F487323

General Info

Members Datasets Scaffolds Average Seq Length
979 465 950 304

Family's Representative Sequence

Representative Sequence 3300006195|Ga0075366_10003336|Ga0075366_100033366
Length 329
Sequence MPDFISEFWSVSIAVITVVSILGCLVLLFSVSTQRVVRDASGKVETTGHTWDDDLGEYNNPLPRWWMWMFILTVVFALAYLVIYPGLGAYKGTLAWTSTGEYQDELRKADAQYGPLFSQYAGRDLKHVAADPQARAIGQRLFLNYCAQCHGSDARGGKGFPDLTDQDWLWGGTPEAIKTTILHGRNGVMPPMGAALGSEQDVRNVANYVMSLSGRAHDSIYAYQGKAKFGACAACHGADGKGNPALGAPNLTDTIWLHGGGVENVMETIRKGRNNVMPGHQVFLGEEKVHLLSAYVWGLSNNTSMPLAAATPPSGAGTGSATPAAVPAR

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
3 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
4 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
5 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
6 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
7 2643221672 Variovorax sp. Root434 Isolate Unclassified
8 2643221683 Variovorax sp. Root473 Isolate Unclassified
9 2721755523 Delftia sp. HK171 Isolate Unclassified
10 2738541277 Variovorax sp. GV051 Isolate Unclassified
11 2738543019 Variovorax sp. GV040 Isolate Unclassified
12 2818991446 Variovorax sp. 1180 Isolate Unclassified
13 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
14 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
15 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
16 2842677519 Variovorax sp. R-72495 Isolate Unclassified
17 2899924645 Variovorax sp. 369 Isolate Unclassified
18 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
19 2904456579 Variovorax sp. 2002 Isolate Unclassified
20 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
21 2928037797 Variovorax sp. 1126 Isolate Unclassified
22 2928044640 Variovorax sp. 1128 Isolate Unclassified
23 2928051484 Variovorax sp. 1133 Isolate Unclassified
24 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
25 2928070936 Variovorax gossypii 1167 Isolate Unclassified
26 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
27 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
28 2929520902 Variovorax beijingensis 502 Isolate Unclassified
29 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
30 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
31 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
32 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
33 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
34 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
35 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
36 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
37 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
38 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
39 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
40 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
41 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
42 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
43 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
44 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
45 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
46 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
47 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
48 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
49 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
50 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
51 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
52 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
53 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
54 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
55 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
56 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
57 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
58 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
59 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
60 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
61 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
62 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
63 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
64 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
65 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
66 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
67 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
68 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
69 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
70 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
71 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
72 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
73 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
74 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
75 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
76 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
77 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
78 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
79 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
80 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
81 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
82 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
83 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
84 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
85 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
86 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
87 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
88 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
89 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
90 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
91 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
92 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
93 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
94 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
95 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
96 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
97 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
98 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
99 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
100 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
101 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
102 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
103 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
104 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
105 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
106 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
107 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
108 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
109 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
110 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
111 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
112 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
113 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
114 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
115 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
116 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
117 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
118 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
119 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
120 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
121 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
122 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
123 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
124 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
125 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
126 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
127 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
128 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
129 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
130 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
131 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
132 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
133 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
134 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
135 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
136 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
137 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
138 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
139 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
140 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
141 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
142 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
143 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
144 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
145 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
146 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
147 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
148 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
149 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
150 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
151 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
152 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
153 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
154 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
155 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
156 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
157 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
158 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
159 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
160 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
161 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
162 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
163 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
164 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
165 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
166 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
167 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
168 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
169 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
170 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
171 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
172 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
173 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
174 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
175 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
179 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
181 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
183 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
184 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
187 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
188 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
189 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
191 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
192 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
250 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
254 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
256 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
257 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
261 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
262 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
263 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
264 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
265 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
266 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
267 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
268 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
269 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
270 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
271 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
272 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
273 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
274 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
275 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
276 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
277 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
278 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
279 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
280 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
281 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
282 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
283 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
284 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
285 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
286 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
287 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
288 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
289 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
290 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
291 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
292 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
293 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
294 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
295 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
296 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
297 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
298 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
299 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
300 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
301 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
302 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
303 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
304 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
305 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
306 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
307 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
308 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
309 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
310 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
311 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
312 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
313 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
314 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
315 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
316 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
317 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
318 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
319 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
320 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
321 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
322 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
323 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
324 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
325 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
326 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
327 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
328 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
329 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
330 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
331 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
332 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
333 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
334 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
335 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
336 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
337 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
338 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
339 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
340 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
341 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
342 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
343 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
344 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
345 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
346 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
347 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
348 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
349 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
350 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
351 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
352 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
353 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
354 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
355 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
356 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
357 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
358 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
359 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
360 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
361 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
362 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
363 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
364 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
365 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
366 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
367 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
368 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
369 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
370 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
371 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
372 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
373 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
374 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
375 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
376 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
377 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
378 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
379 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
380 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
381 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
382 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
383 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
384 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
385 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
386 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
387 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
388 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
389 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
390 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
391 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
392 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
393 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
396 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
401 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
402 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
404 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
405 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
409 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
410 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
411 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
412 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
413 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
414 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
415 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
416 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
417 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
418 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
419 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
420 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
421 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
422 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
423 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
424 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
427 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
428 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
429 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
430 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
431 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
432 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
433 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
434 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
435 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
436 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
437 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
438 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
439 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
440 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
441 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
442 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
443 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
444 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
445 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
446 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
447 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
448 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
449 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
450 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
451 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
452 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
453 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
454 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
455 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
456 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
457 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
458 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
459 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
460 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
461 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
462 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
463 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
464 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
465 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.63
Metatranscriptomes 0.41
Isolates 2.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.85
Nodule 1.02
Rhizoplane 2.55
Rhizosphere 74.67
Stem 0
Stem Tuber 0
Unclassified 4.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1005020 3300001915 Bacteria 2833
2 JGI24740J21852_10000244 3300001979 Bacteria 23006
