 3300046517 | Bacteria | 4694 |
| 825 | Ga0495644_0015793 | 3300046523 | Bacteria | 2893 |
| 826 | Ga0495665_0041908 | 3300046531 | Bacteria | 2437 |
| 827 | Ga0495587_0046695 | 3300046536 | Bacteria | 2569 |
| 828 | Ga0495587_0047676 | 3300046536 | Bacteria | 2540 |
| 829 | Ga0495609_0006375 | 3300046538 | Bacteria | 6022 |
| 830 | Ga0495621_0000671 | 3300046539 | Bacteria | 8661 |
| 831 | Ga0495621_0006888 | 3300046539 | Bacteria | 3341 |
| 832 | Ga0495621_0016009 | 3300046539 | Bacteria | 2399 |
| 833 | Ga0495633_0038924 | 3300046558 | Bacteria | 2270 |
| 834 | Ga0495635_0032266 | 3300046663 | Bacteria | 3634 |
| 835 | Ga0495659_0001886 | 3300046664 | Bacteria | 6919 |
| 836 | Ga0495659_0003052 | 3300046664 | Bacteria | 5374 |
| 837 | Ga0495657_0054595 | 3300046675 | Bacteria | 2668 |
| 838 | Ga0495623_0029630 | 3300046679 | Bacteria | 3522 |
| 839 | Ga0495658_0032708 | 3300046683 | Bacteria | 2842 |
| 840 | Ga0495613_0076543 | 3300046689 | Bacteria | 2435 |
| 841 | Ga0495581_0014727 | 3300047315 | Bacteria | 4537 |
| 842 | Ga0495674_0007954 | 3300047319 | Bacteria | 10121 |
| 843 | Ga0495602_0026743 | 3300048088 | Bacteria | 5560 |
| 844 | Ga0496101_0056460 | 3300048904 | Bacteria | 2839 |
| 845 | Ga0496102_0005785 | 3300048905 | Bacteria | 10509 |
| 846 | Ga0496102_0158381 | 3300048905 | Bacteria | 2129 |
| 847 | Ga0496103_0004124 | 3300048906 | Bacteria | 8821 |
| 848 | Ga0496104_0030065 | 3300048907 | Bacteria | 5045 |
| 849 | Ga0496104_0031520 | 3300048907 | Bacteria | 4931 |
| 850 | Ga0496104_0096075 | 3300048907 | Bacteria | 2835 |
| 851 | Ga0496104_0200606 | 3300048907 | Bacteria | 1907 |
| 852 | Ga0496105_0007966 | 3300048908 | Bacteria | 8238 |
| 853 | Ga0496105_0014515 | 3300048908 | Bacteria | 6270 |
| 854 | Ga0496106_0063713 | 3300048909 | Bacteria | 2803 |
| 855 | Ga0496108_0031332 | 3300048911 | Bacteria | 4412 |
| 856 | Ga0496108_0115665 | 3300048911 | Bacteria | 2297 |
| 857 | Ga0496109_0000381 | 3300048912 | Bacteria | 40340 |
| 858 | Ga0496109_0105099 | 3300048912 | Bacteria | 2622 |
| 859 | Ga0496109_0105507 | 3300048912 | Bacteria | 2617 |
| 860 | Ga0496110_0000862 | 3300048913 | Bacteria | 21421 |
| 861 | Ga0496110_0005513 | 3300048913 | Bacteria | 9932 |
| 862 | Ga0496110_0018500 | 3300048913 | Bacteria | 5842 |
| 863 | Ga0496110_0085458 | 3300048913 | Bacteria | 2816 |
| 864 | Ga0496111_0002956 | 3300048914 | Bacteria | 10401 |
| 865 | Ga0496111_0021817 | 3300048914 | Bacteria | 4474 |
| 866 | Ga0496112_0000155 | 3300048915 | Bacteria | 43076 |
| 867 | Ga0496112_0003539 | 3300048915 | Bacteria | 12966 |
| 868 | Ga0496112_0006599 | 3300048915 | Bacteria | 10211 |
| 869 | Ga0496112_0014512 | 3300048915 | Bacteria | 7315 |
| 870 | Ga0496112_0014861 | 3300048915 | Bacteria | 7242 |
| 871 | Ga0496112_0027695 | 3300048915 | Bacteria | 5465 |
| 872 | Ga0496112_0084871 | 3300048915 | Bacteria | 3133 |
| 873 | Ga0496113_0003008 | 3300048916 | Bacteria | 9983 |
| 874 | Ga0496113_0064984 | 3300048916 | Bacteria | 2760 |
| 875 | Ga0496115_0001879 | 3300048918 | Bacteria | 15050 |
| 876 | Ga0496126_0074144 | 3300048929 | Bacteria | 3023 |
| 877 | Ga0501032_0066449 | 3300049569 | Bacteria | 2410 |
| 878 | Ga0501033_0001466 | 3300049570 | Bacteria | 20890 |
| 879 | Ga0501034_0021241 | 3300049571 | Bacteria | 6621 |
| 880 | Ga0501034_0030656 | 3300049571 | Bacteria | 5465 |
| 881 | Ga0501034_0035712 | 3300049571 | Bacteria | 5038 |
| 882 | Ga0501036_0002139 | 3300049572 | Bacteria | 15413 |
| 883 | Ga0501036_0008849 | 3300049572 | Bacteria | 8266 |
| 884 | Ga0501037_0000070 | 3300049573 | Bacteria | 94985 |
| 885 | Ga0501037_0004528 | 3300049573 | Bacteria | 10101 |
| 886 | Ga0501038_0000082 | 3300049574 | Bacteria | 80551 |
| 887 | Ga0501039_0000077 | 3300049575 | Bacteria | 74065 |
| 888 | Ga0501039_0004672 | 3300049575 | Bacteria | 10360 |
| 889 | Ga0501039_0019334 | 3300049575 | Bacteria | 5221 |
| 890 | Ga0501039_0061470 | 3300049575 | Bacteria | 2909 |
| 891 | Ga0501039_0067587 | 3300049575 | Bacteria | 2775 |
| 892 | Ga0501040_0000048 | 3300049576 | Bacteria | 55371 |
| 893 | Ga0501040_0000330 | 3300049576 | Bacteria | 27805 |
| 894 | Ga0501041_0000007 | 3300049577 | Bacteria | 64272 |
| 895 | Ga0501041_0003269 | 3300049577 | Bacteria | 9316 |
| 896 | Ga0501041_0024740 | 3300049577 | Bacteria | 3605 |
| 897 | Ga0501042_0000011 | 3300049578 | Bacteria | 56069 |
| 898 | Ga0501042_0001198 | 3300049578 | Bacteria | 15016 |
| 899 | Ga0501042_0066931 | 3300049578 | Bacteria | 2568 |
| 900 | Ga0501043_0000208 | 3300049579 | Bacteria | 53881 |
| 901 | Ga0501046_0000089 | 3300049580 | Bacteria | 99031 |
| 902 | Ga0501046_0069001 | 3300049580 | Bacteria | 2751 |
| 903 | Ga0501047_0000237 | 3300049581 | Bacteria | 65237 |
| 904 | Ga0501047_0009879 | 3300049581 | Bacteria | 9020 |
| 905 | Ga0501048_0037208 | 3300049582 | Bacteria | 3494 |
| 906 | Ga0501048_0047617 | 3300049582 | Bacteria | 3059 |
| 907 | Ga0501067_0002232 | 3300049583 | Bacteria | 10694 |
| 908 | Ga0501068_0000856 | 3300049584 | Bacteria | 15851 |
| 909 | Ga0501069_0000139 | 3300049585 | Bacteria | 31998 |
| 910 | Ga0501069_0003510 | 3300049585 | Bacteria | 8074 |
| 911 | Ga0501070_0000234 | 3300049586 | Bacteria | 52540 |
| 912 | Ga0501071_0068948 | 3300049587 | Bacteria | 2574 |
| 913 | Ga0501072_0001511 | 3300049588 | Bacteria | 17432 |
| 914 | Ga0501072_0001977 | 3300049588 | Bacteria | 15271 |
| 915 | Ga0501072_0013236 | 3300049588 | Bacteria | 6319 |
| 916 | Ga0501072_0059457 | 3300049588 | Bacteria | 3013 |
| 917 | Ga0501073_0001338 | 3300049589 | Bacteria | 18161 |
| 918 | Ga0501073_0015703 | 3300049589 | Bacteria | 5491 |
| 919 | Ga0501074_0000002 | 3300049590 | Bacteria | 121767 |
| 920 | Ga0501075_0000782 | 3300049591 | Bacteria | 19882 |
| 921 | Ga0501076_0000167 | 3300049592 | Bacteria | 38185 |
| 922 | Ga0501076_0000246 | 3300049592 | Bacteria | 33219 |
| 923 | Ga0501077_0000090 | 3300049593 | Bacteria | 46393 |
| 924 | Ga0501077_0001464 | 3300049593 | Bacteria | 14196 |
| 925 | Ga0501077_0013555 | 3300049593 | Bacteria | 5112 |
| 926 | Ga0501079_0129424 | 3300049741 | Bacteria | 1964 |
| 927 | Ga0501080_0001053 | 3300049742 | Bacteria | 22707 |
| 928 | Ga0501080_0022833 | 3300049742 | Bacteria | 5798 |
| 929 | Ga0501081_0000112 | 3300049743 | Bacteria | 34866 |
| 930 | Ga0501081_0000598 | 3300049743 | Bacteria | 20594 |
| 931 | Ga0501081_0023338 | 3300049743 | Bacteria | 4145 |
| 932 | Ga0501083_0033740 | 3300049744 | Bacteria | 3502 |
| 933 | Ga0501035_0006035 | 3300049822 | Bacteria | 11406 |
| 934 | Ga0501035_0065057 | 3300049822 | Bacteria | 3239 |
| 935 | Ga0501044_0004943 | 3300049823 | Bacteria | 14909 |
| 936 | Ga0501044_0006636 | 3300049823 | Bacteria | 12758 |
| 937 | Ga0501045_0008702 | 3300049824 | Bacteria | 7079 |
| 938 | Ga0501045_0046589 | 3300049824 | Bacteria | 3157 |
| 939 | Ga0501045_0094387 | 3300049824 | Bacteria | 2213 |
| 940 | nmdc:mga05p37_1051_c1 | 3300050507 | Bacteria | 25770 |
| 941 | nmdc:mga05p37_1788_c1 | 3300050507 | Bacteria | 25109 |
| 942 | nmdc:mga05p37_276725_c1 | 3300050507 | Bacteria | 2004 |
| 943 | nmdc:mga05p37_321673_c1 | 3300050507 | Bacteria | 1831 |
| 944 | nmdc:mga05p37_51424_c1 | 3300050507 | Bacteria | 5067 |
| 945 | nmdc:mga05p37_84214_c1 | 3300050507 | Bacteria | 3917 |
| 946 | nmdc:mga09592_28247_c1 | 3300050508 | Bacteria | 4660 |
| 947 | nmdc:mga0qj67_108404_c1 | 3300050509 | Bacteria | 2241 |
| 948 | nmdc:mga0qj67_2704_c1 | 3300050509 | Bacteria | 12711 |
| 949 | nmdc:mga08y16_26215_c1 | 3300050511 | Bacteria | 6147 |
| 950 | nmdc:mga08y16_37306_c1 | 3300050511 | Bacteria | 5105 |
| 951 | nmdc:mga08y16_39505_c1 | 3300050511 | Bacteria | 4951 |
| 952 | nmdc:mga08y16_524_c1 | 3300050511 | Bacteria | 35438 |
| 953 | nmdc:mga0n895_1225_c1 | 3300050512 | Bacteria | 18962 |
| 954 | nmdc:mga0n895_145662_c1 | 3300050512 | Bacteria | 2398 |
| 955 | nmdc:mga0n895_157977_c1 | 3300050512 | Bacteria | 2299 |
| 956 | nmdc:mga0n895_1771_c1 | 3300050512 | Bacteria | 16368 |
| 957 | nmdc:mga0n895_3475_c1 | 3300050512 | Bacteria | 12714 |
| 958 | nmdc:mga0rr50_1542_c1 | 3300050513 | Bacteria | 12694 |
| 959 | nmdc:mga0rr50_3136_c1 | 3300050513 | Bacteria | 9440 |
| 960 | nmdc:mga0rr50_45969_c1 | 3300050513 | Bacteria | 3212 |
| 961 | nmdc:mga0rr50_73200_c1 | 3300050513 | Bacteria | 2619 |
| 962 | nmdc:mga08x19_3059_c1 | 3300050514 | Bacteria | 10053 |
| 963 | nmdc:mga08x19_45101_c1 | 3300050514 | Bacteria | 2817 |
| 964 | nmdc:mga08x19_50237_c1 | 3300050514 | Bacteria | 2676 |
| 965 | nmdc:mga08x19_9570_c1 | 3300050514 | Bacteria | 5800 |
| 966 | nmdc:mga0a205_10374_c1 | 3300050515 | Bacteria | 8561 |
| 967 | nmdc:mga0a205_1296_c1 | 3300050515 | Bacteria | 21017 |
| 968 | nmdc:mga0a205_3935_c2 | 3300050515 | Bacteria | 11335 |
| 969 | Ga0500641_0000225 | 3300053096 | Bacteria | 21193 |
| 970 | Ga0500568_0014356 | 3300053139 | Bacteria | 3579 |
| 971 | Ga0501084_0000332 | 3300054114 | Bacteria | 36149 |
| 972 | Ga0501084_0003965 | 3300054114 | Bacteria | 12057 |
| 973 | Ga0501084_0021307 | 3300054114 | Bacteria | 5402 |
| 974 | Ga0590075_000898 | 3300059424 | Bacteria | 7757 |
| 975 | Ga0501082_0000241 | 3300060353 | Bacteria | 47793 |
| 976 | Ga0501082_0000888 | 3300060353 | Bacteria | 26405 |
| 977 | Ga0501082_0050102 | 3300060353 | Bacteria | 3601 |
| 978 | Ga0530510_0001350 | 3300061734 | Bacteria | 16417 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300036401 | Ga0373937_0014967 | Ga0373937_0014967_5295_6842 | 473 |
| 2 | 3300035692 | Ga0373935_0059823 | Ga0373935_0059823_28_1596 | 480 |
| 3 | 3300013297 | Ga0157378_10046773 | Ga0157378_100467732 | 500 |
| 4 | 3300046462 | Ga0495651_0004718 | Ga0495651_0004718_2354_4054 | 529 |
| 5 | 3300048911 | Ga0496108_0115665 | Ga0496108_0115665_536_2263 | 533 |
| 6 | 3300009094 | Ga0111539_10018879 | Ga0111539_100188797 | 540 |
| 7 | 3300025939 | Ga0207665_10037214 | Ga0207665_100372142 | 540 |
| 8 | 3300050511 | nmdc:mga08y16_37306_c1 | nmdc:mga08y16_37306_c1_2274_3965 | 540 |
| 9 | 3300014497 | Ga0182008_10005954 | Ga0182008_100059542 | 543 |
| 10 | 3300048909 | Ga0496106_0063713 | Ga0496106_0063713_805_2541 | 543 |
| 11 | 3300048911 | Ga0496108_0031332 | Ga0496108_0031332_1389_3125 | 543 |
| 12 | 3300048912 | Ga0496109_0105507 | Ga0496109_0105507_617_2353 | 543 |
| 13 | 3300005334 | Ga0068869_100007045 | Ga0068869_1000070454 | 545 |
