F487302

General Info

Members Datasets Scaffolds Average Seq Length
978 380 1956 175

Family's Representative Sequence

Representative Sequence 3300026095|Ga0207676_10707429|Ga0207676_107074291
Length 192
Sequence MSNMNKTFAAIITGLVLTVSVGASEAKITGVHLCCQSCVKGVEKAGELKVTLVPEVDASVDADGVTLTPRKDMERAAAMWGLSRSLVNNLVVGVTAGFSSKLEIQGVGYRAAVQGKNLNLQLGFSHDVAYPIPASITITAEKPTMLTIAGIDKQLVGQVAAEIRGYRPPEPYKGKGVRYEGEYVRRKEGKKK

Samples

Sample ID Description Type Environment
1 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
114 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
173 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
179 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
180 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
181 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
182 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
183 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
184 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
185 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
186 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
187 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
188 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
189 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
190 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
191 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
192 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
195 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
196 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
197 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
198 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
199 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
200 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
201 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
202 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
203 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
204 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
205 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
208 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
209 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
210 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
211 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
212 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
213 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
214 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
215 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
216 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
217 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
223 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
225 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
226 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
227 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
228 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
229 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
230 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
231 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
232 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
233 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
234 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
235 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
236 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
237 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
238 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
239 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
240 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
241 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
242 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
243 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
245 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
246 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
247 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
248 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
249 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
250 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
251 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
252 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
253 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
254 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
255 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
256 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
257 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
258 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
259 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
260 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
261 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
262 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
263 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
264 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
265 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
266 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
267 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
268 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
269 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
270 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
271 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
272 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
273 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
274 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
275 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
276 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
277 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
278 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
279 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
280 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
281 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
282 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
283 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
284 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
285 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
286 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
287 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
288 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
289 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
290 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
291 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
292 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
293 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
294 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
295 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
296 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
297 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
298 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
299 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
300 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
301 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
302 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
303 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
304 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
305 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
306 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
307 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
308 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
309 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
310 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
311 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
312 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
313 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
314 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
315 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
331 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
332 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
333 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
334 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
335 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
336 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
337 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
338 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
339 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
340 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
341 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
342 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
343 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
344 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
347 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
348 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
349 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
350 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
351 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
352 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
353 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
354 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
355 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
356 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
357 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
358 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
359 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
360 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
361 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
362 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
363 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
364 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
365 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
366 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
367 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
368 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
369 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
370 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
371 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
372 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
373 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