3 JGI24740J21852_10014817 3300001979 Bacteria 2864
4 JGI24739J22299_10019684 3300001989 Bacteria 2414
5 JGI25152J39213_1000159 3300002773 Bacteria 45944
6 JGI25152J39213_1003485 3300002773 Bacteria 5346
7 JGI25150J39212_1001644 3300002774 Bacteria 6077
8 JGI25150J39212_1005296 3300002774 Bacteria 2769
9 JGI25159J45721_1012146 3300002987 Bacteria 2070
10 JGI25151J46595_10000384 3300003187 Bacteria 45944
11 JGI25151J46595_10000716 3300003187 Bacteria 27662
12 JGI25151J46595_10003350 3300003187 Bacteria 8879
13 JGI25153J46596_10000243 3300003215 Bacteria 45944
14 rootL2_10068905 3300003322 Bacteria 1423
15 rootH1_10001255 3300003323 Bacteria 1629
16 JGI25160J50197_1000275 3300003354 Bacteria 37775
17 JGI25161J50226_1005011 3300003374 Bacteria 2661
18 Ga0006562J51391_1033060 3300003578 Bacteria 1983
19 Ga0055527_1005055 3300003760 Bacteria 1751
20 Ga0055535_1000115 3300003761 Bacteria 86313
21 Ga0055542_1000028 3300003762 Bacteria 251458
22 Ga0055526_1000245 3300003771 Bacteria 45932
23 Ga0055526_1000676 3300003771 Bacteria 26148
24 Ga0055537_1000068 3300003773 Bacteria 75642
25 Ga0055537_1000192 3300003773 Bacteria 45800
26 Ga0055537_1008083 3300003773 Bacteria 2463
27 Ga0055524_1000113 3300003775 Bacteria 95090
28 Ga0055524_1000312 3300003775 Bacteria 45944
29 Ga0055524_1004329 3300003775 Bacteria 6580
30 Ga0055536_1000396 3300003781 Bacteria 31602
31 Ga0055536_1000458 3300003781 Bacteria 28710
32 Ga0055536_1001741 3300003781 Bacteria 12852
33 Ga0055534_1000080 3300003784 Bacteria 75642
34 Ga0055534_1000183 3300003784 Bacteria 45800
35 Ga0055528_1000159 3300003790 Bacteria 56331
36 Ga0055528_1000245 3300003790 Bacteria 45800
37 Ga0055528_1000520 3300003790 Bacteria 30143
38 Ga0055528_1018126 3300003790 Bacteria 2400
39 Ga0055530_10000086 3300003791 Bacteria 80109
40 Ga0055540_1000092 3300003792 Bacteria 98476
41 Ga0055540_1000268 3300003792 Bacteria 47109
42 Ga0055540_1000520 3300003792 Bacteria 29103
43 Ga0055540_1004478 3300003792 Bacteria 6272
44 Ga0055540_1018458 3300003792 Bacteria 1911
45 Ga0055531_10000672 3300003794 Bacteria 29298
46 Ga0055531_10000724 3300003794 Bacteria 28069
47 Ga0055531_10013596 3300003794 Bacteria 3738
48 Ga0055531_10016047 3300003794 Bacteria 3258
49 Ga0055543_1009429 3300004625 Bacteria 2096
50 Ga0055543_1009518 3300004625 Bacteria 2084
51 Ga0065165_1001483 3300005262 Bacteria 24930
52 Ga0065714_10010832 3300005288 Bacteria 3169
53 Ga0065714_10069048 3300005288 Bacteria 4414
54 Ga0065704_10085211 3300005289 Bacteria 3238
55 Ga0065704_10086797 3300005289 Bacteria 3084
56 Ga0065712_10129000 3300005290 Bacteria 1572
57 Ga0065707_10012023 3300005295 Bacteria 2487
58 Ga0070658_10177129 3300005327 Bacteria 1794
59 Ga0070676_10068230 3300005328 Bacteria 2128
60 Ga0070676_10210770 3300005328 Bacteria 1278
61 Ga0070683_100033036 3300005329 Bacteria 4715
62 Ga0070690_100049876 3300005330 Bacteria 2670
63 Ga0070670_100109243 3300005331 Bacteria 2383
64 Ga0070677_10116408 3300005333 Bacteria 1201
65 Ga0068869_100000492 3300005334 Bacteria 21961
66 Ga0068869_100154241 3300005334 Bacteria 1783
67 Ga0070666_10020164 3300005335 Bacteria 4308
68 Ga0070666_10098764 3300005335 Bacteria 2010
69 Ga0070680_100213155 3300005336 Bacteria 1629
70 Ga0070682_100014615 3300005337 Bacteria 4538
71 Ga0068868_100143982 3300005338 Bacteria 1959
72 Ga0068868_100178496 3300005338 Bacteria 1761
73 Ga0068868_100389487 3300005338 Bacteria 1200
74 Ga0070689_100004687 3300005340 Bacteria 9266
75 Ga0070687_100047149 3300005343 Bacteria 2209
76 Ga0070687_100141589 3300005343 Bacteria 1401
77 Ga0070661_100102779 3300005344 Bacteria 2127
78 Ga0070692_10009202 3300005345 Bacteria 4442
79 Ga0070692_10011876 3300005345 Bacteria 4015
80 Ga0070668_100023220 3300005347 Bacteria 4691
81 Ga0070668_100023702 3300005347 Bacteria 4645
82 Ga0070668_100153802 3300005347 Bacteria 1862
83 Ga0070669_100010896 3300005353 Bacteria 6455
84 Ga0070669_100048201 3300005353 Bacteria 3109
85 Ga0070669_100061108 3300005353 Bacteria 2768
86 Ga0070669_100089023 3300005353 Bacteria 2311
87 Ga0070669_100142582 3300005353 Bacteria 1848
88 Ga0070675_100012028 3300005354 Bacteria 6784
89 Ga0070675_100034134 3300005354 Bacteria 4127
90 Ga0070675_100039354 3300005354 Bacteria 3858
91 Ga0070675_100055658 3300005354 Bacteria 3257
92 Ga0070675_100061199 3300005354 Bacteria 3108
93 Ga0070675_100066280 3300005354 Bacteria 2986
94 Ga0070675_100161456 3300005354 Bacteria 1927
95 Ga0070671_100057372 3300005355 Bacteria 3240
96 Ga0070671_100148747 3300005355 Bacteria 1977
97 Ga0070671_100325025 3300005355 Bacteria 1311
98 Ga0070674_100040024 3300005356 Bacteria 3168
99 Ga0070674_100099970 3300005356 Bacteria 2111
100 Ga0070674_100221997 3300005356 Bacteria 1470
101 Ga0070673_100060985 3300005364 Bacteria 2991
102 Ga0070673_100061792 3300005364 Bacteria 2973
103 Ga0070673_100199708 3300005364 Bacteria 1722
104 Ga0070673_100507737 3300005364 Bacteria 1091
105 Ga0070688_100043718 3300005365 Bacteria 2761
106 Ga0070688_100107485 3300005365 Bacteria 1849
107 Ga0070659_100090075 3300005366 Bacteria 2458
108 Ga0070659_100548543 3300005366 Bacteria 989
109 Ga0070667_100010104 3300005367 Bacteria 7808
110 Ga0070667_100026936 3300005367 Bacteria 4782
111 Ga0070667_100137940 3300005367 Bacteria 2133
112 Ga0070667_100193288 3300005367 Bacteria 1803
113 Ga0070701_10064211 3300005438 Bacteria 1945
114 Ga0070701_10067851 3300005438 Bacteria 1899
115 Ga0070701_10095451 3300005438 Bacteria 1637
116 Ga0070701_10112285 3300005438 Bacteria 1524
117 Ga0070711_100169475 3300005439 Bacteria 1663
118 Ga0070705_100025083 3300005440 Bacteria 3227
119 Ga0070700_100007776 3300005441 Bacteria 5809
120 Ga0070700_100024533 3300005441 Bacteria 3542
121 Ga0070700_100039937 3300005441 Bacteria 2870
122 Ga0070700_100076427 3300005441 Bacteria 2150
123 Ga0070694_100203846 3300005444 Bacteria 1476
124 Ga0070694_100272365 3300005444 Unclassified 1288
125 Ga0070678_100018733 3300005456 Bacteria 4494
126 Ga0070678_100028455 3300005456 Bacteria 3812
127 Ga0070678_100238044 3300005456 Bacteria 1521
128 Ga0070662_100027067 3300005457 Bacteria 3977
129 Ga0070662_100181192 3300005457 Bacteria 1660
130 Ga0070662_100242017 3300005457 Bacteria 1447
131 Ga0068867_100008503 3300005459 Bacteria 7246
132 Ga0068867_100015366 3300005459 Bacteria 5429
133 Ga0068867_100068818 3300005459 Bacteria 2642
134 Ga0068867_100367798 3300005459 Bacteria 1204
135 Ga0070698_100010835 3300005471 Bacteria 9702
136 Ga0070684_100048491 3300005535 Bacteria 3685
137 Ga0068853_100024738 3300005539 Bacteria 5037
138 Ga0068853_100044387 3300005539 Bacteria 3805
139 Ga0070672_100065748 3300005543 Bacteria 2869
140 Ga0070672_100148383 3300005543 Bacteria 1939
141 Ga0070672_100151205 3300005543 Bacteria 1920
142 Ga0070672_100152877 3300005543 Bacteria 1910
143 Ga0070672_100157007 3300005543 Bacteria 1885
144 Ga0070672_100350988 3300005543 Bacteria 1257
145 Ga0070686_100042934 3300005544 Bacteria 2834
146 Ga0070686_100085535 3300005544 Bacteria 2098
147 Ga0070695_100108487 3300005545 Bacteria 1880
148 Ga0070695_100148116 3300005545 Bacteria 1635
149 Ga0070695_100237242 3300005545 Bacteria 1321
150 Ga0070696_100030340 3300005546 Bacteria 3701
151 Ga0070665_100023711 3300005548 Bacteria 6180
152 Ga0070665_100028940 3300005548 Bacteria 5577
153 Ga0070665_100063885 3300005548 Bacteria 3691
154 Ga0070665_100379394 3300005548 Bacteria 1421
155 Ga0070665_100524979 3300005548 Bacteria 1196
156 Ga0070704_100254762 3300005549 Bacteria 1443
157 Ga0070704_100515035 3300005549 Bacteria 1040
158 Ga0068855_100219120 3300005563 Bacteria 2135
159 Ga0070664_100006788 3300005564 Bacteria 9229
160 Ga0070664_100011657 3300005564 Bacteria 7132
161 Ga0070664_100075939 3300005564 Bacteria 2887
162 Ga0070664_100083686 3300005564 Bacteria 2753
163 Ga0070664_100148795 3300005564 Bacteria 2066
164 Ga0070664_100206428 3300005564 Bacteria 1755
165 Ga0068857_100249894 3300005577 Bacteria 1625
166 Ga0068857_100279368 3300005577 Bacteria 1536
167 Ga0068857_100308872 3300005577 Bacteria 1459
168 Ga0068857_100328513 3300005577 Bacteria 1413
169 Ga0068854_100028929 3300005578 Bacteria 3833
170 Ga0068854_100100719 3300005578 Bacteria 2166
171 Ga0068854_100179204 3300005578 Bacteria 1654
172 Ga0068856_100101536 3300005614 Bacteria 2869
173 Ga0068856_100370997 3300005614 Bacteria 1450
174 Ga0068856_100529772 3300005614 Bacteria 1199
175 Ga0068852_100023333 3300005616 Bacteria 4978
176 Ga0068852_100079314 3300005616 Bacteria 2908
177 Ga0068852_100128838 3300005616 Bacteria 2328
178 Ga0068852_100547294 3300005616 Bacteria 1157
179 Ga0068859_100004203 3300005617 Bacteria 14701
180 Ga0068859_100043409 3300005617 Bacteria 4518
181 Ga0068859_100050306 3300005617 Bacteria 4187
182 Ga0068859_100140846 3300005617 Bacteria 2485
183 Ga0068859_100205797 3300005617 Bacteria 2053
184 Ga0068859_100275563 3300005617 Bacteria 1775
185 Ga0068859_100344889 3300005617 Bacteria 1584
186 Ga0068864_100045634 3300005618 Bacteria 3759
187 Ga0068864_100067928 3300005618 Bacteria 3096
188 Ga0068864_100110129 3300005618 Bacteria 2452
189 Ga0068864_100198167 3300005618 Bacteria 1843
190 Ga0068864_100199249 3300005618 Bacteria 1838
191 Ga0068864_100223152 3300005618 Bacteria 1739
192 Ga0068866_10006875 3300005718 Bacteria 4752
193 Ga0068866_10047154 3300005718 Bacteria 2171
194 Ga0068866_10133214 3300005718 Bacteria 1416
195 Ga0068866_10136362 3300005718 Bacteria 1403
196 Ga0068861_100000457 3300005719 Bacteria 23806
197 Ga0068861_100011901 3300005719 Bacteria 6058
198 Ga0068861_100033223 3300005719 Bacteria 3804
199 Ga0068851_10000887 3300005834 Bacteria 12923
200 Ga0068851_10011672 3300005834 Bacteria 4124
201 Ga0068851_10013697 3300005834 Bacteria 3839
202 Ga0068851_10040615 3300005834 Bacteria 2338
203 Ga0068870_10098928 3300005840 Bacteria 1644
204 Ga0068870_10144819 3300005840 Bacteria 1393
205 Ga0068863_100039081 3300005841 Bacteria 4516
206 Ga0068863_100083400 3300005841 Bacteria 3029
207 Ga0068863_100236748 3300005841 Bacteria 1762
208 Ga0068858_100019496 3300005842 Bacteria 6343
209 Ga0068858_100039850 3300005842 Bacteria 4355
210 Ga0068858_100099246 3300005842 Bacteria 2715
211 Ga0068860_100000685 3300005843 Bacteria 39158
212 Ga0068860_100042170 3300005843 Bacteria 4359
213 Ga0068860_100101198 3300005843 Bacteria 2749
214 Ga0068860_100258889 3300005843 Bacteria 1695
215 Ga0068862_100001127 3300005844 Bacteria 25370
216 Ga0068862_100003177 3300005844 Bacteria 14245
217 Ga0068862_100078130 3300005844 Bacteria 2867
218 Ga0068862_100084729 3300005844 Bacteria 2754
219 Ga0068862_100097995 3300005844 Bacteria 2560
220 Ga0068862_100222858 3300005844 Bacteria 1708
221 Ga0068862_100261239 3300005844 Bacteria 1581
222 Ga0081455_10004596 3300005937 Bacteria 15410
223 Ga0075365_10002031 3300006038 Bacteria 9618
224 Ga0075368_10009041 3300006042 Bacteria 3576
225 Ga0075363_100002675 3300006048 Bacteria 7358
226 Ga0075363_100007021 3300006048 Bacteria 5149
227 Ga0075363_100057328 3300006048 Bacteria 2090
228 Ga0075363_100073300 3300006048 Bacteria 1863
229 Ga0075364_10007877 3300006051 Bacteria 6344
230 Ga0075364_10052287 3300006051 Bacteria 2669
231 Ga0075364_10160220 3300006051 Bacteria 1519
232 Ga0075432_10005523 3300006058 Bacteria 4307
233 Ga0070712_100133261 3300006175 Bacteria 1886
234 Ga0075362_10008330 3300006177 Bacteria 3961
235 Ga0075362_10010930 3300006177 Bacteria 3562
236 Ga0075362_10049758 3300006177 Bacteria 1873
237 Ga0075362_10052475 3300006177 Bacteria 1827
238 Ga0075367_10135901 3300006178 Bacteria 1521
239 Ga0075369_10005152 3300006186 Bacteria 4870
240 Ga0075366_10003336 3300006195 Bacteria 8450
241 Ga0075366_10008587 3300006195 Bacteria 5686
242 Ga0075366_10014371 3300006195 Bacteria 4520
243 Ga0097621_100003378 3300006237 Bacteria 10987
244 Ga0097621_100023062 3300006237 Bacteria 4840
245 Ga0097621_100154921 3300006237 Bacteria 1966
246 Ga0097621_100199990 3300006237 Bacteria 1734
247 Ga0097621_100266562 3300006237 Bacteria 1504
248 Ga0075370_10003278 3300006353 Bacteria 7677
249 Ga0075370_10012403 3300006353 Bacteria 4503
250 Ga0075370_10056515 3300006353 Bacteria 2230
251 Ga0075370_10131833 3300006353 Bacteria 1458
252 Ga0068871_100008412 3300006358 Bacteria 7421
253 Ga0068871_100009301 3300006358 Bacteria 7112
254 Ga0068871_100095942 3300006358 Bacteria 2477
255 Ga0068871_100162978 3300006358 Bacteria 1908
256 Ga0068871_100237416 3300006358 Bacteria 1584
257 Ga0068871_100325007 3300006358 Bacteria 1355
258 Ga0068871_100442201 3300006358 Bacteria 1164
259 Ga0075428_100385212 3300006844 Bacteria 1503
260 Ga0075430_100187475 3300006846 Bacteria 1720
261 Ga0075431_100003705 3300006847 Bacteria 14849
262 Ga0075434_100163554 3300006871 Bacteria 2245
263 Ga0075429_100000326 3300006880 Bacteria 34334
264 Ga0068865_100097311 3300006881 Bacteria 2148
265 Ga0097620_100004203 3300006931 Bacteria 14701
266 Ga0097620_100043409 3300006931 Bacteria 4518
267 Ga0097620_100050306 3300006931 Bacteria 4187
268 Ga0097620_100140849 3300006931 Bacteria 2485
269 Ga0097620_100205783 3300006931 Bacteria 2053
270 Ga0097620_100275574 3300006931 Bacteria 1775
271 Ga0097620_100344868 3300006931 Bacteria 1584
272 Ga0079104_1000034 3300006946 Bacteria 199368
273 Ga0079104_1000056 3300006946 Bacteria 166276
274 Ga0079104_1037793 3300006946 Bacteria 1148
275 Ga0099826_10000158 3300006948 Bacteria 28172
276 Ga0099826_10173688 3300006948 Bacteria 1207
277 Ga0105244_10000730 3300009036 Bacteria 28251
278 Ga0105240_10102054 3300009093 Bacteria 3487
279 Ga0111539_10170865 3300009094 Bacteria 2540
280 Ga0111539_10217357 3300009094 Bacteria 2226
281 Ga0111539_10256613 3300009094 Bacteria 2036
282 Ga0111539_10477850 3300009094 Bacteria 1451
283 Ga0105247_10399477 3300009101 Bacteria 979
284 Ga0114129_10008954 3300009147 Bacteria 14267
285 Ga0105243_10000392 3300009148 Bacteria 46166
286 Ga0105243_10002832 3300009148 Bacteria 14397
287 Ga0105243_10004141 3300009148 Bacteria 11526
288 Ga0105243_10006138 3300009148 Bacteria 9293
289 Ga0105243_10052781 3300009148 Bacteria 3222
290 Ga0105243_10207747 3300009148 Bacteria 1722
291 Ga0105241_10162914 3300009174 Bacteria 1835
292 Ga0105241_10316107 3300009174 Bacteria 1345
293 Ga0105242_10004957 3300009176 Bacteria 10300
294 Ga0105242_10127021 3300009176 Bacteria 2196
295 Ga0105242_10177028 3300009176 Bacteria 1879
296 Ga0105248_10005948 3300009177 Bacteria 13399
297 Ga0105248_10085062 3300009177 Bacteria 3559
298 Ga0105237_10007850 3300009545 Bacteria 11633
299 Ga0105238_10001422 3300009551 Bacteria 23984
300 Ga0105238_10043722 3300009551 Bacteria 4532
301 Ga0105238_10174661 3300009551 Bacteria 2125
302 Ga0105238_10226513 3300009551 Bacteria 1846
303 Ga0105249_10019420 3300009553 Bacteria 6064
304 Ga0105249_10040550 3300009553 Bacteria 4229
305 Ga0105249_10193650 3300009553 Bacteria 1985
306 Ga0105249_10227041 3300009553 Bacteria 1840
307 Ga0105239_10043053 3300010375 Bacteria 4948
308 Ga0105239_10295740 3300010375 Bacteria 1823
309 Ga0105239_10353288 3300010375 Bacteria 1660
310 Ga0105246_10020610 3300011119 Bacteria 4230
311 Ga0105246_10050913 3300011119 Bacteria 2842
312 Ga0105246_10142264 3300011119 Bacteria 1805
313 Ga0105246_10221659 3300011119 Bacteria 1483
314 Ga0157373_10034715 3300013100 Bacteria 3623
315 Ga0157373_10083856 3300013100 Bacteria 2246
316 Ga0157369_10005435 3300013105 Bacteria 14814
317 Ga0157374_10089392 3300013296 Bacteria 2935
318 Ga0157374_10091172 3300013296 Bacteria 2906
319 Ga0163162_10002995 3300013306 Bacteria 16145
320 Ga0163162_10085086 3300013306 Bacteria 3239
321 Ga0163162_10087528 3300013306 Bacteria 3193
322 Ga0163162_10124232 3300013306 Bacteria 2686
323 Ga0163162_10450054 3300013306 Bacteria 1420
324 Ga0163162_10510596 3300013306 Bacteria 1332
325 Ga0157372_10004902 3300013307 Bacteria 14227
326 Ga0157375_10005919 3300013308 Bacteria 10659
327 Ga0157375_10194265 3300013308 Bacteria 2184
328 Ga0157375_10726370 3300013308 Bacteria 1146
329 Ga0163163_10034424 3300014325 Bacteria 4905
330 Ga0157380_10002488 3300014326 Bacteria 12421
331 Ga0157380_10058210 3300014326 Bacteria 3080
332 Ga0157380_10081167 3300014326 Bacteria 2652
333 Ga0157380_10096386 3300014326 Bacteria 2452
334 Ga0182008_10000536 3300014497 Bacteria 28332
335 Ga0182008_10003802 3300014497 Bacteria 8973
336 Ga0182008_10038117 3300014497 Bacteria 2404
337 Ga0157377_10128626 3300014745 Bacteria 1544
338 Ga0157377_10248550 3300014745 Bacteria 1152
339 Ga0157379_10086742 3300014968 Bacteria 2806
340 Ga0157376_10079140 3300014969 Bacteria 2817
341 Ga0182006_1000910 3300015261 Bacteria 19716
342 Ga0182006_1074943 3300015261 Bacteria 1246
343 Ga0182006_1089025 3300015261 Bacteria 1113
344 Ga0182007_10002257 3300015262 Bacteria 9716
345 Ga0163161_10000441 3300017792 Bacteria 34632
346 Ga0163161_10007311 3300017792 Bacteria 7620
347 Ga0163161_10062469 3300017792 Bacteria 2714
348 Ga0163161_10065587 3300017792 Bacteria 2650
349 Ga0163161_10397696 3300017792 Bacteria 1104
350 Ga0206356_11540035 3300020070 Bacteria 3573
351 Ga0206354_10006232 3300020081 Bacteria 3458
352 Ga0206353_11382456 3300020082 Bacteria 2623
353 Ga0213872_10026422 3300021361 Bacteria 2666
354 Ga0209436_105137 3300025208 Bacteria 3071
355 Ga0209436_111871 3300025208 Bacteria 1507
356 Ga0209672_101025 3300025228 Bacteria 12108
357 Ga0209147_100906 3300025229 Bacteria 13388
358 Ga0209258_100067 3300025242 Bacteria 287603
359 Ga0207425_1000213 3300025245 Bacteria 46021
360 Ga0207425_1002332 3300025245 Bacteria 6786
361 Ga0209148_1000067 3300025254 Bacteria 338678
362 Ga0209129_1000296 3300025258 Bacteria 46753
363 Ga0209129_1006497 3300025258 Bacteria 3756
364 Ga0209565_1000027 3300025263 Bacteria 360545
365 Ga0209565_1000073 3300025263 Bacteria 164695
366 Ga0209565_1006250 3300025263 Bacteria 3368
367 Ga0209673_1000031 3300025273 Bacteria 347560
368 Ga0209673_1000066 3300025273 Bacteria 250037
369 Ga0209673_1000127 3300025273 Bacteria 164695
370 Ga0209673_1001215 3300025273 Bacteria 27353
371 Ga0209130_1000417 3300025284 Bacteria 45994
372 Ga0209130_1002081 3300025284 Bacteria 10769
373 Ga0209675_1000029 3300025291 Bacteria 281053
374 Ga0209675_1000157 3300025291 Bacteria 88700
375 Ga0209675_1007853 3300025291 Bacteria 4012
376 Ga0209675_1008282 3300025291 Bacteria 3845
377 Ga0209676_1000005 3300025292 Bacteria 1076001
378 Ga0209676_1000098 3300025292 Bacteria 234305
379 Ga0209676_1000123 3300025292 Bacteria 195351
380 Ga0209676_1000186 3300025292 Bacteria 142440
381 Ga0209676_1025345 3300025292 Bacteria 1904
382 Ga0209025_1000104 3300025294 Bacteria 226895
383 Ga0209025_1000902 3300025294 Bacteria 46045
384 Ga0209025_1022283 3300025294 Bacteria 3366
385 Ga0209564_1000090 3300025295 Bacteria 249298
386 Ga0209564_1000734 3300025295 Bacteria 46683
387 Ga0209758_1000050 3300025297 Bacteria 345008
388 Ga0209758_1002384 3300025297 Bacteria 19346
389 Ga0209050_1000007 3300025298 Bacteria 1187891
390 Ga0209050_1000188 3300025298 Bacteria 138865
391 Ga0209256_1000022 3300025299 Bacteria 481843
392 Ga0209256_1000023 3300025299 Bacteria 461150
393 Ga0209256_1000049 3300025299 Bacteria 310696
394 Ga0207426_1000202 3300025302 Bacteria 143712
395 Ga0207426_1000260 3300025302 Bacteria 114246
396 Ga0209051_1000029 3300025303 Bacteria 403675
397 Ga0209051_1000036 3300025303 Bacteria 339863
398 Ga0209051_1000091 3300025303 Bacteria 173683
399 Ga0209051_1000098 3300025303 Bacteria 165284
400 Ga0209051_1000298 3300025303 Bacteria 78777
401 Ga0209051_1028054 3300025303 Bacteria 2230
402 Ga0209257_1000011 3300025304 Bacteria 1112630
403 Ga0209257_1000057 3300025304 Bacteria 396985
404 Ga0209257_1000168 3300025304 Bacteria 171312
405 Ga0209257_1000800 3300025304 Bacteria 45909
406 Ga0209257_1005944 3300025304 Bacteria 8198
407 Ga0207697_10005112 3300025315 Bacteria 6141
408 Ga0207656_10017243 3300025321 Bacteria 2825
409 Ga0207656_10027007 3300025321 Bacteria 2345
410 Ga0207656_10027975 3300025321 Bacteria 2310
411 Ga0207655_1001409 3300025728 Bacteria 22356
412 Ga0207682_10005184 3300025893 Bacteria 5335
413 Ga0207642_10057526 3300025899 Bacteria 1789
414 Ga0207688_10008591 3300025901 Bacteria 5560
415 Ga0207688_10060870 3300025901 Bacteria 2128
416 Ga0207647_10001513 3300025904 Bacteria 17873
417 Ga0207685_10040174 3300025905 Bacteria 1742
418 Ga0207645_10029290 3300025907 Bacteria 3550
419 Ga0207643_10011009 3300025908 Bacteria 4881
420 Ga0207643_10039075 3300025908 Bacteria 2669
421 Ga0207643_10223152 3300025908 Bacteria 1154
422 Ga0207705_10000564 3300025909 Bacteria 31096
423 Ga0207705_10014942 3300025909 Bacteria 5582
424 Ga0207707_10002857 3300025912 Bacteria 15425
425 Ga0207695_10023486 3300025913 Bacteria 6964
426 Ga0207695_10479856 3300025913 Bacteria 1126
427 Ga0207693_10195735 3300025915 Bacteria 1590
428 Ga0207663_10036511 3300025916 Bacteria 2957
429 Ga0207660_10001862 3300025917 Bacteria 14055
430 Ga0207660_10034902 3300025917 Bacteria 3489
431 Ga0207662_10013335 3300025918 Bacteria 4596
432 Ga0207662_10209630 3300025918 Bacteria 1264
433 Ga0207657_10016156 3300025919 Bacteria 7206
434 Ga0207657_10022687 3300025919 Bacteria 5865
435 Ga0207649_10012778 3300025920 Bacteria 4670
436 Ga0207649_10049039 3300025920 Bacteria 2606
437 Ga0207649_10157515 3300025920 Bacteria 1570
438 Ga0207652_10000796 3300025921 Bacteria 30107
439 Ga0207681_10005013 3300025923 Bacteria 8136
440 Ga0207681_10039820 3300025923 Bacteria 3123
441 Ga0207681_10061572 3300025923 Bacteria 2581
442 Ga0207681_10085785 3300025923 Bacteria 2235
443 Ga0207681_10433693 3300025923 Bacteria 1066
444 Ga0207694_10063457 3300025924 Bacteria 2878
445 Ga0207694_10209644 3300025924 Bacteria 1587
446 Ga0207650_10064331 3300025925 Bacteria 2745
447 Ga0207650_10119252 3300025925 Bacteria 2052
448 Ga0207659_10135850 3300025926 Bacteria 1903
449 Ga0207687_10231925 3300025927 Bacteria 1458
450 Ga0207644_10076074 3300025931 Bacteria 2468
451 Ga0207644_10086918 3300025931 Bacteria 2322
452 Ga0207706_10006375 3300025933 Bacteria 10957
453 Ga0207706_10009612 3300025933 Bacteria 8875
454 Ga0207706_10013795 3300025933 Bacteria 7333
455 Ga0207706_10021932 3300025933 Bacteria 5732
456 Ga0207706_10022691 3300025933 Bacteria 5634
457 Ga0207706_10201512 3300025933 Bacteria 1746
458 Ga0207709_10000019 3300025935 Bacteria 402225
459 Ga0207709_10000130 3300025935 Bacteria 110843
460 Ga0207709_10002008 3300025935 Bacteria 13202
461 Ga0207709_10027274 3300025935 Bacteria 3288
462 Ga0207670_10085152 3300025936 Bacteria 2221
463 Ga0207669_10032343 3300025937 Bacteria 2936
464 Ga0207704_10054603 3300025938 Bacteria 2436
465 Ga0207704_10058704 3300025938 Bacteria 2370
466 Ga0207691_10108612 3300025940 Bacteria 2469
467 Ga0207691_10138889 3300025940 Bacteria 2142
468 Ga0207691_10194637 3300025940 Bacteria 1767
469 Ga0207691_10361337 3300025940 Bacteria 1241
470 Ga0207711_10024546 3300025941 Bacteria 5053
471 Ga0207711_10083054 3300025941 Bacteria 2801
472 Ga0207689_10000320 3300025942 Bacteria 44520
473 Ga0207689_10021236 3300025942 Bacteria 5458