| 14 | 3300005335 | Ga0070666_10039732 | Ga0070666_100397323 | 545 |
| 15 | 3300005340 | Ga0070689_100031607 | Ga0070689_1000316073 | 545 |
| 16 | 3300005344 | Ga0070661_100015089 | Ga0070661_1000150893 | 545 |
| 17 | 3300005365 | Ga0070688_100007207 | Ga0070688_1000072072 | 545 |
| 18 | 3300005455 | Ga0070663_100015952 | Ga0070663_1000159524 | 545 |
| 19 | 3300005466 | Ga0070685_10003390 | Ga0070685_100033907 | 545 |
| 20 | 3300005535 | Ga0070684_100085152 | Ga0070684_1000851521 | 545 |
| 21 | 3300005543 | Ga0070672_100078707 | Ga0070672_1000787071 | 545 |
| 22 | 3300005544 | Ga0070686_100004959 | Ga0070686_1000049596 | 545 |
| 23 | 3300005564 | Ga0070664_100029161 | Ga0070664_1000291613 | 545 |
| 24 | 3300005577 | Ga0068857_100064478 | Ga0068857_1000644784 | 545 |
| 25 | 3300005615 | Ga0070702_100002922 | Ga0070702_1000029221 | 545 |
| 26 | 3300005616 | Ga0068852_100017162 | Ga0068852_1000171622 | 545 |
| 27 | 3300005617 | Ga0068859_100110663 | Ga0068859_1001106631 | 545 |
| 28 | 3300005834 | Ga0068851_10016930 | Ga0068851_100169302 | 545 |
| 29 | 3300005843 | Ga0068860_100041771 | Ga0068860_1000417714 | 545 |
| 30 | 3300005843 | Ga0068860_100097553 | Ga0068860_1000975533 | 545 |
| 31 | 3300006173 | Ga0070716_100004475 | Ga0070716_1000044753 | 545 |
| 32 | 3300006175 | Ga0070712_100010572 | Ga0070712_1000105722 | 545 |
| 33 | 3300006881 | Ga0068865_100069763 | Ga0068865_1000697632 | 545 |
| 34 | 3300006931 | Ga0097620_100110666 | Ga0097620_1001106661 | 545 |
| 35 | 3300009098 | Ga0105245_10041496 | Ga0105245_100414962 | 545 |
| 36 | 3300009101 | Ga0105247_10007911 | Ga0105247_100079116 | 545 |
| 37 | 3300009174 | Ga0105241_10013412 | Ga0105241_100134126 | 545 |
| 38 | 3300010375 | Ga0105239_10112059 | Ga0105239_101120591 | 545 |
| 39 | 3300011119 | Ga0105246_10002800 | Ga0105246_100028003 | 545 |
| 40 | 3300013102 | Ga0157371_10010303 | Ga0157371_100103032 | 545 |
| 41 | 3300013307 | Ga0157372_10084080 | Ga0157372_100840802 | 545 |
| 42 | 3300014325 | Ga0163163_10001132 | Ga0163163_1000113222 | 545 |
| 43 | 3300025321 | Ga0207656_10014848 | Ga0207656_100148482 | 545 |
| 44 | 3300025903 | Ga0207680_10024457 | Ga0207680_100244572 | 545 |
| 45 | 3300025906 | Ga0207699_10000959 | Ga0207699_100009595 | 545 |
| 46 | 3300025940 | Ga0207691_10070196 | Ga0207691_100701961 | 545 |
| 47 | 3300025986 | Ga0207658_10014960 | Ga0207658_100149604 | 545 |
| 48 | 3300026035 | Ga0207703_10038882 | Ga0207703_100388823 | 545 |
| 49 | 3300026116 | Ga0207674_10027669 | Ga0207674_100276691 | 545 |
| 50 | 3300028381 | Ga0268264_10013030 | Ga0268264_100130306 | 545 |
| 51 | 3300048905 | Ga0496102_0158381 | Ga0496102_0158381_189_1928 | 545 |
| 52 | 3300048912 | Ga0496109_0000381 | Ga0496109_0000381_5546_7285 | 545 |
| 53 | 3300048913 | Ga0496110_0005513 | Ga0496110_0005513_5559_7298 | 545 |
| 54 | 3300048915 | Ga0496112_0000155 | Ga0496112_0000155_35793_37532 | 545 |
| 55 | 3300048916 | Ga0496113_0003008 | Ga0496113_0003008_3040_4779 | 545 |
| 56 | 3300005536 | Ga0070697_100019328 | Ga0070697_1000193282 | 546 |
| 57 | 3300025910 | Ga0207684_10002469 | Ga0207684_100024697 | 546 |
| 58 | 3300025922 | Ga0207646_10000538 | Ga0207646_100005389 | 546 |
| 59 | 3300026023 | Ga0207677_10070987 | Ga0207677_100709872 | 546 |
| 60 | 3300036401 | Ga0373937_0127643 | Ga0373937_0127643_25_1794 | 546 |
| 61 | 3300005335 | Ga0070666_10064885 | Ga0070666_100648851 | 547 |
| 62 | 3300005843 | Ga0068860_100146283 | Ga0068860_1001462831 | 547 |
| 63 | 3300025927 | Ga0207687_10062808 | Ga0207687_100628082 | 547 |
| 64 | 3300005338 | Ga0068868_100002979 | Ga0068868_1000029798 | 548 |
| 65 | 3300005347 | Ga0070668_100013532 | Ga0070668_1000135324 | 548 |
| 66 | 3300005439 | Ga0070711_100000978 | Ga0070711_1000009786 | 548 |
| 67 | 3300005457 | Ga0070662_100006661 | Ga0070662_1000066611 | 548 |
| 68 | 3300005457 | Ga0070662_100055719 | Ga0070662_1000557191 | 548 |
| 69 | 3300005459 | Ga0068867_100013882 | Ga0068867_1000138825 | 548 |
| 70 | 3300005530 | Ga0070679_100008309 | Ga0070679_1000083095 | 548 |
| 71 | 3300005544 | Ga0070686_100043296 | Ga0070686_1000432962 | 548 |
| 72 | 3300005563 | Ga0068855_100000782 | Ga0068855_10000078235 | 548 |
| 73 | 3300005563 | Ga0068855_100003547 | Ga0068855_10000354710 | 548 |
| 74 | 3300005563 | Ga0068855_100053155 | Ga0068855_1000531552 | 548 |
| 75 | 3300005564 | Ga0070664_100001991 | Ga0070664_1000019919 | 548 |
| 76 | 3300005577 | Ga0068857_100000775 | Ga0068857_10000077513 | 548 |
| 77 | 3300005614 | Ga0068856_100002380 | Ga0068856_1000023805 | 548 |
| 78 | 3300005614 | Ga0068856_100007577 | Ga0068856_1000075772 | 548 |
| 79 | 3300005616 | Ga0068852_100056292 | Ga0068852_1000562923 | 548 |
| 80 | 3300005617 | Ga0068859_100000298 | Ga0068859_10000029831 | 548 |
| 81 | 3300005618 | Ga0068864_100002195 | Ga0068864_1000021955 | 548 |
| 82 | 3300005718 | Ga0068866_10008165 | Ga0068866_100081656 | 548 |
| 83 | 3300005841 | Ga0068863_100016274 | Ga0068863_1000162745 | 548 |
| 84 | 3300005842 | Ga0068858_100049497 | Ga0068858_1000494972 | 548 |
| 85 | 3300006237 | Ga0097621_100007702 | Ga0097621_1000077024 | 548 |
| 86 | 3300006237 | Ga0097621_100043545 | Ga0097621_1000435452 | 548 |
| 87 | 3300006358 | Ga0068871_100086608 | Ga0068871_1000866081 | 548 |
| 88 | 3300006931 | Ga0097620_100000298 | Ga0097620_10000029831 | 548 |
| 89 | 3300009174 | Ga0105241_10048402 | Ga0105241_100484022 | 548 |
| 90 | 3300013100 | Ga0157373_10005980 | Ga0157373_100059807 | 548 |
| 91 | 3300013105 | Ga0157369_10104410 | Ga0157369_101044104 | 548 |
| 92 | 3300013296 | Ga0157374_10001545 | Ga0157374_1000154513 | 548 |
| 93 | 3300013296 | Ga0157374_10001876 | Ga0157374_1000187611 | 548 |
| 94 | 3300013297 | Ga0157378_10000133 | Ga0157378_1000013332 | 548 |
| 95 | 3300013297 | Ga0157378_10000970 | Ga0157378_1000097012 | 548 |
| 96 | 3300013307 | Ga0157372_10000749 | Ga0157372_1000074921 | 548 |
| 97 | 3300014969 | Ga0157376_10030563 | Ga0157376_100305632 | 548 |
| 98 | 3300025899 | Ga0207642_10018659 | Ga0207642_100186592 | 548 |
| 99 | 3300025912 | Ga0207707_10045468 | Ga0207707_100454682 | 548 |
| 100 | 3300025924 | Ga0207694_10126471 | Ga0207694_101264711 | 548 |
| 101 | 3300025925 | Ga0207650_10097734 | Ga0207650_100977341 | 548 |
| 102 | 3300025939 | Ga0207665_10034736 | Ga0207665_100347361 | 548 |
| 103 | 3300025949 | Ga0207667_10001648 | Ga0207667_1000164822 | 548 |
| 104 | 3300026023 | Ga0207677_10000965 | Ga0207677_100009652 | 548 |
| 105 | 3300026023 | Ga0207677_10008533 | Ga0207677_100085334 | 548 |
| 106 | 3300026078 | Ga0207702_10006374 | Ga0207702_100063742 | 548 |
| 107 | 3300026078 | Ga0207702_10012397 | Ga0207702_100123972 | 548 |
| 108 | 3300026088 | Ga0207641_10044327 | Ga0207641_100443272 | 548 |
| 109 | 3300026089 | Ga0207648_10005961 | Ga0207648_1000596111 | 548 |
| 110 | 3300026089 | Ga0207648_10026574 | Ga0207648_100265742 | 548 |
| 111 | 3300026116 | Ga0207674_10000165 | Ga0207674_1000016557 | 548 |
| 112 | 3300028381 | Ga0268264_10132466 | Ga0268264_101324661 | 548 |
| 113 | 3300036401 | Ga0373937_0008811 | Ga0373937_0008811_435_2219 | 548 |
| 114 | 3300037068 | Ga0373925_0031504 | Ga0373925_0031504_124_1893 | 548 |
| 115 | 3300039438 | Ga0436360_0812878 | Ga0436360_0812878_4071_5834 | 548 |
| 116 | 3300039447 | Ga0436361_0445142 | Ga0436361_0445142_2884_4647 | 548 |
| 117 | 3300044694 | Ga0466963_0085991 | Ga0466963_0085991_103_1893 | 548 |
| 118 | 3300046472 | Ga0495580_0000196 | Ga0495580_0000196_18621_20390 | 548 |
| 119 | 3300046536 | Ga0495587_0047676 | Ga0495587_0047676_727_2511 | 548 |
| 120 | 3300048915 | Ga0496112_0006599 | Ga0496112_0006599_948_2726 | 548 |
| 121 | 3300050514 | nmdc:mga08x19_45101_c1 | nmdc:mga08x19_45101_c1_45_1823 | 548 |
| 122 | 3300005437 | Ga0070710_10011850 | Ga0070710_100118504 | 549 |
| 123 | 3300005719 | Ga0068861_100018277 | Ga0068861_1000182772 | 549 |
| 124 | 3300006028 | Ga0070717_10020970 | Ga0070717_100209702 | 549 |
| 125 | 3300009093 | Ga0105240_10114614 | Ga0105240_101146141 | 549 |
| 126 | 3300013307 | Ga0157372_10032747 | Ga0157372_100327474 | 549 |
| 127 | 3300013308 | Ga0157375_10094309 | Ga0157375_100943092 | 549 |
| 128 | 3300025904 | Ga0207647_10010301 | Ga0207647_100103013 | 549 |
| 129 | 3300025929 | Ga0207664_10103937 | Ga0207664_101039371 | 549 |
| 130 | 3300026118 | Ga0207675_100025155 | Ga0207675_1000251552 | 549 |
| 131 | 3300025898 | Ga0207692_10001347 | Ga0207692_100013472 | 550 |
| 132 | 3300050511 | nmdc:mga08y16_39505_c1 | nmdc:mga08y16_39505_c1_499_2190 | 550 |
| 133 | 3300022734 | Ga0224571_100064 | Ga0224571_1000642 | 556 |
| 134 | 3300036401 | Ga0373937_0140408 | Ga0373937_0140408_265_2007 | 558 |
| 135 | 3300006175 | Ga0070712_100001481 | Ga0070712_1000014818 | 559 |
| 136 | 3300006175 | Ga0070712_100065704 | Ga0070712_1000657042 | 559 |
| 137 | 3300025915 | Ga0207693_10006481 | Ga0207693_100064814 | 559 |
| 138 | 3300025915 | Ga0207693_10122674 | Ga0207693_101226741 | 559 |
| 139 | 3300031711 | Ga0265314_10000699 | Ga0265314_100006993 | 559 |
| 140 | 3300046455 | Ga0495603_0043373 | Ga0495603_0043373_472_2247 | 559 |
| 141 | 3300046472 | Ga0495580_0000848 | Ga0495580_0000848_3969_5750 | 559 |
| 142 | 3300046472 | Ga0495580_0008930 | Ga0495580_0008930_1268_3043 | 559 |
| 143 | 3300050515 | nmdc:mga0a205_3935_c2 | nmdc:mga0a205_3935_c2_8683_10458 | 559 |
| 144 | 3300005539 | Ga0068853_100186634 | Ga0068853_1001866341 | 560 |
| 145 | 3300005354 | Ga0070675_100000272 | Ga0070675_10000027211 | 561 |
| 146 | 3300005355 | Ga0070671_100026358 | Ga0070671_1000263582 | 561 |
| 147 | 3300005466 | Ga0070685_10002349 | Ga0070685_100023495 | 561 |
| 148 | 3300009094 | Ga0111539_10249249 | Ga0111539_102492492 | 561 |
| 149 | 3300013297 | Ga0157378_10060554 | Ga0157378_100605543 | 561 |
| 150 | 3300022732 | Ga0224569_100199 | Ga0224569_1001995 | 561 |
| 151 | 3300025926 | Ga0207659_10000152 | Ga0207659_100001528 | 561 |
| 152 | 3300025926 | Ga0207659_10031266 | Ga0207659_100312662 | 561 |
| 153 | 3300025960 | Ga0207651_10011141 | Ga0207651_100111413 | 561 |
| 154 | 3300026118 | Ga0207675_100186455 | Ga0207675_1001864552 | 561 |
| 155 | 3300028380 | Ga0268265_10065825 | Ga0268265_100658252 | 561 |
| 156 | 3300037466 | Ga0395898_0101689 | Ga0395898_0101689_939_2738 | 561 |