374 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
375 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
376 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
377 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
378 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
379 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
380 2739367655 Pusillimonas sp. YR330 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.67
Metatranscriptomes 1.23
Isolates 0.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.4
Nodule 0
Rhizoplane 0.82
Rhizosphere 91.62
Stem 0
Stem Tuber 0
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207676_10707429 3300026095 Bacteria 977
2 JGI25165J46597_1001315 3300003214 Bacteria 14050
3 JGI25153J46596_10000830 3300003215 Bacteria 18874
4 rootH2_10048944 3300003320 Bacteria 1909
5 Ga0058859_10022480 3300004798 Bacteria 1971
6 Ga0058863_11970613 3300004799 Bacteria 1145
7 Ga0058862_11940969 3300004803 Bacteria 1024
8 Ga0070658_10045521 3300005327 Bacteria 3548
9 Ga0070658_11372238 3300005327 Bacteria 613
10 Ga0070676_10079075 3300005328 Bacteria 1990
11 Ga0070676_10302467 3300005328 Bacteria 1085
12 Ga0070683_100088671 3300005329 Bacteria 2902
13 Ga0070683_100187211 3300005329 Bacteria 1965
14 Ga0070690_100219016 3300005330 Bacteria 1333
15 Ga0070690_100294104 3300005330 Bacteria 1162
16 Ga0070690_100539086 3300005330 Bacteria 878
17 Ga0068869_100070091 3300005334 Bacteria 2593
18 Ga0068869_101415616 3300005334 Bacteria 616
19 Ga0070666_10007106 3300005335 Bacteria 6904
20 Ga0070666_10123583 3300005335 Bacteria 1795
21 Ga0070680_100002998 3300005336 Bacteria 12534
22 Ga0070680_100072787 3300005336 Bacteria 2825
23 Ga0070680_100078879 3300005336 Bacteria 2713
24 Ga0070680_100226414 3300005336 Bacteria 1579
25 Ga0070680_100255022 3300005336 Bacteria 1484
26 Ga0068868_100153898 3300005338 Bacteria 1895
27 Ga0068868_100397645 3300005338 Bacteria 1188
28 Ga0068868_101181538 3300005338 Bacteria 707
29 Ga0070660_100018276 3300005339 Bacteria 5121
30 Ga0070660_100069129 3300005339 Bacteria 2753
31 Ga0070660_100089034 3300005339 Bacteria 2432
32 Ga0070660_100108074 3300005339 Bacteria 2211
33 Ga0070660_100174288 3300005339 Bacteria 1739
34 Ga0070660_100477533 3300005339 Bacteria 1036
35 Ga0070689_100415195 3300005340 Bacteria 1140
36 Ga0070691_10000386 3300005341 Bacteria 16019
37 Ga0070691_10149346 3300005341 Bacteria 1197
38 Ga0070691_10155140 3300005341 Bacteria 1176
39 Ga0070691_10222565 3300005341 Bacteria 1001
40 Ga0070661_100005946 3300005344 Bacteria 8403
41 Ga0070661_100843647 3300005344 Bacteria 754
42 Ga0070675_101654718 3300005354 Bacteria 591
43 Ga0070671_100262784 3300005355 Bacteria 1467
44 Ga0070671_100563781 3300005355 Bacteria 983
45 Ga0070674_100041872 3300005356 Bacteria 3107
46 Ga0070688_100357639 3300005365 Bacteria 1071
47 Ga0070659_100012925 3300005366 Bacteria 6204
48 Ga0070659_100027373 3300005366 Bacteria 4393
49 Ga0070667_100061525 3300005367 Bacteria 3179
50 Ga0070667_100349423 3300005367 Bacteria 1338
51 Ga0070709_10003511 3300005434 Bacteria 8423
52 Ga0070709_10171867 3300005434 Bacteria 1515
53 Ga0070714_100000676 3300005435 Bacteria 24155
54 Ga0070714_100068815 3300005435 Bacteria 3056
55 Ga0070714_100109782 3300005435 Bacteria 2441
56 Ga0070714_100530839 3300005435 Bacteria 1125
57 Ga0070714_101124907 3300005435 Bacteria 766
58 Ga0070714_101188515 3300005435 Unclassified 744
59 Ga0070713_100000012 3300005436 Bacteria 137708
60 Ga0070713_100162144 3300005436 Bacteria 1997
61 Ga0070713_100213904 3300005436 Bacteria 1746
62 Ga0070713_100364268 3300005436 Bacteria 1344
63 Ga0070710_10040281 3300005437 Bacteria 2575
64 Ga0070710_10553255 3300005437 Bacteria 795
65 Ga0070711_100240856 3300005439 Bacteria 1414
66 Ga0070711_100351636 3300005439 Bacteria 1185
67 Ga0070711_100570669 3300005439 Bacteria 941
68 Ga0070694_100283260 3300005444 Bacteria 1264
69 Ga0070694_100340525 3300005444 Bacteria 1159
70 Ga0070663_100264255 3300005455 Bacteria 1366
71 Ga0070678_100013560 3300005456 Bacteria 5116
72 Ga0070678_100021125 3300005456 Bacteria 4286
73 Ga0070678_100069504 3300005456 Bacteria 2629
74 Ga0070678_100681426 3300005456 Bacteria 925
75 Ga0070681_10000037 3300005458 Bacteria 96087
76 Ga0070681_10034634 3300005458 Bacteria 5070
77 Ga0070681_10048475 3300005458 Bacteria 4244
78 Ga0070681_10160044 3300005458 Bacteria 2175
79 Ga0070681_10179316 3300005458 Bacteria 2040
80 Ga0070681_10237697 3300005458 Bacteria 1735
81 Ga0068867_100100755 3300005459 Bacteria 2205
82 Ga0068867_100540816 3300005459 Bacteria 1007
83 Ga0070707_101144481 3300005468 Bacteria 744
84 Ga0070699_100114998 3300005518 Bacteria 2364
85 Ga0070699_100215896 3300005518 Bacteria 1708
86 Ga0070679_100008411 3300005530 Bacteria 9712
87 Ga0070679_100064794 3300005530 Bacteria 3642
88 Ga0070679_100082939 3300005530 Bacteria 3195
89 Ga0070679_100335688 3300005530 Bacteria 1460
90 Ga0070684_100283884 3300005535 Bacteria 1517
91 Ga0068853_100002020 3300005539 Bacteria 15004
92 Ga0068853_100002660 3300005539 Bacteria 13466
93 Ga0068853_100237414 3300005539 Bacteria 1670
94 Ga0068853_100714452 3300005539 Bacteria 956
95 Ga0068853_101136376 3300005539 Bacteria 754
96 Ga0070686_100311002 3300005544 Bacteria 1172
97 Ga0070695_100019206 3300005545 Bacteria 4159
98 Ga0070696_101268626 3300005546 Bacteria 624
99 Ga0070693_100381808 3300005547 Bacteria 972
100 Ga0070665_100087868 3300005548 Bacteria 3114
101 Ga0070665_100093536 3300005548 Bacteria 3011
102 Ga0070665_100175548 3300005548 Bacteria 2143
103 Ga0070665_100264776 3300005548 Bacteria 1720
104 Ga0070665_100600604 3300005548 Bacteria 1113
105 Ga0070704_100029374 3300005549 Bacteria 3670
106 Ga0068855_100000385 3300005563 Bacteria 54304
107 Ga0068855_100034625 3300005563 Bacteria 6019
108 Ga0068855_100121416 3300005563 Bacteria 2990
109 Ga0068855_100161413 3300005563 Bacteria 2543
110 Ga0068855_100693807 3300005563 Bacteria 1090
111 Ga0068855_100953360 3300005563 Bacteria 904
112 Ga0068855_101722291 3300005563 Bacteria 639
113 Ga0068857_100007896 3300005577 Bacteria 9178
114 Ga0068857_100258522 3300005577 Bacteria 1598
115 Ga0068857_100361571 3300005577 Bacteria 1345
116 Ga0068857_100983381 3300005577 Bacteria 812
117 Ga0068854_100347723 3300005578 Bacteria 1213
118 Ga0068856_100001032 3300005614 Bacteria 29659
119 Ga0068856_100021325 3300005614 Bacteria 6296
120 Ga0068856_100155308 3300005614 Bacteria 2298
121 Ga0068856_100478045 3300005614 Bacteria 1267
122 Ga0068856_100685912 3300005614 Bacteria 1045
123 Ga0070702_100299022 3300005615 Bacteria 1112
124 Ga0068852_100063743 3300005616 Bacteria 3210
125 Ga0068852_100142311 3300005616 Bacteria 2221
126 Ga0068852_100187615 3300005616 Bacteria 1948
127 Ga0068852_100289160 3300005616 Bacteria 1583
128 Ga0068852_100393106 3300005616 Bacteria 1362
129 Ga0068864_100440435 3300005618 Bacteria 1245
130 Ga0068864_101611468 3300005618 Bacteria 653
131 Ga0068866_10072414 3300005718 Bacteria 1826
132 Ga0068866_10260834 3300005718 Bacteria 1065
133 Ga0068863_100043883 3300005841 Bacteria 4244
134 Ga0068863_101146006 3300005841 Bacteria 783
135 Ga0068858_100049282 3300005842 Bacteria 3900
136 Ga0068858_100477057 3300005842 Bacteria 1204
137 Ga0068860_100950609 3300005843 Bacteria 876
138 Ga0068860_101559447 3300005843 Bacteria 682
139 Ga0068862_100100297 3300005844 Bacteria 2532
140 Ga0081540_1008438 3300005983 Bacteria 7199
141 Ga0075365_10000030 3300006038 Bacteria 56932
142 Ga0075368_10095597 3300006042 Bacteria 1217
143 Ga0075363_100001020 3300006048 Bacteria 10057
144 Ga0075364_10000068 3300006051 Bacteria 39877
145 Ga0075364_10024136 3300006051 Bacteria 3857
146 Ga0070716_100211553 3300006173 Bacteria 1296
147 Ga0070716_100564291 3300006173 Bacteria 851
148 Ga0070712_100000902 3300006175 Bacteria 17764
149 Ga0070712_100004052 3300006175 Bacteria 8996
150 Ga0070712_100113045 3300006175 Bacteria 2030
151 Ga0070712_100317927 3300006175 Bacteria 1265
152 Ga0075367_10018355 3300006178 Bacteria 3858
153 Ga0075369_10000030 3300006186 Bacteria 39211
154 Ga0097621_100047344 3300006237 Bacteria 3484
155 Ga0097621_100106219 3300006237 Bacteria 2368
156 Ga0097621_100161557 3300006237 Bacteria 1926
157 Ga0097621_100227174 3300006237 Bacteria 1629
158 Ga0097621_100318759 3300006237 Bacteria 1376
159 Ga0097621_100402268 3300006237 Bacteria 1226
160 Ga0075370_10000042 3300006353 Bacteria 39566
161 Ga0068871_100019627 3300006358 Bacteria 5165
162 Ga0068871_100071528 3300006358 Bacteria 2853
163 Ga0068871_100162546 3300006358 Bacteria 1910
164 Ga0068871_100175438 3300006358 Bacteria 1840
165 Ga0068871_100301487 3300006358 Bacteria 1407
166 Ga0068871_100419656 3300006358 Bacteria 1194
167 Ga0068871_100839602 3300006358 Bacteria 849
168 Ga0075428_100000808 3300006844 Bacteria 32725
169 Ga0075430_100194948 3300006846 Bacteria 1683
170 Ga0075431_100116845 3300006847 Bacteria 2753
171 Ga0075431_101399219 3300006847 Bacteria 659
172 Ga0075433_10105346 3300006852 Bacteria 2499
173 Ga0075434_100176261 3300006871 Bacteria 2158
174 Ga0075434_100262322 3300006871 Bacteria 1747
175 Ga0075434_100441455 3300006871 Bacteria 1323
176 Ga0075429_100028322 3300006880 Bacteria 4864
177 Ga0075429_100043701 3300006880 Bacteria 3899
178 Ga0068865_100002505 3300006881 Bacteria 10873
179 Ga0075436_100000458 3300006914 Bacteria 26344
180 Ga0075436_100000862 3300006914 Bacteria 20155
181 Ga0075436_100002564 3300006914 Bacteria 12509
182 Ga0075436_100029529 3300006914 Bacteria 3771
183 Ga0075435_100006049 3300007076 Bacteria 8522
184 Ga0075435_100018960 3300007076 Bacteria 5244
185 Ga0075435_100609814 3300007076 Bacteria 947
186 Ga0105250_10440537 3300009092 Bacteria 583
187 Ga0105240_10004232 3300009093 Bacteria 21946
188 Ga0105240_10004696 3300009093 Bacteria 20647
189 Ga0105240_10017473 3300009093 Bacteria 9666
190 Ga0105240_10025381 3300009093 Bacteria 7788
191 Ga0105240_10150688 3300009093 Bacteria 2770
192 Ga0105240_10252800 3300009093 Bacteria 2037
193 Ga0105240_10571025 3300009093 Bacteria 1249
194 Ga0105240_10675787 3300009093 Bacteria 1129
195 Ga0105240_10722476 3300009093 Bacteria 1085
196 Ga0105240_11279886 3300009093 Bacteria 774
197 Ga0111539_10002099 3300009094 Bacteria 26631
198 Ga0111539_10023579 3300009094 Bacteria 7562
199 Ga0105245_10230243 3300009098 Bacteria 1792
200 Ga0105245_10538363 3300009098 Bacteria 1188