474 Ga0207689_10266439 3300025942 Bacteria 1418
475 Ga0207661_10232938 3300025944 Bacteria 1631
476 Ga0207679_10056475 3300025945 Bacteria 2898
477 Ga0207679_10130641 3300025945 Bacteria 2014
478 Ga0207679_10172060 3300025945 Bacteria 1784
479 Ga0207679_10287488 3300025945 Bacteria 1412
480 Ga0207679_10476655 3300025945 Unclassified 1110
481 Ga0207667_10042087 3300025949 Bacteria 4858
482 Ga0207667_10048943 3300025949 Bacteria 4467
483 Ga0207667_10153920 3300025949 Bacteria 2366
484 Ga0207667_10216026 3300025949 Bacteria 1965
485 Ga0207651_10153723 3300025960 Bacteria 1795
486 Ga0207651_10182012 3300025960 Bacteria 1668
487 Ga0207712_10048486 3300025961 Bacteria 2955
488 Ga0207712_10092760 3300025961 Bacteria 2227
489 Ga0207668_10042383 3300025972 Bacteria 3082
490 Ga0207668_10061337 3300025972 Bacteria 2644
491 Ga0207668_10144803 3300025972 Bacteria 1832
492 Ga0207640_10006832 3300025981 Bacteria 6272
493 Ga0207640_10079885 3300025981 Bacteria 2231
494 Ga0207640_10180445 3300025981 Bacteria 1582
495 Ga0207640_10182606 3300025981 Bacteria 1574
496 Ga0207640_10339945 3300025981 Bacteria 1202
497 Ga0207658_10046245 3300025986 Bacteria 3177
498 Ga0207658_10062892 3300025986 Bacteria 2779
499 Ga0207658_10079414 3300025986 Bacteria 2510
500 Ga0207658_10167428 3300025986 Bacteria 1807
501 Ga0207677_10049693 3300026023 Bacteria 2832
502 Ga0207677_10052706 3300026023 Bacteria 2765
503 Ga0207677_10528727 3300026023 Bacteria 1024
504 Ga0207703_10377606 3300026035 Bacteria 1310
505 Ga0207639_10059995 3300026041 Bacteria 2933
506 Ga0207639_10093611 3300026041 Bacteria 2410
507 Ga0207639_10102943 3300026041 Bacteria 2312
508 Ga0207678_10020101 3300026067 Bacteria 5865
509 Ga0207678_10031604 3300026067 Bacteria 4617
510 Ga0207708_10008451 3300026075 Bacteria 7621
511 Ga0207708_10025102 3300026075 Bacteria 4507
512 Ga0207708_10026016 3300026075 Bacteria 4427
513 Ga0207708_10040181 3300026075 Bacteria 3566
514 Ga0207708_10051142 3300026075 Bacteria 3145
515 Ga0207702_10063231 3300026078 Bacteria 3164
516 Ga0207702_10483777 3300026078 Bacteria 1205
517 Ga0207641_10255090 3300026088 Bacteria 1640
518 Ga0207648_10001873 3300026089 Bacteria 23008
519 Ga0207648_10017375 3300026089 Bacteria 6546
520 Ga0207648_10018664 3300026089 Bacteria 6275
521 Ga0207648_10021970 3300026089 Bacteria 5732
522 Ga0207648_10385421 3300026089 Bacteria 1268
523 Ga0207648_10483443 3300026089 Bacteria 1131
524 Ga0207676_10003299 3300026095 Bacteria 11461
525 Ga0207676_10013531 3300026095 Bacteria 5858
526 Ga0207676_10266895 3300026095 Bacteria 1548
527 Ga0207674_10011742 3300026116 Bacteria 9828
528 Ga0207674_10070608 3300026116 Bacteria 3511
529 Ga0207674_10180942 3300026116 Bacteria 2059
530 Ga0207674_10272565 3300026116 Bacteria 1640
531 Ga0207675_100003062 3300026118 Bacteria 16396
532 Ga0207675_100007594 3300026118 Bacteria 10243
533 Ga0207675_100011774 3300026118 Bacteria 8177
534 Ga0207675_100013483 3300026118 Bacteria 7626
535 Ga0207675_100019754 3300026118 Bacteria 6288
536 Ga0207675_100052998 3300026118 Bacteria 3785
537 Ga0207675_100085814 3300026118 Bacteria 2955
538 Ga0207683_10112578 3300026121 Bacteria 2437
539 Ga0207683_10226209 3300026121 Bacteria 1705
540 Ga0207683_10334477 3300026121 Bacteria 1388
541 Ga0207698_10017184 3300026142 Bacteria 4900
542 Ga0207698_10195806 3300026142 Bacteria 1805
543 Ga0207698_10520939 3300026142 Bacteria 1160
544 Ga0209281_1000005 3300027111 Bacteria 1242284
545 Ga0209281_1000125 3300027111 Bacteria 200371
546 Ga0209281_1014544 3300027111 Bacteria 1662
547 Ga0209969_1002004 3300027360 Bacteria 2809
548 Ga0209999_1001563 3300027543 Bacteria 3936
549 Ga0209983_1010226 3300027665 Bacteria 1917
550 Ga0209282_1015352 3300027666 Bacteria 4874
551 Ga0209966_1015579 3300027695 Bacteria 1428
552 Ga0209813_10069958 3300027866 Bacteria 1139
553 Ga0207428_10047701 3300027907 Bacteria 3439
554 Ga0268266_10008541 3300028379 Bacteria 9102
555 Ga0268265_10001675 3300028380 Bacteria 18077
556 Ga0268265_10029776 3300028380 Bacteria 3925
557 Ga0268265_10035380 3300028380 Bacteria 3649
558 Ga0268265_10036907 3300028380 Bacteria 3583
559 Ga0268265_10169799 3300028380 Bacteria 1863
560 Ga0268265_10170909 3300028380 Bacteria 1857
561 Ga0268265_10186033 3300028380 Bacteria 1789
562 Ga0268265_10197428 3300028380 Bacteria 1742
563 Ga0268264_10002570 3300028381 Bacteria 15905
564 Ga0268264_10071595 3300028381 Bacteria 2938
565 Ga0265318_10002709 3300028577 Bacteria 9295
566 Ga0307515_10013496 3300028794 Bacteria 15262
567 Ga0307515_10135551 3300028794 Bacteria 2680
568 Ga0307515_10203958 3300028794 Bacteria 1844
569 Ga0316177_1003817 3300030731 Bacteria 7536
570 Ga0316176_1149365 3300030732 Bacteria 4172
571 Ga0314311_1083999 3300030733 Bacteria 4359
572 Ga0316179_1085170 3300030734 Bacteria 2401
573 Ga0316178_1017927 3300030735 Bacteria 3412
574 Ga0316180_1046521 3300030736 Bacteria 2980
575 Ga0316183_1151240 3300030742 Bacteria 10848
576 Ga0316182_1058328 3300030745 Bacteria 1446
577 Ga0316182_1410417 3300030745 Bacteria 2075
578 Ga0265332_10003349 3300031238 Bacteria 7763
579 Ga0265328_10008502 3300031239 Bacteria 4228
580 Ga0265329_10011235 3300031242 Bacteria 3259
581 Ga0265331_10000851 3300031250 Bacteria 24815
582 Ga0265331_10003732 3300031250 Bacteria 9678
583 Ga0265327_10000307 3300031251 Bacteria 95145
584 Ga0265316_10010873 3300031344 Bacteria 8263
585 Ga0307513_10027912 3300031456 Bacteria 6469
586 Ga0307513_10174518 3300031456 Bacteria 2022
587 Ga0307513_10426099 3300031456 Bacteria 1056
588 Ga0307509_10049938 3300031507 Bacteria 4482
589 Ga0307408_100039531 3300031548 Bacteria 3335
590 Ga0307408_100050469 3300031548 Bacteria 2992
591 Ga0307408_100064395 3300031548 Bacteria 2685
592 Ga0307408_100223344 3300031548 Bacteria 1538
593 Ga0307514_10071427 3300031649 Bacteria 2603
594 Ga0265314_10001467 3300031711 Bacteria 26276
595 Ga0307405_10139538 3300031731 Bacteria 1688
596 Ga0307405_10275864 3300031731 Bacteria 1263
597 Ga0307413_10025594 3300031824 Bacteria 3237
598 Ga0307413_10028219 3300031824 Bacteria 3122
599 Ga0307413_10355611 3300031824 Bacteria 1132
600 Ga0307410_10010931 3300031852 Bacteria 5167
601 Ga0307410_10022516 3300031852 Bacteria 3897
602 Ga0307406_10003021 3300031901 Bacteria 9153
603 Ga0307412_10019731 3300031911 Bacteria 4089
604 Ga0307412_10203920 3300031911 Bacteria 1504
605 Ga0307416_100124232 3300032002 Bacteria 2308
606 Ga0307416_100139246 3300032002 Bacteria 2202
607 Ga0307416_100654919 3300032002 Bacteria 1135
608 Ga0307414_10121866 3300032004 Bacteria 2006
609 Ga0307414_10202554 3300032004 Bacteria 1615
610 Ga0307411_10025348 3300032005 Bacteria 3552
611 Ga0307411_10037715 3300032005 Bacteria 3042
612 Ga0307411_10043857 3300032005 Bacteria 2864
613 Ga0307411_10226442 3300032005 Bacteria 1454
614 Ga0307507_10098315 3300033179 Bacteria 2465
615 Ga0373948_0019188 3300034817 Bacteria 1291
616 Ga0373938_0005118 3300034957 Bacteria 2218
617 Ga0373926_0088517 3300035083 Bacteria 1150
618 Ga0373934_0000061 3300035086 Bacteria 37034
619 Ga0373934_0004954 3300035086 Bacteria 4935
620 Ga0373940_0005226 3300035088 Bacteria 2798
621 Ga0373940_0079027 3300035088 Bacteria 970
622 Ga0373951_0005703 3300035091 Bacteria 2882
623 Ga0373941_0004745 3300035115 Bacteria 3160
624 Ga0373941_0037713 3300035115 Bacteria 1476
625 Ga0373945_0016993 3300035116 Bacteria 2462
626 Ga0373956_0000003 3300035119 Bacteria 81669
627 Ga0373956_0049071 3300035119 Bacteria 1892
628 Ga0373957_0006728 3300035120 Bacteria 3638
629 Ga0373943_0163565 3300035170 Bacteria 1213
630 Ga0373931_0006858 3300035691 Bacteria 5354
631 Ga0373931_0030727 3300035691 Bacteria 2768
632 Ga0373935_0049767 3300035692 Bacteria 2657
633 Ga0373927_0033886 3300035695 Bacteria 3323
634 Ga0373933_0000742 3300035724 Bacteria 19915
635 Ga0373947_0118636 3300035725 Bacteria 1679
636 Ga0373937_0000196 3300036401 Bacteria 59256
637 Ga0373937_0150707 3300036401 Bacteria 2178
638 Ga0373937_0153344 3300036401 Bacteria 2159
639 Ga0373925_0081477 3300037068 Bacteria 2461
640 Ga0395900_0081438 3300037418 Bacteria 3326
641 Ga0395898_0007248 3300037466 Bacteria 11769
642 Ga0395905_0030863 3300037471 Bacteria 5047
643 Ga0395905_0050493 3300037471 Bacteria 3896
644 Ga0395901_0027576 3300038443 Bacteria 5837
645 Ga0395901_0053698 3300038443 Bacteria 4187
646 Ga0395901_0225210 3300038443 Bacteria 1959
647 Ga0436361_0931472 3300039447 Bacteria 5962
648 Ga0439466_0054914 3300041411 Bacteria 1296
649 Ga0451807_2059420 3300041486 Bacteria 1608
650 Ga0451843_0974250 3300041509 Bacteria 972
651 Ga0439431_0021016 3300041997 Bacteria 1564
652 Ga0439431_0021376 3300041997 Bacteria 1553
653 Ga0439451_009245 3300042009 Bacteria 1995
654 Ga0450898_008466 3300042134 Bacteria 1624
655 Ga0450908_015792 3300042184 Bacteria 1350
656 Ga0439434_0006693 3300042435 Bacteria 3368
657 Ga0439434_0012979 3300042435 Bacteria 2470
658 Ga0439435_0043938 3300042436 Bacteria 1258
659 Ga0439464_0034703 3300042439 Bacteria 1423
660 Ga0439460_0057314 3300042461 Bacteria 1181
661 Ga0450918_014549 3300042531 Bacteria 1367
662 Ga0451577_0081047 3300042876 Bacteria 2894
663 Ga0453683_0001302 3300044673 Bacteria 22014
664 Ga0453684_0781598 3300044712 Bacteria 1031
665 Ga0451576_0001486 3300045051 Bacteria 39626
666 Ga0451576_0004712 3300045051 Bacteria 17529
667 Ga0451576_0007943 3300045051 Bacteria 12552
668 Ga0451576_0094993 3300045051 Bacteria 3101
669 Ga0451576_0258628 3300045051 Bacteria 1819
670 Ga0495627_012156 3300046453 Bacteria 3065
671 Ga0495592_0163172 3300046454 Bacteria 1531
672 Ga0495590_0002628 3300046457 Bacteria 7428
673 Ga0495629_0079155 3300046459 Bacteria 2295
674 Ga0495629_0166816 3300046459 Bacteria 1529
675 Ga0495651_0000105 3300046462 Bacteria 61688
676 Ga0495651_0012584 3300046462 Bacteria 6530
677 Ga0495653_0016021 3300046463 Bacteria 6109
678 Ga0495580_0022385 3300046472 Bacteria 4651
679 Ga0495580_0194762 3300046472 Bacteria 1397
680 Ga0495639_0032738 3300046475 Bacteria 2319
681 Ga0495662_0028518 3300046476 Bacteria 2694
682 Ga0495594_0059477 3300046499 Bacteria 2113
683 Ga0495608_0122044 3300046511 Bacteria 1670
684 Ga0495610_0037643 3300046512 Bacteria 2460
685 Ga0495616_0032520 3300046513 Bacteria 2724
686 Ga0495618_0012194 3300046514 Bacteria 5217
687 Ga0495620_0024912 3300046515 Bacteria 2839
688 Ga0495620_0029572 3300046515 Bacteria 2533
689 Ga0495628_0155565 3300046516 Bacteria 1739
690 Ga0495630_0002338 3300046517 Bacteria 13181
691 Ga0495631_0000530 3300046518 Bacteria 25592
692 Ga0495632_0038981 3300046519 Bacteria 2402
693 Ga0495652_0037438 3300046529 Bacteria 4209
694 Ga0495654_0090044 3300046530 Bacteria 1425
695 Ga0495665_0013415 3300046531 Bacteria 4430
696 Ga0495640_0072172 3300046533 Bacteria 2313
697 Ga0495587_0081290 3300046536 Bacteria 1877
698 Ga0495667_0128378 3300046559 Bacteria 1635
699 Ga0495634_0066291 3300046642 Bacteria 2390
700 Ga0495625_0000301 3300046660 Bacteria 76108
701 Ga0495625_0255062 3300046660 Bacteria 1137
702 Ga0495588_0101191 3300046674 Bacteria 1514
703 Ga0495657_0017967 3300046675 Bacteria 5127
704 Ga0495657_0047921 3300046675 Bacteria 2886
705 Ga0495647_0024140 3300046681 Bacteria 2211
706 Ga0495658_0020266 3300046683 Bacteria 3486
707 Ga0495658_0103737 3300046683 Bacteria 1701
708 Ga0495669_0040549 3300046684 Bacteria 2065
709 Ga0495669_0122501 3300046684 Bacteria 1220
710 Ga0495670_0061135 3300046691 Bacteria 1893
711 Ga0495671_0027049 3300046692 Bacteria 2966
712 Ga0495600_0002368 3300046809 Bacteria 10773
713 Ga0495674_0009959 3300047319 Bacteria 9014
714 Ga0495672_0081770 3300047320 Bacteria 1798
715 Ga0495676_0001586 3300047321 Bacteria 19725
716 Ga0495680_0101718 3300047322 Bacteria 2140
717 Ga0495675_0006291 3300047444 Bacteria 7268
718 Ga0495593_0027123 3300047673 Bacteria 3155
719 Ga0495614_0005764 3300048089 Bacteria 5577
720 Ga0496100_0067238 3300048903 Bacteria 2379
721 Ga0496101_0017256 3300048904 Bacteria 4894
722 Ga0496101_0034674 3300048904 Bacteria 3566
723 Ga0496102_0007543 3300048905 Bacteria 9299
724 Ga0496102_0123693 3300048905 Bacteria 2417
725 Ga0496102_0406185 3300048905 Bacteria 1280
726 Ga0496104_0095803 3300048907 Bacteria 2839
727 Ga0496105_0039488 3300048908 Bacteria 3890
728 Ga0496105_0134324 3300048908 Bacteria 2039
729 Ga0496106_0040117 3300048909 Bacteria 3505
730 Ga0496106_0045843 3300048909 Bacteria 3285
731 Ga0496107_0040387 3300048910 Bacteria 3349
732 Ga0496109_0050631 3300048912 Bacteria 3782
733 Ga0496109_0407723 3300048912 Bacteria 1284
734 Ga0496110_0111368 3300048913 Bacteria 2460
735 Ga0496110_0498723 3300048913 Bacteria 1108
736 Ga0496111_0067637 3300048914 Bacteria 2595
737 Ga0496114_0003146 3300048917 Bacteria 12674
738 Ga0496114_0070605 3300048917 Bacteria 2934
739 Ga0496114_0376664 3300048917 Bacteria 1256
740 Ga0496115_0013455 3300048918 Bacteria 6190
741 Ga0496116_0011139 3300048919 Bacteria 7476
742 Ga0496117_0005063 3300048920 Bacteria 14119
743 Ga0496117_0022171 3300048920 Bacteria 5099
744 Ga0496118_0019623 3300048921 Bacteria 6034
745 Ga0496118_0070793 3300048921 Bacteria 2515
746 Ga0496119_0166254 3300048922 Bacteria 1168
747 Ga0496121_0084891 3300048924 Bacteria 2494
748 Ga0496121_0140258 3300048924 Bacteria 1794
749 Ga0496122_0001420 3300048925 Bacteria 38777
750 Ga0496122_0022636 3300048925 Bacteria 5578
751 Ga0496123_0000600 3300048926 Bacteria 61187
752 Ga0496123_0027586 3300048926 Bacteria 4226
753 Ga0496123_0114229 3300048926 Bacteria 1536
754 Ga0496124_0040881 3300048927 Bacteria 4006
755 Ga0496124_0071187 3300048927 Bacteria 2883
756 Ga0496124_0077267 3300048927 Bacteria 2746
757 Ga0496125_0061116 3300048928 Bacteria 3023
758 Ga0496125_0072287 3300048928 Bacteria 2688
759 Ga0496126_0251682 3300048929 Bacteria 1472
760 Ga0501031_0004874 3300049568 Bacteria 8725
761 Ga0501032_0015623 3300049569 Bacteria 5353
762 Ga0501032_0099172 3300049569 Bacteria 1930
763 Ga0501033_0004194 3300049570 Bacteria 11601
764 Ga0501034_0010873 3300049571 Bacteria 9453
765 Ga0501034_0061896 3300049571 Bacteria 3758
766 Ga0501036_0000096 3300049572 Bacteria 54442
767 Ga0501036_0038821 3300049572 Bacteria 4031
768 Ga0501036_0093154 3300049572 Bacteria 2545
769 Ga0501036_0109975 3300049572 Bacteria 2329
770 Ga0501037_0004400 3300049573 Bacteria 10237
771 Ga0501037_0042325 3300049573 Bacteria 3347
772 Ga0501037_0085049 3300049573 Bacteria 2290
773 Ga0501038_0000791 3300049574 Bacteria 28037
774 Ga0501038_0010443 3300049574 Bacteria 8493
775 Ga0501038_0084936 3300049574 Bacteria 2663
776 Ga0501038_0369948 3300049574 Unclassified 1113
777 Ga0501038_0442121 3300049574 Bacteria 1001
778 Ga0501039_0008295 3300049575 Bacteria 7917
779 Ga0501039_0026073 3300049575 Bacteria 4493
780 Ga0501039_0033181 3300049575 Bacteria 3982
781 Ga0501039_0080615 3300049575 Bacteria 2533
782 Ga0501040_0000395 3300049576 Bacteria 25703
783 Ga0501040_0013815 3300049576 Bacteria 5315
784 Ga0501040_0105749 3300049576 Bacteria 1966
785 Ga0501040_0122636 3300049576 Bacteria 1824
786 Ga0501040_0239013 3300049576 Bacteria 1294
787 Ga0501041_0000652 3300049577 Bacteria 18234
788 Ga0501041_0010232 3300049577 Bacteria 5528
789 Ga0501041_0042688 3300049577 Bacteria 2756
790 Ga0501041_0176156 3300049577 Bacteria 1339
791 Ga0501041_0220872 3300049577 Bacteria 1189
792 Ga0501042_0003069 3300049578 Bacteria 10402
793 Ga0501042_0005972 3300049578 Bacteria 7885
794 Ga0501042_0074791 3300049578 Bacteria 2424
795 Ga0501043_0023407 3300049579 Bacteria 4845
796 Ga0501043_0142919 3300049579 Bacteria 1873
797 Ga0501046_0000200 3300049580 Bacteria 61991
798 Ga0501047_0002970 3300049581 Bacteria 16081
799 Ga0501047_0105650 3300049581 Bacteria 2696
800 Ga0501047_0112496 3300049581 Bacteria 2604
801 Ga0501048_0004765 3300049582 Bacteria 10333
802 Ga0501048_0022496 3300049582 Bacteria 4610
803 Ga0501048_0039302 3300049582 Bacteria 3395
804 Ga0501048_0090366 3300049582 Bacteria 2160
805 Ga0501048_0147469 3300049582 Bacteria 1664
806 Ga0501067_0011911 3300049583 Bacteria 4818
807 Ga0501068_0010137 3300049584 Bacteria 5286
808 Ga0501068_0028818 3300049584 Bacteria 3286
809 Ga0501068_0032767 3300049584 Bacteria 3090
810 Ga0501068_0180297 3300049584 Bacteria 1335
811 Ga0501069_0010656 3300049585 Bacteria 4872
812 Ga0501070_0000395 3300049586 Bacteria 40067
813 Ga0501070_0006146 3300049586 Bacteria 10239
814 Ga0501070_0103813 3300049586 Bacteria 2350
815 Ga0501071_0001339 3300049587 Bacteria 14072
816 Ga0501071_0003384 3300049587 Bacteria 9959
817 Ga0501071_0007818 3300049587 Bacteria 7051
818 Ga0501071_0008613 3300049587 Bacteria 6742
819 Ga0501071_0041498 3300049587 Bacteria 3295
820 Ga0501071_0174125 3300049587 Bacteria 1611
821 Ga0501072_0000765 3300049588 Bacteria 23435
822 Ga0501072_0002044 3300049588 Bacteria 15013
823 Ga0501072_0029239 3300049588 Bacteria 4303
824 Ga0501072_0029789 3300049588 Bacteria 4265
825 Ga0501072_0048278 3300049588 Bacteria 3352
826 Ga0501072_0120934 3300049588 Bacteria 2086
827 Ga0501073_0002813 3300049589 Bacteria 13024
828 Ga0501073_0003806 3300049589 Bacteria 11331
829 Ga0501073_0037854 3300049589 Bacteria 3424
830 Ga0501074_0002220 3300049590 Bacteria 13466
831 Ga0501074_0007488 3300049590 Bacteria 7897
832 Ga0501074_0021069 3300049590 Bacteria 4734
833 Ga0501074_0051128 3300049590 Bacteria 2983
834 Ga0501074_0162538 3300049590 Bacteria 1595
835 Ga0501074_0176914 3300049590 Bacteria 1523
836 Ga0501074_0274560 3300049590 Bacteria 1198
837 Ga0501075_0000232 3300049591 Bacteria 29854
838 Ga0501075_0093945 3300049591 Bacteria 2276
839 Ga0501075_0098814 3300049591 Bacteria 2216
840 Ga0501075_0168446 3300049591 Bacteria 1671
841 Ga0501076_0002129 3300049592 Bacteria 13587
842 Ga0501076_0005762 3300049592 Bacteria 8931
843 Ga0501076_0048321 3300049592 Bacteria 3363
844 Ga0501076_0051916 3300049592 Bacteria 3246
845 Ga0501076_0059613 3300049592 Bacteria 3036
846 Ga0501076_0200028 3300049592 Bacteria 1631
847 Ga0501076_0447199 3300049592 Bacteria 1064
848 Ga0501077_0004846 3300049593 Bacteria 8174
849 Ga0501077_0087156 3300049593 Bacteria 1979
850 Ga0501077_0121118 3300049593 Bacteria 1658
851 Ga0501077_0303880 3300049593 Bacteria 1016
852 Ga0501079_0000385 3300049741 Bacteria 28427
853 Ga0501079_0003631 3300049741 Bacteria 11359
854 Ga0501079_0031455 3300049741 Bacteria 4079
855 Ga0501080_0000663 3300049742 Bacteria 27344
856 Ga0501080_0003450 3300049742 Bacteria 13954
857 Ga0501080_0016236 3300049742 Bacteria 6873
858 Ga0501080_0066411 3300049742 Bacteria 3354
859 Ga0501080_0091510 3300049742 Bacteria 2825
860 Ga0501080_0140046 3300049742 Bacteria 2237
861 Ga0501080_0182297 3300049742 Bacteria 1932
862 Ga0501080_0208550 3300049742 Bacteria 1791
863 Ga0501081_0002360 3300049743 Bacteria 11890
864 Ga0501081_0081310 3300049743 Bacteria 2269
865 Ga0501081_0176812 3300049743 Bacteria 1543
866 Ga0501083_0031006 3300049744 Bacteria 3670
867 Ga0501083_0051358 3300049744 Bacteria 2773
868 Ga0501083_0083684 3300049744 Bacteria 2113
869 Ga0501262_000019 3300049759 Bacteria 23083
870 Ga0501035_0011489 3300049822 Bacteria 8205
871 Ga0501035_0029066 3300049822 Bacteria 5041
872 Ga0501035_0087952 3300049822 Bacteria 2738
873 Ga0501044_0100778 3300049823 Bacteria 2906
874 Ga0501044_0113506 3300049823 Bacteria 2716
875 Ga0501045_0000087 3300049824 Bacteria 43859
876 Ga0501045_0001611 3300049824 Bacteria 15104
877 Ga0501045_0061952 3300049824 Bacteria 2745
878 nmdc:mga03683_12565_c1 3300050489 Bacteria 3097
879 nmdc:mga03683_44813_c1 3300050489 Bacteria 1829
880 nmdc:mga03683_48867_c1 3300050489 Bacteria 1759
881 nmdc:mga03n38_101880_c1 3300050490 Bacteria 1386
882 nmdc:mga03n38_94249_c1 3300050490 Bacteria 1432
883 nmdc:mga00v17_43064_c1 3300050491 Bacteria 2718
884 nmdc:mga00v17_7571_c1 3300050491 Bacteria 5801
885 nmdc:mga0yw44_178568_c1 3300050492 Bacteria 1396
886 nmdc:mga0yw44_41081_c1 3300050492 Bacteria 2751
887 nmdc:mga0yw44_8270_c1 3300050492 Bacteria 5170
888 nmdc:mga0k408_140243_c1 3300050493 Bacteria 1438
889 nmdc:mga0k408_222030_c1 3300050493 Bacteria 1128
890 nmdc:mga0k408_42947_c1 3300050493 Bacteria 2604
891 nmdc:mga0k408_5475_c1 3300050493 Bacteria 6759
892 nmdc:mga0k408_74029_c1 3300050493 Bacteria 1990
893 nmdc:mga04h51_8520_c1 3300050495 Bacteria 2746
894 nmdc:mga07m45_2775_c1 3300050496 Bacteria 8275
895 nmdc:mga07m45_31312_c1 3300050496 Bacteria 2948
896 nmdc:mga07m45_54575_c1 3300050496 Bacteria 2258
897 nmdc:mga07m45_60505_c1 3300050496 Bacteria 2144
898 nmdc:mga05p37_1073_c1 3300050507 Bacteria 31314
899 nmdc:mga09592_2292_c1 3300050508 Bacteria 15432
900 nmdc:mga09592_231919_c1 3300050508 Bacteria 1600
901 nmdc:mga0qj67_34611_c1 3300050509 Bacteria 3946
902 nmdc:mga06r32_3362_c1 3300050510 Bacteria 14319
903 nmdc:mga08y16_149083_c1 3300050511 Bacteria 2432
904 nmdc:mga08y16_185963_c1 3300050511 Bacteria 2156
905 nmdc:mga08y16_289275_c1 3300050511 Bacteria 1689
906 nmdc:mga08y16_80476_c1 3300050511 Bacteria 3397
907 nmdc:mga0n895_146167_c1 3300050512 Bacteria 2394
908 nmdc:mga0a205_138744_c1 3300050515 Bacteria 2331
909 Ga0495601_0071342 3300053077 Bacteria 2218
910 Ga0500610_0000054 3300053079 Bacteria 36566
911 Ga0500610_0000226 3300053079 Bacteria 17128
912 Ga0495595_0002788 3300053084 Bacteria 6870
913 Ga0495619_0104444 3300053085 Bacteria 1931
914 Ga0495619_0145180 3300053085 Bacteria 1635
915 Ga0500651_0055225 3300053093 Bacteria 2488
916 Ga0500555_030779 3300053103 Bacteria 1522
917 Ga0500562_016884 3300053108 Bacteria 1878
918 Ga0500569_013388 3300053109 Bacteria 2007
919 Ga0500569_025211 3300053109 Bacteria 1617
920 Ga0500571_000117 3300053110 Bacteria 25994
921 Ga0500593_000535 3300053117 Bacteria 14946
922 Ga0500594_0002816 3300053118 Bacteria 3790
923 Ga0500607_001551 3300053121 Bacteria 20371
924 Ga0500608_025912 3300053122 Bacteria 2749
925 Ga0500658_0000018 3300053134 Bacteria 141217
926 Ga0500559_0004905 3300053136 Bacteria 6236
927 Ga0500559_0139303 3300053136 Bacteria 1135
928 Ga0500568_0006939 3300053139 Bacteria 5617
929 Ga0500568_0058483 3300053139 Bacteria 1497
930 Ga0500573_0062433 3300053140 Bacteria 2133
931 Ga0500574_001122 3300053141 Bacteria 3822
932 Ga0500616_0000016 3300053153 Bacteria 627087
933 Ga0500616_0123903 3300053153 Bacteria 1230
934 Ga0500627_0056553 3300053158 Bacteria 1719
935 Ga0500634_0002332 3300053161 Bacteria 7960
936 Ga0500645_034152 3300053730 Bacteria 1519
937 Ga0501084_0004143 3300054114 Bacteria 11816
938 Ga0501084_0013044 3300054114 Bacteria 6878
939 Ga0501084_0027732 3300054114 Bacteria 4732
940 Ga0501084_0028455 3300054114 Bacteria 4671
941 Ga0501084_0047035 3300054114 Bacteria 3613
942 Ga0501084_0105847 3300054114 Bacteria 2363
943 Ga0501082_0010273 3300060353 Bacteria 8059
944 Ga0501082_0078722 3300060353 Bacteria 2843
945 Ga0501082_0104173 3300060353 Bacteria 2454
946 Ga0501082_0179587 3300060353 Bacteria 1841
947 Ga0530510_0000522 3300061734 Bacteria 24577
948 Ga0530510_0004510 3300061734 Bacteria 9639
949 Ga0530510_0044260 3300061734 Bacteria 3216
950 Ga0530510_0080253 3300061734 Bacteria 2374