| 157 | 3300039450 | Ga0436363_0811887 | Ga0436363_0811887_105_1922 | 561 |
| 158 | 3300039453 | Ga0436362_0197917 | Ga0436362_0197917_1117_2934 | 561 |
| 159 | 3300005434 | Ga0070709_10056280 | Ga0070709_100562801 | 562 |
| 160 | 3300005435 | Ga0070714_100000051 | Ga0070714_100000051111 | 562 |
| 161 | 3300005435 | Ga0070714_100009776 | Ga0070714_1000097767 | 562 |
| 162 | 3300005436 | Ga0070713_100000378 | Ga0070713_10000037810 | 562 |
| 163 | 3300005439 | Ga0070711_100000549 | Ga0070711_1000005494 | 562 |
| 164 | 3300005445 | Ga0070708_100039219 | Ga0070708_1000392194 | 562 |
| 165 | 3300006028 | Ga0070717_10012598 | Ga0070717_100125982 | 562 |
| 166 | 3300006028 | Ga0070717_10074261 | Ga0070717_100742614 | 562 |
| 167 | 3300006175 | Ga0070712_100000273 | Ga0070712_10000027317 | 562 |
| 168 | 3300006175 | Ga0070712_100057983 | Ga0070712_1000579832 | 562 |
| 169 | 3300009093 | Ga0105240_10040442 | Ga0105240_100404425 | 562 |
| 170 | 3300013307 | Ga0157372_10014436 | Ga0157372_100144365 | 562 |
| 171 | 3300025916 | Ga0207663_10003872 | Ga0207663_100038721 | 562 |
| 172 | 3300025929 | Ga0207664_10000029 | Ga0207664_1000002980 | 562 |
| 173 | 3300025939 | Ga0207665_10005205 | Ga0207665_100052057 | 562 |
| 174 | 3300030760 | Ga0265762_1000798 | Ga0265762_10007982 | 562 |
| 175 | 3300031090 | Ga0265760_10000370 | Ga0265760_100003709 | 562 |
| 176 | 3300031235 | Ga0265330_10002597 | Ga0265330_100025972 | 562 |
| 177 | 3300031241 | Ga0265325_10018324 | Ga0265325_100183242 | 562 |
| 178 | 3300031249 | Ga0265339_10012233 | Ga0265339_100122334 | 562 |
| 179 | 3300031711 | Ga0265314_10019828 | Ga0265314_100198282 | 562 |
| 180 | 3300033545 | Ga0316214_1000994 | Ga0316214_10009942 | 562 |
| 181 | 3300035083 | Ga0373926_0016950 | Ga0373926_0016950_265_2082 | 562 |
| 182 | 3300035116 | Ga0373945_0000791 | Ga0373945_0000791_6789_8606 | 562 |
| 183 | 3300035116 | Ga0373945_0013509 | Ga0373945_0013509_743_2560 | 562 |
| 184 | 3300035119 | Ga0373956_0017899 | Ga0373956_0017899_1155_2972 | 562 |
| 185 | 3300035170 | Ga0373943_0001897 | Ga0373943_0001897_1584_3401 | 562 |
| 186 | 3300035171 | Ga0373946_0005289 | Ga0373946_0005289_1927_3744 | 562 |
| 187 | 3300035692 | Ga0373935_0015517 | Ga0373935_0015517_799_2616 | 562 |
| 188 | 3300035695 | Ga0373927_0000070 | Ga0373927_0000070_53814_55631 | 562 |
| 189 | 3300035695 | Ga0373927_0085522 | Ga0373927_0085522_219_2036 | 562 |
| 190 | 3300035725 | Ga0373947_0001681 | Ga0373947_0001681_4288_6105 | 562 |
| 191 | 3300037068 | Ga0373925_0001143 | Ga0373925_0001143_21692_23509 | 562 |
| 192 | 3300046472 | Ga0495580_0006140 | Ga0495580_0006140_4231_6048 | 562 |
| 193 | 3300046477 | Ga0495664_0033834 | Ga0495664_0033834_248_2065 | 562 |
| 194 | 3300046517 | Ga0495630_0022152 | Ga0495630_0022152_1773_3590 | 562 |
| 195 | 3300047319 | Ga0495674_0007954 | Ga0495674_0007954_6385_8202 | 562 |
| 196 | 3300048918 | Ga0496115_0001879 | Ga0496115_0001879_4407_6224 | 562 |
| 197 | 3300050512 | nmdc:mga0n895_1225_c1 | nmdc:mga0n895_1225_c1_4322_6139 | 563 |
| 198 | 3300050513 | nmdc:mga0rr50_1542_c1 | nmdc:mga0rr50_1542_c1_6810_8627 | 563 |
| 199 | 3300050514 | nmdc:mga08x19_50237_c1 | nmdc:mga08x19_50237_c1_453_2270 | 563 |
| 200 | 3300050515 | nmdc:mga0a205_1296_c1 | nmdc:mga0a205_1296_c1_6460_8277 | 563 |
| 201 | 3300005328 | Ga0070676_10004901 | Ga0070676_100049015 | 564 |
| 202 | 3300005334 | Ga0068869_100058096 | Ga0068869_1000580963 | 564 |
| 203 | 3300005335 | Ga0070666_10005555 | Ga0070666_100055553 | 564 |
| 204 | 3300005339 | Ga0070660_100105734 | Ga0070660_1001057341 | 564 |
| 205 | 3300005366 | Ga0070659_100004425 | Ga0070659_1000044256 | 564 |
| 206 | 3300005435 | Ga0070714_100053759 | Ga0070714_1000537593 | 564 |
| 207 | 3300005445 | Ga0070708_100006013 | Ga0070708_1000060136 | 564 |
| 208 | 3300005455 | Ga0070663_100007600 | Ga0070663_1000076003 | 564 |
| 209 | 3300005467 | Ga0070706_100003417 | Ga0070706_1000034176 | 564 |
| 210 | 3300005530 | Ga0070679_100006248 | Ga0070679_1000062483 | 564 |
| 211 | 3300005536 | Ga0070697_100000532 | Ga0070697_10000053216 | 564 |
| 212 | 3300005539 | Ga0068853_100114740 | Ga0068853_1001147402 | 564 |
| 213 | 3300005578 | Ga0068854_100009011 | Ga0068854_1000090112 | 564 |
| 214 | 3300005614 | Ga0068856_100045911 | Ga0068856_1000459114 | 564 |
| 215 | 3300006028 | Ga0070717_10010141 | Ga0070717_100101413 | 564 |
| 216 | 3300006173 | Ga0070716_100010911 | Ga0070716_1000109112 | 564 |
| 217 | 3300009093 | Ga0105240_10005889 | Ga0105240_100058895 | 564 |
| 218 | 3300009101 | Ga0105247_10038022 | Ga0105247_100380223 | 564 |
| 219 | 3300009148 | Ga0105243_10025697 | Ga0105243_100256973 | 564 |
| 220 | 3300009174 | Ga0105241_10046513 | Ga0105241_100465133 | 564 |
| 221 | 3300009174 | Ga0105241_10065482 | Ga0105241_100654822 | 564 |
| 222 | 3300009551 | Ga0105238_10000532 | Ga0105238_100005326 | 564 |
| 223 | 3300009553 | Ga0105249_10015894 | Ga0105249_100158942 | 564 |
| 224 | 3300013102 | Ga0157371_10013605 | Ga0157371_100136055 | 564 |
| 225 | 3300013105 | Ga0157369_10001530 | Ga0157369_1000153024 | 564 |
| 226 | 3300013105 | Ga0157369_10005098 | Ga0157369_100050985 | 564 |
| 227 | 3300013105 | Ga0157369_10025320 | Ga0157369_100253202 | 564 |
| 228 | 3300013105 | Ga0157369_10025809 | Ga0157369_100258095 | 564 |
| 229 | 3300013105 | Ga0157369_10036516 | Ga0157369_100365164 | 564 |
| 230 | 3300013296 | Ga0157374_10000357 | Ga0157374_1000035710 | 564 |
| 231 | 3300013296 | Ga0157374_10005940 | Ga0157374_100059406 | 564 |
| 232 | 3300013296 | Ga0157374_10044937 | Ga0157374_100449373 | 564 |
| 233 | 3300013296 | Ga0157374_10117077 | Ga0157374_101170772 | 564 |
| 234 | 3300013297 | Ga0157378_10166368 | Ga0157378_101663681 | 564 |
| 235 | 3300013306 | Ga0163162_10014559 | Ga0163162_100145595 | 564 |
| 236 | 3300013307 | Ga0157372_10000544 | Ga0157372_1000054428 | 564 |
| 237 | 3300013308 | Ga0157375_10122690 | Ga0157375_101226903 | 564 |
| 238 | 3300014325 | Ga0163163_10112476 | Ga0163163_101124762 | 564 |
| 239 | 3300014968 | Ga0157379_10024613 | Ga0157379_100246131 | 564 |
| 240 | 3300025910 | Ga0207684_10008706 | Ga0207684_100087068 | 564 |
| 241 | 3300025911 | Ga0207654_10011498 | Ga0207654_100114981 | 564 |
| 242 | 3300025917 | Ga0207660_10059817 | Ga0207660_100598171 | 564 |
| 243 | 3300025919 | Ga0207657_10003087 | Ga0207657_100030876 | 564 |
| 244 | 3300025921 | Ga0207652_10139531 | Ga0207652_101395311 | 564 |
| 245 | 3300025927 | Ga0207687_10020293 | Ga0207687_100202933 | 564 |
| 246 | 3300025949 | Ga0207667_10014978 | Ga0207667_100149789 | 564 |
| 247 | 3300026041 | Ga0207639_10037881 | Ga0207639_100378811 | 564 |
| 248 | 3300026067 | Ga0207678_10001085 | Ga0207678_100010859 | 564 |
| 249 | 3300026116 | Ga0207674_10070173 | Ga0207674_100701732 | 564 |
| 250 | 3300028800 | Ga0265338_10000759 | Ga0265338_1000075927 | 564 |
| 251 | 3300028800 | Ga0265338_10021457 | Ga0265338_100214576 | 564 |
| 252 | 3300031235 | Ga0265330_10000495 | Ga0265330_1000049519 | 564 |
| 253 | 3300031241 | Ga0265325_10000217 | Ga0265325_1000021710 | 564 |
| 254 | 3300031249 | Ga0265339_10005819 | Ga0265339_100058196 | 564 |
| 255 | 3300031249 | Ga0265339_10008925 | Ga0265339_100089253 | 564 |
| 256 | 3300031344 | Ga0265316_10000390 | Ga0265316_100003902 | 564 |
| 257 | 3300031344 | Ga0265316_10029989 | Ga0265316_100299892 | 564 |
| 258 | 3300031595 | Ga0265313_10002475 | Ga0265313_100024757 | 564 |
| 259 | 3300031712 | Ga0265342_10001956 | Ga0265342_1000195610 | 564 |
| 260 | 3300031712 | Ga0265342_10037573 | Ga0265342_100375733 | 564 |
| 261 | 3300031995 | Ga0307409_100013197 | Ga0307409_1000131973 | 564 |
| 262 | 3300035172 | Ga0373955_0000430 | Ga0373955_0000430_15603_17381 | 564 |
| 263 | 3300035725 | Ga0373947_0055668 | Ga0373947_0055668_433_2244 | 564 |
| 264 | 3300036401 | Ga0373937_0000772 | Ga0373937_0000772_21600_23378 | 564 |
| 265 | 3300037068 | Ga0373925_0007680 | Ga0373925_0007680_2701_4479 | 564 |
| 266 | 3300045976 | Ga0466967_0001326 | Ga0466967_0001326_11939_13759 | 564 |
| 267 | 3300046683 | Ga0495658_0032708 | Ga0495658_0032708_650_2428 | 564 |
| 268 | 3300048088 | Ga0495602_0026743 | Ga0495602_0026743_1316_3148 | 564 |
| 269 | 3300048905 | Ga0496102_0005785 | Ga0496102_0005785_5463_7271 | 564 |
| 270 | 3300048906 | Ga0496103_0004124 | Ga0496103_0004124_5900_7708 | 564 |
| 271 | 3300048907 | Ga0496104_0031520 | Ga0496104_0031520_2840_4672 | 564 |
| 272 | 3300048907 | Ga0496104_0096075 | Ga0496104_0096075_203_2011 | 564 |
| 273 | 3300048907 | Ga0496104_0200606 | Ga0496104_0200606_54_1862 | 564 |
| 274 | 3300048913 | Ga0496110_0018500 | Ga0496110_0018500_248_2029 | 564 |
| 275 | 3300048914 | Ga0496111_0002956 | Ga0496111_0002956_8422_10203 | 564 |
| 276 | 3300048915 | Ga0496112_0003539 | Ga0496112_0003539_9509_11341 | 564 |
| 277 | 3300005435 | Ga0070714_100088522 | Ga0070714_1000885221 | 565 |
| 278 | 3300006028 | Ga0070717_10087238 | Ga0070717_100872381 | 565 |
| 279 | 3300009093 | Ga0105240_10026789 | Ga0105240_100267892 | 565 |
| 280 | 3300013307 | Ga0157372_10001201 | Ga0157372_1000120119 | 565 |
| 281 | 3300003373 | JGI25407J50210_10007439 | JGI25407J50210_100074392 | 566 |
| 282 | 3300005338 | Ga0068868_100038280 | Ga0068868_1000382802 | 566 |
| 283 | 3300005981 | Ga0081538_10000196 | Ga0081538_1000019620 | 566 |
| 284 | 3300006871 | Ga0075434_100013793 | Ga0075434_1000137935 | 566 |
| 285 | 3300007076 | Ga0075435_100000849 | Ga0075435_10000084913 | 566 |
| 286 | 3300009094 | Ga0111539_10084133 | Ga0111539_100841331 | 566 |
| 287 | 3300009553 | Ga0105249_10070577 | Ga0105249_100705773 | 566 |
| 288 | 3300009553 | Ga0105249_10073058 | Ga0105249_100730583 | 566 |
| 289 | 3300010375 | Ga0105239_10106275 | Ga0105239_101062752 | 566 |
| 290 | 3300025942 | Ga0207689_10034197 | Ga0207689_100341975 | 566 |
| 291 | 3300025961 | Ga0207712_10037752 | Ga0207712_100377521 | 566 |
| 292 | 3300046492 | Ga0495585_0034587 | Ga0495585_0034587_574_2319 | 566 |
| 293 | 3300046515 | Ga0495620_0010132 | Ga0495620_0010132_1590_3335 | 566 |
| 294 | 3300046523 | Ga0495644_0015793 | Ga0495644_0015793_542_2287 | 566 |
| 295 | 3300046538 | Ga0495609_0006375 | Ga0495609_0006375_4028_5773 | 566 |
| 296 | 3300048913 | Ga0496110_0000862 | Ga0496110_0000862_547_2292 | 566 |
| 297 | 3300048914 | Ga0496111_0021817 | Ga0496111_0021817_1398_3143 | 566 |