201 Ga0105247_10056711 3300009101 Bacteria 2420
202 Ga0114129_10070335 3300009147 Bacteria 4880
203 Ga0105243_10014172 3300009148 Bacteria 6032
204 Ga0105243_10222994 3300009148 Bacteria 1668
205 Ga0105241_10035275 3300009174 Bacteria 3762
206 Ga0105241_10116852 3300009174 Bacteria 2143
207 Ga0105241_10455114 3300009174 Bacteria 1133
208 Ga0105241_10469421 3300009174 Bacteria 1116
209 Ga0105241_10477193 3300009174 Bacteria 1108
210 Ga0105241_10731521 3300009174 Bacteria 906
211 Ga0105242_10123893 3300009176 Bacteria 2222
212 Ga0105242_10848595 3300009176 Bacteria 909
213 Ga0105242_10891180 3300009176 Bacteria 889
214 Ga0105248_10000005 3300009177 Bacteria 673111
215 Ga0105248_10047589 3300009177 Bacteria 4810
216 Ga0105248_10063706 3300009177 Bacteria 4138
217 Ga0105248_10408693 3300009177 Bacteria 1528
218 Ga0105237_10003253 3300009545 Bacteria 19420
219 Ga0105237_10181890 3300009545 Bacteria 2102
220 Ga0105237_10627975 3300009545 Bacteria 1081
221 Ga0105238_10001939 3300009551 Bacteria 20807
222 Ga0105238_10017491 3300009551 Bacteria 7288
223 Ga0105238_10055822 3300009551 Bacteria 3964
224 Ga0105238_10130022 3300009551 Bacteria 2496
225 Ga0105238_10179895 3300009551 Bacteria 2092
226 Ga0105238_10426203 3300009551 Bacteria 1322
227 Ga0105238_10826441 3300009551 Bacteria 943
228 Ga0105249_10348653 3300009553 Bacteria 1499
229 Ga0099796_10011720 3300010159 Bacteria 2455
230 Ga0105239_10005584 3300010375 Bacteria 14708
231 Ga0105239_10073553 3300010375 Bacteria 3757
232 Ga0105239_10077915 3300010375 Bacteria 3647
233 Ga0105239_10210784 3300010375 Bacteria 2178
234 Ga0105239_10243523 3300010375 Bacteria 2018
235 Ga0105239_10259863 3300010375 Bacteria 1951
236 Ga0105239_10377439 3300010375 Bacteria 1603
237 Ga0105239_12206314 3300010375 Bacteria 640
238 Ga0105246_10013218 3300011119 Bacteria 5169
239 Ga0105246_10062954 3300011119 Bacteria 2586
240 Ga0105246_10516333 3300011119 Bacteria 1017
241 Ga0105246_10563413 3300011119 Bacteria 978
242 Ga0157373_10000820 3300013100 Bacteria 24076
243 Ga0157373_10567405 3300013100 Bacteria 824
244 Ga0157371_10098586 3300013102 Bacteria 2072
245 Ga0157371_10655232 3300013102 Bacteria 784
246 Ga0157370_10003448 3300013104 Bacteria 18559
247 Ga0157370_10008323 3300013104 Bacteria 11186
248 Ga0157370_10035566 3300013104 Bacteria 4839
249 Ga0157370_10083851 3300013104 Bacteria 2996
250 Ga0157370_11614616 3300013104 Bacteria 582
251 Ga0157369_10001535 3300013105 Bacteria 28280
252 Ga0157369_10033188 3300013105 Bacteria 5675
253 Ga0157369_10345530 3300013105 Bacteria 1546
254 Ga0157369_10407520 3300013105 Bacteria 1410
255 Ga0157369_11085912 3300013105 Bacteria 818
256 Ga0157374_10377448 3300013296 Bacteria 1412
257 Ga0157378_10115850 3300013297 Bacteria 2464
258 Ga0157378_10232385 3300013297 Bacteria 1758
259 Ga0157378_10424647 3300013297 Bacteria 1314
260 Ga0157378_10549314 3300013297 Bacteria 1160
261 Ga0157378_10885088 3300013297 Bacteria 923
262 Ga0157378_10906097 3300013297 Bacteria 913
263 Ga0163162_10250500 3300013306 Bacteria 1903
264 Ga0163162_10446856 3300013306 Bacteria 1425
265 Ga0163162_11179552 3300013306 Bacteria 869
266 Ga0157372_10007016 3300013307 Bacteria 11997
267 Ga0157372_10008268 3300013307 Bacteria 11062
268 Ga0157372_10032489 3300013307 Bacteria 5724
269 Ga0157372_10037651 3300013307 Bacteria 5337
270 Ga0157372_10066383 3300013307 Bacteria 4053
271 Ga0157372_10327295 3300013307 Bacteria 1784
272 Ga0157375_10614872 3300013308 Bacteria 1245
273 Ga0163163_10008003 3300014325 Bacteria 9355
274 Ga0163163_10332968 3300014325 Bacteria 1573
275 Ga0163163_10915513 3300014325 Bacteria 940
276 Ga0157380_10294611 3300014326 Bacteria 1491
277 Ga0157379_10007681 3300014968 Bacteria 9336
278 Ga0157379_10010518 3300014968 Bacteria 8065
279 Ga0157379_10019718 3300014968 Bacteria 5958
280 Ga0157379_10052289 3300014968 Bacteria 3649
281 Ga0157379_10232957 3300014968 Bacteria 1670
282 Ga0157379_10428308 3300014968 Bacteria 1219
283 Ga0157376_10147364 3300014969 Bacteria 2119
284 Ga0157376_10291481 3300014969 Bacteria 1541
285 Ga0157376_10517483 3300014969 Bacteria 1175
286 Ga0163161_10646087 3300017792 Bacteria 876
287 Ga0213874_10002785 3300021377 Bacteria 3804
288 Ga0213874_10006777 3300021377 Bacteria 2724
289 Ga0213876_10000421 3300021384 Bacteria 35344
290 Ga0213876_10003189 3300021384 Bacteria 9433
291 Ga0213876_10027585 3300021384 Bacteria 2996
292 Ga0213876_10103540 3300021384 Bacteria 1509
293 Ga0209563_105604 3300025230 Bacteria 2249
294 Ga0209233_1000013 3300025261 Bacteria 1013785
295 Ga0209455_1020331 3300025272 Bacteria 1316
296 Ga0209758_1000013 3300025297 Bacteria 873003
297 Ga0209758_1152298 3300025297 Bacteria 585
298 Ga0207642_10017630 3300025899 Bacteria 2721
299 Ga0207680_10002564 3300025903 Bacteria 8470
300 Ga0207680_10106453 3300025903 Bacteria 1811
301 Ga0207699_10000164 3300025906 Bacteria 41177
302 Ga0207699_10037734 3300025906 Bacteria 2764
303 Ga0207645_10011392 3300025907 Bacteria 6075
304 Ga0207645_10473091 3300025907 Bacteria 847
305 Ga0207643_10030805 3300025908 Bacteria 2989
306 Ga0207643_10032595 3300025908 Bacteria 2911
307 Ga0207705_10000180 3300025909 Bacteria 66404
308 Ga0207705_10004720 3300025909 Bacteria 10265
309 Ga0207705_10194396 3300025909 Bacteria 1535
310 Ga0207705_10311673 3300025909 Bacteria 1208
311 Ga0207684_10294542 3300025910 Bacteria 1399
312 Ga0207654_10033200 3300025911 Bacteria 2859
313 Ga0207654_10063489 3300025911 Bacteria 2168
314 Ga0207654_10164797 3300025911 Bacteria 1434
315 Ga0207654_10428144 3300025911 Bacteria 925
316 Ga0207654_10803875 3300025911 Bacteria 679
317 Ga0207707_10000011 3300025912 Bacteria 282857
318 Ga0207707_10002715 3300025912 Bacteria 15806
319 Ga0207707_10048827 3300025912 Bacteria 3687
320 Ga0207707_10124122 3300025912 Bacteria 2258
321 Ga0207707_10267082 3300025912 Bacteria 1483
322 Ga0207707_10563709 3300025912 Bacteria 967
323 Ga0207695_10000018 3300025913 Bacteria 766611
324 Ga0207695_10028316 3300025913 Bacteria 6218
325 Ga0207695_10040352 3300025913 Bacteria 5007
326 Ga0207695_10128661 3300025913 Bacteria 2492
327 Ga0207695_10182399 3300025913 Bacteria 2020
328 Ga0207695_10217861 3300025913 Bacteria 1817
329 Ga0207695_10284139 3300025913 Bacteria 1548
330 Ga0207695_10284558 3300025913 Bacteria 1546
331 Ga0207695_10340402 3300025913 Bacteria 1388
332 Ga0207695_10383850 3300025913 Bacteria 1290
333 Ga0207671_10019547 3300025914 Bacteria 5178
334 Ga0207671_10049879 3300025914 Bacteria 3099
335 Ga0207671_10408901 3300025914 Bacteria 1079
336 Ga0207671_10499698 3300025914 Bacteria 970
337 Ga0207693_10001210 3300025915 Bacteria 23009
338 Ga0207693_10001929 3300025915 Bacteria 18163
339 Ga0207693_10054085 3300025915 Bacteria 3150
340 Ga0207693_10055946 3300025915 Bacteria 3093
341 Ga0207693_10266868 3300025915 Bacteria 1341
342 Ga0207693_10375640 3300025915 Bacteria 1112
343 Ga0207663_10015424 3300025916 Bacteria 4215
344 Ga0207663_10172408 3300025916 Bacteria 1538
345 Ga0207663_11098027 3300025916 Bacteria 639
346 Ga0207660_10000110 3300025917 Bacteria 46792
347 Ga0207660_10003537 3300025917 Bacteria 10180
348 Ga0207660_10069892 3300025917 Bacteria 2551
349 Ga0207660_10181434 3300025917 Bacteria 1635
350 Ga0207657_10000241 3300025919 Bacteria 57958
351 Ga0207657_10063406 3300025919 Bacteria 3160
352 Ga0207657_10196503 3300025919 Bacteria 1625
353 Ga0207657_10280758 3300025919 Bacteria 1322
354 Ga0207657_10734228 3300025919 Bacteria 766
355 Ga0207649_10000194 3300025920 Bacteria 50112
356 Ga0207652_10000824 3300025921 Bacteria 29561
357 Ga0207652_10007774 3300025921 Bacteria 8614
358 Ga0207652_10108322 3300025921 Bacteria 2462
359 Ga0207652_10115732 3300025921 Bacteria 2382
360 Ga0207694_10000010 3300025924 Bacteria 439722
361 Ga0207694_10025930 3300025924 Bacteria 4456
362 Ga0207694_10026889 3300025924 Bacteria 4381
363 Ga0207694_10221393 3300025924 Bacteria 1544
364 Ga0207694_10810215 3300025924 Bacteria 791
365 Ga0207694_10850182 3300025924 Bacteria 771
366 Ga0207694_10864858 3300025924 Bacteria 764
367 Ga0207694_10906379 3300025924 Bacteria 745
368 Ga0207650_10171098 3300025925 Bacteria 1726
369 Ga0207650_10536252 3300025925 Bacteria 980
370 Ga0207659_10166081 3300025926 Bacteria 1737
371 Ga0207687_10017844 3300025927 Bacteria 4682
372 Ga0207687_10085895 3300025927 Bacteria 2284
373 Ga0207687_10325007 3300025927 Bacteria 1246
374 Ga0207687_10390587 3300025927 Bacteria 1142
375 Ga0207700_10000295 3300025928 Bacteria 29631
376 Ga0207700_10130882 3300025928 Bacteria 2048
377 Ga0207664_10032838 3300025929 Bacteria 3982
378 Ga0207664_10073108 3300025929 Bacteria 2766
379 Ga0207664_10177988 3300025929 Bacteria 1825
380 Ga0207664_10312818 3300025929 Bacteria 1384
381 Ga0207664_10411486 3300025929 Bacteria 1204
382 Ga0207644_10562368 3300025931 Bacteria 945
383 Ga0207690_10346628 3300025932 Bacteria 1173
384 Ga0207686_10073147 3300025934 Bacteria 2211
385 Ga0207686_10163989 3300025934 Bacteria 1560
386 Ga0207709_10125051 3300025935 Bacteria 1743
387 Ga0207670_10845695 3300025936 Bacteria 764
388 Ga0207669_10280567 3300025937 Bacteria 1256
389 Ga0207704_10122838 3300025938 Bacteria 1781
390 Ga0207665_10241385 3300025939 Bacteria 1331
391 Ga0207665_10301672 3300025939 Bacteria 1197
392 Ga0207691_10325382 3300025940 Bacteria 1318
393 Ga0207711_10000002 3300025941 Bacteria 1228676
394 Ga0207711_10145656 3300025941 Bacteria 2134
395 Ga0207689_10127211 3300025942 Bacteria 2096
396 Ga0207689_10261962 3300025942 Bacteria 1430
397 Ga0207661_10144696 3300025944 Bacteria 2049
398 Ga0207661_10219381 3300025944 Bacteria 1680
399 Ga0207661_10500695 3300025944 Bacteria 1110
400 Ga0207679_10701601 3300025945 Bacteria 918
401 Ga0207667_10000388 3300025949 Bacteria 59263
402 Ga0207667_10031700 3300025949 Bacteria 5704
403 Ga0207667_10542855 3300025949 Bacteria 1176
404 Ga0207667_10582275 3300025949 Bacteria 1130
405 Ga0207651_10169073 3300025960 Bacteria 1722
406 Ga0207651_10727070 3300025960 Bacteria 876
407 Ga0207712_11134703 3300025961 Bacteria 696
408 Ga0207712_11399583 3300025961 Bacteria 626
409 Ga0207668_10971586 3300025972 Bacteria 758
410 Ga0207640_10040030 3300025981 Bacteria 2971
411 Ga0207658_10058513 3300025986 Bacteria 2868
412 Ga0207658_10134474 3300025986 Bacteria 1991
413 Ga0207703_10027678 3300026035 Bacteria 4464
414 Ga0207703_10064130 3300026035 Bacteria 3014
415 Ga0207639_10000867 3300026041 Bacteria 20545