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048917 Ga0496114_0376664 Ga0496114_0376664_20_805 250
2 3300050492 nmdc:mga0yw44_178568_c1 nmdc:mga0yw44_178568_c1_596_1378 254
3 3300005548 Ga0070665_100379394 Ga0070665_1003793943 259
4 3300035691 Ga0373931_0030727 Ga0373931_0030727_15_836 266
5 3300005354 Ga0070675_100061199 Ga0070675_1000611991 267
6 3300009553 Ga0105249_10019420 Ga0105249_100194207 268
7 3300005564 Ga0070664_100006788 Ga0070664_10000678812 269
8 3300049572 Ga0501036_0093154 Ga0501036_0093154_1716_2534 269
9 3300031911 Ga0307412_10019731 Ga0307412_100197314 271
10 3300046457 Ga0495590_0002628 Ga0495590_0002628_1407_2360 271
11 3300049593 Ga0501077_0303880 Ga0501077_0303880_52_873 271
12 3300053153 Ga0500616_0000016 Ga0500616_0000016_422266_423216 271
13 3300005834 Ga0068851_10000887 Ga0068851_1000088711 272
14 3300006237 Ga0097621_100266562 Ga0097621_1002665622 272
15 3300009177 Ga0105248_10085062 Ga0105248_100850622 272
16 3300025945 Ga0207679_10172060 Ga0207679_101720603 272
17 3300025961 Ga0207712_10048486 Ga0207712_100484864 272
18 3300028380 Ga0268265_10169799 Ga0268265_101697993 272
19 3300048908 Ga0496105_0134324 Ga0496105_0134324_546_1478 272
20 3300005548 Ga0070665_100063885 Ga0070665_1000638853 273
21 3300028379 Ga0268266_10008541 Ga0268266_100085418 273
22 3300005616 Ga0068852_100079314 Ga0068852_1000793144 274
23 3300006358 Ga0068871_100237416 Ga0068871_1002374162 274
24 3300026023 Ga0207677_10049693 Ga0207677_100496934 274
25 3300026142 Ga0207698_10017184 Ga0207698_100171844 274
26 3300048907 Ga0496104_0095803 Ga0496104_0095803_698_1630 274
27 3300003323 rootH1_10001255 rootH1_100012553 275
28 3300050493 nmdc:mga0k408_222030_c1 nmdc:mga0k408_222030_c1_280_1116 275
29 3300005345 Ga0070692_10009202 Ga0070692_100092024 276
30 3300005535 Ga0070684_100048491 Ga0070684_1000484913 276
31 3300005539 Ga0068853_100044387 Ga0068853_1000443874 276
32 3300005546 Ga0070696_100030340 Ga0070696_1000303404 276
33 3300005578 Ga0068854_100028929 Ga0068854_1000289293 276
34 3300005616 Ga0068852_100547294 Ga0068852_1005472942 276
35 3300005834 Ga0068851_10040615 Ga0068851_100406152 276
36 3300020070 Ga0206356_11540035 Ga0206356_115400354 276
37 3300020081 Ga0206354_10006232 Ga0206354_100062323 276
38 3300020082 Ga0206353_11382456 Ga0206353_113824563 276
39 3300025909 Ga0207705_10000564 Ga0207705_100005644 276
40 3300025909 Ga0207705_10014942 Ga0207705_100149424 276
41 3300025919 Ga0207657_10022687 Ga0207657_100226873 276
42 3300025920 Ga0207649_10012778 Ga0207649_100127784 276
43 3300025924 Ga0207694_10063457 Ga0207694_100634574 276
44 3300025949 Ga0207667_10048943 Ga0207667_100489433 276
45 3300026142 Ga0207698_10520939 Ga0207698_105209392 276
46 3300031731 Ga0307405_10139538 Ga0307405_101395381 276
47 3300031911 Ga0307412_10203920 Ga0307412_102039203 276
48 3300032002 Ga0307416_100139246 Ga0307416_1001392462 276
49 3300041411 Ga0439466_0054914 Ga0439466_0054914_35_874 276
50 3300042435 Ga0439434_0012979 Ga0439434_0012979_1588_2427 276
51 3300032005 Ga0307411_10025348 Ga0307411_100253482 277
52 3300041997 Ga0439431_0021016 Ga0439431_0021016_79_984 278
53 3300053109 Ga0500569_025211 Ga0500569_025211_563_1426 278
54 3300006846 Ga0075430_100187475 Ga0075430_1001874753 279
55 3300026089 Ga0207648_10385421 Ga0207648_103854212 279
56 3300031548 Ga0307408_100223344 Ga0307408_1002233442 279
57 3300031824 Ga0307413_10355611 Ga0307413_103556112 279
58 3300032002 Ga0307416_100654919 Ga0307416_1006549192 279
59 3300032005 Ga0307411_10226442 Ga0307411_102264422 279
60 3300035115 Ga0373941_0037713 Ga0373941_0037713_373_1263 279
61 3300042009 Ga0439451_009245 Ga0439451_009245_999_1892 279
62 3300042436 Ga0439435_0043938 Ga0439435_0043938_174_1067 279
63 3300042461 Ga0439460_0057314 Ga0439460_0057314_145_1038 279
64 3300049573 Ga0501037_0085049 Ga0501037_0085049_1155_2048 279
65 3300049575 Ga0501039_0033181 Ga0501039_0033181_1825_2718 279
66 3300049576 Ga0501040_0013815 Ga0501040_0013815_1242_2135 279
67 3300049576 Ga0501040_0239013 Ga0501040_0239013_128_1021 279
68 3300049577 Ga0501041_0042688 Ga0501041_0042688_37_930 279
69 3300049578 Ga0501042_0074791 Ga0501042_0074791_584_1477 279
70 3300049582 Ga0501048_0090366 Ga0501048_0090366_67_960 279
71 3300049584 Ga0501068_0028818 Ga0501068_0028818_1076_1969 279
72 3300049588 Ga0501072_0002044 Ga0501072_0002044_13042_13935 279
73 3300049592 Ga0501076_0048321 Ga0501076_0048321_1287_2180 279
74 3300049593 Ga0501077_0087156 Ga0501077_0087156_536_1429 279
75 3300049741 Ga0501079_0031455 Ga0501079_0031455_83_976 279
76 3300049742 Ga0501080_0208550 Ga0501080_0208550_755_1648 279
77 3300050509 nmdc:mga0qj67_34611_c1 nmdc:mga0qj67_34611_c1_1331_2221 279
78 3300054114 Ga0501084_0047035 Ga0501084_0047035_1710_2603 279
79 3300061734 Ga0530510_0000522 Ga0530510_0000522_17918_18811 279
80 3300049590 Ga0501074_0176914 Ga0501074_0176914_249_1142 280
81 3300053153 Ga0500616_0123903 Ga0500616_0123903_333_1220 280
82 3300003322 rootL2_10068905 rootL2_100689052 281
83 3300005718 Ga0068866_10133214 Ga0068866_101332143 281
84 3300005843 Ga0068860_100258889 Ga0068860_1002588893 281
85 3300005937 Ga0081455_10004596 Ga0081455_1000459616 281
86 3300026075 Ga0207708_10008451 Ga0207708_100084518 281
87 3300026089 Ga0207648_10483443 Ga0207648_104834432 281
88 3300027665 Ga0209983_1010226 Ga0209983_10102262 281
89 3300041509 Ga0451843_0974250 Ga0451843_0974250_74_955 281
90 3300045051 Ga0451576_0258628 Ga0451576_0258628_364_1260 281
91 3300005330 Ga0070690_100049876 Ga0070690_1000498763 282
92 3300005334 Ga0068869_100000492 Ga0068869_10000049216 282
93 3300005340 Ga0070689_100004687 Ga0070689_1000046877 282
94 3300005343 Ga0070687_100047149 Ga0070687_1000471494 282
95 3300005343 Ga0070687_100141589 Ga0070687_1001415892 282
96 3300005347 Ga0070668_100153802 Ga0070668_1001538021 282
97 3300005354 Ga0070675_100039354 Ga0070675_1000393544 282
98 3300005364 Ga0070673_100060985 Ga0070673_1000609852 282
99 3300005367 Ga0070667_100193288 Ga0070667_1001932882 282
100 3300005438 Ga0070701_10112285 Ga0070701_101122853 282
101 3300005440 Ga0070705_100025083 Ga0070705_1000250832 282
102 3300005444 Ga0070694_100272365 Ga0070694_1002723652 282
103 3300005456 Ga0070678_100028455 Ga0070678_1000284553 282
104 3300005459 Ga0068867_100015366 Ga0068867_1000153664 282
105 3300005544 Ga0070686_100085535 Ga0070686_1000855352 282
106 3300005545 Ga0070695_100237242 Ga0070695_1002372422 282
107 3300005548 Ga0070665_100028940 Ga0070665_1000289406 282
108 3300005549 Ga0070704_100515035 Ga0070704_1005150351 282
109 3300005577 Ga0068857_100308872 Ga0068857_1003088723 282
110 3300005617 Ga0068859_100004203 Ga0068859_1000042037 282
111 3300005617 Ga0068859_100043409 Ga0068859_1000434093 282
112 3300005617 Ga0068859_100050306 Ga0068859_1000503064 282
113 3300005618 Ga0068864_100045634 Ga0068864_1000456344 282
114 3300005618 Ga0068864_100110129 Ga0068864_1001101292 282
115 3300005718 Ga0068866_10047154 Ga0068866_100471543 282
116 3300005719 Ga0068861_100011901 Ga0068861_1000119015 282
117 3300005841 Ga0068863_100083400 Ga0068863_1000834003 282
118 3300005842 Ga0068858_100019496 Ga0068858_1000194966 282
119 3300005844 Ga0068862_100078130 Ga0068862_1000781303 282
120 3300005844 Ga0068862_100084729 Ga0068862_1000847293 282
121 3300005844 Ga0068862_100222858 Ga0068862_1002228583 282
122 3300006237 Ga0097621_100003378 Ga0097621_1000033789 282
123 3300006358 Ga0068871_100009301 Ga0068871_1000093017 282
124 3300006844 Ga0075428_100385212 Ga0075428_1003852122 282
125 3300006847 Ga0075431_100003705 Ga0075431_10000370512 282
126 3300006880 Ga0075429_100000326 Ga0075429_10000032623 282
127 3300006931 Ga0097620_100004203 Ga0097620_10000420310 282
128 3300006931 Ga0097620_100043409 Ga0097620_1000434094 282
129 3300006931 Ga0097620_100050306 Ga0097620_1000503064 282
130 3300009094 Ga0111539_10256613 Ga0111539_102566132 282
131 3300009147 Ga0114129_10008954 Ga0114129_100089546 282
132 3300009177 Ga0105248_10005948 Ga0105248_100059487 282
133 3300009553 Ga0105249_10193650 Ga0105249_101936504 282
134 3300009553 Ga0105249_10227041 Ga0105249_102270413 282
135 3300010375 Ga0105239_10353288 Ga0105239_103532883 282
136 3300011119 Ga0105246_10050913 Ga0105246_100509133 282
137 3300013306 Ga0163162_10087528 Ga0163162_100875283 282
138 3300013308 Ga0157375_10005919 Ga0157375_100059197 282
139 3300014969 Ga0157376_10079140 Ga0157376_100791404 282
140 3300025907 Ga0207645_10029290 Ga0207645_100292905 282
141 3300025918 Ga0207662_10013335 Ga0207662_100133355 282
142 3300025925 Ga0207650_10119252 Ga0207650_101192523 282
143 3300025940 Ga0207691_10108612 Ga0207691_101086123 282
144 3300025941 Ga0207711_10024546 Ga0207711_100245466 282
145 3300025942 Ga0207689_10000320 Ga0207689_1000032025 282
146 3300025981 Ga0207640_10180445 Ga0207640_101804453 282
147 3300025981 Ga0207640_10339945 Ga0207640_103399452 282
148 3300025986 Ga0207658_10167428 Ga0207658_101674283 282
149 3300026075 Ga0207708_10025102 Ga0207708_100251024 282
150 3300026089 Ga0207648_10017375 Ga0207648_100173755 282
151 3300026095 Ga0207676_10013531 Ga0207676_100135313 282
152 3300026116 Ga0207674_10272565 Ga0207674_102725653 282
153 3300026118 Ga0207675_100013483 Ga0207675_1000134835 282
154 3300026118 Ga0207675_100019754 Ga0207675_1000197547 282
155 3300027695 Ga0209966_1015579 Ga0209966_10155793 282
156 3300028380 Ga0268265_10035380 Ga0268265_100353803 282
157 3300028380 Ga0268265_10170909 Ga0268265_101709091 282
158 3300028380 Ga0268265_10186033 Ga0268265_101860333 282
159 3300035086 Ga0373934_0004954 Ga0373934_0004954_3816_4739 282
160 3300035119 Ga0373956_0049071 Ga0373956_0049071_583_1506 282
161 3300035692 Ga0373935_0049767 Ga0373935_0049767_266_1189 282
162 3300041997 Ga0439431_0021376 Ga0439431_0021376_291_1202 282
163 3300046684 Ga0495669_0040549 Ga0495669_0040549_152_1051 282
164 3300049569 Ga0501032_0015623 Ga0501032_0015623_2268_3176 282
165 3300049571 Ga0501034_0010873 Ga0501034_0010873_6460_7368 282
166 3300049574 Ga0501038_0010443 Ga0501038_0010443_7133_8041 282
167 3300049574 Ga0501038_0084936 Ga0501038_0084936_973_1881 282
168 3300049574 Ga0501038_0369948 Ga0501038_0369948_71_979 282
169 3300049579 Ga0501043_0142919 Ga0501043_0142919_777_1685 282
170 3300049581 Ga0501047_0112496 Ga0501047_0112496_189_1097 282
171 3300049582 Ga0501048_0039302 Ga0501048_0039302_312_1220 282
172 3300049583 Ga0501067_0011911 Ga0501067_0011911_2657_3565 282
173 3300049584 Ga0501068_0032767 Ga0501068_0032767_2086_2994 282
174 3300049586 Ga0501070_0103813 Ga0501070_0103813_365_1273 282
175 3300049587 Ga0501071_0007818 Ga0501071_0007818_1442_2350 282
176 3300049590 Ga0501074_0007488 Ga0501074_0007488_2073_2981 282
177 3300049592 Ga0501076_0200028 Ga0501076_0200028_142_1050 282
178 3300049742 Ga0501080_0066411 Ga0501080_0066411_884_1792 282
179 3300049743 Ga0501081_0081310 Ga0501081_0081310_853_1761 282
180 3300049744 Ga0501083_0083684 Ga0501083_0083684_128_1036 282
181 3300049822 Ga0501035_0011489 Ga0501035_0011489_2919_3827 282
182 3300049823 Ga0501044_0113506 Ga0501044_0113506_714_1622 282
183 3300050507 nmdc:mga05p37_1073_c1 nmdc:mga05p37_1073_c1_856_1767 282
184 3300050508 nmdc:mga09592_2292_c1 nmdc:mga09592_2292_c1_3100_4011 282
185 3300050510 nmdc:mga06r32_3362_c1 nmdc:mga06r32_3362_c1_10294_11205 282
186 3300050511 nmdc:mga08y16_185963_c1 nmdc:mga08y16_185963_c1_644_1549 282
187 3300053085 Ga0495619_0104444 Ga0495619_0104444_833_1741 282
188 3300053093 Ga0500651_0055225 Ga0500651_0055225_83_988 282
189 3300054114 Ga0501084_0013044 Ga0501084_0013044_1019_1927 282
190 3300060353 Ga0501082_0078722 Ga0501082_0078722_1107_2015 282
191 3300003187 JGI25151J46595_10000716 JGI25151J46595_100007163 283
192 3300003187 JGI25151J46595_10003350 JGI25151J46595_100033508 283
193 3300003781 Ga0055536_1001741 Ga0055536_100174113 283
194 3300003792 Ga0055540_1000092 Ga0055540_10000923 283
195 3300003794 Ga0055531_10000724 Ga0055531_1000072427 283
196 3300005295 Ga0065707_10012023 Ga0065707_100120232 283
197 3300005329 Ga0070683_100033036 Ga0070683_1000330364 283
198 3300005335 Ga0070666_10020164 Ga0070666_100201641 283
199 3300005336 Ga0070680_100213155 Ga0070680_1002131552 283
200 3300005338 Ga0068868_100178496 Ga0068868_1001784963 283
201 3300005344 Ga0070661_100102779 Ga0070661_1001027793 283
202 3300005345 Ga0070692_10011876 Ga0070692_100118765 283
203 3300005353 Ga0070669_100010896 Ga0070669_1000108966 283
204 3300005354 Ga0070675_100012028 Ga0070675_10001202812 283
205 3300005356 Ga0070674_100040024 Ga0070674_1000400242 283
206 3300005367 Ga0070667_100010104 Ga0070667_1000101047 283
207 3300005439 Ga0070711_100169475 Ga0070711_1001694753 283
208 3300005441 Ga0070700_100007776 Ga0070700_1000077765 283
209 3300005441 Ga0070700_100076427 Ga0070700_1000764274 283
210 3300005444 Ga0070694_100203846 Ga0070694_1002038462 283
211 3300005459 Ga0068867_100008503 Ga0068867_1000085035 283
212 3300005471 Ga0070698_100010835 Ga0070698_10001083510 283
213 3300005543 Ga0070672_100157007 Ga0070672_1001570072 283
214 3300005545 Ga0070695_100108487 Ga0070695_1001084873 283
215 3300005548 Ga0070665_100524979 Ga0070665_1005249792 283
216 3300005549 Ga0070704_100254762 Ga0070704_1002547622 283
217 3300005564 Ga0070664_100206428 Ga0070664_1002064283 283
218 3300005577 Ga0068857_100249894 Ga0068857_1002498943 283
219 3300005578 Ga0068854_100179204 Ga0068854_1001792042 283
220 3300005614 Ga0068856_100101536 Ga0068856_1001015363 283
221 3300005614 Ga0068856_100529772 Ga0068856_1005297722 283
222 3300005616 Ga0068852_100023333 Ga0068852_1000233334 283
223 3300005616 Ga0068852_100128838 Ga0068852_1001288383 283
224 3300005617 Ga0068859_100275563 Ga0068859_1002755633 283
225 3300005618 Ga0068864_100223152 Ga0068864_1002231523 283
226 3300005718 Ga0068866_10006875 Ga0068866_100068752 283
227 3300005834 Ga0068851_10011672 Ga0068851_100116725 283
228 3300005842 Ga0068858_100099246 Ga0068858_1000992463 283
229 3300005843 Ga0068860_100042170 Ga0068860_1000421703 283
230 3300005844 Ga0068862_100001127 Ga0068862_10000112725 283
231 3300006175 Ga0070712_100133261 Ga0070712_1001332613 283
232 3300006178 Ga0075367_10135901 Ga0075367_101359012 283
233 3300006353 Ga0075370_10012403 Ga0075370_100124035 283
234 3300006358 Ga0068871_100008412 Ga0068871_1000084127 283
235 3300006358 Ga0068871_100095942 Ga0068871_1000959424 283
236 3300006871 Ga0075434_100163554 Ga0075434_1001635541 283
237 3300006931 Ga0097620_100275574 Ga0097620_1002755743 283
238 3300009094 Ga0111539_10170865 Ga0111539_101708654 283
239 3300009101 Ga0105247_10399477 Ga0105247_103994771 283
240 3300009148 Ga0105243_10004141 Ga0105243_100041413 283
241 3300009148 Ga0105243_10052781 Ga0105243_100527814 283
242 3300009174 Ga0105241_10316107 Ga0105241_103161073 283
243 3300009545 Ga0105237_10007850 Ga0105237_100078506 283
244 3300009551 Ga0105238_10043722 Ga0105238_100437225 283