| 298 | 3300049569 | Ga0501032_0066449 | Ga0501032_0066449_135_1865 | 566 |
| 299 | 3300049575 | Ga0501039_0067587 | Ga0501039_0067587_206_1936 | 566 |
| 300 | 3300049580 | Ga0501046_0069001 | Ga0501046_0069001_967_2697 | 566 |
| 301 | 3300049583 | Ga0501067_0002232 | Ga0501067_0002232_7459_9204 | 566 |
| 302 | 3300049585 | Ga0501069_0003510 | Ga0501069_0003510_829_2574 | 566 |
| 303 | 3300049588 | Ga0501072_0059457 | Ga0501072_0059457_1148_2878 | 566 |
| 304 | 3300049589 | Ga0501073_0015703 | Ga0501073_0015703_1457_3157 | 566 |
| 305 | 3300049593 | Ga0501077_0013555 | Ga0501077_0013555_1289_3019 | 566 |
| 306 | 3300050507 | nmdc:mga05p37_1051_c1 | nmdc:mga05p37_1051_c1_21476_23197 | 566 |
| 307 | 3300050507 | nmdc:mga05p37_1788_c1 | nmdc:mga05p37_1788_c1_19898_21598 | 566 |
| 308 | 3300050507 | nmdc:mga05p37_84214_c1 | nmdc:mga05p37_84214_c1_1808_3571 | 566 |
| 309 | 3300050508 | nmdc:mga09592_28247_c1 | nmdc:mga09592_28247_c1_926_2647 | 566 |
| 310 | 3300050509 | nmdc:mga0qj67_2704_c1 | nmdc:mga0qj67_2704_c1_900_2621 | 566 |
| 311 | 3300050511 | nmdc:mga08y16_26215_c1 | nmdc:mga08y16_26215_c1_1153_2898 | 566 |
| 312 | 3300050512 | nmdc:mga0n895_145662_c1 | nmdc:mga0n895_145662_c1_606_2306 | 566 |
| 313 | 3300050512 | nmdc:mga0n895_3475_c1 | nmdc:mga0n895_3475_c1_8690_10453 | 566 |
| 314 | 3300050513 | nmdc:mga0rr50_3136_c1 | nmdc:mga0rr50_3136_c1_4337_6100 | 566 |
| 315 | 3300050513 | nmdc:mga0rr50_73200_c1 | nmdc:mga0rr50_73200_c1_104_1804 | 566 |
| 316 | 3300050514 | nmdc:mga08x19_3059_c1 | nmdc:mga08x19_3059_c1_2510_4273 | 566 |
| 317 | 3300050515 | nmdc:mga0a205_10374_c1 | nmdc:mga0a205_10374_c1_4640_6340 | 566 |
| 318 | 3300054114 | Ga0501084_0003965 | Ga0501084_0003965_1116_2846 | 566 |
| 319 | 3300060353 | Ga0501082_0050102 | Ga0501082_0050102_108_1838 | 566 |
| 320 | 3300061734 | Ga0530510_0001350 | Ga0530510_0001350_5178_6908 | 566 |
| 321 | 3300014968 | Ga0157379_10058186 | Ga0157379_100581864 | 567 |
| 322 | 3300025926 | Ga0207659_10000181 | Ga0207659_1000018139 | 567 |
| 323 | 3300005435 | Ga0070714_100000121 | Ga0070714_10000012122 | 568 |
| 324 | 3300005535 | Ga0070684_100024487 | Ga0070684_1000244872 | 568 |
| 325 | 3300005841 | Ga0068863_100013736 | Ga0068863_1000137363 | 568 |
| 326 | 3300014325 | Ga0163163_10142638 | Ga0163163_101426382 | 568 |
| 327 | 3300025929 | Ga0207664_10000112 | Ga0207664_1000011220 | 568 |
| 328 | 3300026088 | Ga0207641_10042648 | Ga0207641_100426482 | 568 |
| 329 | 3300026116 | Ga0207674_10051442 | Ga0207674_100514422 | 568 |
| 330 | 3300036401 | Ga0373937_0129814 | Ga0373937_0129814_160_1986 | 568 |
| 331 | 3300037471 | Ga0395905_0011711 | Ga0395905_0011711_1985_3802 | 568 |
| 332 | 3300046539 | Ga0495621_0006888 | Ga0495621_0006888_160_1890 | 568 |
| 333 | 3300048912 | Ga0496109_0105099 | Ga0496109_0105099_555_2381 | 568 |
| 334 | 3300048915 | Ga0496112_0014512 | Ga0496112_0014512_153_1979 | 568 |
| 335 | 3300005338 | Ga0068868_100115444 | Ga0068868_1001154442 | 569 |
| 336 | 3300013296 | Ga0157374_10149399 | Ga0157374_101493992 | 569 |
| 337 | 3300014325 | Ga0163163_10134079 | Ga0163163_101340792 | 569 |
| 338 | 3300049571 | Ga0501034_0035712 | Ga0501034_0035712_1054_2817 | 569 |
| 339 | 3300049581 | Ga0501047_0009879 | Ga0501047_0009879_5625_7388 | 569 |
| 340 | 3300049823 | Ga0501044_0006636 | Ga0501044_0006636_10139_11902 | 569 |
| 341 | 3300005336 | Ga0070680_100024098 | Ga0070680_1000240983 | 570 |
| 342 | 3300005530 | Ga0070679_100006733 | Ga0070679_1000067332 | 570 |
| 343 | 3300005530 | Ga0070679_100106427 | Ga0070679_1001064272 | 570 |
| 344 | 3300005578 | Ga0068854_100057364 | Ga0068854_1000573642 | 570 |
| 345 | 3300025912 | Ga0207707_10103251 | Ga0207707_101032512 | 570 |
| 346 | 3300035410 | Ga0373924_0003014 | Ga0373924_0003014_3773_5557 | 570 |
| 347 | 3300044842 | Ga0466957_0001064 | Ga0466957_0001064_8035_9819 | 570 |
| 348 | 3300045976 | Ga0466967_0003357 | Ga0466967_0003357_528_2312 | 570 |
| 349 | 3300046531 | Ga0495665_0041908 | Ga0495665_0041908_265_2049 | 570 |
| 350 | 3300046675 | Ga0495657_0054595 | Ga0495657_0054595_130_1914 | 570 |
| 351 | 3300047315 | Ga0495581_0014727 | Ga0495581_0014727_756_2540 | 570 |
| 352 | 3300048913 | Ga0496110_0085458 | Ga0496110_0085458_825_2609 | 570 |
| 353 | 3300048915 | Ga0496112_0027695 | Ga0496112_0027695_724_2508 | 570 |
| 354 | 3300048915 | Ga0496112_0084871 | Ga0496112_0084871_624_2408 | 570 |
| 355 | 3300005354 | Ga0070675_100000005 | Ga0070675_10000000591 | 571 |
| 356 | 3300005439 | Ga0070711_100010586 | Ga0070711_1000105863 | 571 |
| 357 | 3300005441 | Ga0070700_100000096 | Ga0070700_10000009626 | 571 |
| 358 | 3300005578 | Ga0068854_100010352 | Ga0068854_1000103522 | 571 |
| 359 | 3300006173 | Ga0070716_100000096 | Ga0070716_10000009611 | 571 |
| 360 | 3300006175 | Ga0070712_100002426 | Ga0070712_1000024266 | 571 |
| 361 | 3300006852 | Ga0075433_10003220 | Ga0075433_100032203 | 571 |
| 362 | 3300025915 | Ga0207693_10006471 | Ga0207693_100064714 | 571 |
| 363 | 3300025919 | Ga0207657_10002770 | Ga0207657_100027707 | 571 |
| 364 | 3300025926 | Ga0207659_10000019 | Ga0207659_10000019119 | 571 |
| 365 | 3300025928 | Ga0207700_10084705 | Ga0207700_100847052 | 571 |
| 366 | 3300025939 | Ga0207665_10000667 | Ga0207665_1000066711 | 571 |
| 367 | 3300026075 | Ga0207708_10000034 | Ga0207708_1000003480 | 571 |
| 368 | 3300005334 | Ga0068869_100039553 | Ga0068869_1000395533 | 572 |
| 369 | 3300005347 | Ga0070668_100137236 | Ga0070668_1001372362 | 572 |
| 370 | 3300005535 | Ga0070684_100050642 | Ga0070684_1000506422 | 572 |
| 371 | 3300005577 | Ga0068857_100016925 | Ga0068857_1000169253 | 572 |
| 372 | 3300005981 | Ga0081538_10001685 | Ga0081538_1000168521 | 572 |
| 373 | 3300005981 | Ga0081538_10007985 | Ga0081538_100079853 | 572 |
| 374 | 3300006844 | Ga0075428_100177406 | Ga0075428_1001774062 | 572 |
| 375 | 3300006846 | Ga0075430_100064572 | Ga0075430_1000645722 | 572 |
| 376 | 3300006880 | Ga0075429_100009133 | Ga0075429_1000091337 | 572 |
| 377 | 3300009094 | Ga0111539_10000795 | Ga0111539_100007959 | 572 |
| 378 | 3300010375 | Ga0105239_10098682 | Ga0105239_100986823 | 572 |
| 379 | 3300025909 | Ga0207705_10080002 | Ga0207705_100800021 | 572 |
| 380 | 3300025927 | Ga0207687_10007174 | Ga0207687_100071745 | 572 |
| 381 | 3300025944 | Ga0207661_10063054 | Ga0207661_100630542 | 572 |
| 382 | 3300026075 | Ga0207708_10000401 | Ga0207708_1000040114 | 572 |
| 383 | 3300026089 | Ga0207648_10011357 | Ga0207648_100113572 | 572 |
| 384 | 3300026095 | Ga0207676_10048758 | Ga0207676_100487582 | 572 |
| 385 | 3300026116 | Ga0207674_10020151 | Ga0207674_100201515 | 572 |
| 386 | 3300031824 | Ga0307413_10003211 | Ga0307413_100032117 | 572 |
| 387 | 3300031911 | Ga0307412_10005543 | Ga0307412_100055437 | 572 |
| 388 | 3300031995 | Ga0307409_100031021 | Ga0307409_1000310213 | 572 |
| 389 | 3300032126 | Ga0307415_100002658 | Ga0307415_1000026588 | 572 |
| 390 | 3300049570 | Ga0501033_0001466 | Ga0501033_0001466_11811_13550 | 572 |
| 391 | 3300049571 | Ga0501034_0021241 | Ga0501034_0021241_3854_5593 | 572 |
| 392 | 3300049571 | Ga0501034_0030656 | Ga0501034_0030656_248_1987 | 572 |
| 393 | 3300049572 | Ga0501036_0002139 | Ga0501036_0002139_8979_10718 | 572 |
| 394 | 3300049572 | Ga0501036_0008849 | Ga0501036_0008849_1631_3370 | 572 |
| 395 | 3300049573 | Ga0501037_0000070 | Ga0501037_0000070_22151_23890 | 572 |
| 396 | 3300049573 | Ga0501037_0004528 | Ga0501037_0004528_2554_4293 | 572 |
| 397 | 3300049574 | Ga0501038_0000082 | Ga0501038_0000082_54109_55848 | 572 |
| 398 | 3300049575 | Ga0501039_0000077 | Ga0501039_0000077_27570_29309 | 572 |
| 399 | 3300049575 | Ga0501039_0004672 | Ga0501039_0004672_5681_7420 | 572 |
| 400 | 3300049575 | Ga0501039_0061470 | Ga0501039_0061470_111_1850 | 572 |
| 401 | 3300049576 | Ga0501040_0000048 | Ga0501040_0000048_27793_29532 | 572 |
| 402 | 3300049576 | Ga0501040_0000330 | Ga0501040_0000330_24170_25909 | 572 |
| 403 | 3300049577 | Ga0501041_0000007 | Ga0501041_0000007_17473_19212 | 572 |
| 404 | 3300049577 | Ga0501041_0003269 | Ga0501041_0003269_1281_3020 | 572 |
| 405 | 3300049578 | Ga0501042_0000011 | Ga0501042_0000011_53994_55733 | 572 |
| 406 | 3300049578 | Ga0501042_0001198 | Ga0501042_0001198_3027_4766 | 572 |
| 407 | 3300049579 | Ga0501043_0000208 | Ga0501043_0000208_46017_47756 | 572 |
| 408 | 3300049580 | Ga0501046_0000089 | Ga0501046_0000089_54049_55788 | 572 |
| 409 | 3300049581 | Ga0501047_0000237 | Ga0501047_0000237_33044_34783 | 572 |
| 410 | 3300049582 | Ga0501048_0037208 | Ga0501048_0037208_373_2112 | 572 |
| 411 | 3300049584 | Ga0501068_0000856 | Ga0501068_0000856_11693_13432 | 572 |
| 412 | 3300049585 | Ga0501069_0000139 | Ga0501069_0000139_15319_17058 | 572 |
| 413 | 3300049586 | Ga0501070_0000234 | Ga0501070_0000234_46598_48337 | 572 |
| 414 | 3300049587 | Ga0501071_0068948 | Ga0501071_0068948_455_2203 | 572 |
| 415 | 3300049588 | Ga0501072_0001511 | Ga0501072_0001511_15595_17334 | 572 |
| 416 | 3300049588 | Ga0501072_0001977 | Ga0501072_0001977_5071_6810 | 572 |
| 417 | 3300049589 | Ga0501073_0001338 | Ga0501073_0001338_14788_16527 | 572 |
| 418 | 3300049590 | Ga0501074_0000002 | Ga0501074_0000002_55906_57645 | 572 |
| 419 | 3300049591 | Ga0501075_0000782 | Ga0501075_0000782_15723_17462 | 572 |
| 420 | 3300049592 | Ga0501076_0000167 | Ga0501076_0000167_36348_38087 | 572 |
| 421 | 3300049592 | Ga0501076_0000246 | Ga0501076_0000246_7662_9401 | 572 |
| 422 | 3300049593 | Ga0501077_0000090 | Ga0501077_0000090_17398_19137 | 572 |
| 423 | 3300049593 | Ga0501077_0001464 | Ga0501077_0001464_5469_7208 | 572 |
| 424 | 3300049742 | Ga0501080_0001053 | Ga0501080_0001053_9294_11033 | 572 |
| 425 | 3300049742 | Ga0501080_0022833 | Ga0501080_0022833_789_2528 | 572 |
| 426 | 3300049743 | Ga0501081_0000112 | Ga0501081_0000112_27642_29381 | 572 |
| 427 | 3300049743 | Ga0501081_0000598 | Ga0501081_0000598_17473_19212 | 572 |
| 428 | 3300049743 | Ga0501081_0023338 | Ga0501081_0023338_1139_2878 | 572 |
| 429 | 3300049744 | Ga0501083_0033740 | Ga0501083_0033740_487_2226 | 572 |
| 430 | 3300049822 | Ga0501035_0006035 | Ga0501035_0006035_5071_6810 | 572 |
| 431 | 3300049822 | Ga0501035_0065057 | Ga0501035_0065057_1402_3141 | 572 |
| 432 | 3300049823 | Ga0501044_0004943 | Ga0501044_0004943_3888_5627 | 572 |
| 433 | 3300049824 | Ga0501045_0008702 | Ga0501045_0008702_4060_5799 | 572 |