416 Ga0207639_10059896 3300026041 Bacteria 2935
417 Ga0207639_10979110 3300026041 Bacteria 792
418 Ga0207639_11233052 3300026041 Bacteria 702
419 Ga0207639_11280022 3300026041 Bacteria 688
420 Ga0207678_10367816 3300026067 Bacteria 1242
421 Ga0207702_10000315 3300026078 Bacteria 55383
422 Ga0207702_10348694 3300026078 Bacteria 1416
423 Ga0207702_10583836 3300026078 Bacteria 1095
424 Ga0207702_10776759 3300026078 Bacteria 946
425 Ga0207702_11758665 3300026078 Bacteria 612
426 Ga0207641_10035109 3300026088 Bacteria 4175
427 Ga0207648_10154508 3300026089 Bacteria 2025
428 Ga0207648_10243653 3300026089 Bacteria 1601
429 Ga0207674_10001605 3300026116 Bacteria 29115
430 Ga0207674_10192958 3300026116 Bacteria 1987
431 Ga0207674_10291835 3300026116 Bacteria 1579
432 Ga0207674_11105553 3300026116 Bacteria 762
433 Ga0207675_100278079 3300026118 Bacteria 1626
434 Ga0207683_10018489 3300026121 Bacteria 5947
435 Ga0207683_10103171 3300026121 Bacteria 2547
436 Ga0207683_10264595 3300026121 Bacteria 1570
437 Ga0207683_10493868 3300026121 Bacteria 1130
438 Ga0207683_11029523 3300026121 Bacteria 764
439 Ga0207698_10042447 3300026142 Bacteria 3398
440 Ga0207698_10086858 3300026142 Bacteria 2545
441 Ga0207698_10144541 3300026142 Bacteria 2055
442 Ga0209995_1003999 3300027471 Bacteria 2354
443 Ga0209968_1004743 3300027526 Bacteria 2038
444 Ga0209970_1056276 3300027614 Bacteria 717
445 Ga0209971_1044728 3300027682 Bacteria 1067
446 Ga0209813_10045800 3300027866 Bacteria 1348
447 Ga0209813_10091394 3300027866 Bacteria 1022
448 Ga0209974_10060510 3300027876 Bacteria 1282
449 Ga0209974_10065728 3300027876 Bacteria 1232
450 Ga0207428_10002412 3300027907 Bacteria 18661
451 Ga0268266_10000557 3300028379 Bacteria 51935
452 Ga0268266_10055515 3300028379 Bacteria 3405
453 Ga0268266_10076582 3300028379 Bacteria 2907
454 Ga0268266_10092509 3300028379 Bacteria 2653
455 Ga0268266_10095842 3300028379 Bacteria 2606
456 Ga0268266_11207351 3300028379 Bacteria 731
457 Ga0268265_10295536 3300028380 Bacteria 1456
458 Ga0268264_10561069 3300028381 Bacteria 1121
459 Ga0268264_11168559 3300028381 Bacteria 779
460 Ga0265337_1001102 3300028556 Bacteria 13866
461 Ga0265334_10001106 3300028573 Bacteria 13201
462 Ga0265334_10116749 3300028573 Bacteria 956
463 Ga0265318_10000037 3300028577 Bacteria 138223
464 Ga0265318_10004788 3300028577 Bacteria 6480
465 Ga0265338_10000017 3300028800 Bacteria 344481
466 Ga0265338_10002896 3300028800 Bacteria 24981
467 Ga0265338_10005387 3300028800 Bacteria 16717
468 Ga0265338_10017000 3300028800 Bacteria 7869
469 Ga0265338_10038201 3300028800 Bacteria 4553
470 Ga0265338_10073797 3300028800 Bacteria 2906
471 Ga0265338_10106186 3300028800 Bacteria 2274
472 Ga0265338_10165948 3300028800 Bacteria 1700
473 Ga0265338_10203129 3300028800 Bacteria 1493
474 Ga0265338_10647847 3300028800 Bacteria 732
475 Ga0265324_10193448 3300029957 Bacteria 691
476 Ga0265324_10208133 3300029957 Bacteria 664
477 Ga0265330_10006774 3300031235 Bacteria 5647
478 Ga0265332_10017915 3300031238 Bacteria 3122
479 Ga0265332_10031083 3300031238 Bacteria 2330
480 Ga0265332_10071412 3300031238 Bacteria 1478
481 Ga0265332_10075392 3300031238 Bacteria 1434
482 Ga0265332_10197011 3300031238 Bacteria 838
483 Ga0265320_10002069 3300031240 Bacteria 14126
484 Ga0265320_10057577 3300031240 Bacteria 1864
485 Ga0265320_10375024 3300031240 Bacteria 628
486 Ga0265325_10000014 3300031241 Bacteria 131579
487 Ga0265325_10000782 3300031241 Bacteria 23019
488 Ga0265325_10001732 3300031241 Bacteria 15146
489 Ga0265325_10021041 3300031241 Bacteria 3590
490 Ga0265325_10026992 3300031241 Bacteria 3107
491 Ga0265325_10032967 3300031241 Bacteria 2763
492 Ga0265325_10194349 3300031241 Bacteria 939
493 Ga0265329_10025358 3300031242 Bacteria 1963
494 Ga0265329_10046592 3300031242 Bacteria 1385
495 Ga0265340_10001159 3300031247 Bacteria 15088
496 Ga0265340_10002869 3300031247 Bacteria 9812
497 Ga0265340_10007526 3300031247 Bacteria 5912
498 Ga0265340_10038201 3300031247 Bacteria 2376
499 Ga0265340_10042240 3300031247 Bacteria 2239
500 Ga0265340_10088506 3300031247 Bacteria 1450
501 Ga0265340_10092888 3300031247 Bacteria 1409
502 Ga0265339_10000256 3300031249 Bacteria 42839
503 Ga0265339_10004825 3300031249 Bacteria 9117
504 Ga0265339_10007379 3300031249 Bacteria 7114
505 Ga0265339_10342389 3300031249 Bacteria 706
506 Ga0265339_10485136 3300031249 Bacteria 572
507 Ga0265331_10000186 3300031250 Bacteria 76149
508 Ga0265331_10003502 3300031250 Bacteria 10110
509 Ga0265331_10013838 3300031250 Bacteria 4322
510 Ga0265331_10021847 3300031250 Bacteria 3269
511 Ga0265331_10022887 3300031250 Bacteria 3183
512 Ga0265331_10030688 3300031250 Bacteria 2675
513 Ga0265327_10000392 3300031251 Bacteria 82296
514 Ga0265327_10009609 3300031251 Bacteria 6946
515 Ga0265316_10021496 3300031344 Bacteria 5463
516 Ga0265316_10025355 3300031344 Bacteria 4950
517 Ga0265316_10026745 3300031344 Bacteria 4793
518 Ga0265316_10044806 3300031344 Bacteria 3516
519 Ga0265316_10086571 3300031344 Bacteria 2395
520 Ga0265316_10096460 3300031344 Bacteria 2252
521 Ga0265316_10148087 3300031344 Bacteria 1760
522 Ga0265316_10257932 3300031344 Bacteria 1279
523 Ga0265316_10284113 3300031344 Bacteria 1209
524 Ga0265316_10377952 3300031344 Bacteria 1022
525 Ga0307408_100051689 3300031548 Bacteria 2961
526 Ga0265313_10000800 3300031595 Bacteria 31814
527 Ga0265313_10006102 3300031595 Bacteria 8671
528 Ga0265313_10012941 3300031595 Bacteria 5055
529 Ga0265313_10016941 3300031595 Bacteria 4166
530 Ga0265313_10019748 3300031595 Bacteria 3739
531 Ga0265313_10025680 3300031595 Bacteria 3115
532 Ga0265313_10076276 3300031595 Bacteria 1532
533 Ga0265313_10089662 3300031595 Bacteria 1383
534 Ga0265313_10100614 3300031595 Bacteria 1284
535 Ga0265313_10207677 3300031595 Bacteria 812
536 Ga0316575_10000986 3300031665 Bacteria 8786
537 Ga0316575_10019455 3300031665 Bacteria 2597
538 Ga0316579_10005295 3300031691 Bacteria 5195
539 Ga0316579_10010128 3300031691 Bacteria 3978
540 Ga0265314_10000963 3300031711 Bacteria 33816
541 Ga0265314_10004460 3300031711 Bacteria 12990
542 Ga0265314_10024805 3300031711 Bacteria 4537
543 Ga0265314_10027129 3300031711 Bacteria 4292
544 Ga0265314_10041547 3300031711 Bacteria 3289
545 Ga0265314_10055387 3300031711 Bacteria 2738
546 Ga0265314_10056619 3300031711 Bacteria 2697
547 Ga0265314_10068911 3300031711 Bacteria 2376
548 Ga0265314_10107669 3300031711 Bacteria 1778
549 Ga0265314_10178064 3300031711 Bacteria 1277
550 Ga0265314_10213503 3300031711 Bacteria 1131
551 Ga0265342_10006333 3300031712 Bacteria 8824
552 Ga0265342_10021698 3300031712 Bacteria 4095
553 Ga0265342_10072247 3300031712 Bacteria 2009
554 Ga0265342_10090627 3300031712 Bacteria 1753
555 Ga0265342_10338731 3300031712 Bacteria 785
556 Ga0265342_10344967 3300031712 Bacteria 776
557 Ga0316576_10005834 3300031727 Bacteria 7592
558 Ga0316578_10039175 3300031728 Bacteria 2736
559 Ga0316578_10212536 3300031728 Bacteria 1163
560 Ga0307516_10054857 3300031730 Bacteria 3893
561 Ga0307516_10069198 3300031730 Bacteria 3396
562 Ga0307516_10507566 3300031730 Bacteria 860
563 Ga0307405_10008723 3300031731 Bacteria 5154
564 Ga0316577_10032670 3300031733 Bacteria 2907
565 Ga0316577_10043034 3300031733 Bacteria 2527
566 Ga0307413_10061509 3300031824 Bacteria 2317
567 Ga0307410_10138609 3300031852 Bacteria 1796
568 Ga0307410_10183150 3300031852 Bacteria 1587
569 Ga0307406_10072399 3300031901 Bacteria 2262
570 Ga0307407_10102413 3300031903 Bacteria 1780
571 Ga0307412_10046496 3300031911 Bacteria 2844
572 Ga0307409_100030160 3300031995 Bacteria 3892
573 Ga0307416_100005600 3300032002 Bacteria 7741
574 Ga0307416_100212504 3300032002 Bacteria 1847
575 Ga0307414_10939816 3300032004 Bacteria 794
576 Ga0307411_10103293 3300032005 Bacteria 2021
577 Ga0307411_11126293 3300032005 Unclassified 709
578 Ga0307415_100095913 3300032126 Bacteria 2160
579 Ga0316583_10000484 3300032133 Bacteria 11841
580 Ga0316583_10018653 3300032133 Bacteria 2491
581 Ga0316583_10069563 3300032133 Bacteria 1231
582 Ga0316585_10002061 3300032137 Bacteria 5391
583 Ga0316585_10058099 3300032137 Bacteria 1246
584 Ga0316580_10020547 3300032139 Bacteria 2034
585 Ga0316580_10021418 3300032139 Bacteria 1992
586 Ga0316580_10025904 3300032139 Bacteria 1813
587 Ga0316593_10000349 3300032168 Bacteria 8071
588 Ga0316593_10001237 3300032168 Bacteria 5509
589 Ga0316593_10054391 3300032168 Bacteria 1358
590 Ga0316592_1007100 3300033524 Bacteria 2177
591 Ga0316586_1000300 3300033527 Bacteria 4509
592 Ga0316588_1046158 3300033528 Bacteria 1050
593 Ga0316596_1000615 3300033541 Bacteria 6324
594 Ga0373944_0067559 3300035089 Bacteria 1158
595 Ga0373923_0032705 3300035111 Bacteria 2102
596 Ga0373923_0098301 3300035111 Bacteria 1288
597 Ga0373932_0201431 3300035112 Bacteria 708
598 Ga0373936_0008097 3300035113 Bacteria 3952
599 Ga0373939_0042238 3300035114 Bacteria 1378
600 Ga0373939_0081663 3300035114 Bacteria 1074
601 Ga0373945_0006653 3300035116 Bacteria 3735
602 Ga0373945_0078958 3300035116 Bacteria 1258
603 Ga0373953_0157382 3300035117 Bacteria 976
604 Ga0373956_0029348 3300035119 Bacteria 2398
605 Ga0373956_0248982 3300035119 Bacteria 845
606 Ga0373943_0007235 3300035170 Bacteria 4980
607 Ga0373943_0080948 3300035170 Bacteria 1665
608 Ga0373955_0005106 3300035172 Bacteria 5866
609 Ga0373955_0036549 3300035172 Bacteria 2607
610 Ga0373955_0246502 3300035172 Bacteria 1071
611 Ga0373942_0071250 3300035207 Bacteria 1015
612 Ga0373961_0048959 3300035241 Bacteria 1247
613 Ga0373961_0095359 3300035241 Bacteria 956
614 Ga0316574_0001643 3300035398 Bacteria 10749
615 Ga0316574_0008846 3300035398 Bacteria 5614
616 Ga0316574_0038291 3300035398 Bacteria 2943
617 Ga0316574_0203323 3300035398 Bacteria 1272
618 Ga0316574_0389410 3300035398 Bacteria 878
619 Ga0373931_0085845 3300035691 Bacteria 1745
620 Ga0373931_0111163 3300035691 Bacteria 1555
621 Ga0373931_0553263 3300035691 Bacteria 748
622 Ga0373935_0003403 3300035692 Bacteria 9238
623 Ga0373935_0084560 3300035692 Bacteria 2067
624 Ga0373935_0133269 3300035692 Bacteria 1672
625 Ga0373935_0934841 3300035692 Bacteria 643
626 Ga0373927_0064151 3300035695 Bacteria 2376
627 Ga0373927_0158783 3300035695 Bacteria 1481
628 Ga0373927_0167531 3300035695 Bacteria 1440
629 Ga0373933_0005271 3300035724 Bacteria 7048
630 Ga0373933_0043309 3300035724 Bacteria 2663
631 Ga0373933_0433396 3300035724 Bacteria 859