245 3300009551 Ga0105238_10174661 Ga0105238_101746613 283
246 3300009553 Ga0105249_10040550 Ga0105249_100405504 283
247 3300010375 Ga0105239_10043053 Ga0105239_100430534 283
248 3300010375 Ga0105239_10295740 Ga0105239_102957401 283
249 3300011119 Ga0105246_10221659 Ga0105246_102216592 283
250 3300013296 Ga0157374_10091172 Ga0157374_100911722 283
251 3300013306 Ga0163162_10124232 Ga0163162_101242324 283
252 3300013307 Ga0157372_10004902 Ga0157372_1000490213 283
253 3300013308 Ga0157375_10726370 Ga0157375_107263702 283
254 3300014325 Ga0163163_10034424 Ga0163163_100344245 283
255 3300014326 Ga0157380_10002488 Ga0157380_100024883 283
256 3300014745 Ga0157377_10248550 Ga0157377_102485501 283
257 3300015261 Ga0182006_1074943 Ga0182006_10749432 283
258 3300017792 Ga0163161_10000441 Ga0163161_1000044112 283
259 3300025292 Ga0209676_1000123 Ga0209676_100012345 283
260 3300025294 Ga0209025_1000104 Ga0209025_100010462 283
261 3300025298 Ga0209050_1000188 Ga0209050_10001888 283
262 3300025303 Ga0209051_1000091 Ga0209051_100009145 283
263 3300025304 Ga0209257_1000057 Ga0209257_10000573 283
264 3300025321 Ga0207656_10027975 Ga0207656_100279753 283
265 3300025901 Ga0207688_10060870 Ga0207688_100608701 283
266 3300025915 Ga0207693_10195735 Ga0207693_101957353 283
267 3300025916 Ga0207663_10036511 Ga0207663_100365114 283
268 3300025917 Ga0207660_10034902 Ga0207660_100349023 283
269 3300025920 Ga0207649_10157515 Ga0207649_101575153 283
270 3300025923 Ga0207681_10005013 Ga0207681_100050137 283
271 3300025924 Ga0207694_10209644 Ga0207694_102096443 283
272 3300025926 Ga0207659_10135850 Ga0207659_101358501 283
273 3300025935 Ga0207709_10027274 Ga0207709_100272744 283
274 3300025937 Ga0207669_10032343 Ga0207669_100323434 283
275 3300025938 Ga0207704_10054603 Ga0207704_100546032 283
276 3300025961 Ga0207712_10092760 Ga0207712_100927602 283
277 3300025972 Ga0207668_10061337 Ga0207668_100613374 283
278 3300026041 Ga0207639_10093611 Ga0207639_100936111 283
279 3300026067 Ga0207678_10031604 Ga0207678_100316043 283
280 3300026075 Ga0207708_10051142 Ga0207708_100511423 283
281 3300026078 Ga0207702_10483777 Ga0207702_104837772 283
282 3300026089 Ga0207648_10018664 Ga0207648_100186646 283
283 3300026095 Ga0207676_10266895 Ga0207676_102668953 283
284 3300026116 Ga0207674_10070608 Ga0207674_100706085 283
285 3300026116 Ga0207674_10180942 Ga0207674_101809422 283
286 3300026118 Ga0207675_100007594 Ga0207675_1000075946 283
287 3300026142 Ga0207698_10195806 Ga0207698_101958063 283
288 3300028380 Ga0268265_10001675 Ga0268265_100016759 283
289 3300028381 Ga0268264_10071595 Ga0268264_100715952 283
290 3300028794 Ga0307515_10203958 Ga0307515_102039583 283
291 3300033179 Ga0307507_10098315 Ga0307507_100983153 283
292 3300034817 Ga0373948_0019188 Ga0373948_0019188_93_995 283
293 3300034957 Ga0373938_0005118 Ga0373938_0005118_742_1644 283
294 3300035088 Ga0373940_0005226 Ga0373940_0005226_1242_2144 283
295 3300035088 Ga0373940_0079027 Ga0373940_0079027_46_948 283
296 3300035091 Ga0373951_0005703 Ga0373951_0005703_552_1454 283
297 3300035115 Ga0373941_0004745 Ga0373941_0004745_38_940 283
298 3300035691 Ga0373931_0006858 Ga0373931_0006858_2970_3872 283
299 3300035695 Ga0373927_0033886 Ga0373927_0033886_1745_2671 283
300 3300045051 Ga0451576_0094993 Ga0451576_0094993_548_1465 283
301 3300046453 Ga0495627_012156 Ga0495627_012156_673_1587 283
302 3300046454 Ga0495592_0163172 Ga0495592_0163172_594_1520 283
303 3300046462 Ga0495651_0012584 Ga0495651_0012584_274_1200 283
304 3300046463 Ga0495653_0016021 Ga0495653_0016021_3111_4037 283
305 3300046472 Ga0495580_0194762 Ga0495580_0194762_322_1248 283
306 3300046476 Ga0495662_0028518 Ga0495662_0028518_201_1127 283
307 3300046499 Ga0495594_0059477 Ga0495594_0059477_564_1490 283
308 3300046511 Ga0495608_0122044 Ga0495608_0122044_223_1149 283
309 3300046514 Ga0495618_0012194 Ga0495618_0012194_3082_4008 283
310 3300046515 Ga0495620_0024912 Ga0495620_0024912_779_1693 283
311 3300046516 Ga0495628_0155565 Ga0495628_0155565_493_1419 283
312 3300046517 Ga0495630_0002338 Ga0495630_0002338_5774_6700 283
313 3300046529 Ga0495652_0037438 Ga0495652_0037438_1625_2551 283
314 3300046531 Ga0495665_0013415 Ga0495665_0013415_1242_2168 283
315 3300046533 Ga0495640_0072172 Ga0495640_0072172_1210_2136 283
316 3300046536 Ga0495587_0081290 Ga0495587_0081290_771_1697 283
317 3300046559 Ga0495667_0128378 Ga0495667_0128378_594_1520 283
318 3300046642 Ga0495634_0066291 Ga0495634_0066291_1300_2226 283
319 3300046660 Ga0495625_0255062 Ga0495625_0255062_17_931 283
320 3300046675 Ga0495657_0017967 Ga0495657_0017967_593_1519 283
321 3300046681 Ga0495647_0024140 Ga0495647_0024140_322_1248 283
322 3300046683 Ga0495658_0020266 Ga0495658_0020266_2396_3322 283
323 3300046691 Ga0495670_0061135 Ga0495670_0061135_345_1259 283
324 3300046692 Ga0495671_0027049 Ga0495671_0027049_723_1637 283
325 3300046809 Ga0495600_0002368 Ga0495600_0002368_1320_2246 283
326 3300047319 Ga0495674_0009959 Ga0495674_0009959_594_1520 283
327 3300047322 Ga0495680_0101718 Ga0495680_0101718_621_1547 283
328 3300047444 Ga0495675_0006291 Ga0495675_0006291_4980_5906 283
329 3300048918 Ga0496115_0013455 Ga0496115_0013455_4382_5290 283
330 3300049572 Ga0501036_0109975 Ga0501036_0109975_399_1310 283
331 3300049574 Ga0501038_0442121 Ga0501038_0442121_62_973 283
332 3300049576 Ga0501040_0122636 Ga0501040_0122636_783_1718 283
333 3300049588 Ga0501072_0120934 Ga0501072_0120934_1017_1919 283
334 3300049590 Ga0501074_0162538 Ga0501074_0162538_323_1234 283
335 3300050492 nmdc:mga0yw44_41081_c1 nmdc:mga0yw44_41081_c1_1281_2354 283
336 3300050496 nmdc:mga07m45_2775_c1 nmdc:mga07m45_2775_c1_2379_3293 283
337 3300050508 nmdc:mga09592_231919_c1 nmdc:mga09592_231919_c1_635_1540 283
338 3300050511 nmdc:mga08y16_80476_c1 nmdc:mga08y16_80476_c1_1029_1931 283
339 3300050512 nmdc:mga0n895_146167_c1 nmdc:mga0n895_146167_c1_1286_2203 283
340 3300050515 nmdc:mga0a205_138744_c1 nmdc:mga0a205_138744_c1_527_1444 283
341 3300053077 Ga0495601_0071342 Ga0495601_0071342_769_1695 283
342 3300053079 Ga0500610_0000054 Ga0500610_0000054_35635_36549 283
343 3300053079 Ga0500610_0000226 Ga0500610_0000226_18_932 283
344 3300053084 Ga0495595_0002788 Ga0495595_0002788_1541_2467 283
345 3300053085 Ga0495619_0145180 Ga0495619_0145180_116_1042 283
346 3300053103 Ga0500555_030779 Ga0500555_030779_450_1364 283
347 3300053109 Ga0500569_013388 Ga0500569_013388_711_1625 283
348 3300053117 Ga0500593_000535 Ga0500593_000535_12799_13713 283
349 3300053121 Ga0500607_001551 Ga0500607_001551_1064_1984 283
350 3300053136 Ga0500559_0004905 Ga0500559_0004905_4864_5772 283
351 3300053136 Ga0500559_0139303 Ga0500559_0139303_209_1117 283
352 3300053139 Ga0500568_0006939 Ga0500568_0006939_1424_2335 283
353 3300053140 Ga0500573_0062433 Ga0500573_0062433_360_1268 283
354 3300053141 Ga0500574_001122 Ga0500574_001122_2541_3461 283
355 3300053158 Ga0500627_0056553 Ga0500627_0056553_321_1235 283
356 3300053161 Ga0500634_0002332 Ga0500634_0002332_6135_7049 283
357 3300053730 Ga0500645_034152 Ga0500645_034152_175_1089 283
358 iso_pu_bacteria 2643221672 2644399638 283
359 3300001979 JGI24740J21852_10014817 JGI24740J21852_100148174 284
360 3300001989 JGI24739J22299_10019684 JGI24739J22299_100196844 284
361 3300002773 JGI25152J39213_1000159 JGI25152J39213_100015947 284
362 3300002773 JGI25152J39213_1003485 JGI25152J39213_10034854 284
363 3300002774 JGI25150J39212_1001644 JGI25150J39212_10016442 284
364 3300002774 JGI25150J39212_1005296 JGI25150J39212_10052964 284
365 3300002987 JGI25159J45721_1012146 JGI25159J45721_10121462 284
366 3300003187 JGI25151J46595_10000384 JGI25151J46595_1000038447 284
367 3300003215 JGI25153J46596_10000243 JGI25153J46596_1000024347 284
368 3300003354 JGI25160J50197_1000275 JGI25160J50197_10002753 284
369 3300003374 JGI25161J50226_1005011 JGI25161J50226_10050112 284
370 3300003760 Ga0055527_1005055 Ga0055527_10050553 284
371 3300003761 Ga0055535_1000115 Ga0055535_100011548 284
372 3300003762 Ga0055542_1000028 Ga0055542_1000028115 284
373 3300003771 Ga0055526_1000245 Ga0055526_10002453 284
374 3300003771 Ga0055526_1000676 Ga0055526_100067627 284
375 3300003773 Ga0055537_1000192 Ga0055537_10001923 284
376 3300003773 Ga0055537_1008083 Ga0055537_10080833 284
377 3300003775 Ga0055524_1000312 Ga0055524_10003123 284
378 3300003775 Ga0055524_1004329 Ga0055524_10043297 284
379 3300003781 Ga0055536_1000396 Ga0055536_10003963 284
380 3300003784 Ga0055534_1000183 Ga0055534_10001833 284
381 3300003790 Ga0055528_1000245 Ga0055528_10002453 284
382 3300003790 Ga0055528_1018126 Ga0055528_10181263 284
383 3300003791 Ga0055530_10000086 Ga0055530_100000864 284
384 3300003792 Ga0055540_1000520 Ga0055540_10005203 284
385 3300003794 Ga0055531_10000672 Ga0055531_100006723 284
386 3300003794 Ga0055531_10016047 Ga0055531_100160473 284
387 3300004625 Ga0055543_1009429 Ga0055543_10094292 284
388 3300004625 Ga0055543_1009518 Ga0055543_10095182 284
389 3300005262 Ga0065165_1001483 Ga0065165_100148326 284
390 3300005289 Ga0065704_10085211 Ga0065704_100852114 284
391 3300005347 Ga0070668_100023702 Ga0070668_1000237026 284
392 3300005353 Ga0070669_100048201 Ga0070669_1000482013 284
393 3300005441 Ga0070700_100024533 Ga0070700_1000245334 284
394 3300005539 Ga0068853_100024738 Ga0068853_1000247384 284
395 3300005545 Ga0070695_100148116 Ga0070695_1001481163 284
396 3300005577 Ga0068857_100279368 Ga0068857_1002793682 284
397 3300005617 Ga0068859_100344889 Ga0068859_1003448893 284
398 3300005719 Ga0068861_100000457 Ga0068861_10000045719 284
399 3300005834 Ga0068851_10013697 Ga0068851_100136974 284
400 3300005843 Ga0068860_100000685 Ga0068860_10000068533 284
401 3300005844 Ga0068862_100003177 Ga0068862_1000031779 284
402 3300006042 Ga0075368_10009041 Ga0075368_100090412 284
403 3300006048 Ga0075363_100007021 Ga0075363_1000070214 284
404 3300006051 Ga0075364_10052287 Ga0075364_100522872 284
405 3300006177 Ga0075362_10010930 Ga0075362_100109304 284
406 3300006186 Ga0075369_10005152 Ga0075369_100051522 284
407 3300006195 Ga0075366_10003336 Ga0075366_100033366 284
408 3300006881 Ga0068865_100097311 Ga0068865_1000973112 284
409 3300006931 Ga0097620_100344868 Ga0097620_1003448682 284
410 3300006946 Ga0079104_1000034 Ga0079104_1000034173 284
411 3300009148 Ga0105243_10006138 Ga0105243_100061383 284
412 3300009148 Ga0105243_10207747 Ga0105243_102077473 284
413 3300013306 Ga0163162_10002995 Ga0163162_100029954 284
414 3300014326 Ga0157380_10058210 Ga0157380_100582102 284
415 3300014497 Ga0182008_10000536 Ga0182008_1000053632 284
416 3300017792 Ga0163161_10007311 Ga0163161_100073118 284
417 3300025208 Ga0209436_105137 Ga0209436_1051373 284
418 3300025208 Ga0209436_111871 Ga0209436_1118712 284
419 3300025228 Ga0209672_101025 Ga0209672_1010253 284
420 3300025229 Ga0209147_100906 Ga0209147_10090612 284
421 3300025242 Ga0209258_100067 Ga0209258_100067138 284
422 3300025245 Ga0207425_1000213 Ga0207425_100021348 284
423 3300025245 Ga0207425_1002332 Ga0207425_10023323 284
424 3300025254 Ga0209148_1000067 Ga0209148_1000067181 284
425 3300025258 Ga0209129_1000296 Ga0209129_100029648 284
426 3300025258 Ga0209129_1006497 Ga0209129_10064975 284
427 3300025263 Ga0209565_1000027 Ga0209565_1000027310 284
428 3300025263 Ga0209565_1006250 Ga0209565_10062502 284
429 3300025273 Ga0209673_1000031 Ga0209673_1000031300 284
430 3300025273 Ga0209673_1000066 Ga0209673_100006621 284
431 3300025273 Ga0209673_1001215 Ga0209673_100121529 284
432 3300025284 Ga0209130_1000417 Ga0209130_100041748 284
433 3300025284 Ga0209130_1002081 Ga0209130_10020814 284
434 3300025291 Ga0209675_1000157 Ga0209675_100015748 284
435 3300025291 Ga0209675_1007853 Ga0209675_10078533 284
436 3300025292 Ga0209676_1000005 Ga0209676_1000005948 284
437 3300025292 Ga0209676_1000186 Ga0209676_1000186134 284
438 3300025292 Ga0209676_1025345 Ga0209676_10253453 284
439 3300025294 Ga0209025_1000902 Ga0209025_100090248 284
440 3300025294 Ga0209025_1022283 Ga0209025_10222835 284
441 3300025295 Ga0209564_1000090 Ga0209564_10000904 284
442 3300025295 Ga0209564_1000734 Ga0209564_100073448 284
443 3300025297 Ga0209758_1000050 Ga0209758_100005048 284
444 3300025297 Ga0209758_1002384 Ga0209758_100238423 284
445 3300025298 Ga0209050_1000007 Ga0209050_1000007149 284
446 3300025299 Ga0209256_1000022 Ga0209256_1000022288 284
447 3300025299 Ga0209256_1000023 Ga0209256_100002348 284
448 3300025302 Ga0207426_1000202 Ga0207426_1000202108 284
449 3300025302 Ga0207426_1000260 Ga0207426_100026085 284
450 3300025303 Ga0209051_1000036 Ga0209051_1000036299 284
451 3300025303 Ga0209051_1028054 Ga0209051_10280542 284
452 3300025304 Ga0209257_1000011 Ga0209257_1000011922 284
453 3300025304 Ga0209257_1000800 Ga0209257_100080048 284
454 3300025321 Ga0207656_10027007 Ga0207656_100270074 284
455 3300025923 Ga0207681_10039820 Ga0207681_100398203 284
456 3300025935 Ga0207709_10000019 Ga0207709_1000001942 284
457 3300025938 Ga0207704_10058704 Ga0207704_100587042 284
458 3300025972 Ga0207668_10042383 Ga0207668_100423832 284
459 3300026041 Ga0207639_10059995 Ga0207639_100599952 284
460 3300026075 Ga0207708_10040181 Ga0207708_100401814 284
461 3300026089 Ga0207648_10001873 Ga0207648_100018732 284
462 3300026118 Ga0207675_100003062 Ga0207675_10000306217 284
463 3300027111 Ga0209281_1000005 Ga0209281_1000005171 284
464 3300027360 Ga0209969_1002004 Ga0209969_10020042 284
465 3300027543 Ga0209999_1001563 Ga0209999_10015634 284
466 3300027866 Ga0209813_10069958 Ga0209813_100699582 284
467 3300028380 Ga0268265_10197428 Ga0268265_101974282 284
468 3300028381 Ga0268264_10002570 Ga0268264_1000257016 284
469 3300031456 Ga0307513_10426099 Ga0307513_104260992 284
470 3300032002 Ga0307416_100124232 Ga0307416_1001242323 284
471 3300035086 Ga0373934_0000061 Ga0373934_0000061_2184_3128 284
472 3300035119 Ga0373956_0000003 Ga0373956_0000003_50828_51772 284
473 3300035120 Ga0373957_0006728 Ga0373957_0006728_1375_2319 284
474 3300035724 Ga0373933_0000742 Ga0373933_0000742_11373_12317 284
475 3300036401 Ga0373937_0000196 Ga0373937_0000196_30767_31711 284
476 3300037418 Ga0395900_0081438 Ga0395900_0081438_1138_2052 284
477 3300037466 Ga0395898_0007248 Ga0395898_0007248_10598_11512 284
478 3300037471 Ga0395905_0050493 Ga0395905_0050493_1022_1936 284
479 3300038443 Ga0395901_0027576 Ga0395901_0027576_1533_2447 284
480 3300038443 Ga0395901_0053698 Ga0395901_0053698_1265_2179 284
481 3300038443 Ga0395901_0225210 Ga0395901_0225210_24_938 284
482 3300042435 Ga0439434_0006693 Ga0439434_0006693_509_1414 284
483 3300042876 Ga0451577_0081047 Ga0451577_0081047_1652_2560 284
484 3300044712 Ga0453684_0781598 Ga0453684_0781598_22_930 284
485 3300045051 Ga0451576_0001486 Ga0451576_0001486_37302_38210 284
486 3300046459 Ga0495629_0166816 Ga0495629_0166816_493_1416 284
487 3300046462 Ga0495651_0000105 Ga0495651_0000105_54744_55688 284
488 3300046512 Ga0495610_0037643 Ga0495610_0037643_821_1744 284
489 3300046513 Ga0495616_0032520 Ga0495616_0032520_535_1458 284