| 434 | 3300049824 | Ga0501045_0046589 | Ga0501045_0046589_121_1860 | 572 |
| 435 | 3300054114 | Ga0501084_0000332 | Ga0501084_0000332_23080_24819 | 572 |
| 436 | 3300054114 | Ga0501084_0021307 | Ga0501084_0021307_2319_4058 | 572 |
| 437 | 3300060353 | Ga0501082_0000241 | Ga0501082_0000241_44757_46496 | 572 |
| 438 | 3300060353 | Ga0501082_0000888 | Ga0501082_0000888_21652_23391 | 572 |
| 439 | 3300005328 | Ga0070676_10004973 | Ga0070676_100049733 | 573 |
| 440 | 3300005354 | Ga0070675_100029792 | Ga0070675_1000297922 | 573 |
| 441 | 3300005434 | Ga0070709_10000505 | Ga0070709_1000050514 | 573 |
| 442 | 3300005436 | Ga0070713_100000210 | Ga0070713_10000021022 | 573 |
| 443 | 3300005563 | Ga0068855_100036142 | Ga0068855_1000361422 | 573 |
| 444 | 3300005618 | Ga0068864_100062589 | Ga0068864_1000625892 | 573 |
| 445 | 3300005718 | Ga0068866_10001978 | Ga0068866_100019782 | 573 |
| 446 | 3300005842 | Ga0068858_100198842 | Ga0068858_1001988421 | 573 |
| 447 | 3300009177 | Ga0105248_10134533 | Ga0105248_101345331 | 573 |
| 448 | 3300013306 | Ga0163162_10040828 | Ga0163162_100408282 | 573 |
| 449 | 3300014325 | Ga0163163_10057806 | Ga0163163_100578062 | 573 |
| 450 | 3300014969 | Ga0157376_10029110 | Ga0157376_100291102 | 573 |
| 451 | 3300025900 | Ga0207710_10009553 | Ga0207710_100095533 | 573 |
| 452 | 3300025904 | Ga0207647_10008070 | Ga0207647_100080701 | 573 |
| 453 | 3300025907 | Ga0207645_10022633 | Ga0207645_100226332 | 573 |
| 454 | 3300025915 | Ga0207693_10000654 | Ga0207693_100006545 | 573 |
| 455 | 3300025919 | Ga0207657_10009971 | Ga0207657_100099718 | 573 |
| 456 | 3300025923 | Ga0207681_10027170 | Ga0207681_100271701 | 573 |
| 457 | 3300025925 | Ga0207650_10007585 | Ga0207650_100075856 | 573 |
| 458 | 3300025928 | Ga0207700_10000431 | Ga0207700_1000043122 | 573 |
| 459 | 3300025931 | Ga0207644_10029068 | Ga0207644_100290682 | 573 |
| 460 | 3300025933 | Ga0207706_10004765 | Ga0207706_100047656 | 573 |
| 461 | 3300025936 | Ga0207670_10019535 | Ga0207670_100195354 | 573 |
| 462 | 3300025939 | Ga0207665_10026019 | Ga0207665_100260192 | 573 |
| 463 | 3300025941 | Ga0207711_10008275 | Ga0207711_100082756 | 573 |
| 464 | 3300025942 | Ga0207689_10001019 | Ga0207689_100010197 | 573 |
| 465 | 3300025944 | Ga0207661_10000720 | Ga0207661_1000072019 | 573 |
| 466 | 3300025945 | Ga0207679_10002719 | Ga0207679_100027196 | 573 |
| 467 | 3300025960 | Ga0207651_10003433 | Ga0207651_100034333 | 573 |
| 468 | 3300026035 | Ga0207703_10161138 | Ga0207703_101611381 | 573 |
| 469 | 3300026067 | Ga0207678_10008829 | Ga0207678_100088297 | 573 |
| 470 | 3300026088 | Ga0207641_10000030 | Ga0207641_10000030192 | 573 |
| 471 | 3300026089 | Ga0207648_10009848 | Ga0207648_100098488 | 573 |
| 472 | 3300026095 | Ga0207676_10000256 | Ga0207676_100002567 | 573 |
| 473 | 3300026095 | Ga0207676_10074449 | Ga0207676_100744492 | 573 |
| 474 | 3300026118 | Ga0207675_100102638 | Ga0207675_1001026382 | 573 |
| 475 | 3300026121 | Ga0207683_10005395 | Ga0207683_100053951 | 573 |
| 476 | 3300028379 | Ga0268266_10013040 | Ga0268266_100130401 | 573 |
| 477 | 3300028380 | Ga0268265_10015661 | Ga0268265_100156614 | 573 |
| 478 | 3300031852 | Ga0307410_10000548 | Ga0307410_1000054815 | 573 |
| 479 | 3300031903 | Ga0307407_10056938 | Ga0307407_100569382 | 573 |
| 480 | 3300031995 | Ga0307409_100002046 | Ga0307409_1000020464 | 573 |
| 481 | 3300032002 | Ga0307416_100002239 | Ga0307416_1000022395 | 573 |
| 482 | 3300032002 | Ga0307416_100014062 | Ga0307416_1000140622 | 573 |
| 483 | 3300036401 | Ga0373937_0028217 | Ga0373937_0028217_2508_4235 | 573 |
| 484 | 3300000546 | LJNas_1001039 | LJNas_10010394 | 574 |
| 485 | 3300005355 | Ga0070671_100070784 | Ga0070671_1000707842 | 574 |
| 486 | 3300005434 | Ga0070709_10009195 | Ga0070709_100091953 | 574 |
| 487 | 3300005436 | Ga0070713_100000302 | Ga0070713_1000003028 | 574 |
| 488 | 3300005436 | Ga0070713_100099016 | Ga0070713_1000990162 | 574 |
| 489 | 3300005445 | Ga0070708_100003506 | Ga0070708_1000035069 | 574 |
| 490 | 3300005445 | Ga0070708_100080156 | Ga0070708_1000801561 | 574 |
| 491 | 3300005467 | Ga0070706_100000734 | Ga0070706_10000073438 | 574 |
| 492 | 3300005467 | Ga0070706_100002721 | Ga0070706_10000272110 | 574 |
| 493 | 3300005468 | Ga0070707_100000360 | Ga0070707_10000036029 | 574 |
| 494 | 3300005468 | Ga0070707_100018911 | Ga0070707_1000189115 | 574 |
| 495 | 3300005471 | Ga0070698_100001323 | Ga0070698_10000132322 | 574 |
| 496 | 3300005471 | Ga0070698_100006846 | Ga0070698_1000068462 | 574 |
| 497 | 3300005518 | Ga0070699_100001400 | Ga0070699_1000014009 | 574 |
| 498 | 3300005536 | Ga0070697_100002341 | Ga0070697_1000023418 | 574 |
| 499 | 3300005536 | Ga0070697_100011698 | Ga0070697_1000116984 | 574 |
| 500 | 3300005548 | Ga0070665_100007648 | Ga0070665_1000076482 | 574 |
| 501 | 3300005614 | Ga0068856_100002308 | Ga0068856_1000023082 | 574 |
| 502 | 3300006028 | Ga0070717_10007920 | Ga0070717_100079204 | 574 |
| 503 | 3300006163 | Ga0070715_10000755 | Ga0070715_100007554 | 574 |
| 504 | 3300009093 | Ga0105240_10026610 | Ga0105240_100266101 | 574 |
| 505 | 3300013105 | Ga0157369_10012364 | Ga0157369_100123645 | 574 |
| 506 | 3300013296 | Ga0157374_10010818 | Ga0157374_100108184 | 574 |
| 507 | 3300013307 | Ga0157372_10072100 | Ga0157372_100721002 | 574 |
| 508 | 3300014325 | Ga0163163_10053245 | Ga0163163_100532452 | 574 |
| 509 | 3300015262 | Ga0182007_10004753 | Ga0182007_100047534 | 574 |
| 510 | 3300024225 | Ga0224572_1000089 | Ga0224572_10000897 | 574 |
| 511 | 3300024227 | Ga0228598_1000974 | Ga0228598_10009746 | 574 |
| 512 | 3300025904 | Ga0207647_10008884 | Ga0207647_100088843 | 574 |
| 513 | 3300025906 | Ga0207699_10076640 | Ga0207699_100766401 | 574 |
| 514 | 3300025910 | Ga0207684_10000389 | Ga0207684_1000038911 | 574 |
| 515 | 3300025912 | Ga0207707_10015417 | Ga0207707_100154175 | 574 |
| 516 | 3300025912 | Ga0207707_10032207 | Ga0207707_100322072 | 574 |
| 517 | 3300025913 | Ga0207695_10123165 | Ga0207695_101231651 | 574 |
| 518 | 3300025915 | Ga0207693_10000053 | Ga0207693_1000005369 | 574 |
| 519 | 3300025922 | Ga0207646_10001860 | Ga0207646_1000186021 | 574 |
| 520 | 3300025922 | Ga0207646_10026366 | Ga0207646_100263663 | 574 |
| 521 | 3300025928 | Ga0207700_10011703 | Ga0207700_100117033 | 574 |
| 522 | 3300025929 | Ga0207664_10002385 | Ga0207664_100023853 | 574 |
| 523 | 3300025931 | Ga0207644_10072477 | Ga0207644_100724772 | 574 |
| 524 | 3300025939 | Ga0207665_10006792 | Ga0207665_100067923 | 574 |
| 525 | 3300025939 | Ga0207665_10028783 | Ga0207665_100287832 | 574 |
| 526 | 3300026078 | Ga0207702_10000536 | Ga0207702_100005365 | 574 |
| 527 | 3300042876 | Ga0451577_0000294 | Ga0451577_0000294_69574_71502 | 574 |
| 528 | 3300044712 | Ga0453684_0000104 | Ga0453684_0000104_170010_171938 | 574 |
| 529 | 3300045051 | Ga0451576_0028875 | Ga0451576_0028875_520_2448 | 574 |
| 530 | 3300046472 | Ga0495580_0021801 | Ga0495580_0021801_1968_3908 | 574 |
| 531 | 3300048904 | Ga0496101_0056460 | Ga0496101_0056460_841_2679 | 574 |
| 532 | 3300048907 | Ga0496104_0030065 | Ga0496104_0030065_2938_4776 | 574 |
| 533 | 3300048908 | Ga0496105_0007966 | Ga0496105_0007966_870_2708 | 574 |
| 534 | 3300048915 | Ga0496112_0014861 | Ga0496112_0014861_1266_3047 | 574 |
| 535 | 3300048916 | Ga0496113_0064984 | Ga0496113_0064984_607_2445 | 574 |
| 536 | 3300048929 | Ga0496126_0074144 | Ga0496126_0074144_787_2625 | 574 |
| 537 | 3300050514 | nmdc:mga08x19_9570_c1 | nmdc:mga08x19_9570_c1_1664_3481 | 574 |
| 538 | 3300006237 | Ga0097621_100000431 | Ga0097621_10000043117 | 575 |
| 539 | 3300006852 | Ga0075433_10001602 | Ga0075433_100016028 | 575 |
| 540 | 3300006871 | Ga0075434_100000782 | Ga0075434_10000078218 | 575 |
| 541 | 3300006914 | Ga0075436_100034899 | Ga0075436_1000348992 | 575 |
| 542 | 3300007076 | Ga0075435_100001140 | Ga0075435_1000011408 | 575 |
| 543 | 3300009098 | Ga0105245_10001223 | Ga0105245_1000122318 | 575 |
| 544 | 3300009147 | Ga0114129_10104089 | Ga0114129_101040892 | 575 |
| 545 | 3300009177 | Ga0105248_10042619 | Ga0105248_100426191 | 575 |
| 546 | 3300013297 | Ga0157378_10001618 | Ga0157378_1000161811 | 575 |
| 547 | 3300021441 | Ga0213871_10000271 | Ga0213871_100002713 | 575 |
| 548 | 3300028381 | Ga0268264_10087216 | Ga0268264_100872162 | 575 |
| 549 | 3300031249 | Ga0265339_10000023 | Ga0265339_1000002370 | 575 |
| 550 | 3300031344 | Ga0265316_10023297 | Ga0265316_100232972 | 575 |
| 551 | 3300031344 | Ga0265316_10070533 | Ga0265316_100705332 | 575 |
| 552 | 3300031712 | Ga0265342_10001352 | Ga0265342_100013523 | 575 |
| 553 | 3300037068 | Ga0373925_0009291 | Ga0373925_0009291_3457_5307 | 575 |
| 554 | 3300045049 | Ga0466959_0018815 | Ga0466959_0018815_1612_3465 | 575 |
| 555 | 3300046664 | Ga0495659_0003052 | Ga0495659_0003052_3114_4979 | 575 |
| 556 | 3300049578 | Ga0501042_0066931 | Ga0501042_0066931_463_2214 | 575 |
| 557 | 3300005329 | Ga0070683_100000055 | Ga0070683_10000005533 | 576 |
| 558 | 3300005329 | Ga0070683_100093324 | Ga0070683_1000933241 | 576 |
| 559 | 3300005331 | Ga0070670_100000582 | Ga0070670_10000058221 | 576 |
| 560 | 3300005334 | Ga0068869_100000592 | Ga0068869_1000005923 | 576 |
| 561 | 3300005338 | Ga0068868_100001452 | Ga0068868_1000014527 | 576 |
| 562 | 3300005339 | Ga0070660_100000311 | Ga0070660_10000031117 | 576 |
| 563 | 3300005344 | Ga0070661_100005335 | Ga0070661_1000053355 | 576 |
| 564 | 3300005344 | Ga0070661_100015415 | Ga0070661_1000154153 | 576 |
| 565 | 3300005355 | Ga0070671_100013999 | Ga0070671_1000139995 | 576 |
| 566 | 3300005367 | Ga0070667_100000566 | Ga0070667_10000056624 | 576 |
| 567 | 3300005445 | Ga0070708_100030512 | Ga0070708_1000305125 | 576 |
| 568 | 3300005458 | Ga0070681_10000804 | Ga0070681_1000080417 | 576 |
| 569 | 3300005458 | Ga0070681_10002950 | Ga0070681_1000295012 | 576 |
| 570 | 3300005458 | Ga0070681_10057062 | Ga0070681_100570622 | 576 |
| 571 | 3300005530 | Ga0070679_100000226 | Ga0070679_1000002269 | 576 |
| 572 | 3300005535 | Ga0070684_100000153 | Ga0070684_10000015319 | 576 |
| 573 | 3300005535 | Ga0070684_100081193 | Ga0070684_1000811931 | 576 |
| 574 | 3300005539 | Ga0068853_100009193 | Ga0068853_1000091936 | 576 |
| 575 | 3300005539 | Ga0068853_100046671 | Ga0068853_1000466713 | 576 |
| 576 | 3300005548 | Ga0070665_100116575 | Ga0070665_1001165752 | 576 |