632 Ga0373947_0011709 3300035725 Bacteria 5027
633 Ga0373947_0407002 3300035725 Bacteria 918
634 Ga0373937_0003527 3300036401 Bacteria 13164
635 Ga0373937_0070199 3300036401 Bacteria 3231
636 Ga0373937_0104200 3300036401 Bacteria 2635
637 Ga0373937_0128743 3300036401 Bacteria 2363
638 Ga0373937_0190143 3300036401 Bacteria 1929
639 Ga0373937_0193416 3300036401 Bacteria 1912
640 Ga0373937_0198482 3300036401 Bacteria 1886
641 Ga0373937_0310051 3300036401 Bacteria 1492
642 Ga0373937_0777101 3300036401 Bacteria 905
643 Ga0316582_0012337 3300036647 Bacteria 4764
644 Ga0316582_0056650 3300036647 Bacteria 2501
645 Ga0316582_0243316 3300036647 Bacteria 1233
646 Ga0316584_0001849 3300036712 Bacteria 13108
647 Ga0373925_0002514 3300037068 Bacteria 14651
648 Ga0373925_0133491 3300037068 Bacteria 1937
649 Ga0373925_1342811 3300037068 Bacteria 586
650 Ga0395899_0004948 3300037312 Bacteria 10369
651 Ga0395899_0224824 3300037312 Bacteria 1299
652 Ga0395900_0062599 3300037418 Bacteria 3824
653 Ga0395900_0098142 3300037418 Bacteria 3010
654 Ga0395900_0618268 3300037418 Bacteria 1022
655 Ga0395898_0003055 3300037466 Bacteria 18965
656 Ga0395898_0079037 3300037466 Bacteria 3173
657 Ga0395898_0359028 3300037466 Bacteria 1389
658 Ga0316581_0008237 3300037588 Bacteria 2829
659 Ga0316581_0013780 3300037588 Bacteria 2296
660 Ga0395901_0012391 3300038443 Bacteria 8650
661 Ga0395901_0072035 3300038443 Bacteria 3601
662 Ga0400488_12334 3300038741 Bacteria 4329
663 Ga0400486_17540 3300038742 Bacteria 1091
664 Ga0400487_00820 3300039110 Bacteria 3258
665 Ga0436365_0480014 3300039437 Bacteria 887
666 Ga0436365_0544722 3300039437 Bacteria 16758
667 Ga0436365_0868084 3300039437 Bacteria 797
668 Ga0436365_1215018 3300039437 Bacteria 3685
669 Ga0436365_1239236 3300039437 Bacteria 18833
670 Ga0436365_1351612 3300039437 Bacteria 842
671 Ga0436365_1437117 3300039437 Bacteria 1434
672 Ga0436365_1584141 3300039437 Bacteria 579
673 Ga0436365_1637588 3300039437 Bacteria 49130
674 Ga0436360_0360048 3300039438 Bacteria 2053
675 Ga0436360_0449234 3300039438 Bacteria 1196
676 Ga0436360_0716296 3300039438 Bacteria 2775
677 Ga0436361_0767135 3300039447 Bacteria 1162
678 Ga0436363_0427400 3300039450 Bacteria 3997
679 Ga0436363_0896516 3300039450 Bacteria 1486
680 Ga0436363_1041884 3300039450 Bacteria 652
681 Ga0436363_1470856 3300039450 Bacteria 3937
682 Ga0451793_0170406 3300041452 Bacteria 796
683 Ga0451800_0024754 3300041459 Bacteria 869
684 Ga0451802_1407499 3300041460 Bacteria 735
685 Ga0439460_0224418 3300042461 Unclassified 645
686 Ga0451577_0743919 3300042876 Bacteria 887
687 Ga0453684_0000682 3300044712 Bacteria 121090
688 Ga0466957_0637262 3300044842 Bacteria 748
689 Ga0451576_0363162 3300045051 Bacteria 1516
690 Ga0466967_0059567 3300045976 Bacteria 3380
691 Ga0495592_0176228 3300046454 Bacteria 1460
692 Ga0495592_0423576 3300046454 Bacteria 839
693 Ga0495629_0083513 3300046459 Bacteria 2229
694 Ga0495651_0186790 3300046462 Bacteria 1462
695 Ga0495651_0385149 3300046462 Bacteria 919
696 Ga0495580_0003736 3300046472 Bacteria 12895
697 Ga0495580_0046288 3300046472 Bacteria 3087
698 Ga0495582_0043074 3300046473 Bacteria 2486
699 Ga0495582_0065981 3300046473 Bacteria 2000
700 Ga0495662_0112098 3300046476 Bacteria 1337
701 Ga0495664_0034829 3300046477 Bacteria 2963
702 Ga0495664_0225171 3300046477 Bacteria 1135
703 Ga0495664_0237404 3300046477 Bacteria 1103
704 Ga0495585_0181428 3300046492 Bacteria 1082
705 Ga0495606_0159747 3300046507 Bacteria 1316
706 Ga0495628_0328258 3300046516 Bacteria 1128
707 Ga0495631_0321349 3300046518 Bacteria 659
708 Ga0495632_0278674 3300046519 Bacteria 745
709 Ga0495652_0041688 3300046529 Bacteria 3961
710 Ga0495654_0052557 3300046530 Bacteria 1983
711 Ga0495665_0106424 3300046531 Bacteria 1472
712 Ga0495587_0050256 3300046536 Bacteria 2467
713 Ga0495587_0122784 3300046536 Bacteria 1487
714 Ga0495621_0007305 3300046539 Bacteria 3267
715 Ga0495645_0086993 3300046543 Bacteria 2236
716 Ga0495645_0219231 3300046543 Bacteria 1280
717 Ga0495622_0003379 3300046557 Bacteria 7527
718 Ga0495622_0149869 3300046557 Bacteria 1056
719 Ga0495633_0110090 3300046558 Bacteria 1277
720 Ga0495656_0173839 3300046615 Bacteria 1055
721 Ga0495625_0123475 3300046660 Bacteria 1760
722 Ga0495661_0198281 3300046665 Bacteria 1053
723 Ga0495657_0129487 3300046675 Bacteria 1582
724 Ga0495599_0306982 3300046678 Bacteria 957
725 Ga0495623_0165906 3300046679 Bacteria 1294
726 Ga0495658_0001492 3300046683 Bacteria 12268
727 Ga0495613_0442729 3300046689 Bacteria 881
728 Ga0495624_0413944 3300046690 Bacteria 809
729 Ga0495671_0298960 3300046692 Bacteria 774
730 Ga0495649_0106764 3300046694 Bacteria 1486
731 Ga0495649_0224280 3300046694 Bacteria 971
732 Ga0495589_0093052 3300046794 Bacteria 1463
733 Ga0495636_0324543 3300047318 Bacteria 723
734 Ga0495674_0687412 3300047319 Bacteria 804
735 Ga0495683_0134375 3300047323 Bacteria 1164
736 Ga0495675_0062651 3300047444 Bacteria 2354
737 Ga0495675_0256692 3300047444 Bacteria 1048
738 Ga0495673_0177677 3300047469 Bacteria 808
739 Ga0495681_0247614 3300047470 Bacteria 705
740 Ga0495684_0119581 3300047471 Bacteria 1985
741 Ga0495602_0035348 3300048088 Bacteria 4660
742 Ga0495602_0175950 3300048088 Bacteria 1656
743 Ga0495602_0308838 3300048088 Bacteria 1155
744 Ga0495602_0563739 3300048088 Bacteria 788
745 Ga0495615_0027787 3300048090 Bacteria 1331
746 Ga0495626_0026549 3300048091 Bacteria 2822
747 Ga0496100_0292146 3300048903 Bacteria 1218
748 Ga0496104_0414671 3300048907 Bacteria 1259
749 Ga0496107_0164931 3300048910 Bacteria 1642
750 Ga0496112_0440330 3300048915 Bacteria 1241
751 Ga0496115_0373355 3300048918 Bacteria 1161
752 Ga0496121_0006108 3300048924 Bacteria 15150
753 Ga0496126_0000480 3300048929 Bacteria 79257
754 Ga0496126_0077598 3300048929 Bacteria 2945
755 Ga0495682_0005207 3300049460 Bacteria 5432
756 Ga0501313_009732 3300049529 Bacteria 1086
757 Ga0501335_006385 3300049551 Bacteria 1073
758 Ga0501031_0037261 3300049568 Bacteria 3173
759 Ga0501031_0068962 3300049568 Bacteria 2303
760 Ga0501031_0094198 3300049568 Bacteria 1954
761 Ga0501031_0518639 3300049568 Bacteria 768
762 Ga0501032_0001267 3300049569 Bacteria 20244
763 Ga0501032_0004362 3300049569 Bacteria 10681
764 Ga0501032_0019862 3300049569 Bacteria 4691
765 Ga0501032_0020357 3300049569 Bacteria 4622
766 Ga0501032_0030051 3300049569 Bacteria 3727
767 Ga0501032_0178940 3300049569 Bacteria 1389
768 Ga0501032_0201791 3300049569 Bacteria 1298
769 Ga0501033_0005260 3300049570 Bacteria 10269
770 Ga0501033_0012240 3300049570 Bacteria 6548
771 Ga0501033_0012917 3300049570 Bacteria 6369
772 Ga0501033_0036296 3300049570 Bacteria 3693
773 Ga0501033_0175565 3300049570 Bacteria 1537
774 Ga0501033_0180575 3300049570 Bacteria 1513
775 Ga0501033_0245126 3300049570 Bacteria 1271
776 Ga0501033_0322472 3300049570 Bacteria 1085
777 Ga0501034_0000001 3300049571 Bacteria 2184493
778 Ga0501034_0010632 3300049571 Bacteria 9573
779 Ga0501034_0011194 3300049571 Bacteria 9312
780 Ga0501034_0027593 3300049571 Bacteria 5774
781 Ga0501034_0076662 3300049571 Bacteria 3350
782 Ga0501034_0076809 3300049571 Bacteria 3346
783 Ga0501034_0091835 3300049571 Bacteria 3033
784 Ga0501034_0133506 3300049571 Bacteria 2464
785 Ga0501034_0171039 3300049571 Bacteria 2140
786 Ga0501034_0251625 3300049571 Bacteria 1711
787 Ga0501034_1082268 3300049571 Bacteria 683
788 Ga0501036_0005653 3300049572 Bacteria 10145
789 Ga0501036_0005682 3300049572 Bacteria 10117
790 Ga0501036_0009536 3300049572 Bacteria 7983
791 Ga0501037_0024753 3300049573 Bacteria 4438
792 Ga0501037_0039814 3300049573 Bacteria 3459
793 Ga0501037_0091860 3300049573 Bacteria 2196
794 Ga0501037_0130333 3300049573 Bacteria 1803
795 Ga0501037_0314591 3300049573 Bacteria 1085
796 Ga0501037_0466743 3300049573 Bacteria 860
797 Ga0501038_0088134 3300049574 Bacteria 2605
798 Ga0501038_0116476 3300049574 Bacteria 2208
799 Ga0501038_0146861 3300049574 Bacteria 1925
800 Ga0501038_0147189 3300049574 Bacteria 1922
801 Ga0501038_0237262 3300049574 Bacteria 1449
802 Ga0501038_0240433 3300049574 Bacteria 1438
803 Ga0501038_0349287 3300049574 Bacteria 1152
804 Ga0501038_0681305 3300049574 Bacteria 772
805 Ga0501039_0000029 3300049575 Bacteria 131786
806 Ga0501039_0019053 3300049575 Bacteria 5264
807 Ga0501039_0168128 3300049575 Bacteria 1724
808 Ga0501039_0222759 3300049575 Bacteria 1483
809 Ga0501039_0349542 3300049575 Bacteria 1162
810 Ga0501039_1171961 3300049575 Bacteria 595
811 Ga0501042_0098300 3300049578 Bacteria 2105
812 Ga0501042_0392993 3300049578 Bacteria 1005
813 Ga0501043_0010388 3300049579 Bacteria 7296
814 Ga0501043_0014584 3300049579 Bacteria 6152
815 Ga0501043_0097012 3300049579 Bacteria 2317
816 Ga0501043_0198900 3300049579 Bacteria 1556
817 Ga0501043_0228594 3300049579 Bacteria 1437
818 Ga0501043_0369496 3300049579 Bacteria 1087
819 Ga0501043_0399659 3300049579 Bacteria 1038
820 Ga0501046_0005416 3300049580 Bacteria 11410
821 Ga0501046_0011762 3300049580 Bacteria 7472
822 Ga0501046_0012992 3300049580 Bacteria 7068
823 Ga0501047_0018715 3300049581 Bacteria 6641
824 Ga0501047_0025996 3300049581 Bacteria 5629
825 Ga0501047_0033976 3300049581 Bacteria 4923
826 Ga0501047_0065087 3300049581 Bacteria 3514
827 Ga0501047_0075405 3300049581 Bacteria 3245
828 Ga0501047_0131220 3300049581 Bacteria 2386
829 Ga0501047_0138742 3300049581 Bacteria 2310
830 Ga0501047_0160994 3300049581 Bacteria 2116
831 Ga0501047_0171826 3300049581 Bacteria 2036
832 Ga0501047_0176653 3300049581 Bacteria 2003
833 Ga0501047_0220930 3300049581 Bacteria 1751
834 Ga0501047_0251827 3300049581 Bacteria 1614
835 Ga0501047_0375584 3300049581 Bacteria 1256
836 Ga0501047_0441537 3300049581 Bacteria 1131
837 Ga0501047_0492805 3300049581 Bacteria 1052
838 Ga0501047_0559308 3300049581 Bacteria 968
839 Ga0501047_0798800 3300049581 Bacteria 758
840 Ga0501047_0883324 3300049581 Bacteria 707
841 Ga0501048_0023812 3300049582 Bacteria 4471
842 Ga0501048_0124442 3300049582 Bacteria 1823
843 Ga0501048_0209717 3300049582 Bacteria 1382
844 Ga0501048_0278719 3300049582 Bacteria 1189
845 Ga0501067_0001776 3300049583 Bacteria 11844
846 Ga0501067_0005578 3300049583 Bacteria 6979
847 Ga0501067_0022624 3300049583 Bacteria 3478
848 Ga0501068_0077512 3300049584 Bacteria 2035
849 Ga0501068_0601467 3300049584 Bacteria 716
850 Ga0501069_0022165 3300049585 Bacteria 3452
851 Ga0501069_0333797 3300049585 Bacteria 892