490 3300046515 Ga0495620_0029572 Ga0495620_0029572_208_1131 284
491 3300046518 Ga0495631_0000530 Ga0495631_0000530_23323_24246 284
492 3300046530 Ga0495654_0090044 Ga0495654_0090044_470_1393 284
493 3300046674 Ga0495588_0101191 Ga0495588_0101191_73_996 284
494 3300046675 Ga0495657_0047921 Ga0495657_0047921_450_1394 284
495 3300047321 Ga0495676_0001586 Ga0495676_0001586_1984_2907 284
496 3300047673 Ga0495593_0027123 Ga0495593_0027123_2131_3054 284
497 3300048089 Ga0495614_0005764 Ga0495614_0005764_3371_4294 284
498 3300048904 Ga0496101_0017256 Ga0496101_0017256_3466_4386 284
499 3300048920 Ga0496117_0005063 Ga0496117_0005063_11894_12811 284
500 3300048921 Ga0496118_0070793 Ga0496118_0070793_965_1882 284
501 3300048922 Ga0496119_0166254 Ga0496119_0166254_115_1038 284
502 3300048924 Ga0496121_0140258 Ga0496121_0140258_731_1654 284
503 3300048926 Ga0496123_0027586 Ga0496123_0027586_1089_2012 284
504 3300048927 Ga0496124_0040881 Ga0496124_0040881_2401_3318 284
505 3300048928 Ga0496125_0061116 Ga0496125_0061116_739_1656 284
506 3300049568 Ga0501031_0004874 Ga0501031_0004874_6372_7292 284
507 3300049569 Ga0501032_0099172 Ga0501032_0099172_698_1618 284
508 3300049570 Ga0501033_0004194 Ga0501033_0004194_931_1851 284
509 3300049572 Ga0501036_0000096 Ga0501036_0000096_40424_41344 284
510 3300049573 Ga0501037_0042325 Ga0501037_0042325_1097_2017 284
511 3300049574 Ga0501038_0000791 Ga0501038_0000791_12783_13703 284
512 3300049575 Ga0501039_0008295 Ga0501039_0008295_1126_2046 284
513 3300049575 Ga0501039_0080615 Ga0501039_0080615_408_1313 284
514 3300049576 Ga0501040_0000395 Ga0501040_0000395_19253_20173 284
515 3300049577 Ga0501041_0000652 Ga0501041_0000652_1366_2286 284
516 3300049577 Ga0501041_0176156 Ga0501041_0176156_141_1061 284
517 3300049577 Ga0501041_0220872 Ga0501041_0220872_259_1164 284
518 3300049578 Ga0501042_0003069 Ga0501042_0003069_8104_9024 284
519 3300049579 Ga0501043_0023407 Ga0501043_0023407_1238_2158 284
520 3300049580 Ga0501046_0000200 Ga0501046_0000200_35609_36529 284
521 3300049581 Ga0501047_0105650 Ga0501047_0105650_1226_2146 284
522 3300049582 Ga0501048_0004765 Ga0501048_0004765_1452_2372 284
523 3300049584 Ga0501068_0010137 Ga0501068_0010137_3167_4129 284
524 3300049584 Ga0501068_0180297 Ga0501068_0180297_226_1146 284
525 3300049587 Ga0501071_0008613 Ga0501071_0008613_1237_2199 284
526 3300049587 Ga0501071_0041498 Ga0501071_0041498_160_1065 284
527 3300049587 Ga0501071_0174125 Ga0501071_0174125_52_957 284
528 3300049588 Ga0501072_0000765 Ga0501072_0000765_8248_9168 284
529 3300049588 Ga0501072_0029239 Ga0501072_0029239_1237_2142 284
530 3300049588 Ga0501072_0029789 Ga0501072_0029789_1057_2019 284
531 3300049589 Ga0501073_0003806 Ga0501073_0003806_5837_6799 284
532 3300049589 Ga0501073_0037854 Ga0501073_0037854_974_1879 284
533 3300049590 Ga0501074_0021069 Ga0501074_0021069_2455_3417 284
534 3300049590 Ga0501074_0274560 Ga0501074_0274560_132_1037 284
535 3300049591 Ga0501075_0000232 Ga0501075_0000232_1487_2407 284
536 3300049591 Ga0501075_0093945 Ga0501075_0093945_192_1097 284
537 3300049591 Ga0501075_0098814 Ga0501075_0098814_1118_2080 284
538 3300049591 Ga0501075_0168446 Ga0501075_0168446_81_1001 284
539 3300049592 Ga0501076_0005762 Ga0501076_0005762_567_1487 284
540 3300049592 Ga0501076_0059613 Ga0501076_0059613_2098_3003 284
541 3300049592 Ga0501076_0447199 Ga0501076_0447199_114_1034 284
542 3300049593 Ga0501077_0004846 Ga0501077_0004846_1320_2282 284
543 3300049741 Ga0501079_0000385 Ga0501079_0000385_4749_5711 284
544 3300049741 Ga0501079_0003631 Ga0501079_0003631_3900_4820 284
545 3300049742 Ga0501080_0000663 Ga0501080_0000663_24858_25820 284
546 3300049742 Ga0501080_0091510 Ga0501080_0091510_1848_2753 284
547 3300049742 Ga0501080_0140046 Ga0501080_0140046_1176_2096 284
548 3300049743 Ga0501081_0002360 Ga0501081_0002360_1612_2532 284
549 3300049743 Ga0501081_0176812 Ga0501081_0176812_309_1214 284
550 3300049744 Ga0501083_0031006 Ga0501083_0031006_1796_2716 284
551 3300049744 Ga0501083_0051358 Ga0501083_0051358_1686_2591 284
552 3300049822 Ga0501035_0087952 Ga0501035_0087952_550_1470 284
553 3300049823 Ga0501044_0100778 Ga0501044_0100778_289_1209 284
554 3300049824 Ga0501045_0000087 Ga0501045_0000087_28561_29481 284
555 3300050490 nmdc:mga03n38_101880_c1 nmdc:mga03n38_101880_c1_150_1151 284
556 3300050491 nmdc:mga00v17_43064_c1 nmdc:mga00v17_43064_c1_1545_2546 284
557 3300050493 nmdc:mga0k408_5475_c1 nmdc:mga0k408_5475_c1_1040_2041 284
558 3300050495 nmdc:mga04h51_8520_c1 nmdc:mga04h51_8520_c1_1545_2546 284
559 3300050496 nmdc:mga07m45_60505_c1 nmdc:mga07m45_60505_c1_912_1937 284
560 3300053110 Ga0500571_000117 Ga0500571_000117_1352_2275 284
561 3300053118 Ga0500594_0002816 Ga0500594_0002816_2327_3250 284
562 3300053134 Ga0500658_0000018 Ga0500658_0000018_130481_131404 284
563 3300053139 Ga0500568_0058483 Ga0500568_0058483_229_1152 284
564 3300054114 Ga0501084_0004143 Ga0501084_0004143_9487_10407 284
565 3300054114 Ga0501084_0028455 Ga0501084_0028455_528_1490 284
566 3300054114 Ga0501084_0105847 Ga0501084_0105847_1387_2292 284
567 3300060353 Ga0501082_0010273 Ga0501082_0010273_6167_7087 284
568 3300060353 Ga0501082_0104173 Ga0501082_0104173_420_1382 284
569 3300061734 Ga0530510_0044260 Ga0530510_0044260_1027_1947 284
570 iso_pu_bacteria 2599185214 2599620667 284
571 iso_pu_bacteria 2599185226 2599673966 284
572 iso_pu_bacteria 2599185227 2599678717 284
573 iso_pu_bacteria 2599185229 2599690178 284
574 iso_pu_bacteria 2721755523 2722884581 284
575 iso_pu_bacteria 2738541277 2738722272 284
576 iso_pu_bacteria 2738543019 2739282636 284
577 iso_pu_bacteria 2818991446 2819598656 284
578 iso_pu_bacteria 2831265667 2831266556 284
579 iso_pu_bacteria 2838054893 2838057322 284
580 iso_pu_bacteria 2839138175 2839143179 284
581 iso_pu_bacteria 2899924645 2899926727 284
582 iso_pu_bacteria 2928037797 2928043824 284
583 iso_pu_bacteria 2928044640 2928050591 284
584 iso_pu_bacteria 2928051484 2928056947 284
585 iso_pu_bacteria 2928064002 2928070715 284
586 iso_pu_bacteria 2928070936 2928073383 284
587 iso_pu_bacteria 2928084124 2928084601 284
588 3300003578 Ga0006562J51391_1033060 Ga0006562J51391_10330603 285
589 3300003773 Ga0055537_1000068 Ga0055537_100006849 285
590 3300003784 Ga0055534_1000080 Ga0055534_100008049 285
591 3300003790 Ga0055528_1000159 Ga0055528_100015936 285
592 3300003790 Ga0055528_1000520 Ga0055528_10005204 285
593 3300003792 Ga0055540_1004478 Ga0055540_10044787 285
594 3300005288 Ga0065714_10010832 Ga0065714_100108323 285
595 3300005288 Ga0065714_10069048 Ga0065714_100690482 285
596 3300005289 Ga0065704_10086797 Ga0065704_100867973 285
597 3300005328 Ga0070676_10068230 Ga0070676_100682302 285
598 3300005328 Ga0070676_10210770 Ga0070676_102107703 285
599 3300005331 Ga0070670_100109243 Ga0070670_1001092432 285
600 3300005333 Ga0070677_10116408 Ga0070677_101164082 285
601 3300005334 Ga0068869_100154241 Ga0068869_1001542412 285
602 3300005335 Ga0070666_10098764 Ga0070666_100987642 285
603 3300005338 Ga0068868_100143982 Ga0068868_1001439824 285
604 3300005338 Ga0068868_100389487 Ga0068868_1003894872 285
605 3300005347 Ga0070668_100023220 Ga0070668_1000232205 285
606 3300005353 Ga0070669_100089023 Ga0070669_1000890232 285
607 3300005353 Ga0070669_100142582 Ga0070669_1001425824 285
608 3300005354 Ga0070675_100055658 Ga0070675_1000556582 285
609 3300005354 Ga0070675_100066280 Ga0070675_1000662802 285
610 3300005354 Ga0070675_100161456 Ga0070675_1001614562 285
611 3300005355 Ga0070671_100057372 Ga0070671_1000573722 285
612 3300005355 Ga0070671_100148747 Ga0070671_1001487472 285
613 3300005356 Ga0070674_100099970 Ga0070674_1000999702 285
614 3300005364 Ga0070673_100061792 Ga0070673_1000617922 285
615 3300005365 Ga0070688_100043718 Ga0070688_1000437184 285
616 3300005367 Ga0070667_100026936 Ga0070667_1000269363 285
617 3300005367 Ga0070667_100137940 Ga0070667_1001379404 285
618 3300005438 Ga0070701_10067851 Ga0070701_100678512 285
619 3300005438 Ga0070701_10095451 Ga0070701_100954512 285
620 3300005456 Ga0070678_100018733 Ga0070678_1000187336 285
621 3300005456 Ga0070678_100238044 Ga0070678_1002380444 285
622 3300005457 Ga0070662_100181192 Ga0070662_1001811922 285
623 3300005459 Ga0068867_100068818 Ga0068867_1000688184 285
624 3300005459 Ga0068867_100367798 Ga0068867_1003677982 285
625 3300005543 Ga0070672_100065748 Ga0070672_1000657482 285
626 3300005543 Ga0070672_100152877 Ga0070672_1001528773 285
627 3300005543 Ga0070672_100350988 Ga0070672_1003509881 285
628 3300005544 Ga0070686_100042934 Ga0070686_1000429345 285
629 3300005564 Ga0070664_100075939 Ga0070664_1000759393 285
630 3300005577 Ga0068857_100328513 Ga0068857_1003285131 285
631 3300005617 Ga0068859_100140846 Ga0068859_1001408462 285
632 3300005618 Ga0068864_100067928 Ga0068864_1000679285 285
633 3300005618 Ga0068864_100198167 Ga0068864_1001981674 285
634 3300005618 Ga0068864_100199249 Ga0068864_1001992492 285
635 3300005718 Ga0068866_10136362 Ga0068866_101363624 285
636 3300005840 Ga0068870_10098928 Ga0068870_100989284 285
637 3300005840 Ga0068870_10144819 Ga0068870_101448192 285
638 3300005841 Ga0068863_100039081 Ga0068863_1000390812 285
639 3300005841 Ga0068863_100236748 Ga0068863_1002367483 285
640 3300005843 Ga0068860_100101198 Ga0068860_1001011984 285
641 3300006038 Ga0075365_10002031 Ga0075365_100020314 285
642 3300006048 Ga0075363_100002675 Ga0075363_1000026757 285
643 3300006048 Ga0075363_100057328 Ga0075363_1000573282 285
644 3300006048 Ga0075363_100073300 Ga0075363_1000733002 285
645 3300006051 Ga0075364_10007877 Ga0075364_100078774 285
646 3300006058 Ga0075432_10005523 Ga0075432_100055233 285
647 3300006177 Ga0075362_10008330 Ga0075362_100083303 285
648 3300006177 Ga0075362_10049758 Ga0075362_100497583 285
649 3300006177 Ga0075362_10052475 Ga0075362_100524752 285
650 3300006195 Ga0075366_10008587 Ga0075366_100085876 285
651 3300006195 Ga0075366_10014371 Ga0075366_100143715 285
652 3300006237 Ga0097621_100023062 Ga0097621_1000230622 285
653 3300006237 Ga0097621_100154921 Ga0097621_1001549213 285
654 3300006237 Ga0097621_100199990 Ga0097621_1001999901 285
655 3300006353 Ga0075370_10003278 Ga0075370_100032784 285
656 3300006353 Ga0075370_10131833 Ga0075370_101318332 285
657 3300006358 Ga0068871_100162978 Ga0068871_1001629783 285
658 3300006358 Ga0068871_100325007 Ga0068871_1003250073 285
659 3300006931 Ga0097620_100140849 Ga0097620_1001408492 285
660 3300006946 Ga0079104_1037793 Ga0079104_10377932 285
661 3300006948 Ga0099826_10000158 Ga0099826_1000015821 285
662 3300006948 Ga0099826_10173688 Ga0099826_101736881 285
663 3300009094 Ga0111539_10477850 Ga0111539_104778503 285
664 3300009176 Ga0105242_10004957 Ga0105242_100049577 285
665 3300009176 Ga0105242_10127021 Ga0105242_101270214 285
666 3300011119 Ga0105246_10142264 Ga0105246_101422643 285
667 3300013100 Ga0157373_10083856 Ga0157373_100838564 285
668 3300013296 Ga0157374_10089392 Ga0157374_100893922 285
669 3300013306 Ga0163162_10085086 Ga0163162_100850863 285
670 3300013306 Ga0163162_10450054 Ga0163162_104500543 285
671 3300013306 Ga0163162_10510596 Ga0163162_105105962 285
672 3300013308 Ga0157375_10194265 Ga0157375_101942654 285
673 3300014326 Ga0157380_10081167 Ga0157380_100811674 285
674 3300014497 Ga0182008_10003802 Ga0182008_1000380210 285
675 3300014745 Ga0157377_10128626 Ga0157377_101286264 285
676 3300014968 Ga0157379_10086742 Ga0157379_100867422 285
677 3300015261 Ga0182006_1089025 Ga0182006_10890252 285
678 3300017792 Ga0163161_10062469 Ga0163161_100624692 285
679 3300021361 Ga0213872_10026422 Ga0213872_100264224 285
680 3300025263 Ga0209565_1000073 Ga0209565_1000073136 285
681 3300025273 Ga0209673_1000127 Ga0209673_100012731 285
682 3300025291 Ga0209675_1000029 Ga0209675_100002931 285
683 3300025303 Ga0209051_1000298 Ga0209051_100029858 285
684 3300025315 Ga0207697_10005112 Ga0207697_100051125 285
685 3300025893 Ga0207682_10005184 Ga0207682_100051845 285
686 3300025901 Ga0207688_10008591 Ga0207688_100085912 285
687 3300025908 Ga0207643_10011009 Ga0207643_100110098 285
688 3300025908 Ga0207643_10039075 Ga0207643_100390752 285
689 3300025923 Ga0207681_10085785 Ga0207681_100857852 285
690 3300025923 Ga0207681_10433693 Ga0207681_104336931 285
691 3300025925 Ga0207650_10064331 Ga0207650_100643315 285
692 3300025927 Ga0207687_10231925 Ga0207687_102319251 285
693 3300025931 Ga0207644_10076074 Ga0207644_100760743 285
694 3300025931 Ga0207644_10086918 Ga0207644_100869184 285
695 3300025933 Ga0207706_10021932 Ga0207706_100219327 285
696 3300025933 Ga0207706_10022691 Ga0207706_100226911 285
697 3300025940 Ga0207691_10138889 Ga0207691_101388893 285
698 3300025940 Ga0207691_10194637 Ga0207691_101946372 285
699 3300025940 Ga0207691_10361337 Ga0207691_103613371 285
700 3300025942 Ga0207689_10266439 Ga0207689_102664391 285
701 3300025945 Ga0207679_10130641 Ga0207679_101306414 285
702 3300025949 Ga0207667_10153920 Ga0207667_101539202 285
703 3300025986 Ga0207658_10046245 Ga0207658_100462453 285
704 3300025986 Ga0207658_10079414 Ga0207658_100794142 285
705 3300026023 Ga0207677_10052706 Ga0207677_100527062 285
706 3300026023 Ga0207677_10528727 Ga0207677_105287271 285
707 3300026035 Ga0207703_10377606 Ga0207703_103776061 285
708 3300026095 Ga0207676_10003299 Ga0207676_100032999 285
709 3300026121 Ga0207683_10112578 Ga0207683_101125782 285
710 3300026121 Ga0207683_10226209 Ga0207683_102262093 285
711 3300026121 Ga0207683_10334477 Ga0207683_103344774 285
712 3300027111 Ga0209281_1014544 Ga0209281_10145442 285
713 3300027666 Ga0209282_1015352 Ga0209282_10153524 285
714 3300027907 Ga0207428_10047701 Ga0207428_100477013 285
715 3300028577 Ga0265318_10002709 Ga0265318_1000270910 285
716 3300028794 Ga0307515_10013496 Ga0307515_100134964 285
717 3300030731 Ga0316177_1003817 Ga0316177_10038176 285
718 3300030732 Ga0316176_1149365 Ga0316176_11493653 285
719 3300030733 Ga0314311_1083999 Ga0314311_10839994 285
720 3300030734 Ga0316179_1085170 Ga0316179_10851703 285
721 3300030735 Ga0316178_1017927 Ga0316178_10179272 285
722 3300030736 Ga0316180_1046521 Ga0316180_10465212 285
723 3300030742 Ga0316183_1151240 Ga0316183_11512405 285
724 3300030745 Ga0316182_1058328 Ga0316182_10583282 285
725 3300030745 Ga0316182_1410417 Ga0316182_14104172 285
726 3300031238 Ga0265332_10003349 Ga0265332_100033496 285
727 3300031239 Ga0265328_10008502 Ga0265328_100085023 285
728 3300031242 Ga0265329_10011235 Ga0265329_100112352 285
729 3300031250 Ga0265331_10003732 Ga0265331_100037328 285
730 3300031344 Ga0265316_10010873 Ga0265316_100108732 285
731 3300031548 Ga0307408_100039531 Ga0307408_1000395314 285
732 3300031548 Ga0307408_100050469 Ga0307408_1000504692 285
733 3300031548 Ga0307408_100064395 Ga0307408_1000643954 285
734 3300031649 Ga0307514_10071427 Ga0307514_100714274 285
735 3300031711 Ga0265314_10001467 Ga0265314_1000146713 285
736 3300031901 Ga0307406_10003021 Ga0307406_100030214 285