| 577 | 3300005563 | Ga0068855_100000842 | Ga0068855_1000008422 | 576 |
| 578 | 3300005563 | Ga0068855_100000949 | Ga0068855_1000009495 | 576 |
| 579 | 3300005563 | Ga0068855_100003849 | Ga0068855_1000038497 | 576 |
| 580 | 3300005563 | Ga0068855_100009479 | Ga0068855_1000094799 | 576 |
| 581 | 3300005563 | Ga0068855_100090519 | Ga0068855_1000905192 | 576 |
| 582 | 3300005577 | Ga0068857_100020037 | Ga0068857_1000200372 | 576 |
| 583 | 3300005578 | Ga0068854_100002592 | Ga0068854_1000025926 | 576 |
| 584 | 3300005614 | Ga0068856_100000437 | Ga0068856_10000043713 | 576 |
| 585 | 3300005614 | Ga0068856_100001503 | Ga0068856_10000150313 | 576 |
| 586 | 3300005614 | Ga0068856_100101826 | Ga0068856_1001018262 | 576 |
| 587 | 3300005614 | Ga0068856_100136446 | Ga0068856_1001364462 | 576 |
| 588 | 3300005616 | Ga0068852_100000054 | Ga0068852_10000005458 | 576 |
| 589 | 3300005616 | Ga0068852_100000870 | Ga0068852_10000087011 | 576 |
| 590 | 3300005616 | Ga0068852_100003707 | Ga0068852_1000037076 | 576 |
| 591 | 3300005616 | Ga0068852_100013502 | Ga0068852_1000135027 | 576 |
| 592 | 3300005616 | Ga0068852_100086018 | Ga0068852_1000860183 | 576 |
| 593 | 3300005617 | Ga0068859_100006498 | Ga0068859_1000064984 | 576 |
| 594 | 3300005617 | Ga0068859_100099257 | Ga0068859_1000992572 | 576 |
| 595 | 3300005618 | Ga0068864_100000397 | Ga0068864_10000039723 | 576 |
| 596 | 3300005718 | Ga0068866_10034609 | Ga0068866_100346092 | 576 |
| 597 | 3300005834 | Ga0068851_10008726 | Ga0068851_100087261 | 576 |
| 598 | 3300005834 | Ga0068851_10051835 | Ga0068851_100518351 | 576 |
| 599 | 3300005841 | Ga0068863_100000502 | Ga0068863_10000050221 | 576 |
| 600 | 3300005842 | Ga0068858_100003082 | Ga0068858_10000308210 | 576 |
| 601 | 3300005842 | Ga0068858_100097264 | Ga0068858_1000972642 | 576 |
| 602 | 3300005843 | Ga0068860_100000031 | Ga0068860_100000031171 | 576 |
| 603 | 3300005981 | Ga0081538_10000778 | Ga0081538_1000077824 | 576 |
| 604 | 3300005981 | Ga0081538_10001466 | Ga0081538_1000146617 | 576 |
| 605 | 3300006028 | Ga0070717_10018717 | Ga0070717_100187173 | 576 |
| 606 | 3300006028 | Ga0070717_10043179 | Ga0070717_100431794 | 576 |
| 607 | 3300006028 | Ga0070717_10089764 | Ga0070717_100897641 | 576 |
| 608 | 3300006173 | Ga0070716_100005734 | Ga0070716_1000057342 | 576 |
| 609 | 3300006175 | Ga0070712_100000529 | Ga0070712_10000052919 | 576 |
| 610 | 3300006237 | Ga0097621_100000472 | Ga0097621_10000047215 | 576 |
| 611 | 3300006237 | Ga0097621_100000648 | Ga0097621_10000064817 | 576 |
| 612 | 3300006358 | Ga0068871_100000084 | Ga0068871_10000008436 | 576 |
| 613 | 3300006358 | Ga0068871_100003471 | Ga0068871_1000034715 | 576 |
| 614 | 3300006914 | Ga0075436_100018159 | Ga0075436_1000181593 | 576 |
| 615 | 3300006931 | Ga0097620_100006498 | Ga0097620_1000064984 | 576 |
| 616 | 3300006931 | Ga0097620_100099258 | Ga0097620_1000992582 | 576 |
| 617 | 3300009093 | Ga0105240_10000116 | Ga0105240_1000011658 | 576 |
| 618 | 3300009093 | Ga0105240_10000171 | Ga0105240_1000017154 | 576 |
| 619 | 3300009093 | Ga0105240_10002552 | Ga0105240_1000255210 | 576 |
| 620 | 3300009093 | Ga0105240_10041785 | Ga0105240_100417852 | 576 |
| 621 | 3300009098 | Ga0105245_10003105 | Ga0105245_1000310514 | 576 |
| 622 | 3300009098 | Ga0105245_10007294 | Ga0105245_100072942 | 576 |
| 623 | 3300009174 | Ga0105241_10000061 | Ga0105241_1000006134 | 576 |
| 624 | 3300009174 | Ga0105241_10001359 | Ga0105241_1000135914 | 576 |
| 625 | 3300009174 | Ga0105241_10001688 | Ga0105241_100016889 | 576 |
| 626 | 3300009174 | Ga0105241_10002385 | Ga0105241_100023853 | 576 |
| 627 | 3300009174 | Ga0105241_10100604 | Ga0105241_101006042 | 576 |
| 628 | 3300009177 | Ga0105248_10000019 | Ga0105248_10000019181 | 576 |
| 629 | 3300009177 | Ga0105248_10008242 | Ga0105248_100082426 | 576 |
| 630 | 3300009177 | Ga0105248_10010198 | Ga0105248_100101982 | 576 |
| 631 | 3300009545 | Ga0105237_10005201 | Ga0105237_1000520110 | 576 |
| 632 | 3300009545 | Ga0105237_10020862 | Ga0105237_100208622 | 576 |
| 633 | 3300009545 | Ga0105237_10050632 | Ga0105237_100506322 | 576 |
| 634 | 3300009551 | Ga0105238_10000024 | Ga0105238_1000002498 | 576 |
| 635 | 3300009551 | Ga0105238_10006095 | Ga0105238_100060952 | 576 |
| 636 | 3300009551 | Ga0105238_10015185 | Ga0105238_100151852 | 576 |
| 637 | 3300009553 | Ga0105249_10051111 | Ga0105249_100511112 | 576 |
| 638 | 3300010375 | Ga0105239_10003830 | Ga0105239_1000383015 | 576 |
| 639 | 3300010375 | Ga0105239_10006367 | Ga0105239_100063672 | 576 |
| 640 | 3300010375 | Ga0105239_10006871 | Ga0105239_100068714 | 576 |
| 641 | 3300010375 | Ga0105239_10099901 | Ga0105239_100999012 | 576 |
| 642 | 3300011119 | Ga0105246_10000642 | Ga0105246_1000064210 | 576 |
| 643 | 3300013102 | Ga0157371_10014575 | Ga0157371_100145752 | 576 |
| 644 | 3300013104 | Ga0157370_10000019 | Ga0157370_1000001991 | 576 |
| 645 | 3300013104 | Ga0157370_10009377 | Ga0157370_100093779 | 576 |
| 646 | 3300013105 | Ga0157369_10000081 | Ga0157369_1000008160 | 576 |
| 647 | 3300013105 | Ga0157369_10017220 | Ga0157369_1001722010 | 576 |
| 648 | 3300013105 | Ga0157369_10021569 | Ga0157369_100215695 | 576 |
| 649 | 3300013105 | Ga0157369_10043373 | Ga0157369_100433734 | 576 |
| 650 | 3300013105 | Ga0157369_10056365 | Ga0157369_100563652 | 576 |
| 651 | 3300013296 | Ga0157374_10005962 | Ga0157374_100059623 | 576 |
| 652 | 3300013296 | Ga0157374_10033830 | Ga0157374_100338304 | 576 |
| 653 | 3300013296 | Ga0157374_10139086 | Ga0157374_101390862 | 576 |
| 654 | 3300013297 | Ga0157378_10003566 | Ga0157378_100035666 | 576 |
| 655 | 3300013297 | Ga0157378_10028167 | Ga0157378_100281672 | 576 |
| 656 | 3300013297 | Ga0157378_10041269 | Ga0157378_100412692 | 576 |
| 657 | 3300013306 | Ga0163162_10012329 | Ga0163162_100123292 | 576 |
| 658 | 3300013307 | Ga0157372_10000058 | Ga0157372_1000005848 | 576 |
| 659 | 3300013307 | Ga0157372_10004045 | Ga0157372_1000404512 | 576 |
| 660 | 3300013307 | Ga0157372_10008156 | Ga0157372_100081562 | 576 |
| 661 | 3300013307 | Ga0157372_10023953 | Ga0157372_100239534 | 576 |
| 662 | 3300013307 | Ga0157372_10042443 | Ga0157372_100424433 | 576 |
| 663 | 3300013307 | Ga0157372_10125903 | Ga0157372_101259032 | 576 |
| 664 | 3300013308 | Ga0157375_10002599 | Ga0157375_100025994 | 576 |
| 665 | 3300014968 | Ga0157379_10001817 | Ga0157379_1000181712 | 576 |
| 666 | 3300014969 | Ga0157376_10003548 | Ga0157376_100035489 | 576 |
| 667 | 3300025898 | Ga0207692_10003571 | Ga0207692_100035712 | 576 |
| 668 | 3300025900 | Ga0207710_10000465 | Ga0207710_1000046516 | 576 |
| 669 | 3300025906 | Ga0207699_10029501 | Ga0207699_100295012 | 576 |
| 670 | 3300025907 | Ga0207645_10011955 | Ga0207645_100119554 | 576 |
| 671 | 3300025909 | Ga0207705_10010342 | Ga0207705_100103423 | 576 |
| 672 | 3300025909 | Ga0207705_10117065 | Ga0207705_101170651 | 576 |
| 673 | 3300025911 | Ga0207654_10000024 | Ga0207654_1000002430 | 576 |
| 674 | 3300025911 | Ga0207654_10000516 | Ga0207654_1000051610 | 576 |
| 675 | 3300025911 | Ga0207654_10001092 | Ga0207654_100010928 | 576 |
| 676 | 3300025911 | Ga0207654_10023388 | Ga0207654_100233882 | 576 |
| 677 | 3300025912 | Ga0207707_10001372 | Ga0207707_1000137211 | 576 |
| 678 | 3300025912 | Ga0207707_10026085 | Ga0207707_100260856 | 576 |
| 679 | 3300025912 | Ga0207707_10116996 | Ga0207707_101169961 | 576 |
| 680 | 3300025913 | Ga0207695_10000075 | Ga0207695_1000007586 | 576 |
| 681 | 3300025913 | Ga0207695_10000115 | Ga0207695_10000115110 | 576 |
| 682 | 3300025913 | Ga0207695_10000466 | Ga0207695_1000046634 | 576 |
| 683 | 3300025913 | Ga0207695_10001570 | Ga0207695_1000157026 | 576 |
| 684 | 3300025913 | Ga0207695_10003351 | Ga0207695_1000335113 | 576 |
| 685 | 3300025913 | Ga0207695_10029663 | Ga0207695_100296633 | 576 |
| 686 | 3300025913 | Ga0207695_10068165 | Ga0207695_100681653 | 576 |
| 687 | 3300025913 | Ga0207695_10096770 | Ga0207695_100967702 | 576 |
| 688 | 3300025914 | Ga0207671_10000032 | Ga0207671_10000032123 | 576 |
| 689 | 3300025914 | Ga0207671_10003465 | Ga0207671_100034658 | 576 |
| 690 | 3300025914 | Ga0207671_10027957 | Ga0207671_100279572 | 576 |
| 691 | 3300025915 | Ga0207693_10000187 | Ga0207693_100001878 | 576 |
| 692 | 3300025916 | Ga0207663_10001021 | Ga0207663_100010214 | 576 |
| 693 | 3300025919 | Ga0207657_10001924 | Ga0207657_100019247 | 576 |
| 694 | 3300025921 | Ga0207652_10003228 | Ga0207652_100032289 | 576 |
| 695 | 3300025924 | Ga0207694_10000024 | Ga0207694_10000024154 | 576 |
| 696 | 3300025924 | Ga0207694_10001795 | Ga0207694_1000179510 | 576 |
| 697 | 3300025924 | Ga0207694_10002260 | Ga0207694_1000226012 | 576 |
| 698 | 3300025924 | Ga0207694_10004595 | Ga0207694_100045958 | 576 |
| 699 | 3300025924 | Ga0207694_10093687 | Ga0207694_100936871 | 576 |
| 700 | 3300025925 | Ga0207650_10002318 | Ga0207650_100023185 | 576 |
| 701 | 3300025927 | Ga0207687_10015279 | Ga0207687_100152792 | 576 |
| 702 | 3300025927 | Ga0207687_10030755 | Ga0207687_100307552 | 576 |
| 703 | 3300025927 | Ga0207687_10087690 | Ga0207687_100876902 | 576 |
| 704 | 3300025928 | Ga0207700_10024720 | Ga0207700_100247203 | 576 |
| 705 | 3300025928 | Ga0207700_10039215 | Ga0207700_100392153 | 576 |
| 706 | 3300025931 | Ga0207644_10008766 | Ga0207644_100087664 | 576 |
| 707 | 3300025933 | Ga0207706_10000504 | Ga0207706_1000050434 | 576 |
| 708 | 3300025933 | Ga0207706_10009892 | Ga0207706_100098924 | 576 |
| 709 | 3300025939 | Ga0207665_10004411 | Ga0207665_100044112 | 576 |
| 710 | 3300025940 | Ga0207691_10007244 | Ga0207691_100072445 | 576 |
| 711 | 3300025941 | Ga0207711_10000397 | Ga0207711_100003977 | 576 |
| 712 | 3300025941 | Ga0207711_10031216 | Ga0207711_100312162 | 576 |
| 713 | 3300025941 | Ga0207711_10089637 | Ga0207711_100896372 | 576 |
| 714 | 3300025942 | Ga0207689_10002617 | Ga0207689_1000261714 | 576 |
| 715 | 3300025944 | Ga0207661_10000058 | Ga0207661_1000005859 | 576 |
| 716 | 3300025945 | Ga0207679_10001223 | Ga0207679_1000122316 | 576 |
| 717 | 3300025949 | Ga0207667_10000188 | Ga0207667_1000018830 | 576 |
| 718 | 3300025949 | Ga0207667_10000475 | Ga0207667_1000047518 | 576 |
| 719 | 3300025949 | Ga0207667_10001332 | Ga0207667_100013324 | 576 |
| 720 | 3300025949 | Ga0207667_10003699 | Ga0207667_1000369910 | 576 |
| 721 | 3300025986 | Ga0207658_10000041 | Ga0207658_1000004142 | 576 |