852 Ga0501070_0000481 3300049586 Bacteria 36249
853 Ga0501070_0003398 3300049586 Bacteria 13819
854 Ga0501070_0014964 3300049586 Bacteria 6527
855 Ga0501070_0143912 3300049586 Bacteria 1968
856 Ga0501070_0178515 3300049586 Bacteria 1748
857 Ga0501070_0309863 3300049586 Bacteria 1285
858 Ga0501070_0382617 3300049586 Bacteria 1140
859 Ga0501071_0135415 3300049587 Bacteria 1833
860 Ga0501071_0156932 3300049587 Bacteria 1699
861 Ga0501072_0015507 3300049588 Bacteria 5840
862 Ga0501073_0001669 3300049589 Bacteria 16438
863 Ga0501073_0004494 3300049589 Bacteria 10476
864 Ga0501073_0015128 3300049589 Bacteria 5597
865 Ga0501073_0059739 3300049589 Bacteria 2662
866 Ga0501073_0059886 3300049589 Bacteria 2658
867 Ga0501073_0061078 3300049589 Bacteria 2630
868 Ga0501073_0070275 3300049589 Bacteria 2439
869 Ga0501073_0987301 3300049589 Bacteria 579
870 Ga0501074_0004453 3300049590 Bacteria 10023
871 Ga0501074_0042382 3300049590 Bacteria 3293
872 Ga0501074_0079197 3300049590 Bacteria 2358
873 Ga0501077_0059400 3300049593 Bacteria 2427
874 Ga0501079_0001478 3300049741 Bacteria 16629
875 Ga0501079_0017836 3300049741 Bacteria 5421
876 Ga0501079_0140727 3300049741 Bacteria 1880
877 Ga0501079_0188192 3300049741 Bacteria 1611
878 Ga0501079_0330695 3300049741 Bacteria 1193
879 Ga0501080_0018079 3300049742 Bacteria 6526
880 Ga0501080_0040364 3300049742 Bacteria 4353
881 Ga0501080_0043846 3300049742 Bacteria 4165
882 Ga0501080_0062400 3300049742 Bacteria 3468
883 Ga0501080_0125187 3300049742 Bacteria 2380
884 Ga0501080_0179248 3300049742 Bacteria 1951
885 Ga0501080_0283362 3300049742 Bacteria 1506
886 Ga0501080_0628681 3300049742 Bacteria 951
887 Ga0501080_1069414 3300049742 Bacteria 697
888 Ga0501083_0077301 3300049744 Bacteria 2209
889 Ga0501083_0089262 3300049744 Bacteria 2037
890 Ga0501083_0117891 3300049744 Bacteria 1742
891 Ga0501083_0135923 3300049744 Bacteria 1611
892 Ga0501083_0275277 3300049744 Bacteria 1095
893 Ga0501083_0712658 3300049744 Bacteria 653
894 Ga0501280_000425 3300049776 Bacteria 10117
895 Ga0501282_002357 3300049778 Bacteria 2062
896 Ga0501035_0019622 3300049822 Bacteria 6212
897 Ga0501035_0037025 3300049822 Bacteria 4420
898 Ga0501035_0044851 3300049822 Bacteria 3979
899 Ga0501035_0048543 3300049822 Bacteria 3807
900 Ga0501035_0065562 3300049822 Bacteria 3225
901 Ga0501035_0085166 3300049822 Bacteria 2786
902 Ga0501035_0162505 3300049822 Bacteria 1932
903 Ga0501035_0190474 3300049822 Bacteria 1763
904 Ga0501035_0254054 3300049822 Bacteria 1492
905 Ga0501035_0283204 3300049822 Bacteria 1400
906 Ga0501035_0300904 3300049822 Bacteria 1351
907 Ga0501035_0914179 3300049822 Bacteria 694
908 Ga0501044_0015755 3300049823 Bacteria 8141
909 Ga0501044_0024878 3300049823 Bacteria 6351
910 Ga0501044_0032329 3300049823 Bacteria 5501
911 Ga0501044_0044540 3300049823 Bacteria 4604
912 Ga0501044_0099276 3300049823 Bacteria 2930
913 Ga0501044_0114803 3300049823 Bacteria 2698
914 Ga0501044_0129184 3300049823 Bacteria 2522
915 Ga0501044_0140739 3300049823 Bacteria 2401
916 Ga0501044_0161480 3300049823 Bacteria 2217
917 Ga0501044_0210012 3300049823 Bacteria 1901
918 Ga0501044_0504734 3300049823 Bacteria 1110
919 Ga0501044_0519482 3300049823 Bacteria 1090
920 Ga0501045_0128835 3300049824 Bacteria 1881
921 nmdc:mga03683_252067_c1 3300050489 Bacteria 820
922 nmdc:mga03n38_135_c1 3300050490 Bacteria 16000
923 nmdc:mga00v17_123_c1 3300050491 Bacteria 45547
924 nmdc:mga00v17_385_c1 3300050491 Bacteria 25012
925 nmdc:mga0yw44_265_c1 3300050492 Bacteria 17906
926 nmdc:mga06z11_3977_c1 3300050494 Bacteria 5765
927 nmdc:mga06z11_6666_c1 3300050494 Bacteria 4721
928 nmdc:mga04h51_108108_c1 3300050495 Bacteria 1022
929 nmdc:mga04h51_55057_c1 3300050495 Bacteria 1347
930 nmdc:mga07m45_68_c1 3300050496 Bacteria 39566
931 nmdc:mga05p37_167955_c1 3300050507 Bacteria 2677
932 nmdc:mga05p37_507131_c1 3300050507 Bacteria 1383
933 nmdc:mga09592_25742_c1 3300050508 Bacteria 4871
934 nmdc:mga09592_80345_c1 3300050508 Bacteria 2777
935 nmdc:mga0qj67_173986_c1 3300050509 Bacteria 1748
936 nmdc:mga0qj67_275124_c1 3300050509 Bacteria 1365
937 nmdc:mga08y16_19140_c1 3300050511 Bacteria 7214
938 nmdc:mga08y16_2559_c1 3300050511 Bacteria 18707
939 nmdc:mga0n895_10772_c1 3300050512 Bacteria 8108
940 nmdc:mga0n895_17129_c1 3300050512 Bacteria 6675
941 nmdc:mga0n895_277025_c1 3300050512 Bacteria 1701
942 nmdc:mga0n895_789078_c1 3300050512 Bacteria 941
943 nmdc:mga0rr50_45774_c1 3300050513 Bacteria 3218
944 nmdc:mga0rr50_7934_c1 3300050513 Bacteria 6586
945 nmdc:mga08x19_177_c1 3300050514 Bacteria 51482
946 nmdc:mga08x19_2026_c1 3300050514 Bacteria 12425
947 nmdc:mga08x19_945_c1 3300050514 Bacteria 18277
948 nmdc:mga0a205_20420_c1 3300050515 Bacteria 6248
949 nmdc:mga0sz30_17_c1 3300050516 Bacteria 48963
950 Ga0495619_0184369 3300053085 Bacteria 1444
951 Ga0500643_000003 3300053087 Bacteria 876659
952 Ga0500566_0181241 3300053094 Bacteria 1080
953 Ga0500592_011077 3300053116 Bacteria 1441
954 Ga0500594_0012014 3300053118 Bacteria 2032
955 Ga0500595_001661 3300053119 Bacteria 11694
956 Ga0500595_101861 3300053119 Bacteria 822
957 Ga0500655_006392 3300053133 Bacteria 2121
958 Ga0500559_0020972 3300053136 Bacteria 2766
959 Ga0500568_0047421 3300053139 Bacteria 1702
960 Ga0500573_0000452 3300053140 Bacteria 17648
961 Ga0500619_043325 3300053154 Bacteria 1430
962 Ga0500639_087393 3300053163 Bacteria 1559
963 Ga0500576_168654 3300053725 Bacteria 791
964 Ga0500645_070785 3300053730 Bacteria 1001
965 Ga0500645_104061 3300053730 Bacteria 799
966 Ga0501084_0000175 3300054114 Bacteria 50123
967 Ga0501084_0007620 3300054114 Bacteria 8925
968 Ga0501084_0029906 3300054114 Bacteria 4556
969 Ga0501084_0074161 3300054114 Bacteria 2849
970 Ga0501084_0145505 3300054114 Bacteria 1996
971 Ga0501084_0363006 3300054114 Bacteria 1224
972 Ga0501082_0006964 3300060353 Bacteria 9766
973 Ga0501082_0039783 3300060353 Bacteria 4056
974 Ga0501082_0069701 3300060353 Bacteria 3028
975 Ga0501082_0107936 3300060353 Bacteria 2409
976 Ga0501082_0590704 3300060353 Bacteria 972
977 Ga0530510_0238077 3300061734 Bacteria 1355
978 2739613616 2739367655 Bacteria 4051151
979 Ga0207676_10707429
980 JGI25165J46597_1001315
981 JGI25153J46596_10000830
982 rootH2_10048944
983 Ga0058859_10022480
984 Ga0058863_11970613
985 Ga0058862_11940969
986 Ga0070658_10045521
987 Ga0070658_11372238
988 Ga0070676_10079075
989 Ga0070676_10302467
990 Ga0070683_100088671
991 Ga0070683_100187211
992 Ga0070690_100219016
993 Ga0070690_100294104
994 Ga0070690_100539086
995 Ga0068869_100070091
996 Ga0068869_101415616
997 Ga0070666_10007106
998 Ga0070666_10123583
999 Ga0070680_100002998
1000 Ga0070680_100072787
1001 Ga0070680_100078879
1002 Ga0070680_100226414
1003 Ga0070680_100255022
1004 Ga0068868_100153898
1005 Ga0068868_100397645
1006 Ga0068868_101181538
1007 Ga0070660_100018276
1008 Ga0070660_100069129
1009 Ga0070660_100089034
1010 Ga0070660_100108074
1011 Ga0070660_100174288
1012 Ga0070660_100477533
1013 Ga0070689_100415195
1014 Ga0070691_10000386
1015 Ga0070691_10149346
1016 Ga0070691_10155140
1017 Ga0070691_10222565
1018 Ga0070661_100005946
1019 Ga0070661_100843647
1020 Ga0070675_101654718
1021 Ga0070671_100262784
1022 Ga0070671_100563781
1023 Ga0070674_100041872
1024 Ga0070688_100357639
1025 Ga0070659_100012925
1026 Ga0070659_100027373
1027 Ga0070667_100061525
1028 Ga0070667_100349423
1029 Ga0070709_10003511
1030 Ga0070709_10171867
1031 Ga0070714_100000676
1032 Ga0070714_100068815
1033 Ga0070714_100109782
1034 Ga0070714_100530839
1035 Ga0070714_101124907
1036 Ga0070714_101188515
1037 Ga0070713_100000012
1038 Ga0070713_100162144
1039 Ga0070713_100213904
1040 Ga0070713_100364268
1041 Ga0070710_10040281
1042 Ga0070710_10553255
1043 Ga0070711_100240856
1044 Ga0070711_100351636
1045 Ga0070711_100570669
1046 Ga0070694_100283260
1047 Ga0070694_100340525
1048 Ga0070663_100264255
1049 Ga0070678_100013560
1050 Ga0070678_100021125
1051 Ga0070678_100069504
1052 Ga0070678_100681426
1053 Ga0070681_10000037
1054 Ga0070681_10034634
1055 Ga0070681_10048475
1056 Ga0070681_10160044
1057 Ga0070681_10179316
1058 Ga0070681_10237697
1059 Ga0068867_100100755
1060 Ga0068867_100540816
1061 Ga0070707_101144481
1062 Ga0070699_100114998
1063 Ga0070699_100215896
1064 Ga0070679_100008411
1065 Ga0070679_100064794
1066 Ga0070679_100082939
1067 Ga0070679_100335688
1068 Ga0070684_100283884
1069 Ga0068853_100002020
1070 Ga0068853_100002660
1071 Ga0068853_100237414
1072 Ga0068853_100714452
1073 Ga0068853_101136376
1074 Ga0070686_100311002
1075 Ga0070695_100019206
1076 Ga0070696_101268626
1077 Ga0070693_100381808
1078 Ga0070665_100087868
1079 Ga0070665_100093536
1080 Ga0070665_100175548
1081 Ga0070665_100264776
1082 Ga0070665_100600604
1083 Ga0070704_100029374
1084 Ga0068855_100000385
1085 Ga0068855_100034625
1086 Ga0068855_100121416
1087 Ga0068855_100161413
1088 Ga0068855_100693807
1089 Ga0068855_100953360
1090 Ga0068855_101722291
1091 Ga0068857_100007896
1092 Ga0068857_100258522
1093 Ga0068857_100361571
1094 Ga0068857_100983381
1095 Ga0068854_100347723
1096 Ga0068856_100001032
1097 Ga0068856_100021325
1098 Ga0068856_100155308
1099 Ga0068856_100478045
1100 Ga0068856_100685912
1101 Ga0070702_100299022
1102 Ga0068852_100063743
1103 Ga0068852_100142311
1104 Ga0068852_100187615
1105 Ga0068852_100289160
1106 Ga0068852_100393106
1107 Ga0068864_100440435
1108 Ga0068864_101611468
1109 Ga0068866_10072414
1110 Ga0068866_10260834
1111 Ga0068863_100043883
1112 Ga0068863_101146006
1113 Ga0068858_100049282
1114 Ga0068858_100477057
1115 Ga0068860_100950609
1116 Ga0068860_101559447
1117 Ga0068862_100100297
1118 Ga0081540_1008438
1119 Ga0075365_10000030
1120 Ga0075368_10095597
1121 Ga0075363_100001020
1122 Ga0075364_10000068
1123 Ga0075364_10024136
1124 Ga0070716_100211553
1125 Ga0070716_100564291
1126 Ga0070712_100000902
1127 Ga0070712_100004052
1128 Ga0070712_100113045
1129 Ga0070712_100317927
1130 Ga0075367_10018355
1131 Ga0075369_10000030
1132 Ga0097621_100047344
1133 Ga0097621_100106219
1134 Ga0097621_100161557
1135 Ga0097621_100227174
1136 Ga0097621_100318759
1137 Ga0097621_100402268
1138 Ga0075370_10000042
1139 Ga0068871_100019627
1140 Ga0068871_100071528
1141 Ga0068871_100162546
1142 Ga0068871_100175438
1143 Ga0068871_100301487
1144 Ga0068871_100419656
1145 Ga0068871_100839602
1146 Ga0075428_100000808
1147 Ga0075430_100194948
1148 Ga0075431_100116845