737 3300032004 Ga0307414_10121866 Ga0307414_101218662 285
738 3300032004 Ga0307414_10202554 Ga0307414_102025542 285
739 3300035725 Ga0373947_0118636 Ga0373947_0118636_440_1378 285
740 3300036401 Ga0373937_0153344 Ga0373937_0153344_194_1108 285
741 3300039447 Ga0436361_0931472 Ga0436361_0931472_568_1491 285
742 3300042134 Ga0450898_008466 Ga0450898_008466_473_1390 285
743 3300042184 Ga0450908_015792 Ga0450908_015792_249_1160 285
744 3300042439 Ga0439464_0034703 Ga0439464_0034703_439_1356 285
745 3300042531 Ga0450918_014549 Ga0450918_014549_65_976 285
746 3300044673 Ga0453683_0001302 Ga0453683_0001302_8820_9740 285
747 3300045051 Ga0451576_0007943 Ga0451576_0007943_1345_2265 285
748 3300046459 Ga0495629_0079155 Ga0495629_0079155_1290_2228 285
749 3300046475 Ga0495639_0032738 Ga0495639_0032738_501_1421 285
750 3300046660 Ga0495625_0000301 Ga0495625_0000301_47020_47931 285
751 3300046683 Ga0495658_0103737 Ga0495658_0103737_571_1509 285
752 3300046684 Ga0495669_0122501 Ga0495669_0122501_187_1107 285
753 3300048903 Ga0496100_0067238 Ga0496100_0067238_361_1281 285
754 3300048905 Ga0496102_0007543 Ga0496102_0007543_1323_2243 285
755 3300048905 Ga0496102_0406185 Ga0496102_0406185_162_1088 285
756 3300048908 Ga0496105_0039488 Ga0496105_0039488_1241_2161 285
757 3300048909 Ga0496106_0045843 Ga0496106_0045843_766_1680 285
758 3300048910 Ga0496107_0040387 Ga0496107_0040387_1539_2459 285
759 3300048912 Ga0496109_0050631 Ga0496109_0050631_697_1617 285
760 3300048912 Ga0496109_0407723 Ga0496109_0407723_133_1059 285
761 3300048913 Ga0496110_0111368 Ga0496110_0111368_435_1355 285
762 3300048913 Ga0496110_0498723 Ga0496110_0498723_104_1024 285
763 3300048914 Ga0496111_0067637 Ga0496111_0067637_1249_2169 285
764 3300048925 Ga0496122_0001420 Ga0496122_0001420_1620_2537 285
765 3300048926 Ga0496123_0000600 Ga0496123_0000600_1281_2198 285
766 3300048927 Ga0496124_0071187 Ga0496124_0071187_1123_2040 285
767 3300048929 Ga0496126_0251682 Ga0496126_0251682_180_1097 285
768 3300049572 Ga0501036_0038821 Ga0501036_0038821_1787_2695 285
769 3300049575 Ga0501039_0026073 Ga0501039_0026073_1272_2180 285
770 3300049576 Ga0501040_0105749 Ga0501040_0105749_779_1687 285
771 3300049577 Ga0501041_0010232 Ga0501041_0010232_900_1808 285
772 3300049578 Ga0501042_0005972 Ga0501042_0005972_1362_2270 285
773 3300049582 Ga0501048_0022496 Ga0501048_0022496_13_921 285
774 3300049582 Ga0501048_0147469 Ga0501048_0147469_580_1488 285
775 3300049587 Ga0501071_0003384 Ga0501071_0003384_7265_8173 285
776 3300049588 Ga0501072_0048278 Ga0501072_0048278_426_1334 285
777 3300049590 Ga0501074_0051128 Ga0501074_0051128_2003_2911 285
778 3300049592 Ga0501076_0002129 Ga0501076_0002129_10861_11769 285
779 3300049592 Ga0501076_0051916 Ga0501076_0051916_1947_2855 285
780 3300049593 Ga0501077_0121118 Ga0501077_0121118_458_1381 285
781 3300049742 Ga0501080_0003450 Ga0501080_0003450_11211_12119 285
782 3300049759 Ga0501262_000019 Ga0501262_000019_1420_2334 285
783 3300049824 Ga0501045_0001611 Ga0501045_0001611_10986_11894 285
784 3300049824 Ga0501045_0061952 Ga0501045_0061952_866_1774 285
785 3300050489 nmdc:mga03683_12565_c1 nmdc:mga03683_12565_c1_1863_2777 285
786 3300050489 nmdc:mga03683_44813_c1 nmdc:mga03683_44813_c1_461_1372 285
787 3300050489 nmdc:mga03683_48867_c1 nmdc:mga03683_48867_c1_171_1082 285
788 3300050490 nmdc:mga03n38_94249_c1 nmdc:mga03n38_94249_c1_374_1285 285
789 3300050491 nmdc:mga00v17_7571_c1 nmdc:mga00v17_7571_c1_585_1496 285
790 3300050492 nmdc:mga0yw44_8270_c1 nmdc:mga0yw44_8270_c1_1863_2774 285
791 3300050493 nmdc:mga0k408_140243_c1 nmdc:mga0k408_140243_c1_335_1246 285
792 3300050493 nmdc:mga0k408_74029_c1 nmdc:mga0k408_74029_c1_350_1264 285
793 3300050496 nmdc:mga07m45_31312_c1 nmdc:mga07m45_31312_c1_634_1545 285
794 3300053108 Ga0500562_016884 Ga0500562_016884_954_1862 285
795 3300054114 Ga0501084_0027732 Ga0501084_0027732_44_952 285
796 3300060353 Ga0501082_0179587 Ga0501082_0179587_762_1670 285
797 3300061734 Ga0530510_0004510 Ga0530510_0004510_7118_8026 285
798 3300061734 Ga0530510_0080253 Ga0530510_0080253_1248_2156 285
799 iso_pu_bacteria 2643221628 2644159708 285
800 iso_pu_bacteria 2842677519 2842678547 285
801 iso_pu_bacteria 2904449895 2904454282 285
802 iso_pu_bacteria 2904456579 2904462722 285
803 iso_pu_bacteria 2919462493 2919465038 285
804 iso_pu_bacteria 2928115317 2928116237 285
805 iso_pu_bacteria 2929520902 2929527170 285
806 iso_pu_bacteria 2954767861 2954772190 285
807 3300003775 Ga0055524_1000113 Ga0055524_100011321 286
808 3300003781 Ga0055536_1000458 Ga0055536_10004583 286
809 3300003792 Ga0055540_1000268 Ga0055540_100026835 286
810 3300003792 Ga0055540_1018458 Ga0055540_10184582 286
811 3300003794 Ga0055531_10013596 Ga0055531_100135964 286
812 3300005327 Ga0070658_10177129 Ga0070658_101771292 286
813 3300005366 Ga0070659_100090075 Ga0070659_1000900752 286
814 3300005441 Ga0070700_100039937 Ga0070700_1000399373 286
815 3300005457 Ga0070662_100027067 Ga0070662_1000270673 286
816 3300005548 Ga0070665_100023711 Ga0070665_1000237114 286
817 3300005564 Ga0070664_100083686 Ga0070664_1000836862 286
818 3300005617 Ga0068859_100205797 Ga0068859_1002057973 286
819 3300005844 Ga0068862_100097995 Ga0068862_1000979952 286
820 3300006051 Ga0075364_10160220 Ga0075364_101602203 286
821 3300006353 Ga0075370_10056515 Ga0075370_100565153 286
822 3300006358 Ga0068871_100442201 Ga0068871_1004422011 286
823 3300006931 Ga0097620_100205783 Ga0097620_1002057833 286
824 3300006946 Ga0079104_1000056 Ga0079104_1000056117 286
825 3300009036 Ga0105244_10000730 Ga0105244_1000073023 286
826 3300009148 Ga0105243_10000392 Ga0105243_100003922 286
827 3300009148 Ga0105243_10002832 Ga0105243_100028328 286
828 3300009174 Ga0105241_10162914 Ga0105241_101629142 286
829 3300009176 Ga0105242_10177028 Ga0105242_101770283 286
830 3300009551 Ga0105238_10226513 Ga0105238_102265132 286
831 3300011119 Ga0105246_10020610 Ga0105246_100206105 286
832 3300014497 Ga0182008_10038117 Ga0182008_100381172 286
833 3300015261 Ga0182006_1000910 Ga0182006_100091011 286
834 3300015262 Ga0182007_10002257 Ga0182007_1000225715 286
835 3300025291 Ga0209675_1008282 Ga0209675_10082822 286
836 3300025292 Ga0209676_1000098 Ga0209676_1000098108 286
837 3300025299 Ga0209256_1000049 Ga0209256_1000049238 286
838 3300025303 Ga0209051_1000029 Ga0209051_1000029238 286
839 3300025303 Ga0209051_1000098 Ga0209051_1000098108 286
840 3300025304 Ga0209257_1000168 Ga0209257_100016834 286
841 3300025304 Ga0209257_1005944 Ga0209257_10059449 286
842 3300025728 Ga0207655_1001409 Ga0207655_100140917 286
843 3300025905 Ga0207685_10040174 Ga0207685_100401743 286
844 3300025933 Ga0207706_10006375 Ga0207706_1000637511 286
845 3300025935 Ga0207709_10000130 Ga0207709_1000013041 286
846 3300025935 Ga0207709_10002008 Ga0207709_1000200813 286
847 3300025942 Ga0207689_10021236 Ga0207689_100212361 286
848 3300025945 Ga0207679_10056475 Ga0207679_100564754 286
849 3300025981 Ga0207640_10182606 Ga0207640_101826061 286
850 3300026088 Ga0207641_10255090 Ga0207641_102550901 286
851 3300026118 Ga0207675_100052998 Ga0207675_1000529984 286
852 3300027111 Ga0209281_1000125 Ga0209281_1000125125 286
853 3300028380 Ga0268265_10036907 Ga0268265_100369073 286
854 3300028794 Ga0307515_10135551 Ga0307515_101355512 286
855 3300031250 Ga0265331_10000851 Ga0265331_1000085110 286
856 3300031251 Ga0265327_10000307 Ga0265327_1000030770 286
857 3300031456 Ga0307513_10027912 Ga0307513_100279123 286
858 3300031456 Ga0307513_10174518 Ga0307513_101745183 286
859 3300036401 Ga0373937_0150707 Ga0373937_0150707_674_1603 286
860 3300037471 Ga0395905_0030863 Ga0395905_0030863_32_955 286
861 3300045051 Ga0451576_0004712 Ga0451576_0004712_10230_11126 286
862 3300046519 Ga0495632_0038981 Ga0495632_0038981_669_1601 286
863 3300048917 Ga0496114_0003146 Ga0496114_0003146_10456_11367 286
864 3300048917 Ga0496114_0070605 Ga0496114_0070605_1570_2520 286
865 3300048919 Ga0496116_0011139 Ga0496116_0011139_5309_6223 286
866 3300048920 Ga0496117_0022171 Ga0496117_0022171_385_1299 286
867 3300048921 Ga0496118_0019623 Ga0496118_0019623_4933_5847 286
868 3300048924 Ga0496121_0084891 Ga0496121_0084891_654_1568 286
869 3300048927 Ga0496124_0077267 Ga0496124_0077267_1310_2224 286
870 3300048928 Ga0496125_0072287 Ga0496125_0072287_978_1892 286
871 3300049742 Ga0501080_0182297 Ga0501080_0182297_82_1011 286
872 3300050493 nmdc:mga0k408_42947_c1 nmdc:mga0k408_42947_c1_968_1882 286
873 3300050496 nmdc:mga07m45_54575_c1 nmdc:mga07m45_54575_c1_340_1254 286
874 3300053122 Ga0500608_025912 Ga0500608_025912_1035_1967 286
875 iso_pu_bacteria 2513020051 2513228564 286
876 iso_pu_bacteria 2643221683 2644464790 286
877 3300005364 Ga0070673_100199708 Ga0070673_1001997083 287
878 3300005543 Ga0070672_100148383 Ga0070672_1001483833 287
879 3300005844 Ga0068862_100261239 Ga0068862_1002612393 287
880 3300025918 Ga0207662_10209630 Ga0207662_102096303 287
881 3300025920 Ga0207649_10049039 Ga0207649_100490393 287
882 3300025933 Ga0207706_10201512 Ga0207706_102015123 287
883 3300025936 Ga0207670_10085152 Ga0207670_100851523 287
884 3300025960 Ga0207651_10153723 Ga0207651_101537233 287
885 3300028380 Ga0268265_10029776 Ga0268265_100297765 287
886 3300031731 Ga0307405_10275864 Ga0307405_102758641 287
887 3300031824 Ga0307413_10025594 Ga0307413_100255944 287
888 3300031852 Ga0307410_10022516 Ga0307410_100225164 287
889 3300032005 Ga0307411_10037715 Ga0307411_100377154 287
890 3300005353 Ga0070669_100061108 Ga0070669_1000611083 288
891 3300005354 Ga0070675_100034134 Ga0070675_1000341344 288
892 3300005355 Ga0070671_100325025 Ga0070671_1003250252 288
893 3300005364 Ga0070673_100507737 Ga0070673_1005077371 288
894 3300005438 Ga0070701_10064211 Ga0070701_100642113 288
895 3300005563 Ga0068855_100219120 Ga0068855_1002191202 288
896 3300005578 Ga0068854_100100719 Ga0068854_1001007193 288
897 3300005614 Ga0068856_100370997 Ga0068856_1003709972 288
898 3300005719 Ga0068861_100033223 Ga0068861_1000332235 288
899 3300009094 Ga0111539_10217357 Ga0111539_102173573 288
900 3300013100 Ga0157373_10034715 Ga0157373_100347152 288
901 3300013105 Ga0157369_10005435 Ga0157369_1000543511 288
902 3300014326 Ga0157380_10096386 Ga0157380_100963863 288
903 3300017792 Ga0163161_10397696 Ga0163161_103976962 288
904 3300025908 Ga0207643_10223152 Ga0207643_102231522 288
905 3300025913 Ga0207695_10023486 Ga0207695_100234867 288
906 3300025923 Ga0207681_10061572 Ga0207681_100615723 288
907 3300025949 Ga0207667_10042087 Ga0207667_100420873 288
908 3300025960 Ga0207651_10182012 Ga0207651_101820122 288
909 3300025972 Ga0207668_10144803 Ga0207668_101448031 288
910 3300025981 Ga0207640_10079885 Ga0207640_100798852 288
911 3300026075 Ga0207708_10026016 Ga0207708_100260165 288
912 3300026118 Ga0207675_100085814 Ga0207675_1000858144 288
913 3300031507 Ga0307509_10049938 Ga0307509_100499384 288
914 3300031824 Ga0307413_10028219 Ga0307413_100282194 288
915 3300031852 Ga0307410_10010931 Ga0307410_100109315 288
916 3300032005 Ga0307411_10043857 Ga0307411_100438573 288
917 3300041486 Ga0451807_2059420 Ga0451807_2059420_240_1199 288
918 3300047320 Ga0495672_0081770 Ga0495672_0081770_501_1445 288
919 3300048925 Ga0496122_0022636 Ga0496122_0022636_89_1027 288
920 3300048926 Ga0496123_0114229 Ga0496123_0114229_466_1404 288
921 3300050511 nmdc:mga08y16_289275_c1 nmdc:mga08y16_289275_c1_150_1094 288
922 3300005290 Ga0065712_10129000 Ga0065712_101290003 291
923 3300005356 Ga0070674_100221997 Ga0070674_1002219971 291
924 3300005365 Ga0070688_100107485 Ga0070688_1001074851 291
925 3300005457 Ga0070662_100242017 Ga0070662_1002420173 291
926 3300005543 Ga0070672_100151205 Ga0070672_1001512053 291
927 3300005564 Ga0070664_100148795 Ga0070664_1001487952 291
928 3300005842 Ga0068858_100039850 Ga0068858_1000398503 291
929 3300017792 Ga0163161_10065587 Ga0163161_100655873 291
930 3300025321 Ga0207656_10017243 Ga0207656_100172434 291
931 3300025899 Ga0207642_10057526 Ga0207642_100575263 291
932 3300025919 Ga0207657_10016156 Ga0207657_100161569 291
933 3300025933 Ga0207706_10009612 Ga0207706_100096125 291
934 3300025941 Ga0207711_10083054 Ga0207711_100830543 291
935 3300025945 Ga0207679_10476655 Ga0207679_104766552 291
936 3300025949 Ga0207667_10216026 Ga0207667_102160263 291
937 3300025986 Ga0207658_10062892 Ga0207658_100628924 291
938 3300026089 Ga0207648_10021970 Ga0207648_100219703 291
939 3300026118 Ga0207675_100011774 Ga0207675_1000117746 291
940 3300035083 Ga0373926_0088517 Ga0373926_0088517_88_999 291
941 3300035116 Ga0373945_0016993 Ga0373945_0016993_1240_2151 291
942 3300035170 Ga0373943_0163565 Ga0373943_0163565_225_1136 291
943 3300037068 Ga0373925_0081477 Ga0373925_0081477_10_921 291
944 3300046472 Ga0495580_0022385 Ga0495580_0022385_2990_3901 291
945 3300048904 Ga0496101_0034674 Ga0496101_0034674_726_1637 291
946 3300048905 Ga0496102_0123693 Ga0496102_0123693_166_1077 291
947 3300048909 Ga0496106_0040117 Ga0496106_0040117_1008_1919 291
948 3300050511 nmdc:mga08y16_149083_c1 nmdc:mga08y16_149083_c1_253_1164 291
949 3300001915 JGI24741J21665_1005020 JGI24741J21665_10050202 292
950 3300001979 JGI24740J21852_10000244 JGI24740J21852_100002446 292
951 3300005337 Ga0070682_100014615 Ga0070682_1000146154 292
952 3300005366 Ga0070659_100548543 Ga0070659_1005485431 292
953 3300005564 Ga0070664_100011657 Ga0070664_1000116573 292
954 3300009093 Ga0105240_10102054 Ga0105240_101020542 292
955 3300009551 Ga0105238_10001422 Ga0105238_100014229 292
956 3300025904 Ga0207647_10001513 Ga0207647_1000151312 292
957 3300025912 Ga0207707_10002857 Ga0207707_100028576 292
958 3300025913 Ga0207695_10479856 Ga0207695_104798561 292
959 3300025917 Ga0207660_10001862 Ga0207660_100018624 292
960 3300025921 Ga0207652_10000796 Ga0207652_1000079614 292
961 3300025933 Ga0207706_10013795 Ga0207706_100137956 292
962 3300025944 Ga0207661_10232938 Ga0207661_102329383 292
963 3300025945 Ga0207679_10287488 Ga0207679_102874881 292
964 3300025981 Ga0207640_10006832 Ga0207640_100068326 292
965 3300026041 Ga0207639_10102943 Ga0207639_101029433 292
966 3300026067 Ga0207678_10020101 Ga0207678_100201013 292
967 3300026078 Ga0207702_10063231 Ga0207702_100632312 292
968 3300026116 Ga0207674_10011742 Ga0207674_100117424 292
969 3300049571 Ga0501034_0061896 Ga0501034_0061896_302_1213 292
970 3300049573 Ga0501037_0004400 Ga0501037_0004400_6506_7417 292
971 3300049581 Ga0501047_0002970 Ga0501047_0002970_12155_13066 292
972 3300049585 Ga0501069_0010656 Ga0501069_0010656_3288_4199 292
973 3300049586 Ga0501070_0000395 Ga0501070_0000395_3239_4150 292
974 3300049586 Ga0501070_0006146 Ga0501070_0006146_2389_3300 292
975 3300049587 Ga0501071_0001339 Ga0501071_0001339_9192_10103 292
976 3300049589 Ga0501073_0002813 Ga0501073_0002813_5607_6518 292
977 3300049590 Ga0501074_0002220 Ga0501074_0002220_7093_8004 292
978 3300049742 Ga0501080_0016236 Ga0501080_0016236_5722_6633 292
979 3300049822 Ga0501035_0029066 Ga0501035_0029066_1138_2049 292

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14715

FixP_N

N-terminal domain of cytochrome oxidase-cbb3, FixP

43

91

0.96

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

133

209

0.88

PF00034

Cytochrom_C

Cytochrome c

135

213

0.83

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

222

296

0.75

PF00034

Cytochrom_C

Cytochrome c

222

300

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wqb-assembly1.cif.gz_A thiosulfate dehydrogenase (tsda) from allochromatium vinosum - bisulfite soak 0.8524 120 149
4wqd-assembly1.cif.gz_A thiosulfate dehydrogenase (tsda) from allochromatium vinosum - k208g mutant 0.8351 118 149
4wq8-assembly1.cif.gz_A thiosulfate dehydrogenase (tsda) from allochromatium vinosum - tetrathionate soak 0.8341 118 149
2xts-assembly1.cif.gz_B crystal structure of the sulfane dehydrogenase soxcd from paracoccus pantotrophus 0.8278 118 152
4wqe-assembly1.cif.gz_A thiosulfate dehydrogenase (tsda) from allochromatium vinosum - k208g mutant 0.8223 120 149
ID Description Score Start End Superfamily
3mk7C02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9023 81 281 1.10.760.10
3mk7C02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8879 81 281 1.10.760.10
3mk7M03 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8707 172 251 1.10.760.10
2xtsD01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8273 118 152 1.10.760.10
2c8sA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8209 113 165 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A522KMC7-F1-model_v4 C-type cytochrome 0.9783 190 282 GO:0005506
GO:0009055
GO:0020037
AF-A0A840A0G1-F1-model_v4 Mono/diheme cytochrome c family protein 0.9742 170 254 GO:0009055
GO:0020037
GO:0046872
AF-A0A7Y2UED4-F1-model_v4 C-type cytochrome 0.9732 153 280 GO:0009055
GO:0020037
GO:0046872
AF-A0A4Q3SSL5-F1-model_v4 C-type cytochrome 0.9732 170 279 GO:0005506
GO:0009055
GO:0020037
AF-A0A7V5R1M8-F1-model_v4 C-type cytochrome 0.9707 152 282 GO:0009055
GO:0020037
GO:0046872

Feature Viewer

pLDDT pTM Quality
86.49 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map