| 722 | 3300025986 | Ga0207658_10010154 | Ga0207658_100101543 | 576 |
| 723 | 3300026023 | Ga0207677_10000099 | Ga0207677_1000009946 | 576 |
| 724 | 3300026035 | Ga0207703_10000432 | Ga0207703_1000043224 | 576 |
| 725 | 3300026041 | Ga0207639_10000753 | Ga0207639_1000075313 | 576 |
| 726 | 3300026041 | Ga0207639_10013041 | Ga0207639_100130412 | 576 |
| 727 | 3300026041 | Ga0207639_10051911 | Ga0207639_100519112 | 576 |
| 728 | 3300026041 | Ga0207639_10098426 | Ga0207639_100984261 | 576 |
| 729 | 3300026078 | Ga0207702_10000457 | Ga0207702_1000045716 | 576 |
| 730 | 3300026078 | Ga0207702_10009621 | Ga0207702_100096212 | 576 |
| 731 | 3300026078 | Ga0207702_10014432 | Ga0207702_100144322 | 576 |
| 732 | 3300026078 | Ga0207702_10016867 | Ga0207702_100168676 | 576 |
| 733 | 3300026088 | Ga0207641_10000223 | Ga0207641_1000022310 | 576 |
| 734 | 3300026095 | Ga0207676_10001520 | Ga0207676_1000152010 | 576 |
| 735 | 3300026116 | Ga0207674_10001042 | Ga0207674_1000104224 | 576 |
| 736 | 3300026116 | Ga0207674_10001306 | Ga0207674_1000130615 | 576 |
| 737 | 3300026116 | Ga0207674_10032217 | Ga0207674_100322171 | 576 |
| 738 | 3300026121 | Ga0207683_10001542 | Ga0207683_100015425 | 576 |
| 739 | 3300026142 | Ga0207698_10000011 | Ga0207698_10000011120 | 576 |
| 740 | 3300026142 | Ga0207698_10001094 | Ga0207698_100010946 | 576 |
| 741 | 3300026142 | Ga0207698_10011250 | Ga0207698_100112504 | 576 |
| 742 | 3300028379 | Ga0268266_10084031 | Ga0268266_100840312 | 576 |
| 743 | 3300028381 | Ga0268264_10000240 | Ga0268264_1000024073 | 576 |
| 744 | 3300028577 | Ga0265318_10004034 | Ga0265318_100040344 | 576 |
| 745 | 3300028666 | Ga0265336_10000952 | Ga0265336_100009529 | 576 |
| 746 | 3300028666 | Ga0265336_10009982 | Ga0265336_100099821 | 576 |
| 747 | 3300028800 | Ga0265338_10004331 | Ga0265338_1000433114 | 576 |
| 748 | 3300028800 | Ga0265338_10017201 | Ga0265338_100172013 | 576 |
| 749 | 3300031235 | Ga0265330_10000216 | Ga0265330_100002166 | 576 |
| 750 | 3300031235 | Ga0265330_10006442 | Ga0265330_100064425 | 576 |
| 751 | 3300031235 | Ga0265330_10016996 | Ga0265330_100169963 | 576 |
| 752 | 3300031239 | Ga0265328_10001519 | Ga0265328_100015196 | 576 |
| 753 | 3300031241 | Ga0265325_10000249 | Ga0265325_1000024921 | 576 |
| 754 | 3300031242 | Ga0265329_10006526 | Ga0265329_100065261 | 576 |
| 755 | 3300031247 | Ga0265340_10000990 | Ga0265340_100009906 | 576 |
| 756 | 3300031249 | Ga0265339_10001829 | Ga0265339_1000182912 | 576 |
| 757 | 3300031344 | Ga0265316_10002993 | Ga0265316_1000299313 | 576 |
| 758 | 3300031344 | Ga0265316_10011773 | Ga0265316_100117735 | 576 |
| 759 | 3300031344 | Ga0265316_10041160 | Ga0265316_100411602 | 576 |
| 760 | 3300031595 | Ga0265313_10002347 | Ga0265313_100023476 | 576 |
| 761 | 3300031711 | Ga0265314_10000239 | Ga0265314_1000023941 | 576 |
| 762 | 3300031711 | Ga0265314_10014008 | Ga0265314_100140084 | 576 |
| 763 | 3300031712 | Ga0265342_10001442 | Ga0265342_1000144214 | 576 |
| 764 | 3300031712 | Ga0265342_10005484 | Ga0265342_1000548411 | 576 |
| 765 | 3300037068 | Ga0373925_0063287 | Ga0373925_0063287_173_2068 | 576 |
| 766 | 3300037068 | Ga0373925_0080608 | Ga0373925_0080608_507_2360 | 576 |
| 767 | 3300044694 | Ga0466963_0007935 | Ga0466963_0007935_323_2197 | 576 |
| 768 | 3300045976 | Ga0466967_0121565 | Ga0466967_0121565_146_2020 | 576 |
| 769 | 3300046475 | Ga0495639_0044778 | Ga0495639_0044778_75_1904 | 576 |
| 770 | 3300046536 | Ga0495587_0046695 | Ga0495587_0046695_284_2164 | 576 |
| 771 | 3300046663 | Ga0495635_0032266 | Ga0495635_0032266_184_2064 | 576 |
| 772 | 3300046679 | Ga0495623_0029630 | Ga0495623_0029630_389_2269 | 576 |
| 773 | 3300048908 | Ga0496105_0014515 | Ga0496105_0014515_3142_5040 | 576 |
| 774 | 3300005334 | Ga0068869_100000460 | Ga0068869_1000004605 | 577 |
| 775 | 3300005617 | Ga0068859_100048328 | Ga0068859_1000483282 | 577 |
| 776 | 3300005842 | Ga0068858_100003081 | Ga0068858_1000030817 | 577 |
| 777 | 3300006931 | Ga0097620_100048336 | Ga0097620_1000483364 | 577 |
| 778 | 3300009545 | Ga0105237_10095147 | Ga0105237_100951473 | 577 |
| 779 | 3300013105 | Ga0157369_10013248 | Ga0157369_100132486 | 577 |
| 780 | 3300013296 | Ga0157374_10014703 | Ga0157374_100147033 | 577 |
| 781 | 3300014968 | Ga0157379_10021417 | Ga0157379_100214171 | 577 |
| 782 | 3300025913 | Ga0207695_10027987 | Ga0207695_100279873 | 577 |
| 783 | 3300026035 | Ga0207703_10014240 | Ga0207703_100142404 | 577 |
| 784 | 3300028381 | Ga0268264_10032829 | Ga0268264_100328292 | 577 |
| 785 | 3300035724 | Ga0373933_0056789 | Ga0373933_0056789_322_2223 | 577 |
| 786 | 3300044712 | Ga0453684_0155408 | Ga0453684_0155408_599_2347 | 577 |
| 787 | 3300005337 | Ga0070682_100000014 | Ga0070682_10000001436 | 578 |
| 788 | 3300005338 | Ga0068868_100002673 | Ga0068868_1000026737 | 578 |
| 789 | 3300005340 | Ga0070689_100000488 | Ga0070689_10000048816 | 578 |
| 790 | 3300005435 | Ga0070714_100066949 | Ga0070714_1000669491 | 578 |
| 791 | 3300005543 | Ga0070672_100000082 | Ga0070672_1000000829 | 578 |
| 792 | 3300005618 | Ga0068864_100000097 | Ga0068864_10000009752 | 578 |
| 793 | 3300005840 | Ga0068870_10007784 | Ga0068870_100077844 | 578 |
| 794 | 3300005842 | Ga0068858_100000243 | Ga0068858_10000024316 | 578 |
| 795 | 3300009098 | Ga0105245_10003410 | Ga0105245_100034106 | 578 |
| 796 | 3300013308 | Ga0157375_10000001 | Ga0157375_1000000159 | 578 |
| 797 | 3300025927 | Ga0207687_10003664 | Ga0207687_100036648 | 578 |
| 798 | 3300025936 | Ga0207670_10001926 | Ga0207670_1000192610 | 578 |
| 799 | 3300025940 | Ga0207691_10001100 | Ga0207691_100011009 | 578 |
| 800 | 3300026023 | Ga0207677_10000035 | Ga0207677_1000003557 | 578 |
| 801 | 3300026035 | Ga0207703_10000046 | Ga0207703_1000004688 | 578 |
| 802 | 3300026095 | Ga0207676_10000013 | Ga0207676_10000013275 | 578 |
| 803 | 3300005339 | Ga0070660_100013186 | Ga0070660_1000131863 | 579 |
| 804 | 3300005458 | Ga0070681_10014599 | Ga0070681_100145995 | 579 |
| 805 | 3300005530 | Ga0070679_100045850 | Ga0070679_1000458503 | 579 |
| 806 | 3300025912 | Ga0207707_10029783 | Ga0207707_100297833 | 579 |
| 807 | 3300025919 | Ga0207657_10021487 | Ga0207657_100214874 | 579 |
| 808 | 3300025921 | Ga0207652_10062779 | Ga0207652_100627792 | 579 |
| 809 | 3300036647 | Ga0316582_0051099 | Ga0316582_0051099_441_2189 | 579 |
| 810 | 3300031242 | Ga0265329_10005123 | Ga0265329_100051235 | 581 |
| 811 | 3300005335 | Ga0070666_10015995 | Ga0070666_100159954 | 582 |
| 812 | 3300005344 | Ga0070661_100046721 | Ga0070661_1000467213 | 582 |
| 813 | 3300005617 | Ga0068859_100006100 | Ga0068859_1000061007 | 582 |
| 814 | 3300005617 | Ga0068859_100023095 | Ga0068859_1000230955 | 582 |
| 815 | 3300005841 | Ga0068863_100001036 | Ga0068863_1000010366 | 582 |
| 816 | 3300005842 | Ga0068858_100003641 | Ga0068858_1000036412 | 582 |
| 817 | 3300005843 | Ga0068860_100003297 | Ga0068860_1000032974 | 582 |
| 818 | 3300005843 | Ga0068860_100004066 | Ga0068860_10000406612 | 582 |
| 819 | 3300006358 | Ga0068871_100002089 | Ga0068871_1000020898 | 582 |
| 820 | 3300006931 | Ga0097620_100006100 | Ga0097620_1000061004 | 582 |
| 821 | 3300006931 | Ga0097620_100023098 | Ga0097620_1000230985 | 582 |
| 822 | 3300009177 | Ga0105248_10000260 | Ga0105248_1000026010 | 582 |
| 823 | 3300013306 | Ga0163162_10032999 | Ga0163162_100329995 | 582 |
| 824 | 3300013308 | Ga0157375_10000213 | Ga0157375_100002139 | 582 |
| 825 | 3300014745 | Ga0157377_10028546 | Ga0157377_100285462 | 582 |
| 826 | 3300014968 | Ga0157379_10000201 | Ga0157379_1000020117 | 582 |
| 827 | 3300014969 | Ga0157376_10018802 | Ga0157376_100188023 | 582 |
| 828 | 3300025920 | Ga0207649_10047217 | Ga0207649_100472172 | 582 |
| 829 | 3300025940 | Ga0207691_10007240 | Ga0207691_100072402 | 582 |
| 830 | 3300025986 | Ga0207658_10008554 | Ga0207658_100085545 | 582 |
| 831 | 3300026088 | Ga0207641_10002614 | Ga0207641_1000261410 | 582 |
| 832 | 3300028381 | Ga0268264_10001181 | Ga0268264_1000118111 | 582 |
| 833 | 3300028381 | Ga0268264_10010333 | Ga0268264_100103332 | 582 |
| 834 | 3300006844 | Ga0075428_100130455 | Ga0075428_1001304552 | 585 |
| 835 | 3300009147 | Ga0114129_10248071 | Ga0114129_102480712 | 585 |
| 836 | 3300031235 | Ga0265330_10006808 | Ga0265330_100068083 | 585 |
| 837 | 3300031242 | Ga0265329_10005902 | Ga0265329_100059022 | 585 |
| 838 | 3300031247 | Ga0265340_10035867 | Ga0265340_100358672 | 585 |
| 839 | 3300044712 | Ga0453684_0156897 | Ga0453684_0156897_378_2147 | 585 |
| 840 | 3300050507 | nmdc:mga05p37_321673_c1 | nmdc:mga05p37_321673_c1_54_1820 | 585 |
| 841 | 3300006358 | Ga0068871_100034049 | Ga0068871_1000340492 | 586 |
| 842 | 3300025893 | Ga0207682_10023447 | Ga0207682_100234471 | 586 |
| 843 | 3300025940 | Ga0207691_10103556 | Ga0207691_101035562 | 586 |
| 844 | 3300032002 | Ga0307416_100030511 | Ga0307416_1000305112 | 586 |
| 845 | 3300006844 | Ga0075428_100041305 | Ga0075428_1000413054 | 587 |
| 846 | 3300014326 | Ga0157380_10000592 | Ga0157380_1000059211 | 587 |
| 847 | 3300031731 | Ga0307405_10097846 | Ga0307405_100978462 | 587 |
| 848 | 3300046689 | Ga0495613_0076543 | Ga0495613_0076543_376_2142 | 587 |
| 849 | 3300049575 | Ga0501039_0019334 | Ga0501039_0019334_814_2580 | 587 |
| 850 | 3300049577 | Ga0501041_0024740 | Ga0501041_0024740_548_2314 | 587 |
| 851 | 3300049582 | Ga0501048_0047617 | Ga0501048_0047617_345_2111 | 587 |
| 852 | 3300049588 | Ga0501072_0013236 | Ga0501072_0013236_1130_2896 | 587 |
| 853 | 3300049741 | Ga0501079_0129424 | Ga0501079_0129424_75_1841 | 587 |
| 854 | 3300049824 | Ga0501045_0094387 | Ga0501045_0094387_202_1968 | 587 |
| 855 | 3300005458 | Ga0070681_10053278 | Ga0070681_100532782 | 588 |
| 856 | 3300009545 | Ga0105237_10028854 | Ga0105237_100288541 | 588 |
| 857 | 3300026041 | Ga0207639_10029778 | Ga0207639_100297781 | 588 |
| 858 | 3300031235 | Ga0265330_10004042 | Ga0265330_100040425 | 588 |
| 859 | 3300031235 | Ga0265330_10022103 | Ga0265330_100221033 | 588 |
| 860 | 3300031238 | Ga0265332_10013037 | Ga0265332_100130371 | 588 |
| 861 | 3300031239 | Ga0265328_10011587 | Ga0265328_100115873 | 588 |
| 862 | 3300031240 | Ga0265320_10031605 | Ga0265320_100316051 | 588 |
| 863 | 3300031242 | Ga0265329_10006092 | Ga0265329_100060924 | 588 |
| 864 | 3300031250 | Ga0265331_10000183 | Ga0265331_1000018326 | 588 |
| 865 | 3300031344 | Ga0265316_10000148 | Ga0265316_1000014826 | 588 |