1149 Ga0075431_101399219
1150 Ga0075433_10105346
1151 Ga0075434_100176261
1152 Ga0075434_100262322
1153 Ga0075434_100441455
1154 Ga0075429_100028322
1155 Ga0075429_100043701
1156 Ga0068865_100002505
1157 Ga0075436_100000458
1158 Ga0075436_100000862
1159 Ga0075436_100002564
1160 Ga0075436_100029529
1161 Ga0075435_100006049
1162 Ga0075435_100018960
1163 Ga0075435_100609814
1164 Ga0105250_10440537
1165 Ga0105240_10004232
1166 Ga0105240_10004696
1167 Ga0105240_10017473
1168 Ga0105240_10025381
1169 Ga0105240_10150688
1170 Ga0105240_10252800
1171 Ga0105240_10571025
1172 Ga0105240_10675787
1173 Ga0105240_10722476
1174 Ga0105240_11279886
1175 Ga0111539_10002099
1176 Ga0111539_10023579
1177 Ga0105245_10230243
1178 Ga0105245_10538363
1179 Ga0105247_10056711
1180 Ga0114129_10070335
1181 Ga0105243_10014172
1182 Ga0105243_10222994
1183 Ga0105241_10035275
1184 Ga0105241_10116852
1185 Ga0105241_10455114
1186 Ga0105241_10469421
1187 Ga0105241_10477193
1188 Ga0105241_10731521
1189 Ga0105242_10123893
1190 Ga0105242_10848595
1191 Ga0105242_10891180
1192 Ga0105248_10000005
1193 Ga0105248_10047589
1194 Ga0105248_10063706
1195 Ga0105248_10408693
1196 Ga0105237_10003253
1197 Ga0105237_10181890
1198 Ga0105237_10627975
1199 Ga0105238_10001939
1200 Ga0105238_10017491
1201 Ga0105238_10055822
1202 Ga0105238_10130022
1203 Ga0105238_10179895
1204 Ga0105238_10426203
1205 Ga0105238_10826441
1206 Ga0105249_10348653
1207 Ga0099796_10011720
1208 Ga0105239_10005584
1209 Ga0105239_10073553
1210 Ga0105239_10077915
1211 Ga0105239_10210784
1212 Ga0105239_10243523
1213 Ga0105239_10259863
1214 Ga0105239_10377439
1215 Ga0105239_12206314
1216 Ga0105246_10013218
1217 Ga0105246_10062954
1218 Ga0105246_10516333
1219 Ga0105246_10563413
1220 Ga0157373_10000820
1221 Ga0157373_10567405
1222 Ga0157371_10098586
1223 Ga0157371_10655232
1224 Ga0157370_10003448
1225 Ga0157370_10008323
1226 Ga0157370_10035566
1227 Ga0157370_10083851
1228 Ga0157370_11614616
1229 Ga0157369_10001535
1230 Ga0157369_10033188
1231 Ga0157369_10345530
1232 Ga0157369_10407520
1233 Ga0157369_11085912
1234 Ga0157374_10377448
1235 Ga0157378_10115850
1236 Ga0157378_10232385
1237 Ga0157378_10424647
1238 Ga0157378_10549314
1239 Ga0157378_10885088
1240 Ga0157378_10906097
1241 Ga0163162_10250500
1242 Ga0163162_10446856
1243 Ga0163162_11179552
1244 Ga0157372_10007016
1245 Ga0157372_10008268
1246 Ga0157372_10032489
1247 Ga0157372_10037651
1248 Ga0157372_10066383
1249 Ga0157372_10327295
1250 Ga0157375_10614872
1251 Ga0163163_10008003
1252 Ga0163163_10332968
1253 Ga0163163_10915513
1254 Ga0157380_10294611
1255 Ga0157379_10007681
1256 Ga0157379_10010518
1257 Ga0157379_10019718
1258 Ga0157379_10052289
1259 Ga0157379_10232957
1260 Ga0157379_10428308
1261 Ga0157376_10147364
1262 Ga0157376_10291481
1263 Ga0157376_10517483
1264 Ga0163161_10646087
1265 Ga0213874_10002785
1266 Ga0213874_10006777
1267 Ga0213876_10000421
1268 Ga0213876_10003189
1269 Ga0213876_10027585
1270 Ga0213876_10103540
1271 Ga0209563_105604
1272 Ga0209233_1000013
1273 Ga0209455_1020331
1274 Ga0209758_1000013
1275 Ga0209758_1152298
1276 Ga0207642_10017630
1277 Ga0207680_10002564
1278 Ga0207680_10106453
1279 Ga0207699_10000164
1280 Ga0207699_10037734
1281 Ga0207645_10011392
1282 Ga0207645_10473091
1283 Ga0207643_10030805
1284 Ga0207643_10032595
1285 Ga0207705_10000180
1286 Ga0207705_10004720
1287 Ga0207705_10194396
1288 Ga0207705_10311673
1289 Ga0207684_10294542
1290 Ga0207654_10033200
1291 Ga0207654_10063489
1292 Ga0207654_10164797
1293 Ga0207654_10428144
1294 Ga0207654_10803875
1295 Ga0207707_10000011
1296 Ga0207707_10002715
1297 Ga0207707_10048827
1298 Ga0207707_10124122
1299 Ga0207707_10267082
1300 Ga0207707_10563709
1301 Ga0207695_10000018
1302 Ga0207695_10028316
1303 Ga0207695_10040352
1304 Ga0207695_10128661
1305 Ga0207695_10182399
1306 Ga0207695_10217861
1307 Ga0207695_10284139
1308 Ga0207695_10284558
1309 Ga0207695_10340402
1310 Ga0207695_10383850
1311 Ga0207671_10019547
1312 Ga0207671_10049879
1313 Ga0207671_10408901
1314 Ga0207671_10499698
1315 Ga0207693_10001210
1316 Ga0207693_10001929
1317 Ga0207693_10054085
1318 Ga0207693_10055946
1319 Ga0207693_10266868
1320 Ga0207693_10375640
1321 Ga0207663_10015424
1322 Ga0207663_10172408
1323 Ga0207663_11098027
1324 Ga0207660_10000110
1325 Ga0207660_10003537
1326 Ga0207660_10069892
1327 Ga0207660_10181434
1328 Ga0207657_10000241
1329 Ga0207657_10063406
1330 Ga0207657_10196503
1331 Ga0207657_10280758
1332 Ga0207657_10734228
1333 Ga0207649_10000194
1334 Ga0207652_10000824
1335 Ga0207652_10007774
1336 Ga0207652_10108322
1337 Ga0207652_10115732
1338 Ga0207694_10000010
1339 Ga0207694_10025930
1340 Ga0207694_10026889
1341 Ga0207694_10221393
1342 Ga0207694_10810215
1343 Ga0207694_10850182
1344 Ga0207694_10864858
1345 Ga0207694_10906379
1346 Ga0207650_10171098
1347 Ga0207650_10536252
1348 Ga0207659_10166081
1349 Ga0207687_10017844
1350 Ga0207687_10085895
1351 Ga0207687_10325007
1352 Ga0207687_10390587
1353 Ga0207700_10000295
1354 Ga0207700_10130882
1355 Ga0207664_10032838
1356 Ga0207664_10073108
1357 Ga0207664_10177988
1358 Ga0207664_10312818
1359 Ga0207664_10411486
1360 Ga0207644_10562368
1361 Ga0207690_10346628
1362 Ga0207686_10073147
1363 Ga0207686_10163989
1364 Ga0207709_10125051
1365 Ga0207670_10845695
1366 Ga0207669_10280567
1367 Ga0207704_10122838
1368 Ga0207665_10241385
1369 Ga0207665_10301672
1370 Ga0207691_10325382
1371 Ga0207711_10000002
1372 Ga0207711_10145656
1373 Ga0207689_10127211
1374 Ga0207689_10261962
1375 Ga0207661_10144696
1376 Ga0207661_10219381
1377 Ga0207661_10500695
1378 Ga0207679_10701601
1379 Ga0207667_10000388
1380 Ga0207667_10031700
1381 Ga0207667_10542855
1382 Ga0207667_10582275
1383 Ga0207651_10169073
1384 Ga0207651_10727070
1385 Ga0207712_11134703
1386 Ga0207712_11399583
1387 Ga0207668_10971586
1388 Ga0207640_10040030
1389 Ga0207658_10058513
1390 Ga0207658_10134474
1391 Ga0207703_10027678
1392 Ga0207703_10064130
1393 Ga0207639_10000867
1394 Ga0207639_10059896
1395 Ga0207639_10979110
1396 Ga0207639_11233052
1397 Ga0207639_11280022
1398 Ga0207678_10367816
1399 Ga0207702_10000315
1400 Ga0207702_10348694
1401 Ga0207702_10583836
1402 Ga0207702_10776759
1403 Ga0207702_11758665
1404 Ga0207641_10035109
1405 Ga0207648_10154508
1406 Ga0207648_10243653
1407 Ga0207674_10001605
1408 Ga0207674_10192958
1409 Ga0207674_10291835
1410 Ga0207674_11105553
1411 Ga0207675_100278079
1412 Ga0207683_10018489
1413 Ga0207683_10103171
1414 Ga0207683_10264595
1415 Ga0207683_10493868
1416 Ga0207683_11029523
1417 Ga0207698_10042447
1418 Ga0207698_10086858
1419 Ga0207698_10144541
1420 Ga0209995_1003999
1421 Ga0209968_1004743
1422 Ga0209970_1056276
1423 Ga0209971_1044728
1424 Ga0209813_10045800
1425 Ga0209813_10091394
1426 Ga0209974_10060510
1427 Ga0209974_10065728
1428 Ga0207428_10002412
1429 Ga0268266_10000557
1430 Ga0268266_10055515
1431 Ga0268266_10076582
1432 Ga0268266_10092509
1433 Ga0268266_10095842
1434 Ga0268266_11207351
1435 Ga0268265_10295536
1436 Ga0268264_10561069
1437 Ga0268264_11168559
1438 Ga0265337_1001102
1439 Ga0265334_10001106
1440 Ga0265334_10116749
1441 Ga0265318_10000037
1442 Ga0265318_10004788
1443 Ga0265338_10000017
1444 Ga0265338_10002896
1445 Ga0265338_10005387
1446 Ga0265338_10017000
1447 Ga0265338_10038201
1448 Ga0265338_10073797
1449 Ga0265338_10106186
1450 Ga0265338_10165948
1451 Ga0265338_10203129
1452 Ga0265338_10647847
1453 Ga0265324_10193448
1454 Ga0265324_10208133
1455 Ga0265330_10006774
1456 Ga0265332_10017915
1457 Ga0265332_10031083
1458 Ga0265332_10071412
1459 Ga0265332_10075392
1460 Ga0265332_10197011
1461 Ga0265320_10002069
1462 Ga0265320_10057577
1463 Ga0265320_10375024
1464 Ga0265325_10000014
1465 Ga0265325_10000782
1466 Ga0265325_10001732
1467 Ga0265325_10021041
1468 Ga0265325_10026992
1469 Ga0265325_10032967
1470 Ga0265325_10194349
1471 Ga0265329_10025358
1472 Ga0265329_10046592
1473 Ga0265340_10001159
1474 Ga0265340_10002869
1475 Ga0265340_10007526
1476 Ga0265340_10038201
1477 Ga0265340_10042240
1478 Ga0265340_10088506
1479 Ga0265340_10092888
1480 Ga0265339_10000256
1481 Ga0265339_10004825
1482 Ga0265339_10007379
1483 Ga0265339_10342389
1484 Ga0265339_10485136
1485 Ga0265331_10000186
1486 Ga0265331_10003502
1487 Ga0265331_10013838
1488 Ga0265331_10021847
1489 Ga0265331_10022887
1490 Ga0265331_10030688
1491 Ga0265327_10000392
1492 Ga0265327_10009609
1493 Ga0265316_10021496
1494 Ga0265316_10025355
1495 Ga0265316_10026745
1496 Ga0265316_10044806
1497 Ga0265316_10086571
1498 Ga0265316_10096460
1499 Ga0265316_10148087
1500 Ga0265316_10257932
1501 Ga0265316_10284113
1502 Ga0265316_10377952
1503 Ga0307408_100051689
1504 Ga0265313_10000800
1505 Ga0265313_10006102
1506 Ga0265313_10012941
1507 Ga0265313_10016941
1508 Ga0265313_10019748
1509 Ga0265313_10025680
1510 Ga0265313_10076276
1511 Ga0265313_10089662
1512 Ga0265313_10100614
1513 Ga0265313_10207677
1514 Ga0316575_10000986
1515 Ga0316575_10019455
1516 Ga0316579_10005295
1517 Ga0316579_10010128
1518 Ga0265314_10000963
1519 Ga0265314_10004460
1520 Ga0265314_10024805
1521 Ga0265314_10027129
1522 Ga0265314_10041547
1523 Ga0265314_10055387
1524 Ga0265314_10056619
1525 Ga0265314_10068911
1526 Ga0265314_10107669
1527 Ga0265314_10178064
1528 Ga0265314_10213503
1529 Ga0265342_10006333
1530 Ga0265342_10021698
1531 Ga0265342_10072247
1532 Ga0265342_10090627
1533 Ga0265342_10338731
1534 Ga0265342_10344967
1535 Ga0316576_10005834
1536 Ga0316578_10039175
1537 Ga0316578_10212536
1538 Ga0307516_10054857
1539 Ga0307516_10069198
1540 Ga0307516_10507566
1541 Ga0307405_10008723
1542 Ga0316577_10032670
1543 Ga0316577_10043034
1544 Ga0307413_10061509
1545 Ga0307410_10138609
1546 Ga0307410_10183150
1547 Ga0307406_10072399
1548 Ga0307407_10102413
1549 Ga0307412_10046496
1550 Ga0307409_100030160
1551 Ga0307416_100005600
1552 Ga0307416_100212504
1553 Ga0307414_10939816
1554 Ga0307411_10103293
1555 Ga0307411_11126293
1556 Ga0307415_100095913
1557 Ga0316583_10000484
1558 Ga0316583_10018653
1559 Ga0316583_10069563
1560 Ga0316585_10002061
1561 Ga0316585_10058099
1562 Ga0316580_10020547
1563 Ga0316580_10021418
1564 Ga0316580_10025904
1565 Ga0316593_10000349
1566 Ga0316593_10001237
1567 Ga0316593_10054391
1568 Ga0316592_1007100
1569 Ga0316586_1000300
1570 Ga0316588_1046158
1571 Ga0316596_1000615
1572 Ga0373944_0067559
1573 Ga0373923_0032705
1574 Ga0373923_0098301
1575 Ga0373932_0201431
1576 Ga0373936_0008097
1577 Ga0373939_0042238
1578 Ga0373939_0081663
1579 Ga0373945_0006653
1580 Ga0373945_0078958
1581 Ga0373953_0157382
1582 Ga0373956_0029348
1583 Ga0373956_0248982
1584 Ga0373943_0007235
1585 Ga0373943_0080948
1586 Ga0373955_0005106
1587 Ga0373955_0036549
1588 Ga0373955_0246502
1589 Ga0373942_0071250
1590 Ga0373961_0048959
1591 Ga0373961_0095359
1592 Ga0316574_0001643
1593 Ga0316574_0008846
1594 Ga0316574_0038291
1595 Ga0316574_0203323
1596 Ga0316574_0389410
1597 Ga0373931_0085845
1598 Ga0373931_0111163
1599 Ga0373931_0553263
1600 Ga0373935_0003403
1601 Ga0373935_0084560
1602 Ga0373935_0133269
1603 Ga0373935_0934841
1604 Ga0373927_0064151
1605 Ga0373927_0158783
1606 Ga0373927_0167531
1607 Ga0373933_0005271
1608 Ga0373933_0043309
1609 Ga0373933_0433396
1610 Ga0373947_0011709
1611 Ga0373947_0407002
1612 Ga0373937_0003527
1613 Ga0373937_0070199
1614 Ga0373937_0104200
1615 Ga0373937_0128743
1616 Ga0373937_0190143
1617 Ga0373937_0193416
1618 Ga0373937_0198482
1619 Ga0373937_0310051
1620 Ga0373937_0777101
1621 Ga0316582_0012337
1622 Ga0316582_0056650
1623 Ga0316582_0243316
1624 Ga0316584_0001849
1625 Ga0373925_0002514
1626 Ga0373925_0133491
1627 Ga0373925_1342811
1628 Ga0395899_0004948
1629 Ga0395899_0224824
1630 Ga0395900_0062599
1631 Ga0395900_0098142
1632 Ga0395900_0618268
1633 Ga0395898_0003055
1634 Ga0395898_0079037
1635 Ga0395898_0359028
1636 Ga0316581_0008237
1637 Ga0316581_0013780
1638 Ga0395901_0012391
1639 Ga0395901_0072035
1640 Ga0400488_12334
1641 Ga0400486_17540
1642 Ga0400487_00820
1643 Ga0436365_0480014
1644 Ga0436365_0544722
1645 Ga0436365_0868084
1646 Ga0436365_1215018
1647 Ga0436365_1239236
1648 Ga0436365_1351612
1649 Ga0436365_1437117
1650 Ga0436365_1584141
1651 Ga0436365_1637588
1652 Ga0436360_0360048
1653 Ga0436360_0449234
1654 Ga0436360_0716296
1655 Ga0436361_0767135
1656 Ga0436363_0427400
1657 Ga0436363_0896516
1658 Ga0436363_1041884
1659 Ga0436363_1470856
1660 Ga0451793_0170406
1661 Ga0451800_0024754
1662 Ga0451802_1407499
1663 Ga0439460_0224418
1664 Ga0451577_0743919
1665 Ga0453684_0000682
1666 Ga0466957_0637262
1667 Ga0451576_0363162
1668 Ga0466967_0059567
1669 Ga0495592_0176228
1670 Ga0495592_0423576
1671 Ga0495629_0083513
1672 Ga0495651_0186790
1673 Ga0495651_0385149
1674 Ga0495580_0003736
1675 Ga0495580_0046288
1676 Ga0495582_0043074
1677 Ga0495582_0065981
1678 Ga0495662_0112098
1679 Ga0495664_0034829
1680 Ga0495664_0225171
1681 Ga0495664_0237404
1682 Ga0495585_0181428
1683 Ga0495606_0159747
1684 Ga0495628_0328258
1685 Ga0495631_0321349
1686 Ga0495632_0278674
1687 Ga0495652_0041688
1688 Ga0495654_0052557
1689 Ga0495665_0106424
1690 Ga0495587_0050256
1691 Ga0495587_0122784
1692 Ga0495621_0007305
1693 Ga0495645_0086993
1694 Ga0495645_0219231
1695 Ga0495622_0003379
1696 Ga0495622_0149869
1697 Ga0495633_0110090
1698 Ga0495656_0173839
1699 Ga0495625_0123475
1700 Ga0495661_0198281
1701 Ga0495657_0129487
1702 Ga0495599_0306982
1703 Ga0495623_0165906
1704 Ga0495658_0001492
1705 Ga0495613_0442729
1706 Ga0495624_0413944
1707 Ga0495671_0298960
1708 Ga0495649_0106764
1709 Ga0495649_0224280
1710 Ga0495589_0093052
1711 Ga0495636_0324543
1712 Ga0495674_0687412
1713 Ga0495683_0134375
1714 Ga0495675_0062651
1715 Ga0495675_0256692
1716 Ga0495673_0177677
1717 Ga0495681_0247614
1718 Ga0495684_0119581
1719 Ga0495602_0035348
1720 Ga0495602_0175950
1721 Ga0495602_0308838
1722 Ga0495602_0563739
1723 Ga0495615_0027787
1724 Ga0495626_0026549
1725 Ga0496100_0292146
1726 Ga0496104_0414671
1727 Ga0496107_0164931
1728 Ga0496112_0440330
1729 Ga0496115_0373355
1730 Ga0496121_0006108
1731 Ga0496126_0000480
1732 Ga0496126_0077598
1733 Ga0495682_0005207
1734 Ga0501313_009732
1735 Ga0501335_006385
1736 Ga0501031_0037261
1737 Ga0501031_0068962
1738 Ga0501031_0094198
1739 Ga0501031_0518639
1740 Ga0501032_0001267
1741 Ga0501032_0004362
1742 Ga0501032_0019862
1743 Ga0501032_0020357
1744 Ga0501032_0030051
1745 Ga0501032_0178940
1746 Ga0501032_0201791
1747 Ga0501033_0005260
1748 Ga0501033_0012240
1749 Ga0501033_0012917
1750 Ga0501033_0036296
1751 Ga0501033_0175565
1752 Ga0501033_0180575
1753 Ga0501033_0245126
1754 Ga0501033_0322472
1755 Ga0501034_0000001
1756 Ga0501034_0010632
1757 Ga0501034_0011194
1758 Ga0501034_0027593
1759 Ga0501034_0076662
1760 Ga0501034_0076809
1761 Ga0501034_0091835
1762 Ga0501034_0133506
1763 Ga0501034_0171039
1764 Ga0501034_0251625
1765 Ga0501034_1082268
1766 Ga0501036_0005653
1767 Ga0501036_0005682
1768 Ga0501036_0009536
1769 Ga0501037_0024753
1770 Ga0501037_0039814
1771 Ga0501037_0091860
1772 Ga0501037_0130333
1773 Ga0501037_0314591
1774 Ga0501037_0466743
1775 Ga0501038_0088134
1776 Ga0501038_0116476
1777 Ga0501038_0146861
1778 Ga0501038_0147189
1779 Ga0501038_0237262
1780 Ga0501038_0240433
1781 Ga0501038_0349287
1782 Ga0501038_0681305
1783 Ga0501039_0000029
1784 Ga0501039_0019053
1785 Ga0501039_0168128
1786 Ga0501039_0222759
1787 Ga0501039_0349542
1788 Ga0501039_1171961
1789 Ga0501042_0098300
1790 Ga0501042_0392993
1791 Ga0501043_0010388
1792 Ga0501043_0014584
1793 Ga0501043_0097012
1794 Ga0501043_0198900
1795 Ga0501043_0228594
1796 Ga0501043_0369496
1797 Ga0501043_0399659
1798 Ga0501046_0005416
1799 Ga0501046_0011762
1800 Ga0501046_0012992
1801 Ga0501047_0018715
1802 Ga0501047_0025996
1803 Ga0501047_0033976
1804 Ga0501047_0065087
1805 Ga0501047_0075405
1806 Ga0501047_0131220
1807 Ga0501047_0138742
1808 Ga0501047_0160994
1809 Ga0501047_0171826
1810 Ga0501047_0176653
1811 Ga0501047_0220930
1812 Ga0501047_0251827
1813 Ga0501047_0375584
1814 Ga0501047_0441537
1815 Ga0501047_0492805
1816 Ga0501047_0559308
1817 Ga0501047_0798800
1818 Ga0501047_0883324
1819 Ga0501048_0023812
1820 Ga0501048_0124442
1821 Ga0501048_0209717
1822 Ga0501048_0278719
1823 Ga0501067_0001776
1824 Ga0501067_0005578
1825 Ga0501067_0022624
1826 Ga0501068_0077512
1827 Ga0501068_0601467
1828 Ga0501069_0022165
1829 Ga0501069_0333797
1830 Ga0501070_0000481
1831 Ga0501070_0003398
1832 Ga0501070_0014964
1833 Ga0501070_0143912
1834 Ga0501070_0178515
1835 Ga0501070_0309863
1836 Ga0501070_0382617
1837 Ga0501071_0135415
1838 Ga0501071_0156932
1839 Ga0501072_0015507
1840 Ga0501073_0001669
1841 Ga0501073_0004494
1842 Ga0501073_0015128
1843 Ga0501073_0059739
1844 Ga0501073_0059886
1845 Ga0501073_0061078
1846 Ga0501073_0070275
1847 Ga0501073_0987301
1848 Ga0501074_0004453
1849 Ga0501074_0042382
1850 Ga0501074_0079197
1851 Ga0501077_0059400
1852 Ga0501079_0001478
1853 Ga0501079_0017836
1854 Ga0501079_0140727
1855 Ga0501079_0188192
1856 Ga0501079_0330695
1857 Ga0501080_0018079
1858 Ga0501080_0040364
1859 Ga0501080_0043846
1860 Ga0501080_0062400
1861 Ga0501080_0125187
1862 Ga0501080_0179248
1863 Ga0501080_0283362
1864 Ga0501080_0628681
1865 Ga0501080_1069414
1866 Ga0501083_0077301
1867 Ga0501083_0089262
1868 Ga0501083_0117891
1869 Ga0501083_0135923
1870 Ga0501083_0275277
1871 Ga0501083_0712658
1872 Ga0501280_000425
1873 Ga0501282_002357
1874 Ga0501035_0019622
1875 Ga0501035_0037025
1876 Ga0501035_0044851
1877 Ga0501035_0048543
1878 Ga0501035_0065562
1879 Ga0501035_0085166
1880 Ga0501035_0162505
1881 Ga0501035_0190474
1882 Ga0501035_0254054
1883 Ga0501035_0283204
1884 Ga0501035_0300904
1885 Ga0501035_0914179
1886 Ga0501044_0015755
1887 Ga0501044_0024878
1888 Ga0501044_0032329
1889 Ga0501044_0044540
1890 Ga0501044_0099276
1891 Ga0501044_0114803
1892 Ga0501044_0129184
1893 Ga0501044_0140739
1894 Ga0501044_0161480
1895 Ga0501044_0210012
1896 Ga0501044_0504734
1897 Ga0501044_0519482
1898 Ga0501045_0128835
1899 nmdc:mga03683_252067_c1
1900 nmdc:mga03n38_135_c1
1901 nmdc:mga00v17_123_c1
1902 nmdc:mga00v17_385_c1
1903 nmdc:mga0yw44_265_c1
1904 nmdc:mga06z11_3977_c1
1905 nmdc:mga06z11_6666_c1
1906 nmdc:mga04h51_108108_c1
1907 nmdc:mga04h51_55057_c1
1908 nmdc:mga07m45_68_c1
1909 nmdc:mga05p37_167955_c1
1910 nmdc:mga05p37_507131_c1
1911 nmdc:mga09592_25742_c1
1912 nmdc:mga09592_80345_c1
1913 nmdc:mga0qj67_173986_c1
1914 nmdc:mga0qj67_275124_c1
1915 nmdc:mga08y16_19140_c1
1916 nmdc:mga08y16_2559_c1
1917 nmdc:mga0n895_10772_c1
1918 nmdc:mga0n895_17129_c1
1919 nmdc:mga0n895_277025_c1
1920 nmdc:mga0n895_789078_c1
1921 nmdc:mga0rr50_45774_c1
1922 nmdc:mga0rr50_7934_c1
1923 nmdc:mga08x19_177_c1
1924 nmdc:mga08x19_2026_c1
1925 nmdc:mga08x19_945_c1
1926 nmdc:mga0a205_20420_c1
1927 nmdc:mga0sz30_17_c1
1928 Ga0495619_0184369
1929 Ga0500643_000003
1930 Ga0500566_0181241
1931 Ga0500592_011077
1932 Ga0500594_0012014
1933 Ga0500595_001661
1934 Ga0500595_101861
1935 Ga0500655_006392
1936 Ga0500559_0020972
1937 Ga0500568_0047421
1938 Ga0500573_0000452
1939 Ga0500619_043325
1940 Ga0500639_087393
1941 Ga0500576_168654
1942 Ga0500645_070785
1943 Ga0500645_104061
1944 Ga0501084_0000175
1945 Ga0501084_0007620
1946 Ga0501084_0029906
1947 Ga0501084_0074161
1948 Ga0501084_0145505
1949 Ga0501084_0363006
1950 Ga0501082_0006964
1951 Ga0501082_0039783
1952 Ga0501082_0069701
1953 Ga0501082_0107936
1954 Ga0501082_0590704
1955 Ga0530510_0238077
1956 2739613616

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00347

Ribosomal_L6

Ribosomal protein L6

105

180

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fn2-assembly1.cif.gz_H the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.9578 1 172
8cgk-assembly1.cif.gz_g lincomycin and avilamycin bound to the 50s subunit 0.9554 2 172
8ceu-assembly1.cif.gz_g retapamulin and capreomycin bound to the 50s subunit 0.9484 2 175
5li0-assembly1.cif.gz_H 70s ribosome from staphylococcus aureus 0.947 9 171
8cgv-assembly1.cif.gz_g tiamulin bound to the 50s subunit 0.9467 2 177
ID Description Score Start End Superfamily
3knmH02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9455 83 168 3.90.930.12
af_Q09865_118_210_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9454 83 172 3.90.930.12
af_Q25814_82_167_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9428 83 164 3.90.930.12
4g5lH02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9409 83 170 3.90.930.12
1vw4F02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9352 83 171 3.90.930.12
ID Description Score Start End GO Terms
AF-A0A2J1D431-F1-model_v4 deleted 0.9905 74 168
AF-A0A2J6L7U4-F1-model_v4 deleted 0.9863 82 164
AF-A0A358FVP3-F1-model_v4 50S ribosomal protein L6 0.9861 81 161 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-X1G5X1-F1-model_v4 Large ribosomal subunit protein uL6 alpha-beta domain-containing protein 0.9828 82 154 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A1V4GKA1-F1-model_v4 deleted 0.9795 76 146

Map