| 866 | 3300031711 | Ga0265314_10000984 | Ga0265314_1000098426 | 588 |
| 867 | 3300031712 | Ga0265342_10007130 | Ga0265342_100071302 | 588 |
| 868 | 3300044712 | Ga0453684_0015233 | Ga0453684_0015233_1424_3214 | 588 |
| 869 | 3300046460 | Ga0495638_0061240 | Ga0495638_0061240_136_1920 | 588 |
| 870 | 3300053096 | Ga0500641_0000225 | Ga0500641_0000225_9153_10928 | 588 |
| 871 | 3300053139 | Ga0500568_0014356 | Ga0500568_0014356_1622_3406 | 588 |
| 872 | 3300005331 | Ga0070670_100008250 | Ga0070670_1000082505 | 589 |
| 873 | 3300005455 | Ga0070663_100005932 | Ga0070663_1000059323 | 589 |
| 874 | 3300005564 | Ga0070664_100015491 | Ga0070664_1000154916 | 589 |
| 875 | 3300009551 | Ga0105238_10009190 | Ga0105238_100091909 | 589 |
| 876 | 3300014325 | Ga0163163_10136796 | Ga0163163_101367961 | 589 |
| 877 | 3300025924 | Ga0207694_10034906 | Ga0207694_100349063 | 589 |
| 878 | 3300025925 | Ga0207650_10004995 | Ga0207650_100049955 | 589 |
| 879 | 3300025960 | Ga0207651_10074738 | Ga0207651_100747382 | 589 |
| 880 | 3300026121 | Ga0207683_10093318 | Ga0207683_100933182 | 589 |
| 881 | 3300042876 | Ga0451577_0000053 | Ga0451577_0000053_173183_174979 | 589 |
| 882 | 3300042876 | Ga0451577_0000658 | Ga0451577_0000658_32874_34670 | 589 |
| 883 | 3300042876 | Ga0451577_0001280 | Ga0451577_0001280_24353_26149 | 589 |
| 884 | 3300044712 | Ga0453684_0000103 | Ga0453684_0000103_260078_261874 | 589 |
| 885 | 3300044712 | Ga0453684_0000208 | Ga0453684_0000208_31277_33073 | 589 |
| 886 | 3300044712 | Ga0453684_0246806 | Ga0453684_0246806_49_1845 | 589 |
| 887 | 3300045051 | Ga0451576_0002362 | Ga0451576_0002362_10688_12484 | 589 |
| 888 | 3300005293 | Ga0065715_10132088 | Ga0065715_101320881 | 590 |
| 889 | 3300005331 | Ga0070670_100026609 | Ga0070670_1000266092 | 590 |
| 890 | 3300005364 | Ga0070673_100003191 | Ga0070673_1000031917 | 590 |
| 891 | 3300005468 | Ga0070707_100120088 | Ga0070707_1001200882 | 590 |
| 892 | 3300005543 | Ga0070672_100013365 | Ga0070672_1000133654 | 590 |
| 893 | 3300005844 | Ga0068862_100113094 | Ga0068862_1001130942 | 590 |
| 894 | 3300006846 | Ga0075430_100081873 | Ga0075430_1000818732 | 590 |
| 895 | 3300006880 | Ga0075429_100033476 | Ga0075429_1000334764 | 590 |
| 896 | 3300009094 | Ga0111539_10144018 | Ga0111539_101440182 | 590 |
| 897 | 3300009147 | Ga0114129_10008909 | Ga0114129_1000890911 | 590 |
| 898 | 3300025940 | Ga0207691_10009627 | Ga0207691_100096277 | 590 |
| 899 | 3300026095 | Ga0207676_10023229 | Ga0207676_100232294 | 590 |
| 900 | 3300028380 | Ga0268265_10106397 | Ga0268265_101063972 | 590 |
| 901 | 3300031903 | Ga0307407_10008476 | Ga0307407_100084762 | 590 |
| 902 | 3300031995 | Ga0307409_100055966 | Ga0307409_1000559661 | 590 |
| 903 | 3300032002 | Ga0307416_100000683 | Ga0307416_1000006835 | 590 |
| 904 | 3300032002 | Ga0307416_100012525 | Ga0307416_1000125254 | 590 |
| 905 | 3300032005 | Ga0307411_10005339 | Ga0307411_100053393 | 590 |
| 906 | 3300032126 | Ga0307415_100004748 | Ga0307415_1000047487 | 590 |
| 907 | 3300032126 | Ga0307415_100106050 | Ga0307415_1001060502 | 590 |
| 908 | 3300046558 | Ga0495633_0038924 | Ga0495633_0038924_466_2244 | 590 |
| 909 | 3300050507 | nmdc:mga05p37_51424_c1 | nmdc:mga05p37_51424_c1_611_2386 | 590 |
| 910 | 3300050509 | nmdc:mga0qj67_108404_c1 | nmdc:mga0qj67_108404_c1_368_2143 | 590 |
| 911 | 3300050511 | nmdc:mga08y16_524_c1 | nmdc:mga08y16_524_c1_21845_23623 | 590 |
| 912 | 3300059424 | Ga0590075_000898 | Ga0590075_000898_855_2630 | 590 |
| 913 | 2162886007 | SwRhRL2b_contig_604697 | SwRhRL2b_0947.00001260 | 591 |
| 914 | 3300005289 | Ga0065704_10072792 | Ga0065704_100727927 | 591 |
| 915 | 3300005295 | Ga0065707_10001510 | Ga0065707_100015103 | 591 |
| 916 | 3300005331 | Ga0070670_100009392 | Ga0070670_1000093928 | 591 |
| 917 | 3300005336 | Ga0070680_100168103 | Ga0070680_1001681031 | 591 |
| 918 | 3300005340 | Ga0070689_100023528 | Ga0070689_1000235284 | 591 |
| 919 | 3300005340 | Ga0070689_100072627 | Ga0070689_1000726272 | 591 |
| 920 | 3300005354 | Ga0070675_100006612 | Ga0070675_1000066124 | 591 |
| 921 | 3300005354 | Ga0070675_100033628 | Ga0070675_1000336284 | 591 |
| 922 | 3300005354 | Ga0070675_100043727 | Ga0070675_1000437274 | 591 |
| 923 | 3300005355 | Ga0070671_100088961 | Ga0070671_1000889612 | 591 |
| 924 | 3300005355 | Ga0070671_100115985 | Ga0070671_1001159852 | 591 |
| 925 | 3300005364 | Ga0070673_100043033 | Ga0070673_1000430332 | 591 |
| 926 | 3300005364 | Ga0070673_100084830 | Ga0070673_1000848301 | 591 |
| 927 | 3300005365 | Ga0070688_100040711 | Ga0070688_1000407112 | 591 |
| 928 | 3300005458 | Ga0070681_10023670 | Ga0070681_100236702 | 591 |
| 929 | 3300005468 | Ga0070707_100041377 | Ga0070707_1000413772 | 591 |
| 930 | 3300005471 | Ga0070698_100000242 | Ga0070698_10000024211 | 591 |
| 931 | 3300005518 | Ga0070699_100007701 | Ga0070699_10000770110 | 591 |
| 932 | 3300005518 | Ga0070699_100103101 | Ga0070699_1001031012 | 591 |
| 933 | 3300005546 | Ga0070696_100014845 | Ga0070696_1000148454 | 591 |
| 934 | 3300005617 | Ga0068859_100009782 | Ga0068859_1000097827 | 591 |
| 935 | 3300005719 | Ga0068861_100009595 | Ga0068861_1000095951 | 591 |
| 936 | 3300005841 | Ga0068863_100016634 | Ga0068863_1000166345 | 591 |
| 937 | 3300005843 | Ga0068860_100008019 | Ga0068860_1000080197 | 591 |
| 938 | 3300006358 | Ga0068871_100107228 | Ga0068871_1001072282 | 591 |
| 939 | 3300006852 | Ga0075433_10017711 | Ga0075433_100177113 | 591 |
| 940 | 3300006852 | Ga0075433_10031345 | Ga0075433_100313454 | 591 |
| 941 | 3300006852 | Ga0075433_10036428 | Ga0075433_100364284 | 591 |
| 942 | 3300006871 | Ga0075434_100022049 | Ga0075434_1000220492 | 591 |
| 943 | 3300006931 | Ga0097620_100009783 | Ga0097620_1000097837 | 591 |
| 944 | 3300007076 | Ga0075435_100015116 | Ga0075435_1000151162 | 591 |
| 945 | 3300007076 | Ga0075435_100021210 | Ga0075435_1000212102 | 591 |
| 946 | 3300009147 | Ga0114129_10026626 | Ga0114129_100266264 | 591 |
| 947 | 3300009147 | Ga0114129_10142742 | Ga0114129_101427423 | 591 |
| 948 | 3300009553 | Ga0105249_10024546 | Ga0105249_100245464 | 591 |
| 949 | 3300013308 | Ga0157375_10012952 | Ga0157375_100129523 | 591 |
| 950 | 3300025907 | Ga0207645_10040709 | Ga0207645_100407092 | 591 |
| 951 | 3300025912 | Ga0207707_10034673 | Ga0207707_100346732 | 591 |
| 952 | 3300025918 | Ga0207662_10036360 | Ga0207662_100363602 | 591 |
| 953 | 3300025922 | Ga0207646_10081870 | Ga0207646_100818702 | 591 |
| 954 | 3300025926 | Ga0207659_10000227 | Ga0207659_1000022712 | 591 |
| 955 | 3300025940 | Ga0207691_10044357 | Ga0207691_100443572 | 591 |
| 956 | 3300025940 | Ga0207691_10058456 | Ga0207691_100584562 | 591 |
| 957 | 3300025960 | Ga0207651_10074126 | Ga0207651_100741261 | 591 |
| 958 | 3300026075 | Ga0207708_10017646 | Ga0207708_100176466 | 591 |
| 959 | 3300026095 | Ga0207676_10056450 | Ga0207676_100564502 | 591 |
| 960 | 3300026116 | Ga0207674_10010324 | Ga0207674_1001032411 | 591 |
| 961 | 3300026118 | Ga0207675_100005264 | Ga0207675_1000052642 | 591 |
| 962 | 3300026121 | Ga0207683_10031790 | Ga0207683_100317902 | 591 |
| 963 | 3300027907 | Ga0207428_10010477 | Ga0207428_100104776 | 591 |
| 964 | 3300028380 | Ga0268265_10012948 | Ga0268265_100129486 | 591 |
| 965 | 3300028381 | Ga0268264_10017223 | Ga0268264_100172234 | 591 |
| 966 | 3300028381 | Ga0268264_10156111 | Ga0268264_101561112 | 591 |
| 967 | 3300045051 | Ga0451576_0009935 | Ga0451576_0009935_5142_6917 | 591 |
| 968 | 3300045051 | Ga0451576_0053000 | Ga0451576_0053000_2412_4187 | 591 |
| 969 | 3300045051 | Ga0451576_0074357 | Ga0451576_0074357_1456_3231 | 591 |
| 970 | 3300046459 | Ga0495629_0004294 | Ga0495629_0004294_8416_10209 | 591 |
| 971 | 3300046499 | Ga0495594_0017951 | Ga0495594_0017951_617_2392 | 591 |
| 972 | 3300046539 | Ga0495621_0000671 | Ga0495621_0000671_3767_5542 | 591 |
| 973 | 3300046539 | Ga0495621_0016009 | Ga0495621_0016009_80_1855 | 591 |
| 974 | 3300046664 | Ga0495659_0001886 | Ga0495659_0001886_3364_5139 | 591 |
| 975 | 3300050507 | nmdc:mga05p37_276725_c1 | nmdc:mga05p37_276725_c1_166_1941 | 591 |
| 976 | 3300050512 | nmdc:mga0n895_157977_c1 | nmdc:mga0n895_157977_c1_412_2187 | 591 |
| 977 | 3300050512 | nmdc:mga0n895_1771_c1 | nmdc:mga0n895_1771_c1_10835_12610 | 591 |
| 978 | 3300050513 | nmdc:mga0rr50_45969_c1 | nmdc:mga0rr50_45969_c1_510_2285 | 591 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6wom-assembly1.cif.gz_B | crystal structure of aspartyl-trna ligase from elizabethkingia sp. | 0.9529 | 10 | 591 |
| 6hhx-assembly1.cif.gz_A | structure of t. thermophilus asprs in complex with 5'-o-(n-(l-aspartyl)-sulfamoyl)cytidine | 0.9528 | 10 | 591 |
| 6sjc-assembly1.cif.gz_A | structure of t. thermophilus asprs in complex with 5'-o-(n-(l-aspartyl)-sulfamoyl)adenosine | 0.9523 | 10 | 591 |
| 7ap4-assembly1.cif.gz_A | thermus thermophilus aspartyl-trna synthetase in complex with compound asps7hmdda | 0.9503 | 10 | 591 |
| 1l0w-assembly1.cif.gz_B | aspartyl-trna synthetase-1 from space-grown crystals | 0.9494 | 9 | 591 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1c0aA01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9764 | 9 | 114 | 2.40.50.140 |
| 1c0aA01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9675 | 9 | 114 | 2.40.50.140 |
| 1l0wB01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9658 | 9 | 116 | 2.40.50.140 |
| 4o2dB01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9615 | 10 | 114 | 2.40.50.140 |
| af_A0A0R0FYI1_245_329_3.30.930.10 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.9521 | 430 | 516 | 3.30.930.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X7FD61-F1-model_v4 | deleted | 0.9864 | 429 | 590 |
|
| AF-A0A3D2RF65-F1-model_v4 | Aspartate--tRNA ligase | 0.986 | 432 | 591 |
GO:0004815
GO:0005524 GO:0006422 |
| AF-A0A382LAP6-F1-model_v4 | Aminoacyl-transfer RNA synthetases class-II family profile domain-containing protein | 0.9847 | 482 | 590 |
GO:0004815
GO:0005524 GO:0006422 |
| AF-A0A2T4RXQ7-F1-model_v4 | Aspartate--tRNA ligase (EC 6.1.1.12) | 0.9843 | 128 | 259 |
GO:0004815
GO:0005524 GO:0005737 GO:0006422 GO:0016740 |
| AF-A0A7C7QCQ7-F1-model_v4 | Aminoacyl-tRNA synthetase class II (D/K/N) domain-containing protein | 0.9841 | 438 | 591 |
GO:0004815
GO:0005524 GO:0006422 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar