F487323
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 979 | 465 | 950 | 304 |
Family's Representative Sequence
| Representative Sequence | 3300006195|Ga0075366_10003336|Ga0075366_100033366 |
| Length | 329 |
| Sequence | MPDFISEFWSVSIAVITVVSILGCLVLLFSVSTQRVVRDASGKVETTGHTWDDDLGEYNNPLPRWWMWMFILTVVFALAYLVIYPGLGAYKGTLAWTSTGEYQDELRKADAQYGPLFSQYAGRDLKHVAADPQARAIGQRLFLNYCAQCHGSDARGGKGFPDLTDQDWLWGGTPEAIKTTILHGRNGVMPPMGAALGSEQDVRNVANYVMSLSGRAHDSIYAYQGKAKFGACAACHGADGKGNPALGAPNLTDTIWLHGGGVENVMETIRKGRNNVMPGHQVFLGEEKVHLLSAYVWGLSNNTSMPLAAATPPSGAGTGSATPAAVPAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 2 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 3 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 4 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 5 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 6 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 7 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 8 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 9 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 10 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 11 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 12 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 13 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 14 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 15 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 16 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 17 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 18 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 19 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 20 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 21 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 22 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 23 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 24 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 25 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 26 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 27 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 28 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 29 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 30 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 31 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 32 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 33 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 34 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 35 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 36 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 37 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 38 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 39 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 40 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 41 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 42 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 43 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 44 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 45 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 46 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 47 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 48 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 49 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 50 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 51 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 52 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 53 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 54 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 55 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 56 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 57 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 58 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 59 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 60 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 61 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 68 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 72 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 73 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 83 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 93 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 95 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 96 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 98 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 103 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 105 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 106 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 107 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 108 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 109 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 110 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 111 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 112 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 113 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 114 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 115 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 116 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 117 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 118 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 119 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 120 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 121 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 122 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 123 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 124 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 125 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 126 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 127 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 128 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 129 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 131 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 132 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 133 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 134 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 135 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 136 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 137 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 138 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 140 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 141 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 164 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 168 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 169 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 171 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 172 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 173 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 174 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 181 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 185 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 188 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 191 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 250 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 254 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 256 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 257 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 261 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 262 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 263 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 264 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 265 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 266 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 267 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 268 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 269 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 270 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 271 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 272 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 273 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 274 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 275 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 276 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 277 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 278 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 279 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 280 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 281 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 282 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 283 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 284 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 285 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 286 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 287 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 288 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 289 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 290 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 291 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 292 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 293 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 294 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 295 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 296 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 297 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 298 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 299 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 300 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 301 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 302 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 303 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 304 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 305 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 306 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 307 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 308 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 309 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 310 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 311 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 312 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 313 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 314 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 315 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 316 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 317 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 318 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 319 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 320 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 321 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 322 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 323 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 324 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 325 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 326 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 327 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 328 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 329 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 372 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 373 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 374 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 375 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 376 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 377 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 378 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 379 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 380 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 381 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 382 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 383 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 384 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 385 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 386 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 387 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 388 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 389 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 390 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 391 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 392 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 393 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 424 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 428 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 429 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 430 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 431 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 432 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 433 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 434 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 435 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 436 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 437 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 438 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 439 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 440 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 441 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 443 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 446 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 447 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 448 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 449 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 450 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 451 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 452 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 453 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 454 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 455 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 456 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 457 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 458 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 459 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 460 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 461 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 462 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 463 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.63 |
| Metatranscriptomes | 0.41 |
| Isolates | 2.96 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.85 |
| Nodule | 1.02 |
| Rhizoplane | 2.55 |
| Rhizosphere | 74.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.9 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1005020 | 3300001915 | Bacteria | 2833 |
| 2 | JGI24740J21852_10000244 | 3300001979 | Bacteria | 23006 |
| 3 | JGI24740J21852_10014817 | 3300001979 | Bacteria | 2864 |
| 4 | JGI24739J22299_10019684 | 3300001989 | Bacteria | 2414 |
| 5 | JGI25152J39213_1000159 | 3300002773 | Bacteria | 45944 |
| 6 | JGI25152J39213_1003485 | 3300002773 | Bacteria | 5346 |
| 7 | JGI25150J39212_1001644 | 3300002774 | Bacteria | 6077 |
| 8 | JGI25150J39212_1005296 | 3300002774 | Bacteria | 2769 |
| 9 | JGI25159J45721_1012146 | 3300002987 | Bacteria | 2070 |
| 10 | JGI25151J46595_10000384 | 3300003187 | Bacteria | 45944 |
| 11 | JGI25151J46595_10000716 | 3300003187 | Bacteria | 27662 |
| 12 | JGI25151J46595_10003350 | 3300003187 | Bacteria | 8879 |
| 13 | JGI25153J46596_10000243 | 3300003215 | Bacteria | 45944 |
| 14 | rootL2_10068905 | 3300003322 | Bacteria | 1423 |
| 15 | rootH1_10001255 | 3300003323 | Bacteria | 1629 |
| 16 | JGI25160J50197_1000275 | 3300003354 | Bacteria | 37775 |
| 17 | JGI25161J50226_1005011 | 3300003374 | Bacteria | 2661 |
| 18 | Ga0006562J51391_1033060 | 3300003578 | Bacteria | 1983 |
| 19 | Ga0055527_1005055 | 3300003760 | Bacteria | 1751 |
| 20 | Ga0055535_1000115 | 3300003761 | Bacteria | 86313 |
| 21 | Ga0055542_1000028 | 3300003762 | Bacteria | 251458 |
| 22 | Ga0055526_1000245 | 3300003771 | Bacteria | 45932 |
| 23 | Ga0055526_1000676 | 3300003771 | Bacteria | 26148 |
| 24 | Ga0055537_1000068 | 3300003773 | Bacteria | 75642 |
| 25 | Ga0055537_1000192 | 3300003773 | Bacteria | 45800 |
| 26 | Ga0055537_1008083 | 3300003773 | Bacteria | 2463 |
| 27 | Ga0055524_1000113 | 3300003775 | Bacteria | 95090 |
| 28 | Ga0055524_1000312 | 3300003775 | Bacteria | 45944 |
| 29 | Ga0055524_1004329 | 3300003775 | Bacteria | 6580 |
| 30 | Ga0055536_1000396 | 3300003781 | Bacteria | 31602 |
| 31 | Ga0055536_1000458 | 3300003781 | Bacteria | 28710 |
| 32 | Ga0055536_1001741 | 3300003781 | Bacteria | 12852 |
| 33 | Ga0055534_1000080 | 3300003784 | Bacteria | 75642 |
| 34 | Ga0055534_1000183 | 3300003784 | Bacteria | 45800 |
| 35 | Ga0055528_1000159 | 3300003790 | Bacteria | 56331 |
| 36 | Ga0055528_1000245 | 3300003790 | Bacteria | 45800 |
| 37 | Ga0055528_1000520 | 3300003790 | Bacteria | 30143 |
| 38 | Ga0055528_1018126 | 3300003790 | Bacteria | 2400 |
| 39 | Ga0055530_10000086 | 3300003791 | Bacteria | 80109 |
| 40 | Ga0055540_1000092 | 3300003792 | Bacteria | 98476 |
| 41 | Ga0055540_1000268 | 3300003792 | Bacteria | 47109 |
| 42 | Ga0055540_1000520 | 3300003792 | Bacteria | 29103 |
| 43 | Ga0055540_1004478 | 3300003792 | Bacteria | 6272 |
| 44 | Ga0055540_1018458 | 3300003792 | Bacteria | 1911 |
| 45 | Ga0055531_10000672 | 3300003794 | Bacteria | 29298 |
| 46 | Ga0055531_10000724 | 3300003794 | Bacteria | 28069 |
| 47 | Ga0055531_10013596 | 3300003794 | Bacteria | 3738 |
| 48 | Ga0055531_10016047 | 3300003794 | Bacteria | 3258 |
| 49 | Ga0055543_1009429 | 3300004625 | Bacteria | 2096 |
| 50 | Ga0055543_1009518 | 3300004625 | Bacteria | 2084 |
| 51 | Ga0065165_1001483 | 3300005262 | Bacteria | 24930 |
| 52 | Ga0065714_10010832 | 3300005288 | Bacteria | 3169 |
| 53 | Ga0065714_10069048 | 3300005288 | Bacteria | 4414 |
| 54 | Ga0065704_10085211 | 3300005289 | Bacteria | 3238 |
| 55 | Ga0065704_10086797 | 3300005289 | Bacteria | 3084 |
| 56 | Ga0065712_10129000 | 3300005290 | Bacteria | 1572 |
| 57 | Ga0065707_10012023 | 3300005295 | Bacteria | 2487 |
| 58 | Ga0070658_10177129 | 3300005327 | Bacteria | 1794 |
| 59 | Ga0070676_10068230 | 3300005328 | Bacteria | 2128 |
| 60 | Ga0070676_10210770 | 3300005328 | Bacteria | 1278 |
| 61 | Ga0070683_100033036 | 3300005329 | Bacteria | 4715 |
| 62 | Ga0070690_100049876 | 3300005330 | Bacteria | 2670 |
| 63 | Ga0070670_100109243 | 3300005331 | Bacteria | 2383 |
| 64 | Ga0070677_10116408 | 3300005333 | Bacteria | 1201 |
| 65 | Ga0068869_100000492 | 3300005334 | Bacteria | 21961 |
| 66 | Ga0068869_100154241 | 3300005334 | Bacteria | 1783 |
| 67 | Ga0070666_10020164 | 3300005335 | Bacteria | 4308 |
| 68 | Ga0070666_10098764 | 3300005335 | Bacteria | 2010 |
| 69 | Ga0070680_100213155 | 3300005336 | Bacteria | 1629 |
| 70 | Ga0070682_100014615 | 3300005337 | Bacteria | 4538 |
| 71 | Ga0068868_100143982 | 3300005338 | Bacteria | 1959 |
| 72 | Ga0068868_100178496 | 3300005338 | Bacteria | 1761 |
| 73 | Ga0068868_100389487 | 3300005338 | Bacteria | 1200 |
| 74 | Ga0070689_100004687 | 3300005340 | Bacteria | 9266 |
| 75 | Ga0070687_100047149 | 3300005343 | Bacteria | 2209 |
| 76 | Ga0070687_100141589 | 3300005343 | Bacteria | 1401 |
| 77 | Ga0070661_100102779 | 3300005344 | Bacteria | 2127 |
| 78 | Ga0070692_10009202 | 3300005345 | Bacteria | 4442 |
| 79 | Ga0070692_10011876 | 3300005345 | Bacteria | 4015 |
| 80 | Ga0070668_100023220 | 3300005347 | Bacteria | 4691 |
| 81 | Ga0070668_100023702 | 3300005347 | Bacteria | 4645 |
| 82 | Ga0070668_100153802 | 3300005347 | Bacteria | 1862 |
| 83 | Ga0070669_100010896 | 3300005353 | Bacteria | 6455 |
| 84 | Ga0070669_100048201 | 3300005353 | Bacteria | 3109 |
| 85 | Ga0070669_100061108 | 3300005353 | Bacteria | 2768 |
| 86 | Ga0070669_100089023 | 3300005353 | Bacteria | 2311 |
| 87 | Ga0070669_100142582 | 3300005353 | Bacteria | 1848 |
| 88 | Ga0070675_100012028 | 3300005354 | Bacteria | 6784 |
| 89 | Ga0070675_100034134 | 3300005354 | Bacteria | 4127 |
| 90 | Ga0070675_100039354 | 3300005354 | Bacteria | 3858 |
| 91 | Ga0070675_100055658 | 3300005354 | Bacteria | 3257 |
| 92 | Ga0070675_100061199 | 3300005354 | Bacteria | 3108 |
| 93 | Ga0070675_100066280 | 3300005354 | Bacteria | 2986 |
| 94 | Ga0070675_100161456 | 3300005354 | Bacteria | 1927 |
| 95 | Ga0070671_100057372 | 3300005355 | Bacteria | 3240 |
| 96 | Ga0070671_100148747 | 3300005355 | Bacteria | 1977 |
| 97 | Ga0070671_100325025 | 3300005355 | Bacteria | 1311 |
| 98 | Ga0070674_100040024 | 3300005356 | Bacteria | 3168 |
| 99 | Ga0070674_100099970 | 3300005356 | Bacteria | 2111 |
| 100 | Ga0070674_100221997 | 3300005356 | Bacteria | 1470 |
| 101 | Ga0070673_100060985 | 3300005364 | Bacteria | 2991 |
| 102 | Ga0070673_100061792 | 3300005364 | Bacteria | 2973 |
| 103 | Ga0070673_100199708 | 3300005364 | Bacteria | 1722 |
| 104 | Ga0070673_100507737 | 3300005364 | Bacteria | 1091 |
| 105 | Ga0070688_100043718 | 3300005365 | Bacteria | 2761 |
| 106 | Ga0070688_100107485 | 3300005365 | Bacteria | 1849 |
| 107 | Ga0070659_100090075 | 3300005366 | Bacteria | 2458 |
| 108 | Ga0070659_100548543 | 3300005366 | Bacteria | 989 |
| 109 | Ga0070667_100010104 | 3300005367 | Bacteria | 7808 |
| 110 | Ga0070667_100026936 | 3300005367 | Bacteria | 4782 |
| 111 | Ga0070667_100137940 | 3300005367 | Bacteria | 2133 |
| 112 | Ga0070667_100193288 | 3300005367 | Bacteria | 1803 |
| 113 | Ga0070701_10064211 | 3300005438 | Bacteria | 1945 |
| 114 | Ga0070701_10067851 | 3300005438 | Bacteria | 1899 |
| 115 | Ga0070701_10095451 | 3300005438 | Bacteria | 1637 |
| 116 | Ga0070701_10112285 | 3300005438 | Bacteria | 1524 |
| 117 | Ga0070711_100169475 | 3300005439 | Bacteria | 1663 |
| 118 | Ga0070705_100025083 | 3300005440 | Bacteria | 3227 |
| 119 | Ga0070700_100007776 | 3300005441 | Bacteria | 5809 |
| 120 | Ga0070700_100024533 | 3300005441 | Bacteria | 3542 |
| 121 | Ga0070700_100039937 | 3300005441 | Bacteria | 2870 |
| 122 | Ga0070700_100076427 | 3300005441 | Bacteria | 2150 |
| 123 | Ga0070694_100203846 | 3300005444 | Bacteria | 1476 |
| 124 | Ga0070694_100272365 | 3300005444 | Unclassified | 1288 |
| 125 | Ga0070678_100018733 | 3300005456 | Bacteria | 4494 |
| 126 | Ga0070678_100028455 | 3300005456 | Bacteria | 3812 |
| 127 | Ga0070678_100238044 | 3300005456 | Bacteria | 1521 |
| 128 | Ga0070662_100027067 | 3300005457 | Bacteria | 3977 |
| 129 | Ga0070662_100181192 | 3300005457 | Bacteria | 1660 |
| 130 | Ga0070662_100242017 | 3300005457 | Bacteria | 1447 |
| 131 | Ga0068867_100008503 | 3300005459 | Bacteria | 7246 |
| 132 | Ga0068867_100015366 | 3300005459 | Bacteria | 5429 |
| 133 | Ga0068867_100068818 | 3300005459 | Bacteria | 2642 |
| 134 | Ga0068867_100367798 | 3300005459 | Bacteria | 1204 |
| 135 | Ga0070698_100010835 | 3300005471 | Bacteria | 9702 |
| 136 | Ga0070684_100048491 | 3300005535 | Bacteria | 3685 |
| 137 | Ga0068853_100024738 | 3300005539 | Bacteria | 5037 |
| 138 | Ga0068853_100044387 | 3300005539 | Bacteria | 3805 |
| 139 | Ga0070672_100065748 | 3300005543 | Bacteria | 2869 |
| 140 | Ga0070672_100148383 | 3300005543 | Bacteria | 1939 |
| 141 | Ga0070672_100151205 | 3300005543 | Bacteria | 1920 |
| 142 | Ga0070672_100152877 | 3300005543 | Bacteria | 1910 |
| 143 | Ga0070672_100157007 | 3300005543 | Bacteria | 1885 |
| 144 | Ga0070672_100350988 | 3300005543 | Bacteria | 1257 |
| 145 | Ga0070686_100042934 | 3300005544 | Bacteria | 2834 |
| 146 | Ga0070686_100085535 | 3300005544 | Bacteria | 2098 |
| 147 | Ga0070695_100108487 | 3300005545 | Bacteria | 1880 |
| 148 | Ga0070695_100148116 | 3300005545 | Bacteria | 1635 |
| 149 | Ga0070695_100237242 | 3300005545 | Bacteria | 1321 |
| 150 | Ga0070696_100030340 | 3300005546 | Bacteria | 3701 |
| 151 | Ga0070665_100023711 | 3300005548 | Bacteria | 6180 |
| 152 | Ga0070665_100028940 | 3300005548 | Bacteria | 5577 |
| 153 | Ga0070665_100063885 | 3300005548 | Bacteria | 3691 |
| 154 | Ga0070665_100379394 | 3300005548 | Bacteria | 1421 |
| 155 | Ga0070665_100524979 | 3300005548 | Bacteria | 1196 |
| 156 | Ga0070704_100254762 | 3300005549 | Bacteria | 1443 |
| 157 | Ga0070704_100515035 | 3300005549 | Bacteria | 1040 |
| 158 | Ga0068855_100219120 | 3300005563 | Bacteria | 2135 |
| 159 | Ga0070664_100006788 | 3300005564 | Bacteria | 9229 |
| 160 | Ga0070664_100011657 | 3300005564 | Bacteria | 7132 |
| 161 | Ga0070664_100075939 | 3300005564 | Bacteria | 2887 |
| 162 | Ga0070664_100083686 | 3300005564 | Bacteria | 2753 |
| 163 | Ga0070664_100148795 | 3300005564 | Bacteria | 2066 |
| 164 | Ga0070664_100206428 | 3300005564 | Bacteria | 1755 |
| 165 | Ga0068857_100249894 | 3300005577 | Bacteria | 1625 |
| 166 | Ga0068857_100279368 | 3300005577 | Bacteria | 1536 |
| 167 | Ga0068857_100308872 | 3300005577 | Bacteria | 1459 |
| 168 | Ga0068857_100328513 | 3300005577 | Bacteria | 1413 |
| 169 | Ga0068854_100028929 | 3300005578 | Bacteria | 3833 |
| 170 | Ga0068854_100100719 | 3300005578 | Bacteria | 2166 |
| 171 | Ga0068854_100179204 | 3300005578 | Bacteria | 1654 |
| 172 | Ga0068856_100101536 | 3300005614 | Bacteria | 2869 |
| 173 | Ga0068856_100370997 | 3300005614 | Bacteria | 1450 |
| 174 | Ga0068856_100529772 | 3300005614 | Bacteria | 1199 |
| 175 | Ga0068852_100023333 | 3300005616 | Bacteria | 4978 |
| 176 | Ga0068852_100079314 | 3300005616 | Bacteria | 2908 |
| 177 | Ga0068852_100128838 | 3300005616 | Bacteria | 2328 |
| 178 | Ga0068852_100547294 | 3300005616 | Bacteria | 1157 |
| 179 | Ga0068859_100004203 | 3300005617 | Bacteria | 14701 |
| 180 | Ga0068859_100043409 | 3300005617 | Bacteria | 4518 |
| 181 | Ga0068859_100050306 | 3300005617 | Bacteria | 4187 |
| 182 | Ga0068859_100140846 | 3300005617 | Bacteria | 2485 |
| 183 | Ga0068859_100205797 | 3300005617 | Bacteria | 2053 |
| 184 | Ga0068859_100275563 | 3300005617 | Bacteria | 1775 |
| 185 | Ga0068859_100344889 | 3300005617 | Bacteria | 1584 |
| 186 | Ga0068864_100045634 | 3300005618 | Bacteria | 3759 |
| 187 | Ga0068864_100067928 | 3300005618 | Bacteria | 3096 |
| 188 | Ga0068864_100110129 | 3300005618 | Bacteria | 2452 |
| 189 | Ga0068864_100198167 | 3300005618 | Bacteria | 1843 |
| 190 | Ga0068864_100199249 | 3300005618 | Bacteria | 1838 |
| 191 | Ga0068864_100223152 | 3300005618 | Bacteria | 1739 |
| 192 | Ga0068866_10006875 | 3300005718 | Bacteria | 4752 |
| 193 | Ga0068866_10047154 | 3300005718 | Bacteria | 2171 |
| 194 | Ga0068866_10133214 | 3300005718 | Bacteria | 1416 |
| 195 | Ga0068866_10136362 | 3300005718 | Bacteria | 1403 |
| 196 | Ga0068861_100000457 | 3300005719 | Bacteria | 23806 |
| 197 | Ga0068861_100011901 | 3300005719 | Bacteria | 6058 |
| 198 | Ga0068861_100033223 | 3300005719 | Bacteria | 3804 |
| 199 | Ga0068851_10000887 | 3300005834 | Bacteria | 12923 |
| 200 | Ga0068851_10011672 | 3300005834 | Bacteria | 4124 |
| 201 | Ga0068851_10013697 | 3300005834 | Bacteria | 3839 |
| 202 | Ga0068851_10040615 | 3300005834 | Bacteria | 2338 |
| 203 | Ga0068870_10098928 | 3300005840 | Bacteria | 1644 |
| 204 | Ga0068870_10144819 | 3300005840 | Bacteria | 1393 |
| 205 | Ga0068863_100039081 | 3300005841 | Bacteria | 4516 |
| 206 | Ga0068863_100083400 | 3300005841 | Bacteria | 3029 |
| 207 | Ga0068863_100236748 | 3300005841 | Bacteria | 1762 |
| 208 | Ga0068858_100019496 | 3300005842 | Bacteria | 6343 |
| 209 | Ga0068858_100039850 | 3300005842 | Bacteria | 4355 |
| 210 | Ga0068858_100099246 | 3300005842 | Bacteria | 2715 |
| 211 | Ga0068860_100000685 | 3300005843 | Bacteria | 39158 |
| 212 | Ga0068860_100042170 | 3300005843 | Bacteria | 4359 |
| 213 | Ga0068860_100101198 | 3300005843 | Bacteria | 2749 |
| 214 | Ga0068860_100258889 | 3300005843 | Bacteria | 1695 |
| 215 | Ga0068862_100001127 | 3300005844 | Bacteria | 25370 |
| 216 | Ga0068862_100003177 | 3300005844 | Bacteria | 14245 |
| 217 | Ga0068862_100078130 | 3300005844 | Bacteria | 2867 |
| 218 | Ga0068862_100084729 | 3300005844 | Bacteria | 2754 |
| 219 | Ga0068862_100097995 | 3300005844 | Bacteria | 2560 |
| 220 | Ga0068862_100222858 | 3300005844 | Bacteria | 1708 |
| 221 | Ga0068862_100261239 | 3300005844 | Bacteria | 1581 |
| 222 | Ga0081455_10004596 | 3300005937 | Bacteria | 15410 |
| 223 | Ga0075365_10002031 | 3300006038 | Bacteria | 9618 |
| 224 | Ga0075368_10009041 | 3300006042 | Bacteria | 3576 |
| 225 | Ga0075363_100002675 | 3300006048 | Bacteria | 7358 |
| 226 | Ga0075363_100007021 | 3300006048 | Bacteria | 5149 |
| 227 | Ga0075363_100057328 | 3300006048 | Bacteria | 2090 |
| 228 | Ga0075363_100073300 | 3300006048 | Bacteria | 1863 |
| 229 | Ga0075364_10007877 | 3300006051 | Bacteria | 6344 |
| 230 | Ga0075364_10052287 | 3300006051 | Bacteria | 2669 |
| 231 | Ga0075364_10160220 | 3300006051 | Bacteria | 1519 |
| 232 | Ga0075432_10005523 | 3300006058 | Bacteria | 4307 |
| 233 | Ga0070712_100133261 | 3300006175 | Bacteria | 1886 |
| 234 | Ga0075362_10008330 | 3300006177 | Bacteria | 3961 |
| 235 | Ga0075362_10010930 | 3300006177 | Bacteria | 3562 |
| 236 | Ga0075362_10049758 | 3300006177 | Bacteria | 1873 |
| 237 | Ga0075362_10052475 | 3300006177 | Bacteria | 1827 |
| 238 | Ga0075367_10135901 | 3300006178 | Bacteria | 1521 |
| 239 | Ga0075369_10005152 | 3300006186 | Bacteria | 4870 |
| 240 | Ga0075366_10003336 | 3300006195 | Bacteria | 8450 |
| 241 | Ga0075366_10008587 | 3300006195 | Bacteria | 5686 |
| 242 | Ga0075366_10014371 | 3300006195 | Bacteria | 4520 |
| 243 | Ga0097621_100003378 | 3300006237 | Bacteria | 10987 |
| 244 | Ga0097621_100023062 | 3300006237 | Bacteria | 4840 |
| 245 | Ga0097621_100154921 | 3300006237 | Bacteria | 1966 |
| 246 | Ga0097621_100199990 | 3300006237 | Bacteria | 1734 |
| 247 | Ga0097621_100266562 | 3300006237 | Bacteria | 1504 |
| 248 | Ga0075370_10003278 | 3300006353 | Bacteria | 7677 |
| 249 | Ga0075370_10012403 | 3300006353 | Bacteria | 4503 |
| 250 | Ga0075370_10056515 | 3300006353 | Bacteria | 2230 |
| 251 | Ga0075370_10131833 | 3300006353 | Bacteria | 1458 |
| 252 | Ga0068871_100008412 | 3300006358 | Bacteria | 7421 |
| 253 | Ga0068871_100009301 | 3300006358 | Bacteria | 7112 |
| 254 | Ga0068871_100095942 | 3300006358 | Bacteria | 2477 |
| 255 | Ga0068871_100162978 | 3300006358 | Bacteria | 1908 |
| 256 | Ga0068871_100237416 | 3300006358 | Bacteria | 1584 |
| 257 | Ga0068871_100325007 | 3300006358 | Bacteria | 1355 |
| 258 | Ga0068871_100442201 | 3300006358 | Bacteria | 1164 |
| 259 | Ga0075428_100385212 | 3300006844 | Bacteria | 1503 |
| 260 | Ga0075430_100187475 | 3300006846 | Bacteria | 1720 |
| 261 | Ga0075431_100003705 | 3300006847 | Bacteria | 14849 |
| 262 | Ga0075434_100163554 | 3300006871 | Bacteria | 2245 |
| 263 | Ga0075429_100000326 | 3300006880 | Bacteria | 34334 |
| 264 | Ga0068865_100097311 | 3300006881 | Bacteria | 2148 |
| 265 | Ga0097620_100004203 | 3300006931 | Bacteria | 14701 |
| 266 | Ga0097620_100043409 | 3300006931 | Bacteria | 4518 |
| 267 | Ga0097620_100050306 | 3300006931 | Bacteria | 4187 |
| 268 | Ga0097620_100140849 | 3300006931 | Bacteria | 2485 |
| 269 | Ga0097620_100205783 | 3300006931 | Bacteria | 2053 |
| 270 | Ga0097620_100275574 | 3300006931 | Bacteria | 1775 |
| 271 | Ga0097620_100344868 | 3300006931 | Bacteria | 1584 |
| 272 | Ga0079104_1000034 | 3300006946 | Bacteria | 199368 |
| 273 | Ga0079104_1000056 | 3300006946 | Bacteria | 166276 |
| 274 | Ga0079104_1037793 | 3300006946 | Bacteria | 1148 |
| 275 | Ga0099826_10000158 | 3300006948 | Bacteria | 28172 |
| 276 | Ga0099826_10173688 | 3300006948 | Bacteria | 1207 |
| 277 | Ga0105244_10000730 | 3300009036 | Bacteria | 28251 |
| 278 | Ga0105240_10102054 | 3300009093 | Bacteria | 3487 |
| 279 | Ga0111539_10170865 | 3300009094 | Bacteria | 2540 |
| 280 | Ga0111539_10217357 | 3300009094 | Bacteria | 2226 |
| 281 | Ga0111539_10256613 | 3300009094 | Bacteria | 2036 |
| 282 | Ga0111539_10477850 | 3300009094 | Bacteria | 1451 |
| 283 | Ga0105247_10399477 | 3300009101 | Bacteria | 979 |
| 284 | Ga0114129_10008954 | 3300009147 | Bacteria | 14267 |
| 285 | Ga0105243_10000392 | 3300009148 | Bacteria | 46166 |
| 286 | Ga0105243_10002832 | 3300009148 | Bacteria | 14397 |
| 287 | Ga0105243_10004141 | 3300009148 | Bacteria | 11526 |
| 288 | Ga0105243_10006138 | 3300009148 | Bacteria | 9293 |
| 289 | Ga0105243_10052781 | 3300009148 | Bacteria | 3222 |
| 290 | Ga0105243_10207747 | 3300009148 | Bacteria | 1722 |
| 291 | Ga0105241_10162914 | 3300009174 | Bacteria | 1835 |
| 292 | Ga0105241_10316107 | 3300009174 | Bacteria | 1345 |
| 293 | Ga0105242_10004957 | 3300009176 | Bacteria | 10300 |
| 294 | Ga0105242_10127021 | 3300009176 | Bacteria | 2196 |
| 295 | Ga0105242_10177028 | 3300009176 | Bacteria | 1879 |
| 296 | Ga0105248_10005948 | 3300009177 | Bacteria | 13399 |
| 297 | Ga0105248_10085062 | 3300009177 | Bacteria | 3559 |
| 298 | Ga0105237_10007850 | 3300009545 | Bacteria | 11633 |
| 299 | Ga0105238_10001422 | 3300009551 | Bacteria | 23984 |
| 300 | Ga0105238_10043722 | 3300009551 | Bacteria | 4532 |
| 301 | Ga0105238_10174661 | 3300009551 | Bacteria | 2125 |
| 302 | Ga0105238_10226513 | 3300009551 | Bacteria | 1846 |
| 303 | Ga0105249_10019420 | 3300009553 | Bacteria | 6064 |
| 304 | Ga0105249_10040550 | 3300009553 | Bacteria | 4229 |
| 305 | Ga0105249_10193650 | 3300009553 | Bacteria | 1985 |
| 306 | Ga0105249_10227041 | 3300009553 | Bacteria | 1840 |
| 307 | Ga0105239_10043053 | 3300010375 | Bacteria | 4948 |
| 308 | Ga0105239_10295740 | 3300010375 | Bacteria | 1823 |
| 309 | Ga0105239_10353288 | 3300010375 | Bacteria | 1660 |
| 310 | Ga0105246_10020610 | 3300011119 | Bacteria | 4230 |
| 311 | Ga0105246_10050913 | 3300011119 | Bacteria | 2842 |
| 312 | Ga0105246_10142264 | 3300011119 | Bacteria | 1805 |
| 313 | Ga0105246_10221659 | 3300011119 | Bacteria | 1483 |
| 314 | Ga0157373_10034715 | 3300013100 | Bacteria | 3623 |
| 315 | Ga0157373_10083856 | 3300013100 | Bacteria | 2246 |
| 316 | Ga0157369_10005435 | 3300013105 | Bacteria | 14814 |
| 317 | Ga0157374_10089392 | 3300013296 | Bacteria | 2935 |
| 318 | Ga0157374_10091172 | 3300013296 | Bacteria | 2906 |
| 319 | Ga0163162_10002995 | 3300013306 | Bacteria | 16145 |
| 320 | Ga0163162_10085086 | 3300013306 | Bacteria | 3239 |
| 321 | Ga0163162_10087528 | 3300013306 | Bacteria | 3193 |
| 322 | Ga0163162_10124232 | 3300013306 | Bacteria | 2686 |
| 323 | Ga0163162_10450054 | 3300013306 | Bacteria | 1420 |
| 324 | Ga0163162_10510596 | 3300013306 | Bacteria | 1332 |
| 325 | Ga0157372_10004902 | 3300013307 | Bacteria | 14227 |
| 326 | Ga0157375_10005919 | 3300013308 | Bacteria | 10659 |
| 327 | Ga0157375_10194265 | 3300013308 | Bacteria | 2184 |
| 328 | Ga0157375_10726370 | 3300013308 | Bacteria | 1146 |
| 329 | Ga0163163_10034424 | 3300014325 | Bacteria | 4905 |
| 330 | Ga0157380_10002488 | 3300014326 | Bacteria | 12421 |
| 331 | Ga0157380_10058210 | 3300014326 | Bacteria | 3080 |
| 332 | Ga0157380_10081167 | 3300014326 | Bacteria | 2652 |
| 333 | Ga0157380_10096386 | 3300014326 | Bacteria | 2452 |
| 334 | Ga0182008_10000536 | 3300014497 | Bacteria | 28332 |
| 335 | Ga0182008_10003802 | 3300014497 | Bacteria | 8973 |
| 336 | Ga0182008_10038117 | 3300014497 | Bacteria | 2404 |
| 337 | Ga0157377_10128626 | 3300014745 | Bacteria | 1544 |
| 338 | Ga0157377_10248550 | 3300014745 | Bacteria | 1152 |
| 339 | Ga0157379_10086742 | 3300014968 | Bacteria | 2806 |
| 340 | Ga0157376_10079140 | 3300014969 | Bacteria | 2817 |
| 341 | Ga0182006_1000910 | 3300015261 | Bacteria | 19716 |
| 342 | Ga0182006_1074943 | 3300015261 | Bacteria | 1246 |
| 343 | Ga0182006_1089025 | 3300015261 | Bacteria | 1113 |
| 344 | Ga0182007_10002257 | 3300015262 | Bacteria | 9716 |
| 345 | Ga0163161_10000441 | 3300017792 | Bacteria | 34632 |
| 346 | Ga0163161_10007311 | 3300017792 | Bacteria | 7620 |
| 347 | Ga0163161_10062469 | 3300017792 | Bacteria | 2714 |
| 348 | Ga0163161_10065587 | 3300017792 | Bacteria | 2650 |
| 349 | Ga0163161_10397696 | 3300017792 | Bacteria | 1104 |
| 350 | Ga0206356_11540035 | 3300020070 | Bacteria | 3573 |
| 351 | Ga0206354_10006232 | 3300020081 | Bacteria | 3458 |
| 352 | Ga0206353_11382456 | 3300020082 | Bacteria | 2623 |
| 353 | Ga0213872_10026422 | 3300021361 | Bacteria | 2666 |
| 354 | Ga0209436_105137 | 3300025208 | Bacteria | 3071 |
| 355 | Ga0209436_111871 | 3300025208 | Bacteria | 1507 |
| 356 | Ga0209672_101025 | 3300025228 | Bacteria | 12108 |
| 357 | Ga0209147_100906 | 3300025229 | Bacteria | 13388 |
| 358 | Ga0209258_100067 | 3300025242 | Bacteria | 287603 |
| 359 | Ga0207425_1000213 | 3300025245 | Bacteria | 46021 |
| 360 | Ga0207425_1002332 | 3300025245 | Bacteria | 6786 |
| 361 | Ga0209148_1000067 | 3300025254 | Bacteria | 338678 |
| 362 | Ga0209129_1000296 | 3300025258 | Bacteria | 46753 |
| 363 | Ga0209129_1006497 | 3300025258 | Bacteria | 3756 |
| 364 | Ga0209565_1000027 | 3300025263 | Bacteria | 360545 |
| 365 | Ga0209565_1000073 | 3300025263 | Bacteria | 164695 |
| 366 | Ga0209565_1006250 | 3300025263 | Bacteria | 3368 |
| 367 | Ga0209673_1000031 | 3300025273 | Bacteria | 347560 |
| 368 | Ga0209673_1000066 | 3300025273 | Bacteria | 250037 |
| 369 | Ga0209673_1000127 | 3300025273 | Bacteria | 164695 |
| 370 | Ga0209673_1001215 | 3300025273 | Bacteria | 27353 |
| 371 | Ga0209130_1000417 | 3300025284 | Bacteria | 45994 |
| 372 | Ga0209130_1002081 | 3300025284 | Bacteria | 10769 |
| 373 | Ga0209675_1000029 | 3300025291 | Bacteria | 281053 |
| 374 | Ga0209675_1000157 | 3300025291 | Bacteria | 88700 |
| 375 | Ga0209675_1007853 | 3300025291 | Bacteria | 4012 |
| 376 | Ga0209675_1008282 | 3300025291 | Bacteria | 3845 |
| 377 | Ga0209676_1000005 | 3300025292 | Bacteria | 1076001 |
| 378 | Ga0209676_1000098 | 3300025292 | Bacteria | 234305 |
| 379 | Ga0209676_1000123 | 3300025292 | Bacteria | 195351 |
| 380 | Ga0209676_1000186 | 3300025292 | Bacteria | 142440 |
| 381 | Ga0209676_1025345 | 3300025292 | Bacteria | 1904 |
| 382 | Ga0209025_1000104 | 3300025294 | Bacteria | 226895 |
| 383 | Ga0209025_1000902 | 3300025294 | Bacteria | 46045 |
| 384 | Ga0209025_1022283 | 3300025294 | Bacteria | 3366 |
| 385 | Ga0209564_1000090 | 3300025295 | Bacteria | 249298 |
| 386 | Ga0209564_1000734 | 3300025295 | Bacteria | 46683 |
| 387 | Ga0209758_1000050 | 3300025297 | Bacteria | 345008 |
| 388 | Ga0209758_1002384 | 3300025297 | Bacteria | 19346 |
| 389 | Ga0209050_1000007 | 3300025298 | Bacteria | 1187891 |
| 390 | Ga0209050_1000188 | 3300025298 | Bacteria | 138865 |
| 391 | Ga0209256_1000022 | 3300025299 | Bacteria | 481843 |
| 392 | Ga0209256_1000023 | 3300025299 | Bacteria | 461150 |
| 393 | Ga0209256_1000049 | 3300025299 | Bacteria | 310696 |
| 394 | Ga0207426_1000202 | 3300025302 | Bacteria | 143712 |
| 395 | Ga0207426_1000260 | 3300025302 | Bacteria | 114246 |
| 396 | Ga0209051_1000029 | 3300025303 | Bacteria | 403675 |
| 397 | Ga0209051_1000036 | 3300025303 | Bacteria | 339863 |
| 398 | Ga0209051_1000091 | 3300025303 | Bacteria | 173683 |
| 399 | Ga0209051_1000098 | 3300025303 | Bacteria | 165284 |
| 400 | Ga0209051_1000298 | 3300025303 | Bacteria | 78777 |
| 401 | Ga0209051_1028054 | 3300025303 | Bacteria | 2230 |
| 402 | Ga0209257_1000011 | 3300025304 | Bacteria | 1112630 |
| 403 | Ga0209257_1000057 | 3300025304 | Bacteria | 396985 |
| 404 | Ga0209257_1000168 | 3300025304 | Bacteria | 171312 |
| 405 | Ga0209257_1000800 | 3300025304 | Bacteria | 45909 |
| 406 | Ga0209257_1005944 | 3300025304 | Bacteria | 8198 |
| 407 | Ga0207697_10005112 | 3300025315 | Bacteria | 6141 |
| 408 | Ga0207656_10017243 | 3300025321 | Bacteria | 2825 |
| 409 | Ga0207656_10027007 | 3300025321 | Bacteria | 2345 |
| 410 | Ga0207656_10027975 | 3300025321 | Bacteria | 2310 |
| 411 | Ga0207655_1001409 | 3300025728 | Bacteria | 22356 |
| 412 | Ga0207682_10005184 | 3300025893 | Bacteria | 5335 |
| 413 | Ga0207642_10057526 | 3300025899 | Bacteria | 1789 |
| 414 | Ga0207688_10008591 | 3300025901 | Bacteria | 5560 |
| 415 | Ga0207688_10060870 | 3300025901 | Bacteria | 2128 |
| 416 | Ga0207647_10001513 | 3300025904 | Bacteria | 17873 |
| 417 | Ga0207685_10040174 | 3300025905 | Bacteria | 1742 |
| 418 | Ga0207645_10029290 | 3300025907 | Bacteria | 3550 |
| 419 | Ga0207643_10011009 | 3300025908 | Bacteria | 4881 |
| 420 | Ga0207643_10039075 | 3300025908 | Bacteria | 2669 |
| 421 | Ga0207643_10223152 | 3300025908 | Bacteria | 1154 |
| 422 | Ga0207705_10000564 | 3300025909 | Bacteria | 31096 |
| 423 | Ga0207705_10014942 | 3300025909 | Bacteria | 5582 |
| 424 | Ga0207707_10002857 | 3300025912 | Bacteria | 15425 |
| 425 | Ga0207695_10023486 | 3300025913 | Bacteria | 6964 |
| 426 | Ga0207695_10479856 | 3300025913 | Bacteria | 1126 |
| 427 | Ga0207693_10195735 | 3300025915 | Bacteria | 1590 |
| 428 | Ga0207663_10036511 | 3300025916 | Bacteria | 2957 |
| 429 | Ga0207660_10001862 | 3300025917 | Bacteria | 14055 |
| 430 | Ga0207660_10034902 | 3300025917 | Bacteria | 3489 |
| 431 | Ga0207662_10013335 | 3300025918 | Bacteria | 4596 |
| 432 | Ga0207662_10209630 | 3300025918 | Bacteria | 1264 |
| 433 | Ga0207657_10016156 | 3300025919 | Bacteria | 7206 |
| 434 | Ga0207657_10022687 | 3300025919 | Bacteria | 5865 |
| 435 | Ga0207649_10012778 | 3300025920 | Bacteria | 4670 |
| 436 | Ga0207649_10049039 | 3300025920 | Bacteria | 2606 |
| 437 | Ga0207649_10157515 | 3300025920 | Bacteria | 1570 |
| 438 | Ga0207652_10000796 | 3300025921 | Bacteria | 30107 |
| 439 | Ga0207681_10005013 | 3300025923 | Bacteria | 8136 |
| 440 | Ga0207681_10039820 | 3300025923 | Bacteria | 3123 |
| 441 | Ga0207681_10061572 | 3300025923 | Bacteria | 2581 |
| 442 | Ga0207681_10085785 | 3300025923 | Bacteria | 2235 |
| 443 | Ga0207681_10433693 | 3300025923 | Bacteria | 1066 |
| 444 | Ga0207694_10063457 | 3300025924 | Bacteria | 2878 |
| 445 | Ga0207694_10209644 | 3300025924 | Bacteria | 1587 |
| 446 | Ga0207650_10064331 | 3300025925 | Bacteria | 2745 |
| 447 | Ga0207650_10119252 | 3300025925 | Bacteria | 2052 |
| 448 | Ga0207659_10135850 | 3300025926 | Bacteria | 1903 |
| 449 | Ga0207687_10231925 | 3300025927 | Bacteria | 1458 |
| 450 | Ga0207644_10076074 | 3300025931 | Bacteria | 2468 |
| 451 | Ga0207644_10086918 | 3300025931 | Bacteria | 2322 |
| 452 | Ga0207706_10006375 | 3300025933 | Bacteria | 10957 |
| 453 | Ga0207706_10009612 | 3300025933 | Bacteria | 8875 |
| 454 | Ga0207706_10013795 | 3300025933 | Bacteria | 7333 |
| 455 | Ga0207706_10021932 | 3300025933 | Bacteria | 5732 |
| 456 | Ga0207706_10022691 | 3300025933 | Bacteria | 5634 |
| 457 | Ga0207706_10201512 | 3300025933 | Bacteria | 1746 |
| 458 | Ga0207709_10000019 | 3300025935 | Bacteria | 402225 |
| 459 | Ga0207709_10000130 | 3300025935 | Bacteria | 110843 |
| 460 | Ga0207709_10002008 | 3300025935 | Bacteria | 13202 |
| 461 | Ga0207709_10027274 | 3300025935 | Bacteria | 3288 |
| 462 | Ga0207670_10085152 | 3300025936 | Bacteria | 2221 |
| 463 | Ga0207669_10032343 | 3300025937 | Bacteria | 2936 |
| 464 | Ga0207704_10054603 | 3300025938 | Bacteria | 2436 |
| 465 | Ga0207704_10058704 | 3300025938 | Bacteria | 2370 |
| 466 | Ga0207691_10108612 | 3300025940 | Bacteria | 2469 |
| 467 | Ga0207691_10138889 | 3300025940 | Bacteria | 2142 |
| 468 | Ga0207691_10194637 | 3300025940 | Bacteria | 1767 |
| 469 | Ga0207691_10361337 | 3300025940 | Bacteria | 1241 |
| 470 | Ga0207711_10024546 | 3300025941 | Bacteria | 5053 |
| 471 | Ga0207711_10083054 | 3300025941 | Bacteria | 2801 |
| 472 | Ga0207689_10000320 | 3300025942 | Bacteria | 44520 |
| 473 | Ga0207689_10021236 | 3300025942 | Bacteria | 5458 |
| 474 | Ga0207689_10266439 | 3300025942 | Bacteria | 1418 |
| 475 | Ga0207661_10232938 | 3300025944 | Bacteria | 1631 |
| 476 | Ga0207679_10056475 | 3300025945 | Bacteria | 2898 |
| 477 | Ga0207679_10130641 | 3300025945 | Bacteria | 2014 |
| 478 | Ga0207679_10172060 | 3300025945 | Bacteria | 1784 |
| 479 | Ga0207679_10287488 | 3300025945 | Bacteria | 1412 |
| 480 | Ga0207679_10476655 | 3300025945 | Unclassified | 1110 |
| 481 | Ga0207667_10042087 | 3300025949 | Bacteria | 4858 |
| 482 | Ga0207667_10048943 | 3300025949 | Bacteria | 4467 |
| 483 | Ga0207667_10153920 | 3300025949 | Bacteria | 2366 |
| 484 | Ga0207667_10216026 | 3300025949 | Bacteria | 1965 |
| 485 | Ga0207651_10153723 | 3300025960 | Bacteria | 1795 |
| 486 | Ga0207651_10182012 | 3300025960 | Bacteria | 1668 |
| 487 | Ga0207712_10048486 | 3300025961 | Bacteria | 2955 |
| 488 | Ga0207712_10092760 | 3300025961 | Bacteria | 2227 |
| 489 | Ga0207668_10042383 | 3300025972 | Bacteria | 3082 |
| 490 | Ga0207668_10061337 | 3300025972 | Bacteria | 2644 |
| 491 | Ga0207668_10144803 | 3300025972 | Bacteria | 1832 |
| 492 | Ga0207640_10006832 | 3300025981 | Bacteria | 6272 |
| 493 | Ga0207640_10079885 | 3300025981 | Bacteria | 2231 |
| 494 | Ga0207640_10180445 | 3300025981 | Bacteria | 1582 |
| 495 | Ga0207640_10182606 | 3300025981 | Bacteria | 1574 |
| 496 | Ga0207640_10339945 | 3300025981 | Bacteria | 1202 |
| 497 | Ga0207658_10046245 | 3300025986 | Bacteria | 3177 |
| 498 | Ga0207658_10062892 | 3300025986 | Bacteria | 2779 |
| 499 | Ga0207658_10079414 | 3300025986 | Bacteria | 2510 |
| 500 | Ga0207658_10167428 | 3300025986 | Bacteria | 1807 |
| 501 | Ga0207677_10049693 | 3300026023 | Bacteria | 2832 |
| 502 | Ga0207677_10052706 | 3300026023 | Bacteria | 2765 |
| 503 | Ga0207677_10528727 | 3300026023 | Bacteria | 1024 |
| 504 | Ga0207703_10377606 | 3300026035 | Bacteria | 1310 |
| 505 | Ga0207639_10059995 | 3300026041 | Bacteria | 2933 |
| 506 | Ga0207639_10093611 | 3300026041 | Bacteria | 2410 |
| 507 | Ga0207639_10102943 | 3300026041 | Bacteria | 2312 |
| 508 | Ga0207678_10020101 | 3300026067 | Bacteria | 5865 |
| 509 | Ga0207678_10031604 | 3300026067 | Bacteria | 4617 |
| 510 | Ga0207708_10008451 | 3300026075 | Bacteria | 7621 |
| 511 | Ga0207708_10025102 | 3300026075 | Bacteria | 4507 |
| 512 | Ga0207708_10026016 | 3300026075 | Bacteria | 4427 |
| 513 | Ga0207708_10040181 | 3300026075 | Bacteria | 3566 |
| 514 | Ga0207708_10051142 | 3300026075 | Bacteria | 3145 |
| 515 | Ga0207702_10063231 | 3300026078 | Bacteria | 3164 |
| 516 | Ga0207702_10483777 | 3300026078 | Bacteria | 1205 |
| 517 | Ga0207641_10255090 | 3300026088 | Bacteria | 1640 |
| 518 | Ga0207648_10001873 | 3300026089 | Bacteria | 23008 |
| 519 | Ga0207648_10017375 | 3300026089 | Bacteria | 6546 |
| 520 | Ga0207648_10018664 | 3300026089 | Bacteria | 6275 |
| 521 | Ga0207648_10021970 | 3300026089 | Bacteria | 5732 |
| 522 | Ga0207648_10385421 | 3300026089 | Bacteria | 1268 |
| 523 | Ga0207648_10483443 | 3300026089 | Bacteria | 1131 |
| 524 | Ga0207676_10003299 | 3300026095 | Bacteria | 11461 |
| 525 | Ga0207676_10013531 | 3300026095 | Bacteria | 5858 |
| 526 | Ga0207676_10266895 | 3300026095 | Bacteria | 1548 |
| 527 | Ga0207674_10011742 | 3300026116 | Bacteria | 9828 |
| 528 | Ga0207674_10070608 | 3300026116 | Bacteria | 3511 |
| 529 | Ga0207674_10180942 | 3300026116 | Bacteria | 2059 |
| 530 | Ga0207674_10272565 | 3300026116 | Bacteria | 1640 |
| 531 | Ga0207675_100003062 | 3300026118 | Bacteria | 16396 |
| 532 | Ga0207675_100007594 | 3300026118 | Bacteria | 10243 |
| 533 | Ga0207675_100011774 | 3300026118 | Bacteria | 8177 |
| 534 | Ga0207675_100013483 | 3300026118 | Bacteria | 7626 |
| 535 | Ga0207675_100019754 | 3300026118 | Bacteria | 6288 |
| 536 | Ga0207675_100052998 | 3300026118 | Bacteria | 3785 |
| 537 | Ga0207675_100085814 | 3300026118 | Bacteria | 2955 |
| 538 | Ga0207683_10112578 | 3300026121 | Bacteria | 2437 |
| 539 | Ga0207683_10226209 | 3300026121 | Bacteria | 1705 |
| 540 | Ga0207683_10334477 | 3300026121 | Bacteria | 1388 |
| 541 | Ga0207698_10017184 | 3300026142 | Bacteria | 4900 |
| 542 | Ga0207698_10195806 | 3300026142 | Bacteria | 1805 |
| 543 | Ga0207698_10520939 | 3300026142 | Bacteria | 1160 |
| 544 | Ga0209281_1000005 | 3300027111 | Bacteria | 1242284 |
| 545 | Ga0209281_1000125 | 3300027111 | Bacteria | 200371 |
| 546 | Ga0209281_1014544 | 3300027111 | Bacteria | 1662 |
| 547 | Ga0209969_1002004 | 3300027360 | Bacteria | 2809 |
| 548 | Ga0209999_1001563 | 3300027543 | Bacteria | 3936 |
| 549 | Ga0209983_1010226 | 3300027665 | Bacteria | 1917 |
| 550 | Ga0209282_1015352 | 3300027666 | Bacteria | 4874 |
| 551 | Ga0209966_1015579 | 3300027695 | Bacteria | 1428 |
| 552 | Ga0209813_10069958 | 3300027866 | Bacteria | 1139 |
| 553 | Ga0207428_10047701 | 3300027907 | Bacteria | 3439 |
| 554 | Ga0268266_10008541 | 3300028379 | Bacteria | 9102 |
| 555 | Ga0268265_10001675 | 3300028380 | Bacteria | 18077 |
| 556 | Ga0268265_10029776 | 3300028380 | Bacteria | 3925 |
| 557 | Ga0268265_10035380 | 3300028380 | Bacteria | 3649 |
| 558 | Ga0268265_10036907 | 3300028380 | Bacteria | 3583 |
| 559 | Ga0268265_10169799 | 3300028380 | Bacteria | 1863 |
| 560 | Ga0268265_10170909 | 3300028380 | Bacteria | 1857 |
| 561 | Ga0268265_10186033 | 3300028380 | Bacteria | 1789 |
| 562 | Ga0268265_10197428 | 3300028380 | Bacteria | 1742 |
| 563 | Ga0268264_10002570 | 3300028381 | Bacteria | 15905 |
| 564 | Ga0268264_10071595 | 3300028381 | Bacteria | 2938 |
| 565 | Ga0265318_10002709 | 3300028577 | Bacteria | 9295 |
| 566 | Ga0307515_10013496 | 3300028794 | Bacteria | 15262 |
| 567 | Ga0307515_10135551 | 3300028794 | Bacteria | 2680 |
| 568 | Ga0307515_10203958 | 3300028794 | Bacteria | 1844 |
| 569 | Ga0316177_1003817 | 3300030731 | Bacteria | 7536 |
| 570 | Ga0316176_1149365 | 3300030732 | Bacteria | 4172 |
| 571 | Ga0314311_1083999 | 3300030733 | Bacteria | 4359 |
| 572 | Ga0316179_1085170 | 3300030734 | Bacteria | 2401 |
| 573 | Ga0316178_1017927 | 3300030735 | Bacteria | 3412 |
| 574 | Ga0316180_1046521 | 3300030736 | Bacteria | 2980 |
| 575 | Ga0316183_1151240 | 3300030742 | Bacteria | 10848 |
| 576 | Ga0316182_1058328 | 3300030745 | Bacteria | 1446 |
| 577 | Ga0316182_1410417 | 3300030745 | Bacteria | 2075 |
| 578 | Ga0265332_10003349 | 3300031238 | Bacteria | 7763 |
| 579 | Ga0265328_10008502 | 3300031239 | Bacteria | 4228 |
| 580 | Ga0265329_10011235 | 3300031242 | Bacteria | 3259 |
| 581 | Ga0265331_10000851 | 3300031250 | Bacteria | 24815 |
| 582 | Ga0265331_10003732 | 3300031250 | Bacteria | 9678 |
| 583 | Ga0265327_10000307 | 3300031251 | Bacteria | 95145 |
| 584 | Ga0265316_10010873 | 3300031344 | Bacteria | 8263 |
| 585 | Ga0307513_10027912 | 3300031456 | Bacteria | 6469 |
| 586 | Ga0307513_10174518 | 3300031456 | Bacteria | 2022 |
| 587 | Ga0307513_10426099 | 3300031456 | Bacteria | 1056 |
| 588 | Ga0307509_10049938 | 3300031507 | Bacteria | 4482 |
| 589 | Ga0307408_100039531 | 3300031548 | Bacteria | 3335 |
| 590 | Ga0307408_100050469 | 3300031548 | Bacteria | 2992 |
| 591 | Ga0307408_100064395 | 3300031548 | Bacteria | 2685 |
| 592 | Ga0307408_100223344 | 3300031548 | Bacteria | 1538 |
| 593 | Ga0307514_10071427 | 3300031649 | Bacteria | 2603 |
| 594 | Ga0265314_10001467 | 3300031711 | Bacteria | 26276 |
| 595 | Ga0307405_10139538 | 3300031731 | Bacteria | 1688 |
| 596 | Ga0307405_10275864 | 3300031731 | Bacteria | 1263 |
| 597 | Ga0307413_10025594 | 3300031824 | Bacteria | 3237 |
| 598 | Ga0307413_10028219 | 3300031824 | Bacteria | 3122 |
| 599 | Ga0307413_10355611 | 3300031824 | Bacteria | 1132 |
| 600 | Ga0307410_10010931 | 3300031852 | Bacteria | 5167 |
| 601 | Ga0307410_10022516 | 3300031852 | Bacteria | 3897 |
| 602 | Ga0307406_10003021 | 3300031901 | Bacteria | 9153 |
| 603 | Ga0307412_10019731 | 3300031911 | Bacteria | 4089 |
| 604 | Ga0307412_10203920 | 3300031911 | Bacteria | 1504 |
| 605 | Ga0307416_100124232 | 3300032002 | Bacteria | 2308 |
| 606 | Ga0307416_100139246 | 3300032002 | Bacteria | 2202 |
| 607 | Ga0307416_100654919 | 3300032002 | Bacteria | 1135 |
| 608 | Ga0307414_10121866 | 3300032004 | Bacteria | 2006 |
| 609 | Ga0307414_10202554 | 3300032004 | Bacteria | 1615 |
| 610 | Ga0307411_10025348 | 3300032005 | Bacteria | 3552 |
| 611 | Ga0307411_10037715 | 3300032005 | Bacteria | 3042 |
| 612 | Ga0307411_10043857 | 3300032005 | Bacteria | 2864 |
| 613 | Ga0307411_10226442 | 3300032005 | Bacteria | 1454 |
| 614 | Ga0307507_10098315 | 3300033179 | Bacteria | 2465 |
| 615 | Ga0373948_0019188 | 3300034817 | Bacteria | 1291 |
| 616 | Ga0373938_0005118 | 3300034957 | Bacteria | 2218 |
| 617 | Ga0373926_0088517 | 3300035083 | Bacteria | 1150 |
| 618 | Ga0373934_0000061 | 3300035086 | Bacteria | 37034 |
| 619 | Ga0373934_0004954 | 3300035086 | Bacteria | 4935 |
| 620 | Ga0373940_0005226 | 3300035088 | Bacteria | 2798 |
| 621 | Ga0373940_0079027 | 3300035088 | Bacteria | 970 |
| 622 | Ga0373951_0005703 | 3300035091 | Bacteria | 2882 |
| 623 | Ga0373941_0004745 | 3300035115 | Bacteria | 3160 |
| 624 | Ga0373941_0037713 | 3300035115 | Bacteria | 1476 |
| 625 | Ga0373945_0016993 | 3300035116 | Bacteria | 2462 |
| 626 | Ga0373956_0000003 | 3300035119 | Bacteria | 81669 |
| 627 | Ga0373956_0049071 | 3300035119 | Bacteria | 1892 |
| 628 | Ga0373957_0006728 | 3300035120 | Bacteria | 3638 |
| 629 | Ga0373943_0163565 | 3300035170 | Bacteria | 1213 |
| 630 | Ga0373931_0006858 | 3300035691 | Bacteria | 5354 |
| 631 | Ga0373931_0030727 | 3300035691 | Bacteria | 2768 |
| 632 | Ga0373935_0049767 | 3300035692 | Bacteria | 2657 |
| 633 | Ga0373927_0033886 | 3300035695 | Bacteria | 3323 |
| 634 | Ga0373933_0000742 | 3300035724 | Bacteria | 19915 |
| 635 | Ga0373947_0118636 | 3300035725 | Bacteria | 1679 |
| 636 | Ga0373937_0000196 | 3300036401 | Bacteria | 59256 |
| 637 | Ga0373937_0150707 | 3300036401 | Bacteria | 2178 |
| 638 | Ga0373937_0153344 | 3300036401 | Bacteria | 2159 |
| 639 | Ga0373925_0081477 | 3300037068 | Bacteria | 2461 |
| 640 | Ga0395900_0081438 | 3300037418 | Bacteria | 3326 |
| 641 | Ga0395898_0007248 | 3300037466 | Bacteria | 11769 |
| 642 | Ga0395905_0030863 | 3300037471 | Bacteria | 5047 |
| 643 | Ga0395905_0050493 | 3300037471 | Bacteria | 3896 |
| 644 | Ga0395901_0027576 | 3300038443 | Bacteria | 5837 |
| 645 | Ga0395901_0053698 | 3300038443 | Bacteria | 4187 |
| 646 | Ga0395901_0225210 | 3300038443 | Bacteria | 1959 |
| 647 | Ga0436361_0931472 | 3300039447 | Bacteria | 5962 |
| 648 | Ga0439466_0054914 | 3300041411 | Bacteria | 1296 |
| 649 | Ga0451807_2059420 | 3300041486 | Bacteria | 1608 |
| 650 | Ga0451843_0974250 | 3300041509 | Bacteria | 972 |
| 651 | Ga0439431_0021016 | 3300041997 | Bacteria | 1564 |
| 652 | Ga0439431_0021376 | 3300041997 | Bacteria | 1553 |
| 653 | Ga0439451_009245 | 3300042009 | Bacteria | 1995 |
| 654 | Ga0450898_008466 | 3300042134 | Bacteria | 1624 |
| 655 | Ga0450908_015792 | 3300042184 | Bacteria | 1350 |
| 656 | Ga0439434_0006693 | 3300042435 | Bacteria | 3368 |
| 657 | Ga0439434_0012979 | 3300042435 | Bacteria | 2470 |
| 658 | Ga0439435_0043938 | 3300042436 | Bacteria | 1258 |
| 659 | Ga0439464_0034703 | 3300042439 | Bacteria | 1423 |
| 660 | Ga0439460_0057314 | 3300042461 | Bacteria | 1181 |
| 661 | Ga0450918_014549 | 3300042531 | Bacteria | 1367 |
| 662 | Ga0451577_0081047 | 3300042876 | Bacteria | 2894 |
| 663 | Ga0453683_0001302 | 3300044673 | Bacteria | 22014 |
| 664 | Ga0453684_0781598 | 3300044712 | Bacteria | 1031 |
| 665 | Ga0451576_0001486 | 3300045051 | Bacteria | 39626 |
| 666 | Ga0451576_0004712 | 3300045051 | Bacteria | 17529 |
| 667 | Ga0451576_0007943 | 3300045051 | Bacteria | 12552 |
| 668 | Ga0451576_0094993 | 3300045051 | Bacteria | 3101 |
| 669 | Ga0451576_0258628 | 3300045051 | Bacteria | 1819 |
| 670 | Ga0495627_012156 | 3300046453 | Bacteria | 3065 |
| 671 | Ga0495592_0163172 | 3300046454 | Bacteria | 1531 |
| 672 | Ga0495590_0002628 | 3300046457 | Bacteria | 7428 |
| 673 | Ga0495629_0079155 | 3300046459 | Bacteria | 2295 |
| 674 | Ga0495629_0166816 | 3300046459 | Bacteria | 1529 |
| 675 | Ga0495651_0000105 | 3300046462 | Bacteria | 61688 |
| 676 | Ga0495651_0012584 | 3300046462 | Bacteria | 6530 |
| 677 | Ga0495653_0016021 | 3300046463 | Bacteria | 6109 |
| 678 | Ga0495580_0022385 | 3300046472 | Bacteria | 4651 |
| 679 | Ga0495580_0194762 | 3300046472 | Bacteria | 1397 |
| 680 | Ga0495639_0032738 | 3300046475 | Bacteria | 2319 |
| 681 | Ga0495662_0028518 | 3300046476 | Bacteria | 2694 |
| 682 | Ga0495594_0059477 | 3300046499 | Bacteria | 2113 |
| 683 | Ga0495608_0122044 | 3300046511 | Bacteria | 1670 |
| 684 | Ga0495610_0037643 | 3300046512 | Bacteria | 2460 |
| 685 | Ga0495616_0032520 | 3300046513 | Bacteria | 2724 |
| 686 | Ga0495618_0012194 | 3300046514 | Bacteria | 5217 |
| 687 | Ga0495620_0024912 | 3300046515 | Bacteria | 2839 |
| 688 | Ga0495620_0029572 | 3300046515 | Bacteria | 2533 |
| 689 | Ga0495628_0155565 | 3300046516 | Bacteria | 1739 |
| 690 | Ga0495630_0002338 | 3300046517 | Bacteria | 13181 |
| 691 | Ga0495631_0000530 | 3300046518 | Bacteria | 25592 |
| 692 | Ga0495632_0038981 | 3300046519 | Bacteria | 2402 |
| 693 | Ga0495652_0037438 | 3300046529 | Bacteria | 4209 |
| 694 | Ga0495654_0090044 | 3300046530 | Bacteria | 1425 |
| 695 | Ga0495665_0013415 | 3300046531 | Bacteria | 4430 |
| 696 | Ga0495640_0072172 | 3300046533 | Bacteria | 2313 |
| 697 | Ga0495587_0081290 | 3300046536 | Bacteria | 1877 |
| 698 | Ga0495667_0128378 | 3300046559 | Bacteria | 1635 |
| 699 | Ga0495634_0066291 | 3300046642 | Bacteria | 2390 |
| 700 | Ga0495625_0000301 | 3300046660 | Bacteria | 76108 |
| 701 | Ga0495625_0255062 | 3300046660 | Bacteria | 1137 |
| 702 | Ga0495588_0101191 | 3300046674 | Bacteria | 1514 |
| 703 | Ga0495657_0017967 | 3300046675 | Bacteria | 5127 |
| 704 | Ga0495657_0047921 | 3300046675 | Bacteria | 2886 |
| 705 | Ga0495647_0024140 | 3300046681 | Bacteria | 2211 |
| 706 | Ga0495658_0020266 | 3300046683 | Bacteria | 3486 |
| 707 | Ga0495658_0103737 | 3300046683 | Bacteria | 1701 |
| 708 | Ga0495669_0040549 | 3300046684 | Bacteria | 2065 |
| 709 | Ga0495669_0122501 | 3300046684 | Bacteria | 1220 |
| 710 | Ga0495670_0061135 | 3300046691 | Bacteria | 1893 |
| 711 | Ga0495671_0027049 | 3300046692 | Bacteria | 2966 |
| 712 | Ga0495600_0002368 | 3300046809 | Bacteria | 10773 |
| 713 | Ga0495674_0009959 | 3300047319 | Bacteria | 9014 |
| 714 | Ga0495672_0081770 | 3300047320 | Bacteria | 1798 |
| 715 | Ga0495676_0001586 | 3300047321 | Bacteria | 19725 |
| 716 | Ga0495680_0101718 | 3300047322 | Bacteria | 2140 |
| 717 | Ga0495675_0006291 | 3300047444 | Bacteria | 7268 |
| 718 | Ga0495593_0027123 | 3300047673 | Bacteria | 3155 |
| 719 | Ga0495614_0005764 | 3300048089 | Bacteria | 5577 |
| 720 | Ga0496100_0067238 | 3300048903 | Bacteria | 2379 |
| 721 | Ga0496101_0017256 | 3300048904 | Bacteria | 4894 |
| 722 | Ga0496101_0034674 | 3300048904 | Bacteria | 3566 |
| 723 | Ga0496102_0007543 | 3300048905 | Bacteria | 9299 |
| 724 | Ga0496102_0123693 | 3300048905 | Bacteria | 2417 |
| 725 | Ga0496102_0406185 | 3300048905 | Bacteria | 1280 |
| 726 | Ga0496104_0095803 | 3300048907 | Bacteria | 2839 |
| 727 | Ga0496105_0039488 | 3300048908 | Bacteria | 3890 |
| 728 | Ga0496105_0134324 | 3300048908 | Bacteria | 2039 |
| 729 | Ga0496106_0040117 | 3300048909 | Bacteria | 3505 |
| 730 | Ga0496106_0045843 | 3300048909 | Bacteria | 3285 |
| 731 | Ga0496107_0040387 | 3300048910 | Bacteria | 3349 |
| 732 | Ga0496109_0050631 | 3300048912 | Bacteria | 3782 |
| 733 | Ga0496109_0407723 | 3300048912 | Bacteria | 1284 |
| 734 | Ga0496110_0111368 | 3300048913 | Bacteria | 2460 |
| 735 | Ga0496110_0498723 | 3300048913 | Bacteria | 1108 |
| 736 | Ga0496111_0067637 | 3300048914 | Bacteria | 2595 |
| 737 | Ga0496114_0003146 | 3300048917 | Bacteria | 12674 |
| 738 | Ga0496114_0070605 | 3300048917 | Bacteria | 2934 |
| 739 | Ga0496114_0376664 | 3300048917 | Bacteria | 1256 |
| 740 | Ga0496115_0013455 | 3300048918 | Bacteria | 6190 |
| 741 | Ga0496116_0011139 | 3300048919 | Bacteria | 7476 |
| 742 | Ga0496117_0005063 | 3300048920 | Bacteria | 14119 |
| 743 | Ga0496117_0022171 | 3300048920 | Bacteria | 5099 |
| 744 | Ga0496118_0019623 | 3300048921 | Bacteria | 6034 |
| 745 | Ga0496118_0070793 | 3300048921 | Bacteria | 2515 |
| 746 | Ga0496119_0166254 | 3300048922 | Bacteria | 1168 |
| 747 | Ga0496121_0084891 | 3300048924 | Bacteria | 2494 |
| 748 | Ga0496121_0140258 | 3300048924 | Bacteria | 1794 |
| 749 | Ga0496122_0001420 | 3300048925 | Bacteria | 38777 |
| 750 | Ga0496122_0022636 | 3300048925 | Bacteria | 5578 |
| 751 | Ga0496123_0000600 | 3300048926 | Bacteria | 61187 |
| 752 | Ga0496123_0027586 | 3300048926 | Bacteria | 4226 |
| 753 | Ga0496123_0114229 | 3300048926 | Bacteria | 1536 |
| 754 | Ga0496124_0040881 | 3300048927 | Bacteria | 4006 |
| 755 | Ga0496124_0071187 | 3300048927 | Bacteria | 2883 |
| 756 | Ga0496124_0077267 | 3300048927 | Bacteria | 2746 |
| 757 | Ga0496125_0061116 | 3300048928 | Bacteria | 3023 |
| 758 | Ga0496125_0072287 | 3300048928 | Bacteria | 2688 |
| 759 | Ga0496126_0251682 | 3300048929 | Bacteria | 1472 |
| 760 | Ga0501031_0004874 | 3300049568 | Bacteria | 8725 |
| 761 | Ga0501032_0015623 | 3300049569 | Bacteria | 5353 |
| 762 | Ga0501032_0099172 | 3300049569 | Bacteria | 1930 |
| 763 | Ga0501033_0004194 | 3300049570 | Bacteria | 11601 |
| 764 | Ga0501034_0010873 | 3300049571 | Bacteria | 9453 |
| 765 | Ga0501034_0061896 | 3300049571 | Bacteria | 3758 |
| 766 | Ga0501036_0000096 | 3300049572 | Bacteria | 54442 |
| 767 | Ga0501036_0038821 | 3300049572 | Bacteria | 4031 |
| 768 | Ga0501036_0093154 | 3300049572 | Bacteria | 2545 |
| 769 | Ga0501036_0109975 | 3300049572 | Bacteria | 2329 |
| 770 | Ga0501037_0004400 | 3300049573 | Bacteria | 10237 |
| 771 | Ga0501037_0042325 | 3300049573 | Bacteria | 3347 |
| 772 | Ga0501037_0085049 | 3300049573 | Bacteria | 2290 |
| 773 | Ga0501038_0000791 | 3300049574 | Bacteria | 28037 |
| 774 | Ga0501038_0010443 | 3300049574 | Bacteria | 8493 |
| 775 | Ga0501038_0084936 | 3300049574 | Bacteria | 2663 |
| 776 | Ga0501038_0369948 | 3300049574 | Unclassified | 1113 |
| 777 | Ga0501038_0442121 | 3300049574 | Bacteria | 1001 |
| 778 | Ga0501039_0008295 | 3300049575 | Bacteria | 7917 |
| 779 | Ga0501039_0026073 | 3300049575 | Bacteria | 4493 |
| 780 | Ga0501039_0033181 | 3300049575 | Bacteria | 3982 |
| 781 | Ga0501039_0080615 | 3300049575 | Bacteria | 2533 |
| 782 | Ga0501040_0000395 | 3300049576 | Bacteria | 25703 |
| 783 | Ga0501040_0013815 | 3300049576 | Bacteria | 5315 |
| 784 | Ga0501040_0105749 | 3300049576 | Bacteria | 1966 |
| 785 | Ga0501040_0122636 | 3300049576 | Bacteria | 1824 |
| 786 | Ga0501040_0239013 | 3300049576 | Bacteria | 1294 |
| 787 | Ga0501041_0000652 | 3300049577 | Bacteria | 18234 |
| 788 | Ga0501041_0010232 | 3300049577 | Bacteria | 5528 |
| 789 | Ga0501041_0042688 | 3300049577 | Bacteria | 2756 |
| 790 | Ga0501041_0176156 | 3300049577 | Bacteria | 1339 |
| 791 | Ga0501041_0220872 | 3300049577 | Bacteria | 1189 |
| 792 | Ga0501042_0003069 | 3300049578 | Bacteria | 10402 |
| 793 | Ga0501042_0005972 | 3300049578 | Bacteria | 7885 |
| 794 | Ga0501042_0074791 | 3300049578 | Bacteria | 2424 |
| 795 | Ga0501043_0023407 | 3300049579 | Bacteria | 4845 |
| 796 | Ga0501043_0142919 | 3300049579 | Bacteria | 1873 |
| 797 | Ga0501046_0000200 | 3300049580 | Bacteria | 61991 |
| 798 | Ga0501047_0002970 | 3300049581 | Bacteria | 16081 |
| 799 | Ga0501047_0105650 | 3300049581 | Bacteria | 2696 |
| 800 | Ga0501047_0112496 | 3300049581 | Bacteria | 2604 |
| 801 | Ga0501048_0004765 | 3300049582 | Bacteria | 10333 |
| 802 | Ga0501048_0022496 | 3300049582 | Bacteria | 4610 |
| 803 | Ga0501048_0039302 | 3300049582 | Bacteria | 3395 |
| 804 | Ga0501048_0090366 | 3300049582 | Bacteria | 2160 |
| 805 | Ga0501048_0147469 | 3300049582 | Bacteria | 1664 |
| 806 | Ga0501067_0011911 | 3300049583 | Bacteria | 4818 |
| 807 | Ga0501068_0010137 | 3300049584 | Bacteria | 5286 |
| 808 | Ga0501068_0028818 | 3300049584 | Bacteria | 3286 |
| 809 | Ga0501068_0032767 | 3300049584 | Bacteria | 3090 |
| 810 | Ga0501068_0180297 | 3300049584 | Bacteria | 1335 |
| 811 | Ga0501069_0010656 | 3300049585 | Bacteria | 4872 |
| 812 | Ga0501070_0000395 | 3300049586 | Bacteria | 40067 |
| 813 | Ga0501070_0006146 | 3300049586 | Bacteria | 10239 |
| 814 | Ga0501070_0103813 | 3300049586 | Bacteria | 2350 |
| 815 | Ga0501071_0001339 | 3300049587 | Bacteria | 14072 |
| 816 | Ga0501071_0003384 | 3300049587 | Bacteria | 9959 |
| 817 | Ga0501071_0007818 | 3300049587 | Bacteria | 7051 |
| 818 | Ga0501071_0008613 | 3300049587 | Bacteria | 6742 |
| 819 | Ga0501071_0041498 | 3300049587 | Bacteria | 3295 |
| 820 | Ga0501071_0174125 | 3300049587 | Bacteria | 1611 |
| 821 | Ga0501072_0000765 | 3300049588 | Bacteria | 23435 |
| 822 | Ga0501072_0002044 | 3300049588 | Bacteria | 15013 |
| 823 | Ga0501072_0029239 | 3300049588 | Bacteria | 4303 |
| 824 | Ga0501072_0029789 | 3300049588 | Bacteria | 4265 |
| 825 | Ga0501072_0048278 | 3300049588 | Bacteria | 3352 |
| 826 | Ga0501072_0120934 | 3300049588 | Bacteria | 2086 |
| 827 | Ga0501073_0002813 | 3300049589 | Bacteria | 13024 |
| 828 | Ga0501073_0003806 | 3300049589 | Bacteria | 11331 |
| 829 | Ga0501073_0037854 | 3300049589 | Bacteria | 3424 |
| 830 | Ga0501074_0002220 | 3300049590 | Bacteria | 13466 |
| 831 | Ga0501074_0007488 | 3300049590 | Bacteria | 7897 |
| 832 | Ga0501074_0021069 | 3300049590 | Bacteria | 4734 |
| 833 | Ga0501074_0051128 | 3300049590 | Bacteria | 2983 |
| 834 | Ga0501074_0162538 | 3300049590 | Bacteria | 1595 |
| 835 | Ga0501074_0176914 | 3300049590 | Bacteria | 1523 |
| 836 | Ga0501074_0274560 | 3300049590 | Bacteria | 1198 |
| 837 | Ga0501075_0000232 | 3300049591 | Bacteria | 29854 |
| 838 | Ga0501075_0093945 | 3300049591 | Bacteria | 2276 |
| 839 | Ga0501075_0098814 | 3300049591 | Bacteria | 2216 |
| 840 | Ga0501075_0168446 | 3300049591 | Bacteria | 1671 |
| 841 | Ga0501076_0002129 | 3300049592 | Bacteria | 13587 |
| 842 | Ga0501076_0005762 | 3300049592 | Bacteria | 8931 |
| 843 | Ga0501076_0048321 | 3300049592 | Bacteria | 3363 |
| 844 | Ga0501076_0051916 | 3300049592 | Bacteria | 3246 |
| 845 | Ga0501076_0059613 | 3300049592 | Bacteria | 3036 |
| 846 | Ga0501076_0200028 | 3300049592 | Bacteria | 1631 |
| 847 | Ga0501076_0447199 | 3300049592 | Bacteria | 1064 |
| 848 | Ga0501077_0004846 | 3300049593 | Bacteria | 8174 |
| 849 | Ga0501077_0087156 | 3300049593 | Bacteria | 1979 |
| 850 | Ga0501077_0121118 | 3300049593 | Bacteria | 1658 |
| 851 | Ga0501077_0303880 | 3300049593 | Bacteria | 1016 |
| 852 | Ga0501079_0000385 | 3300049741 | Bacteria | 28427 |
| 853 | Ga0501079_0003631 | 3300049741 | Bacteria | 11359 |
| 854 | Ga0501079_0031455 | 3300049741 | Bacteria | 4079 |
| 855 | Ga0501080_0000663 | 3300049742 | Bacteria | 27344 |
| 856 | Ga0501080_0003450 | 3300049742 | Bacteria | 13954 |
| 857 | Ga0501080_0016236 | 3300049742 | Bacteria | 6873 |
| 858 | Ga0501080_0066411 | 3300049742 | Bacteria | 3354 |
| 859 | Ga0501080_0091510 | 3300049742 | Bacteria | 2825 |
| 860 | Ga0501080_0140046 | 3300049742 | Bacteria | 2237 |
| 861 | Ga0501080_0182297 | 3300049742 | Bacteria | 1932 |
| 862 | Ga0501080_0208550 | 3300049742 | Bacteria | 1791 |
| 863 | Ga0501081_0002360 | 3300049743 | Bacteria | 11890 |
| 864 | Ga0501081_0081310 | 3300049743 | Bacteria | 2269 |
| 865 | Ga0501081_0176812 | 3300049743 | Bacteria | 1543 |
| 866 | Ga0501083_0031006 | 3300049744 | Bacteria | 3670 |
| 867 | Ga0501083_0051358 | 3300049744 | Bacteria | 2773 |
| 868 | Ga0501083_0083684 | 3300049744 | Bacteria | 2113 |
| 869 | Ga0501262_000019 | 3300049759 | Bacteria | 23083 |
| 870 | Ga0501035_0011489 | 3300049822 | Bacteria | 8205 |
| 871 | Ga0501035_0029066 | 3300049822 | Bacteria | 5041 |
| 872 | Ga0501035_0087952 | 3300049822 | Bacteria | 2738 |
| 873 | Ga0501044_0100778 | 3300049823 | Bacteria | 2906 |
| 874 | Ga0501044_0113506 | 3300049823 | Bacteria | 2716 |
| 875 | Ga0501045_0000087 | 3300049824 | Bacteria | 43859 |
| 876 | Ga0501045_0001611 | 3300049824 | Bacteria | 15104 |
| 877 | Ga0501045_0061952 | 3300049824 | Bacteria | 2745 |
| 878 | nmdc:mga03683_12565_c1 | 3300050489 | Bacteria | 3097 |
| 879 | nmdc:mga03683_44813_c1 | 3300050489 | Bacteria | 1829 |
| 880 | nmdc:mga03683_48867_c1 | 3300050489 | Bacteria | 1759 |
| 881 | nmdc:mga03n38_101880_c1 | 3300050490 | Bacteria | 1386 |
| 882 | nmdc:mga03n38_94249_c1 | 3300050490 | Bacteria | 1432 |
| 883 | nmdc:mga00v17_43064_c1 | 3300050491 | Bacteria | 2718 |
| 884 | nmdc:mga00v17_7571_c1 | 3300050491 | Bacteria | 5801 |
| 885 | nmdc:mga0yw44_178568_c1 | 3300050492 | Bacteria | 1396 |
| 886 | nmdc:mga0yw44_41081_c1 | 3300050492 | Bacteria | 2751 |
| 887 | nmdc:mga0yw44_8270_c1 | 3300050492 | Bacteria | 5170 |
| 888 | nmdc:mga0k408_140243_c1 | 3300050493 | Bacteria | 1438 |
| 889 | nmdc:mga0k408_222030_c1 | 3300050493 | Bacteria | 1128 |
| 890 | nmdc:mga0k408_42947_c1 | 3300050493 | Bacteria | 2604 |
| 891 | nmdc:mga0k408_5475_c1 | 3300050493 | Bacteria | 6759 |
| 892 | nmdc:mga0k408_74029_c1 | 3300050493 | Bacteria | 1990 |
| 893 | nmdc:mga04h51_8520_c1 | 3300050495 | Bacteria | 2746 |
| 894 | nmdc:mga07m45_2775_c1 | 3300050496 | Bacteria | 8275 |
| 895 | nmdc:mga07m45_31312_c1 | 3300050496 | Bacteria | 2948 |
| 896 | nmdc:mga07m45_54575_c1 | 3300050496 | Bacteria | 2258 |
| 897 | nmdc:mga07m45_60505_c1 | 3300050496 | Bacteria | 2144 |
| 898 | nmdc:mga05p37_1073_c1 | 3300050507 | Bacteria | 31314 |
| 899 | nmdc:mga09592_2292_c1 | 3300050508 | Bacteria | 15432 |
| 900 | nmdc:mga09592_231919_c1 | 3300050508 | Bacteria | 1600 |
| 901 | nmdc:mga0qj67_34611_c1 | 3300050509 | Bacteria | 3946 |
| 902 | nmdc:mga06r32_3362_c1 | 3300050510 | Bacteria | 14319 |
| 903 | nmdc:mga08y16_149083_c1 | 3300050511 | Bacteria | 2432 |
| 904 | nmdc:mga08y16_185963_c1 | 3300050511 | Bacteria | 2156 |
| 905 | nmdc:mga08y16_289275_c1 | 3300050511 | Bacteria | 1689 |
| 906 | nmdc:mga08y16_80476_c1 | 3300050511 | Bacteria | 3397 |
| 907 | nmdc:mga0n895_146167_c1 | 3300050512 | Bacteria | 2394 |
| 908 | nmdc:mga0a205_138744_c1 | 3300050515 | Bacteria | 2331 |
| 909 | Ga0495601_0071342 | 3300053077 | Bacteria | 2218 |
| 910 | Ga0500610_0000054 | 3300053079 | Bacteria | 36566 |
| 911 | Ga0500610_0000226 | 3300053079 | Bacteria | 17128 |
| 912 | Ga0495595_0002788 | 3300053084 | Bacteria | 6870 |
| 913 | Ga0495619_0104444 | 3300053085 | Bacteria | 1931 |
| 914 | Ga0495619_0145180 | 3300053085 | Bacteria | 1635 |
| 915 | Ga0500651_0055225 | 3300053093 | Bacteria | 2488 |
| 916 | Ga0500555_030779 | 3300053103 | Bacteria | 1522 |
| 917 | Ga0500562_016884 | 3300053108 | Bacteria | 1878 |
| 918 | Ga0500569_013388 | 3300053109 | Bacteria | 2007 |
| 919 | Ga0500569_025211 | 3300053109 | Bacteria | 1617 |
| 920 | Ga0500571_000117 | 3300053110 | Bacteria | 25994 |
| 921 | Ga0500593_000535 | 3300053117 | Bacteria | 14946 |
| 922 | Ga0500594_0002816 | 3300053118 | Bacteria | 3790 |
| 923 | Ga0500607_001551 | 3300053121 | Bacteria | 20371 |
| 924 | Ga0500608_025912 | 3300053122 | Bacteria | 2749 |
| 925 | Ga0500658_0000018 | 3300053134 | Bacteria | 141217 |
| 926 | Ga0500559_0004905 | 3300053136 | Bacteria | 6236 |
| 927 | Ga0500559_0139303 | 3300053136 | Bacteria | 1135 |
| 928 | Ga0500568_0006939 | 3300053139 | Bacteria | 5617 |
| 929 | Ga0500568_0058483 | 3300053139 | Bacteria | 1497 |
| 930 | Ga0500573_0062433 | 3300053140 | Bacteria | 2133 |
| 931 | Ga0500574_001122 | 3300053141 | Bacteria | 3822 |
| 932 | Ga0500616_0000016 | 3300053153 | Bacteria | 627087 |
| 933 | Ga0500616_0123903 | 3300053153 | Bacteria | 1230 |
| 934 | Ga0500627_0056553 | 3300053158 | Bacteria | 1719 |
| 935 | Ga0500634_0002332 | 3300053161 | Bacteria | 7960 |
| 936 | Ga0500645_034152 | 3300053730 | Bacteria | 1519 |
| 937 | Ga0501084_0004143 | 3300054114 | Bacteria | 11816 |
| 938 | Ga0501084_0013044 | 3300054114 | Bacteria | 6878 |
| 939 | Ga0501084_0027732 | 3300054114 | Bacteria | 4732 |
| 940 | Ga0501084_0028455 | 3300054114 | Bacteria | 4671 |
| 941 | Ga0501084_0047035 | 3300054114 | Bacteria | 3613 |
| 942 | Ga0501084_0105847 | 3300054114 | Bacteria | 2363 |
| 943 | Ga0501082_0010273 | 3300060353 | Bacteria | 8059 |
| 944 | Ga0501082_0078722 | 3300060353 | Bacteria | 2843 |
| 945 | Ga0501082_0104173 | 3300060353 | Bacteria | 2454 |
| 946 | Ga0501082_0179587 | 3300060353 | Bacteria | 1841 |
| 947 | Ga0530510_0000522 | 3300061734 | Bacteria | 24577 |
| 948 | Ga0530510_0004510 | 3300061734 | Bacteria | 9639 |
| 949 | Ga0530510_0044260 | 3300061734 | Bacteria | 3216 |
| 950 | Ga0530510_0080253 | 3300061734 | Bacteria | 2374 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048917 | Ga0496114_0376664 | Ga0496114_0376664_20_805 | 250 |
| 2 | 3300050492 | nmdc:mga0yw44_178568_c1 | nmdc:mga0yw44_178568_c1_596_1378 | 254 |
| 3 | 3300005548 | Ga0070665_100379394 | Ga0070665_1003793943 | 259 |
| 4 | 3300035691 | Ga0373931_0030727 | Ga0373931_0030727_15_836 | 266 |
| 5 | 3300005354 | Ga0070675_100061199 | Ga0070675_1000611991 | 267 |
| 6 | 3300009553 | Ga0105249_10019420 | Ga0105249_100194207 | 268 |
| 7 | 3300005564 | Ga0070664_100006788 | Ga0070664_10000678812 | 269 |
| 8 | 3300049572 | Ga0501036_0093154 | Ga0501036_0093154_1716_2534 | 269 |
| 9 | 3300031911 | Ga0307412_10019731 | Ga0307412_100197314 | 271 |
| 10 | 3300046457 | Ga0495590_0002628 | Ga0495590_0002628_1407_2360 | 271 |
| 11 | 3300049593 | Ga0501077_0303880 | Ga0501077_0303880_52_873 | 271 |
| 12 | 3300053153 | Ga0500616_0000016 | Ga0500616_0000016_422266_423216 | 271 |
| 13 | 3300005834 | Ga0068851_10000887 | Ga0068851_1000088711 | 272 |
| 14 | 3300006237 | Ga0097621_100266562 | Ga0097621_1002665622 | 272 |
| 15 | 3300009177 | Ga0105248_10085062 | Ga0105248_100850622 | 272 |
| 16 | 3300025945 | Ga0207679_10172060 | Ga0207679_101720603 | 272 |
| 17 | 3300025961 | Ga0207712_10048486 | Ga0207712_100484864 | 272 |
| 18 | 3300028380 | Ga0268265_10169799 | Ga0268265_101697993 | 272 |
| 19 | 3300048908 | Ga0496105_0134324 | Ga0496105_0134324_546_1478 | 272 |
| 20 | 3300005548 | Ga0070665_100063885 | Ga0070665_1000638853 | 273 |
| 21 | 3300028379 | Ga0268266_10008541 | Ga0268266_100085418 | 273 |
| 22 | 3300005616 | Ga0068852_100079314 | Ga0068852_1000793144 | 274 |
| 23 | 3300006358 | Ga0068871_100237416 | Ga0068871_1002374162 | 274 |
| 24 | 3300026023 | Ga0207677_10049693 | Ga0207677_100496934 | 274 |
| 25 | 3300026142 | Ga0207698_10017184 | Ga0207698_100171844 | 274 |
| 26 | 3300048907 | Ga0496104_0095803 | Ga0496104_0095803_698_1630 | 274 |
| 27 | 3300003323 | rootH1_10001255 | rootH1_100012553 | 275 |
| 28 | 3300050493 | nmdc:mga0k408_222030_c1 | nmdc:mga0k408_222030_c1_280_1116 | 275 |
| 29 | 3300005345 | Ga0070692_10009202 | Ga0070692_100092024 | 276 |
| 30 | 3300005535 | Ga0070684_100048491 | Ga0070684_1000484913 | 276 |
| 31 | 3300005539 | Ga0068853_100044387 | Ga0068853_1000443874 | 276 |
| 32 | 3300005546 | Ga0070696_100030340 | Ga0070696_1000303404 | 276 |
| 33 | 3300005578 | Ga0068854_100028929 | Ga0068854_1000289293 | 276 |
| 34 | 3300005616 | Ga0068852_100547294 | Ga0068852_1005472942 | 276 |
| 35 | 3300005834 | Ga0068851_10040615 | Ga0068851_100406152 | 276 |
| 36 | 3300020070 | Ga0206356_11540035 | Ga0206356_115400354 | 276 |
| 37 | 3300020081 | Ga0206354_10006232 | Ga0206354_100062323 | 276 |
| 38 | 3300020082 | Ga0206353_11382456 | Ga0206353_113824563 | 276 |
| 39 | 3300025909 | Ga0207705_10000564 | Ga0207705_100005644 | 276 |
| 40 | 3300025909 | Ga0207705_10014942 | Ga0207705_100149424 | 276 |
| 41 | 3300025919 | Ga0207657_10022687 | Ga0207657_100226873 | 276 |
| 42 | 3300025920 | Ga0207649_10012778 | Ga0207649_100127784 | 276 |
| 43 | 3300025924 | Ga0207694_10063457 | Ga0207694_100634574 | 276 |
| 44 | 3300025949 | Ga0207667_10048943 | Ga0207667_100489433 | 276 |
| 45 | 3300026142 | Ga0207698_10520939 | Ga0207698_105209392 | 276 |
| 46 | 3300031731 | Ga0307405_10139538 | Ga0307405_101395381 | 276 |
| 47 | 3300031911 | Ga0307412_10203920 | Ga0307412_102039203 | 276 |
| 48 | 3300032002 | Ga0307416_100139246 | Ga0307416_1001392462 | 276 |
| 49 | 3300041411 | Ga0439466_0054914 | Ga0439466_0054914_35_874 | 276 |
| 50 | 3300042435 | Ga0439434_0012979 | Ga0439434_0012979_1588_2427 | 276 |
| 51 | 3300032005 | Ga0307411_10025348 | Ga0307411_100253482 | 277 |
| 52 | 3300041997 | Ga0439431_0021016 | Ga0439431_0021016_79_984 | 278 |
| 53 | 3300053109 | Ga0500569_025211 | Ga0500569_025211_563_1426 | 278 |
| 54 | 3300006846 | Ga0075430_100187475 | Ga0075430_1001874753 | 279 |
| 55 | 3300026089 | Ga0207648_10385421 | Ga0207648_103854212 | 279 |
| 56 | 3300031548 | Ga0307408_100223344 | Ga0307408_1002233442 | 279 |
| 57 | 3300031824 | Ga0307413_10355611 | Ga0307413_103556112 | 279 |
| 58 | 3300032002 | Ga0307416_100654919 | Ga0307416_1006549192 | 279 |
| 59 | 3300032005 | Ga0307411_10226442 | Ga0307411_102264422 | 279 |
| 60 | 3300035115 | Ga0373941_0037713 | Ga0373941_0037713_373_1263 | 279 |
| 61 | 3300042009 | Ga0439451_009245 | Ga0439451_009245_999_1892 | 279 |
| 62 | 3300042436 | Ga0439435_0043938 | Ga0439435_0043938_174_1067 | 279 |
| 63 | 3300042461 | Ga0439460_0057314 | Ga0439460_0057314_145_1038 | 279 |
| 64 | 3300049573 | Ga0501037_0085049 | Ga0501037_0085049_1155_2048 | 279 |
| 65 | 3300049575 | Ga0501039_0033181 | Ga0501039_0033181_1825_2718 | 279 |
| 66 | 3300049576 | Ga0501040_0013815 | Ga0501040_0013815_1242_2135 | 279 |
| 67 | 3300049576 | Ga0501040_0239013 | Ga0501040_0239013_128_1021 | 279 |
| 68 | 3300049577 | Ga0501041_0042688 | Ga0501041_0042688_37_930 | 279 |
| 69 | 3300049578 | Ga0501042_0074791 | Ga0501042_0074791_584_1477 | 279 |
| 70 | 3300049582 | Ga0501048_0090366 | Ga0501048_0090366_67_960 | 279 |
| 71 | 3300049584 | Ga0501068_0028818 | Ga0501068_0028818_1076_1969 | 279 |
| 72 | 3300049588 | Ga0501072_0002044 | Ga0501072_0002044_13042_13935 | 279 |
| 73 | 3300049592 | Ga0501076_0048321 | Ga0501076_0048321_1287_2180 | 279 |
| 74 | 3300049593 | Ga0501077_0087156 | Ga0501077_0087156_536_1429 | 279 |
| 75 | 3300049741 | Ga0501079_0031455 | Ga0501079_0031455_83_976 | 279 |
| 76 | 3300049742 | Ga0501080_0208550 | Ga0501080_0208550_755_1648 | 279 |
| 77 | 3300050509 | nmdc:mga0qj67_34611_c1 | nmdc:mga0qj67_34611_c1_1331_2221 | 279 |
| 78 | 3300054114 | Ga0501084_0047035 | Ga0501084_0047035_1710_2603 | 279 |
| 79 | 3300061734 | Ga0530510_0000522 | Ga0530510_0000522_17918_18811 | 279 |
| 80 | 3300049590 | Ga0501074_0176914 | Ga0501074_0176914_249_1142 | 280 |
| 81 | 3300053153 | Ga0500616_0123903 | Ga0500616_0123903_333_1220 | 280 |
| 82 | 3300003322 | rootL2_10068905 | rootL2_100689052 | 281 |
| 83 | 3300005718 | Ga0068866_10133214 | Ga0068866_101332143 | 281 |
| 84 | 3300005843 | Ga0068860_100258889 | Ga0068860_1002588893 | 281 |
| 85 | 3300005937 | Ga0081455_10004596 | Ga0081455_1000459616 | 281 |
| 86 | 3300026075 | Ga0207708_10008451 | Ga0207708_100084518 | 281 |
| 87 | 3300026089 | Ga0207648_10483443 | Ga0207648_104834432 | 281 |
| 88 | 3300027665 | Ga0209983_1010226 | Ga0209983_10102262 | 281 |
| 89 | 3300041509 | Ga0451843_0974250 | Ga0451843_0974250_74_955 | 281 |
| 90 | 3300045051 | Ga0451576_0258628 | Ga0451576_0258628_364_1260 | 281 |
| 91 | 3300005330 | Ga0070690_100049876 | Ga0070690_1000498763 | 282 |
| 92 | 3300005334 | Ga0068869_100000492 | Ga0068869_10000049216 | 282 |
| 93 | 3300005340 | Ga0070689_100004687 | Ga0070689_1000046877 | 282 |
| 94 | 3300005343 | Ga0070687_100047149 | Ga0070687_1000471494 | 282 |
| 95 | 3300005343 | Ga0070687_100141589 | Ga0070687_1001415892 | 282 |
| 96 | 3300005347 | Ga0070668_100153802 | Ga0070668_1001538021 | 282 |
| 97 | 3300005354 | Ga0070675_100039354 | Ga0070675_1000393544 | 282 |
| 98 | 3300005364 | Ga0070673_100060985 | Ga0070673_1000609852 | 282 |
| 99 | 3300005367 | Ga0070667_100193288 | Ga0070667_1001932882 | 282 |
| 100 | 3300005438 | Ga0070701_10112285 | Ga0070701_101122853 | 282 |
| 101 | 3300005440 | Ga0070705_100025083 | Ga0070705_1000250832 | 282 |
| 102 | 3300005444 | Ga0070694_100272365 | Ga0070694_1002723652 | 282 |
| 103 | 3300005456 | Ga0070678_100028455 | Ga0070678_1000284553 | 282 |
| 104 | 3300005459 | Ga0068867_100015366 | Ga0068867_1000153664 | 282 |
| 105 | 3300005544 | Ga0070686_100085535 | Ga0070686_1000855352 | 282 |
| 106 | 3300005545 | Ga0070695_100237242 | Ga0070695_1002372422 | 282 |
| 107 | 3300005548 | Ga0070665_100028940 | Ga0070665_1000289406 | 282 |
| 108 | 3300005549 | Ga0070704_100515035 | Ga0070704_1005150351 | 282 |
| 109 | 3300005577 | Ga0068857_100308872 | Ga0068857_1003088723 | 282 |
| 110 | 3300005617 | Ga0068859_100004203 | Ga0068859_1000042037 | 282 |
| 111 | 3300005617 | Ga0068859_100043409 | Ga0068859_1000434093 | 282 |
| 112 | 3300005617 | Ga0068859_100050306 | Ga0068859_1000503064 | 282 |
| 113 | 3300005618 | Ga0068864_100045634 | Ga0068864_1000456344 | 282 |
| 114 | 3300005618 | Ga0068864_100110129 | Ga0068864_1001101292 | 282 |
| 115 | 3300005718 | Ga0068866_10047154 | Ga0068866_100471543 | 282 |
| 116 | 3300005719 | Ga0068861_100011901 | Ga0068861_1000119015 | 282 |
| 117 | 3300005841 | Ga0068863_100083400 | Ga0068863_1000834003 | 282 |
| 118 | 3300005842 | Ga0068858_100019496 | Ga0068858_1000194966 | 282 |
| 119 | 3300005844 | Ga0068862_100078130 | Ga0068862_1000781303 | 282 |
| 120 | 3300005844 | Ga0068862_100084729 | Ga0068862_1000847293 | 282 |
| 121 | 3300005844 | Ga0068862_100222858 | Ga0068862_1002228583 | 282 |
| 122 | 3300006237 | Ga0097621_100003378 | Ga0097621_1000033789 | 282 |
| 123 | 3300006358 | Ga0068871_100009301 | Ga0068871_1000093017 | 282 |
| 124 | 3300006844 | Ga0075428_100385212 | Ga0075428_1003852122 | 282 |
| 125 | 3300006847 | Ga0075431_100003705 | Ga0075431_10000370512 | 282 |
| 126 | 3300006880 | Ga0075429_100000326 | Ga0075429_10000032623 | 282 |
| 127 | 3300006931 | Ga0097620_100004203 | Ga0097620_10000420310 | 282 |
| 128 | 3300006931 | Ga0097620_100043409 | Ga0097620_1000434094 | 282 |
| 129 | 3300006931 | Ga0097620_100050306 | Ga0097620_1000503064 | 282 |
| 130 | 3300009094 | Ga0111539_10256613 | Ga0111539_102566132 | 282 |
| 131 | 3300009147 | Ga0114129_10008954 | Ga0114129_100089546 | 282 |
| 132 | 3300009177 | Ga0105248_10005948 | Ga0105248_100059487 | 282 |
| 133 | 3300009553 | Ga0105249_10193650 | Ga0105249_101936504 | 282 |
| 134 | 3300009553 | Ga0105249_10227041 | Ga0105249_102270413 | 282 |
| 135 | 3300010375 | Ga0105239_10353288 | Ga0105239_103532883 | 282 |
| 136 | 3300011119 | Ga0105246_10050913 | Ga0105246_100509133 | 282 |
| 137 | 3300013306 | Ga0163162_10087528 | Ga0163162_100875283 | 282 |
| 138 | 3300013308 | Ga0157375_10005919 | Ga0157375_100059197 | 282 |
| 139 | 3300014969 | Ga0157376_10079140 | Ga0157376_100791404 | 282 |
| 140 | 3300025907 | Ga0207645_10029290 | Ga0207645_100292905 | 282 |
| 141 | 3300025918 | Ga0207662_10013335 | Ga0207662_100133355 | 282 |
| 142 | 3300025925 | Ga0207650_10119252 | Ga0207650_101192523 | 282 |
| 143 | 3300025940 | Ga0207691_10108612 | Ga0207691_101086123 | 282 |
| 144 | 3300025941 | Ga0207711_10024546 | Ga0207711_100245466 | 282 |
| 145 | 3300025942 | Ga0207689_10000320 | Ga0207689_1000032025 | 282 |
| 146 | 3300025981 | Ga0207640_10180445 | Ga0207640_101804453 | 282 |
| 147 | 3300025981 | Ga0207640_10339945 | Ga0207640_103399452 | 282 |
| 148 | 3300025986 | Ga0207658_10167428 | Ga0207658_101674283 | 282 |
| 149 | 3300026075 | Ga0207708_10025102 | Ga0207708_100251024 | 282 |
| 150 | 3300026089 | Ga0207648_10017375 | Ga0207648_100173755 | 282 |
| 151 | 3300026095 | Ga0207676_10013531 | Ga0207676_100135313 | 282 |
| 152 | 3300026116 | Ga0207674_10272565 | Ga0207674_102725653 | 282 |
| 153 | 3300026118 | Ga0207675_100013483 | Ga0207675_1000134835 | 282 |
| 154 | 3300026118 | Ga0207675_100019754 | Ga0207675_1000197547 | 282 |
| 155 | 3300027695 | Ga0209966_1015579 | Ga0209966_10155793 | 282 |
| 156 | 3300028380 | Ga0268265_10035380 | Ga0268265_100353803 | 282 |
| 157 | 3300028380 | Ga0268265_10170909 | Ga0268265_101709091 | 282 |
| 158 | 3300028380 | Ga0268265_10186033 | Ga0268265_101860333 | 282 |
| 159 | 3300035086 | Ga0373934_0004954 | Ga0373934_0004954_3816_4739 | 282 |
| 160 | 3300035119 | Ga0373956_0049071 | Ga0373956_0049071_583_1506 | 282 |
| 161 | 3300035692 | Ga0373935_0049767 | Ga0373935_0049767_266_1189 | 282 |
| 162 | 3300041997 | Ga0439431_0021376 | Ga0439431_0021376_291_1202 | 282 |
| 163 | 3300046684 | Ga0495669_0040549 | Ga0495669_0040549_152_1051 | 282 |
| 164 | 3300049569 | Ga0501032_0015623 | Ga0501032_0015623_2268_3176 | 282 |
| 165 | 3300049571 | Ga0501034_0010873 | Ga0501034_0010873_6460_7368 | 282 |
| 166 | 3300049574 | Ga0501038_0010443 | Ga0501038_0010443_7133_8041 | 282 |
| 167 | 3300049574 | Ga0501038_0084936 | Ga0501038_0084936_973_1881 | 282 |
| 168 | 3300049574 | Ga0501038_0369948 | Ga0501038_0369948_71_979 | 282 |
| 169 | 3300049579 | Ga0501043_0142919 | Ga0501043_0142919_777_1685 | 282 |
| 170 | 3300049581 | Ga0501047_0112496 | Ga0501047_0112496_189_1097 | 282 |
| 171 | 3300049582 | Ga0501048_0039302 | Ga0501048_0039302_312_1220 | 282 |
| 172 | 3300049583 | Ga0501067_0011911 | Ga0501067_0011911_2657_3565 | 282 |
| 173 | 3300049584 | Ga0501068_0032767 | Ga0501068_0032767_2086_2994 | 282 |
| 174 | 3300049586 | Ga0501070_0103813 | Ga0501070_0103813_365_1273 | 282 |
| 175 | 3300049587 | Ga0501071_0007818 | Ga0501071_0007818_1442_2350 | 282 |
| 176 | 3300049590 | Ga0501074_0007488 | Ga0501074_0007488_2073_2981 | 282 |
| 177 | 3300049592 | Ga0501076_0200028 | Ga0501076_0200028_142_1050 | 282 |
| 178 | 3300049742 | Ga0501080_0066411 | Ga0501080_0066411_884_1792 | 282 |
| 179 | 3300049743 | Ga0501081_0081310 | Ga0501081_0081310_853_1761 | 282 |
| 180 | 3300049744 | Ga0501083_0083684 | Ga0501083_0083684_128_1036 | 282 |
| 181 | 3300049822 | Ga0501035_0011489 | Ga0501035_0011489_2919_3827 | 282 |
| 182 | 3300049823 | Ga0501044_0113506 | Ga0501044_0113506_714_1622 | 282 |
| 183 | 3300050507 | nmdc:mga05p37_1073_c1 | nmdc:mga05p37_1073_c1_856_1767 | 282 |
| 184 | 3300050508 | nmdc:mga09592_2292_c1 | nmdc:mga09592_2292_c1_3100_4011 | 282 |
| 185 | 3300050510 | nmdc:mga06r32_3362_c1 | nmdc:mga06r32_3362_c1_10294_11205 | 282 |
| 186 | 3300050511 | nmdc:mga08y16_185963_c1 | nmdc:mga08y16_185963_c1_644_1549 | 282 |
| 187 | 3300053085 | Ga0495619_0104444 | Ga0495619_0104444_833_1741 | 282 |
| 188 | 3300053093 | Ga0500651_0055225 | Ga0500651_0055225_83_988 | 282 |
| 189 | 3300054114 | Ga0501084_0013044 | Ga0501084_0013044_1019_1927 | 282 |
| 190 | 3300060353 | Ga0501082_0078722 | Ga0501082_0078722_1107_2015 | 282 |
| 191 | 3300003187 | JGI25151J46595_10000716 | JGI25151J46595_100007163 | 283 |
| 192 | 3300003187 | JGI25151J46595_10003350 | JGI25151J46595_100033508 | 283 |
| 193 | 3300003781 | Ga0055536_1001741 | Ga0055536_100174113 | 283 |
| 194 | 3300003792 | Ga0055540_1000092 | Ga0055540_10000923 | 283 |
| 195 | 3300003794 | Ga0055531_10000724 | Ga0055531_1000072427 | 283 |
| 196 | 3300005295 | Ga0065707_10012023 | Ga0065707_100120232 | 283 |
| 197 | 3300005329 | Ga0070683_100033036 | Ga0070683_1000330364 | 283 |
| 198 | 3300005335 | Ga0070666_10020164 | Ga0070666_100201641 | 283 |
| 199 | 3300005336 | Ga0070680_100213155 | Ga0070680_1002131552 | 283 |
| 200 | 3300005338 | Ga0068868_100178496 | Ga0068868_1001784963 | 283 |
| 201 | 3300005344 | Ga0070661_100102779 | Ga0070661_1001027793 | 283 |
| 202 | 3300005345 | Ga0070692_10011876 | Ga0070692_100118765 | 283 |
| 203 | 3300005353 | Ga0070669_100010896 | Ga0070669_1000108966 | 283 |
| 204 | 3300005354 | Ga0070675_100012028 | Ga0070675_10001202812 | 283 |
| 205 | 3300005356 | Ga0070674_100040024 | Ga0070674_1000400242 | 283 |
| 206 | 3300005367 | Ga0070667_100010104 | Ga0070667_1000101047 | 283 |
| 207 | 3300005439 | Ga0070711_100169475 | Ga0070711_1001694753 | 283 |
| 208 | 3300005441 | Ga0070700_100007776 | Ga0070700_1000077765 | 283 |
| 209 | 3300005441 | Ga0070700_100076427 | Ga0070700_1000764274 | 283 |
| 210 | 3300005444 | Ga0070694_100203846 | Ga0070694_1002038462 | 283 |
| 211 | 3300005459 | Ga0068867_100008503 | Ga0068867_1000085035 | 283 |
| 212 | 3300005471 | Ga0070698_100010835 | Ga0070698_10001083510 | 283 |
| 213 | 3300005543 | Ga0070672_100157007 | Ga0070672_1001570072 | 283 |
| 214 | 3300005545 | Ga0070695_100108487 | Ga0070695_1001084873 | 283 |
| 215 | 3300005548 | Ga0070665_100524979 | Ga0070665_1005249792 | 283 |
| 216 | 3300005549 | Ga0070704_100254762 | Ga0070704_1002547622 | 283 |
| 217 | 3300005564 | Ga0070664_100206428 | Ga0070664_1002064283 | 283 |
| 218 | 3300005577 | Ga0068857_100249894 | Ga0068857_1002498943 | 283 |
| 219 | 3300005578 | Ga0068854_100179204 | Ga0068854_1001792042 | 283 |
| 220 | 3300005614 | Ga0068856_100101536 | Ga0068856_1001015363 | 283 |
| 221 | 3300005614 | Ga0068856_100529772 | Ga0068856_1005297722 | 283 |
| 222 | 3300005616 | Ga0068852_100023333 | Ga0068852_1000233334 | 283 |
| 223 | 3300005616 | Ga0068852_100128838 | Ga0068852_1001288383 | 283 |
| 224 | 3300005617 | Ga0068859_100275563 | Ga0068859_1002755633 | 283 |
| 225 | 3300005618 | Ga0068864_100223152 | Ga0068864_1002231523 | 283 |
| 226 | 3300005718 | Ga0068866_10006875 | Ga0068866_100068752 | 283 |
| 227 | 3300005834 | Ga0068851_10011672 | Ga0068851_100116725 | 283 |
| 228 | 3300005842 | Ga0068858_100099246 | Ga0068858_1000992463 | 283 |
| 229 | 3300005843 | Ga0068860_100042170 | Ga0068860_1000421703 | 283 |
| 230 | 3300005844 | Ga0068862_100001127 | Ga0068862_10000112725 | 283 |
| 231 | 3300006175 | Ga0070712_100133261 | Ga0070712_1001332613 | 283 |
| 232 | 3300006178 | Ga0075367_10135901 | Ga0075367_101359012 | 283 |
| 233 | 3300006353 | Ga0075370_10012403 | Ga0075370_100124035 | 283 |
| 234 | 3300006358 | Ga0068871_100008412 | Ga0068871_1000084127 | 283 |
| 235 | 3300006358 | Ga0068871_100095942 | Ga0068871_1000959424 | 283 |
| 236 | 3300006871 | Ga0075434_100163554 | Ga0075434_1001635541 | 283 |
| 237 | 3300006931 | Ga0097620_100275574 | Ga0097620_1002755743 | 283 |
| 238 | 3300009094 | Ga0111539_10170865 | Ga0111539_101708654 | 283 |
| 239 | 3300009101 | Ga0105247_10399477 | Ga0105247_103994771 | 283 |
| 240 | 3300009148 | Ga0105243_10004141 | Ga0105243_100041413 | 283 |
| 241 | 3300009148 | Ga0105243_10052781 | Ga0105243_100527814 | 283 |
| 242 | 3300009174 | Ga0105241_10316107 | Ga0105241_103161073 | 283 |
| 243 | 3300009545 | Ga0105237_10007850 | Ga0105237_100078506 | 283 |
| 244 | 3300009551 | Ga0105238_10043722 | Ga0105238_100437225 | 283 |
| 245 | 3300009551 | Ga0105238_10174661 | Ga0105238_101746613 | 283 |
| 246 | 3300009553 | Ga0105249_10040550 | Ga0105249_100405504 | 283 |
| 247 | 3300010375 | Ga0105239_10043053 | Ga0105239_100430534 | 283 |
| 248 | 3300010375 | Ga0105239_10295740 | Ga0105239_102957401 | 283 |
| 249 | 3300011119 | Ga0105246_10221659 | Ga0105246_102216592 | 283 |
| 250 | 3300013296 | Ga0157374_10091172 | Ga0157374_100911722 | 283 |
| 251 | 3300013306 | Ga0163162_10124232 | Ga0163162_101242324 | 283 |
| 252 | 3300013307 | Ga0157372_10004902 | Ga0157372_1000490213 | 283 |
| 253 | 3300013308 | Ga0157375_10726370 | Ga0157375_107263702 | 283 |
| 254 | 3300014325 | Ga0163163_10034424 | Ga0163163_100344245 | 283 |
| 255 | 3300014326 | Ga0157380_10002488 | Ga0157380_100024883 | 283 |
| 256 | 3300014745 | Ga0157377_10248550 | Ga0157377_102485501 | 283 |
| 257 | 3300015261 | Ga0182006_1074943 | Ga0182006_10749432 | 283 |
| 258 | 3300017792 | Ga0163161_10000441 | Ga0163161_1000044112 | 283 |
| 259 | 3300025292 | Ga0209676_1000123 | Ga0209676_100012345 | 283 |
| 260 | 3300025294 | Ga0209025_1000104 | Ga0209025_100010462 | 283 |
| 261 | 3300025298 | Ga0209050_1000188 | Ga0209050_10001888 | 283 |
| 262 | 3300025303 | Ga0209051_1000091 | Ga0209051_100009145 | 283 |
| 263 | 3300025304 | Ga0209257_1000057 | Ga0209257_10000573 | 283 |
| 264 | 3300025321 | Ga0207656_10027975 | Ga0207656_100279753 | 283 |
| 265 | 3300025901 | Ga0207688_10060870 | Ga0207688_100608701 | 283 |
| 266 | 3300025915 | Ga0207693_10195735 | Ga0207693_101957353 | 283 |
| 267 | 3300025916 | Ga0207663_10036511 | Ga0207663_100365114 | 283 |
| 268 | 3300025917 | Ga0207660_10034902 | Ga0207660_100349023 | 283 |
| 269 | 3300025920 | Ga0207649_10157515 | Ga0207649_101575153 | 283 |
| 270 | 3300025923 | Ga0207681_10005013 | Ga0207681_100050137 | 283 |
| 271 | 3300025924 | Ga0207694_10209644 | Ga0207694_102096443 | 283 |
| 272 | 3300025926 | Ga0207659_10135850 | Ga0207659_101358501 | 283 |
| 273 | 3300025935 | Ga0207709_10027274 | Ga0207709_100272744 | 283 |
| 274 | 3300025937 | Ga0207669_10032343 | Ga0207669_100323434 | 283 |
| 275 | 3300025938 | Ga0207704_10054603 | Ga0207704_100546032 | 283 |
| 276 | 3300025961 | Ga0207712_10092760 | Ga0207712_100927602 | 283 |
| 277 | 3300025972 | Ga0207668_10061337 | Ga0207668_100613374 | 283 |
| 278 | 3300026041 | Ga0207639_10093611 | Ga0207639_100936111 | 283 |
| 279 | 3300026067 | Ga0207678_10031604 | Ga0207678_100316043 | 283 |
| 280 | 3300026075 | Ga0207708_10051142 | Ga0207708_100511423 | 283 |
| 281 | 3300026078 | Ga0207702_10483777 | Ga0207702_104837772 | 283 |
| 282 | 3300026089 | Ga0207648_10018664 | Ga0207648_100186646 | 283 |
| 283 | 3300026095 | Ga0207676_10266895 | Ga0207676_102668953 | 283 |
| 284 | 3300026116 | Ga0207674_10070608 | Ga0207674_100706085 | 283 |
| 285 | 3300026116 | Ga0207674_10180942 | Ga0207674_101809422 | 283 |
| 286 | 3300026118 | Ga0207675_100007594 | Ga0207675_1000075946 | 283 |
| 287 | 3300026142 | Ga0207698_10195806 | Ga0207698_101958063 | 283 |
| 288 | 3300028380 | Ga0268265_10001675 | Ga0268265_100016759 | 283 |
| 289 | 3300028381 | Ga0268264_10071595 | Ga0268264_100715952 | 283 |
| 290 | 3300028794 | Ga0307515_10203958 | Ga0307515_102039583 | 283 |
| 291 | 3300033179 | Ga0307507_10098315 | Ga0307507_100983153 | 283 |
| 292 | 3300034817 | Ga0373948_0019188 | Ga0373948_0019188_93_995 | 283 |
| 293 | 3300034957 | Ga0373938_0005118 | Ga0373938_0005118_742_1644 | 283 |
| 294 | 3300035088 | Ga0373940_0005226 | Ga0373940_0005226_1242_2144 | 283 |
| 295 | 3300035088 | Ga0373940_0079027 | Ga0373940_0079027_46_948 | 283 |
| 296 | 3300035091 | Ga0373951_0005703 | Ga0373951_0005703_552_1454 | 283 |
| 297 | 3300035115 | Ga0373941_0004745 | Ga0373941_0004745_38_940 | 283 |
| 298 | 3300035691 | Ga0373931_0006858 | Ga0373931_0006858_2970_3872 | 283 |
| 299 | 3300035695 | Ga0373927_0033886 | Ga0373927_0033886_1745_2671 | 283 |
| 300 | 3300045051 | Ga0451576_0094993 | Ga0451576_0094993_548_1465 | 283 |
| 301 | 3300046453 | Ga0495627_012156 | Ga0495627_012156_673_1587 | 283 |
| 302 | 3300046454 | Ga0495592_0163172 | Ga0495592_0163172_594_1520 | 283 |
| 303 | 3300046462 | Ga0495651_0012584 | Ga0495651_0012584_274_1200 | 283 |
| 304 | 3300046463 | Ga0495653_0016021 | Ga0495653_0016021_3111_4037 | 283 |
| 305 | 3300046472 | Ga0495580_0194762 | Ga0495580_0194762_322_1248 | 283 |
| 306 | 3300046476 | Ga0495662_0028518 | Ga0495662_0028518_201_1127 | 283 |
| 307 | 3300046499 | Ga0495594_0059477 | Ga0495594_0059477_564_1490 | 283 |
| 308 | 3300046511 | Ga0495608_0122044 | Ga0495608_0122044_223_1149 | 283 |
| 309 | 3300046514 | Ga0495618_0012194 | Ga0495618_0012194_3082_4008 | 283 |
| 310 | 3300046515 | Ga0495620_0024912 | Ga0495620_0024912_779_1693 | 283 |
| 311 | 3300046516 | Ga0495628_0155565 | Ga0495628_0155565_493_1419 | 283 |
| 312 | 3300046517 | Ga0495630_0002338 | Ga0495630_0002338_5774_6700 | 283 |
| 313 | 3300046529 | Ga0495652_0037438 | Ga0495652_0037438_1625_2551 | 283 |
| 314 | 3300046531 | Ga0495665_0013415 | Ga0495665_0013415_1242_2168 | 283 |
| 315 | 3300046533 | Ga0495640_0072172 | Ga0495640_0072172_1210_2136 | 283 |
| 316 | 3300046536 | Ga0495587_0081290 | Ga0495587_0081290_771_1697 | 283 |
| 317 | 3300046559 | Ga0495667_0128378 | Ga0495667_0128378_594_1520 | 283 |
| 318 | 3300046642 | Ga0495634_0066291 | Ga0495634_0066291_1300_2226 | 283 |
| 319 | 3300046660 | Ga0495625_0255062 | Ga0495625_0255062_17_931 | 283 |
| 320 | 3300046675 | Ga0495657_0017967 | Ga0495657_0017967_593_1519 | 283 |
| 321 | 3300046681 | Ga0495647_0024140 | Ga0495647_0024140_322_1248 | 283 |
| 322 | 3300046683 | Ga0495658_0020266 | Ga0495658_0020266_2396_3322 | 283 |
| 323 | 3300046691 | Ga0495670_0061135 | Ga0495670_0061135_345_1259 | 283 |
| 324 | 3300046692 | Ga0495671_0027049 | Ga0495671_0027049_723_1637 | 283 |
| 325 | 3300046809 | Ga0495600_0002368 | Ga0495600_0002368_1320_2246 | 283 |
| 326 | 3300047319 | Ga0495674_0009959 | Ga0495674_0009959_594_1520 | 283 |
| 327 | 3300047322 | Ga0495680_0101718 | Ga0495680_0101718_621_1547 | 283 |
| 328 | 3300047444 | Ga0495675_0006291 | Ga0495675_0006291_4980_5906 | 283 |
| 329 | 3300048918 | Ga0496115_0013455 | Ga0496115_0013455_4382_5290 | 283 |
| 330 | 3300049572 | Ga0501036_0109975 | Ga0501036_0109975_399_1310 | 283 |
| 331 | 3300049574 | Ga0501038_0442121 | Ga0501038_0442121_62_973 | 283 |
| 332 | 3300049576 | Ga0501040_0122636 | Ga0501040_0122636_783_1718 | 283 |
| 333 | 3300049588 | Ga0501072_0120934 | Ga0501072_0120934_1017_1919 | 283 |
| 334 | 3300049590 | Ga0501074_0162538 | Ga0501074_0162538_323_1234 | 283 |
| 335 | 3300050492 | nmdc:mga0yw44_41081_c1 | nmdc:mga0yw44_41081_c1_1281_2354 | 283 |
| 336 | 3300050496 | nmdc:mga07m45_2775_c1 | nmdc:mga07m45_2775_c1_2379_3293 | 283 |
| 337 | 3300050508 | nmdc:mga09592_231919_c1 | nmdc:mga09592_231919_c1_635_1540 | 283 |
| 338 | 3300050511 | nmdc:mga08y16_80476_c1 | nmdc:mga08y16_80476_c1_1029_1931 | 283 |
| 339 | 3300050512 | nmdc:mga0n895_146167_c1 | nmdc:mga0n895_146167_c1_1286_2203 | 283 |
| 340 | 3300050515 | nmdc:mga0a205_138744_c1 | nmdc:mga0a205_138744_c1_527_1444 | 283 |
| 341 | 3300053077 | Ga0495601_0071342 | Ga0495601_0071342_769_1695 | 283 |
| 342 | 3300053079 | Ga0500610_0000054 | Ga0500610_0000054_35635_36549 | 283 |
| 343 | 3300053079 | Ga0500610_0000226 | Ga0500610_0000226_18_932 | 283 |
| 344 | 3300053084 | Ga0495595_0002788 | Ga0495595_0002788_1541_2467 | 283 |
| 345 | 3300053085 | Ga0495619_0145180 | Ga0495619_0145180_116_1042 | 283 |
| 346 | 3300053103 | Ga0500555_030779 | Ga0500555_030779_450_1364 | 283 |
| 347 | 3300053109 | Ga0500569_013388 | Ga0500569_013388_711_1625 | 283 |
| 348 | 3300053117 | Ga0500593_000535 | Ga0500593_000535_12799_13713 | 283 |
| 349 | 3300053121 | Ga0500607_001551 | Ga0500607_001551_1064_1984 | 283 |
| 350 | 3300053136 | Ga0500559_0004905 | Ga0500559_0004905_4864_5772 | 283 |
| 351 | 3300053136 | Ga0500559_0139303 | Ga0500559_0139303_209_1117 | 283 |
| 352 | 3300053139 | Ga0500568_0006939 | Ga0500568_0006939_1424_2335 | 283 |
| 353 | 3300053140 | Ga0500573_0062433 | Ga0500573_0062433_360_1268 | 283 |
| 354 | 3300053141 | Ga0500574_001122 | Ga0500574_001122_2541_3461 | 283 |
| 355 | 3300053158 | Ga0500627_0056553 | Ga0500627_0056553_321_1235 | 283 |
| 356 | 3300053161 | Ga0500634_0002332 | Ga0500634_0002332_6135_7049 | 283 |
| 357 | 3300053730 | Ga0500645_034152 | Ga0500645_034152_175_1089 | 283 |
| 358 | iso_pu_bacteria | 2643221672 | 2644399638 | 283 |
| 359 | 3300001979 | JGI24740J21852_10014817 | JGI24740J21852_100148174 | 284 |
| 360 | 3300001989 | JGI24739J22299_10019684 | JGI24739J22299_100196844 | 284 |
| 361 | 3300002773 | JGI25152J39213_1000159 | JGI25152J39213_100015947 | 284 |
| 362 | 3300002773 | JGI25152J39213_1003485 | JGI25152J39213_10034854 | 284 |
| 363 | 3300002774 | JGI25150J39212_1001644 | JGI25150J39212_10016442 | 284 |
| 364 | 3300002774 | JGI25150J39212_1005296 | JGI25150J39212_10052964 | 284 |
| 365 | 3300002987 | JGI25159J45721_1012146 | JGI25159J45721_10121462 | 284 |
| 366 | 3300003187 | JGI25151J46595_10000384 | JGI25151J46595_1000038447 | 284 |
| 367 | 3300003215 | JGI25153J46596_10000243 | JGI25153J46596_1000024347 | 284 |
| 368 | 3300003354 | JGI25160J50197_1000275 | JGI25160J50197_10002753 | 284 |
| 369 | 3300003374 | JGI25161J50226_1005011 | JGI25161J50226_10050112 | 284 |
| 370 | 3300003760 | Ga0055527_1005055 | Ga0055527_10050553 | 284 |
| 371 | 3300003761 | Ga0055535_1000115 | Ga0055535_100011548 | 284 |
| 372 | 3300003762 | Ga0055542_1000028 | Ga0055542_1000028115 | 284 |
| 373 | 3300003771 | Ga0055526_1000245 | Ga0055526_10002453 | 284 |
| 374 | 3300003771 | Ga0055526_1000676 | Ga0055526_100067627 | 284 |
| 375 | 3300003773 | Ga0055537_1000192 | Ga0055537_10001923 | 284 |
| 376 | 3300003773 | Ga0055537_1008083 | Ga0055537_10080833 | 284 |
| 377 | 3300003775 | Ga0055524_1000312 | Ga0055524_10003123 | 284 |
| 378 | 3300003775 | Ga0055524_1004329 | Ga0055524_10043297 | 284 |
| 379 | 3300003781 | Ga0055536_1000396 | Ga0055536_10003963 | 284 |
| 380 | 3300003784 | Ga0055534_1000183 | Ga0055534_10001833 | 284 |
| 381 | 3300003790 | Ga0055528_1000245 | Ga0055528_10002453 | 284 |
| 382 | 3300003790 | Ga0055528_1018126 | Ga0055528_10181263 | 284 |
| 383 | 3300003791 | Ga0055530_10000086 | Ga0055530_100000864 | 284 |
| 384 | 3300003792 | Ga0055540_1000520 | Ga0055540_10005203 | 284 |
| 385 | 3300003794 | Ga0055531_10000672 | Ga0055531_100006723 | 284 |
| 386 | 3300003794 | Ga0055531_10016047 | Ga0055531_100160473 | 284 |
| 387 | 3300004625 | Ga0055543_1009429 | Ga0055543_10094292 | 284 |
| 388 | 3300004625 | Ga0055543_1009518 | Ga0055543_10095182 | 284 |
| 389 | 3300005262 | Ga0065165_1001483 | Ga0065165_100148326 | 284 |
| 390 | 3300005289 | Ga0065704_10085211 | Ga0065704_100852114 | 284 |
| 391 | 3300005347 | Ga0070668_100023702 | Ga0070668_1000237026 | 284 |
| 392 | 3300005353 | Ga0070669_100048201 | Ga0070669_1000482013 | 284 |
| 393 | 3300005441 | Ga0070700_100024533 | Ga0070700_1000245334 | 284 |
| 394 | 3300005539 | Ga0068853_100024738 | Ga0068853_1000247384 | 284 |
| 395 | 3300005545 | Ga0070695_100148116 | Ga0070695_1001481163 | 284 |
| 396 | 3300005577 | Ga0068857_100279368 | Ga0068857_1002793682 | 284 |
| 397 | 3300005617 | Ga0068859_100344889 | Ga0068859_1003448893 | 284 |
| 398 | 3300005719 | Ga0068861_100000457 | Ga0068861_10000045719 | 284 |
| 399 | 3300005834 | Ga0068851_10013697 | Ga0068851_100136974 | 284 |
| 400 | 3300005843 | Ga0068860_100000685 | Ga0068860_10000068533 | 284 |
| 401 | 3300005844 | Ga0068862_100003177 | Ga0068862_1000031779 | 284 |
| 402 | 3300006042 | Ga0075368_10009041 | Ga0075368_100090412 | 284 |
| 403 | 3300006048 | Ga0075363_100007021 | Ga0075363_1000070214 | 284 |
| 404 | 3300006051 | Ga0075364_10052287 | Ga0075364_100522872 | 284 |
| 405 | 3300006177 | Ga0075362_10010930 | Ga0075362_100109304 | 284 |
| 406 | 3300006186 | Ga0075369_10005152 | Ga0075369_100051522 | 284 |
| 407 | 3300006195 | Ga0075366_10003336 | Ga0075366_100033366 | 284 |
| 408 | 3300006881 | Ga0068865_100097311 | Ga0068865_1000973112 | 284 |
| 409 | 3300006931 | Ga0097620_100344868 | Ga0097620_1003448682 | 284 |
| 410 | 3300006946 | Ga0079104_1000034 | Ga0079104_1000034173 | 284 |
| 411 | 3300009148 | Ga0105243_10006138 | Ga0105243_100061383 | 284 |
| 412 | 3300009148 | Ga0105243_10207747 | Ga0105243_102077473 | 284 |
| 413 | 3300013306 | Ga0163162_10002995 | Ga0163162_100029954 | 284 |
| 414 | 3300014326 | Ga0157380_10058210 | Ga0157380_100582102 | 284 |
| 415 | 3300014497 | Ga0182008_10000536 | Ga0182008_1000053632 | 284 |
| 416 | 3300017792 | Ga0163161_10007311 | Ga0163161_100073118 | 284 |
| 417 | 3300025208 | Ga0209436_105137 | Ga0209436_1051373 | 284 |
| 418 | 3300025208 | Ga0209436_111871 | Ga0209436_1118712 | 284 |
| 419 | 3300025228 | Ga0209672_101025 | Ga0209672_1010253 | 284 |
| 420 | 3300025229 | Ga0209147_100906 | Ga0209147_10090612 | 284 |
| 421 | 3300025242 | Ga0209258_100067 | Ga0209258_100067138 | 284 |
| 422 | 3300025245 | Ga0207425_1000213 | Ga0207425_100021348 | 284 |
| 423 | 3300025245 | Ga0207425_1002332 | Ga0207425_10023323 | 284 |
| 424 | 3300025254 | Ga0209148_1000067 | Ga0209148_1000067181 | 284 |
| 425 | 3300025258 | Ga0209129_1000296 | Ga0209129_100029648 | 284 |
| 426 | 3300025258 | Ga0209129_1006497 | Ga0209129_10064975 | 284 |
| 427 | 3300025263 | Ga0209565_1000027 | Ga0209565_1000027310 | 284 |
| 428 | 3300025263 | Ga0209565_1006250 | Ga0209565_10062502 | 284 |
| 429 | 3300025273 | Ga0209673_1000031 | Ga0209673_1000031300 | 284 |
| 430 | 3300025273 | Ga0209673_1000066 | Ga0209673_100006621 | 284 |
| 431 | 3300025273 | Ga0209673_1001215 | Ga0209673_100121529 | 284 |
| 432 | 3300025284 | Ga0209130_1000417 | Ga0209130_100041748 | 284 |
| 433 | 3300025284 | Ga0209130_1002081 | Ga0209130_10020814 | 284 |
| 434 | 3300025291 | Ga0209675_1000157 | Ga0209675_100015748 | 284 |
| 435 | 3300025291 | Ga0209675_1007853 | Ga0209675_10078533 | 284 |
| 436 | 3300025292 | Ga0209676_1000005 | Ga0209676_1000005948 | 284 |
| 437 | 3300025292 | Ga0209676_1000186 | Ga0209676_1000186134 | 284 |
| 438 | 3300025292 | Ga0209676_1025345 | Ga0209676_10253453 | 284 |
| 439 | 3300025294 | Ga0209025_1000902 | Ga0209025_100090248 | 284 |
| 440 | 3300025294 | Ga0209025_1022283 | Ga0209025_10222835 | 284 |
| 441 | 3300025295 | Ga0209564_1000090 | Ga0209564_10000904 | 284 |
| 442 | 3300025295 | Ga0209564_1000734 | Ga0209564_100073448 | 284 |
| 443 | 3300025297 | Ga0209758_1000050 | Ga0209758_100005048 | 284 |
| 444 | 3300025297 | Ga0209758_1002384 | Ga0209758_100238423 | 284 |
| 445 | 3300025298 | Ga0209050_1000007 | Ga0209050_1000007149 | 284 |
| 446 | 3300025299 | Ga0209256_1000022 | Ga0209256_1000022288 | 284 |
| 447 | 3300025299 | Ga0209256_1000023 | Ga0209256_100002348 | 284 |
| 448 | 3300025302 | Ga0207426_1000202 | Ga0207426_1000202108 | 284 |
| 449 | 3300025302 | Ga0207426_1000260 | Ga0207426_100026085 | 284 |
| 450 | 3300025303 | Ga0209051_1000036 | Ga0209051_1000036299 | 284 |
| 451 | 3300025303 | Ga0209051_1028054 | Ga0209051_10280542 | 284 |
| 452 | 3300025304 | Ga0209257_1000011 | Ga0209257_1000011922 | 284 |
| 453 | 3300025304 | Ga0209257_1000800 | Ga0209257_100080048 | 284 |
| 454 | 3300025321 | Ga0207656_10027007 | Ga0207656_100270074 | 284 |
| 455 | 3300025923 | Ga0207681_10039820 | Ga0207681_100398203 | 284 |
| 456 | 3300025935 | Ga0207709_10000019 | Ga0207709_1000001942 | 284 |
| 457 | 3300025938 | Ga0207704_10058704 | Ga0207704_100587042 | 284 |
| 458 | 3300025972 | Ga0207668_10042383 | Ga0207668_100423832 | 284 |
| 459 | 3300026041 | Ga0207639_10059995 | Ga0207639_100599952 | 284 |
| 460 | 3300026075 | Ga0207708_10040181 | Ga0207708_100401814 | 284 |
| 461 | 3300026089 | Ga0207648_10001873 | Ga0207648_100018732 | 284 |
| 462 | 3300026118 | Ga0207675_100003062 | Ga0207675_10000306217 | 284 |
| 463 | 3300027111 | Ga0209281_1000005 | Ga0209281_1000005171 | 284 |
| 464 | 3300027360 | Ga0209969_1002004 | Ga0209969_10020042 | 284 |
| 465 | 3300027543 | Ga0209999_1001563 | Ga0209999_10015634 | 284 |
| 466 | 3300027866 | Ga0209813_10069958 | Ga0209813_100699582 | 284 |
| 467 | 3300028380 | Ga0268265_10197428 | Ga0268265_101974282 | 284 |
| 468 | 3300028381 | Ga0268264_10002570 | Ga0268264_1000257016 | 284 |
| 469 | 3300031456 | Ga0307513_10426099 | Ga0307513_104260992 | 284 |
| 470 | 3300032002 | Ga0307416_100124232 | Ga0307416_1001242323 | 284 |
| 471 | 3300035086 | Ga0373934_0000061 | Ga0373934_0000061_2184_3128 | 284 |
| 472 | 3300035119 | Ga0373956_0000003 | Ga0373956_0000003_50828_51772 | 284 |
| 473 | 3300035120 | Ga0373957_0006728 | Ga0373957_0006728_1375_2319 | 284 |
| 474 | 3300035724 | Ga0373933_0000742 | Ga0373933_0000742_11373_12317 | 284 |
| 475 | 3300036401 | Ga0373937_0000196 | Ga0373937_0000196_30767_31711 | 284 |
| 476 | 3300037418 | Ga0395900_0081438 | Ga0395900_0081438_1138_2052 | 284 |
| 477 | 3300037466 | Ga0395898_0007248 | Ga0395898_0007248_10598_11512 | 284 |
| 478 | 3300037471 | Ga0395905_0050493 | Ga0395905_0050493_1022_1936 | 284 |
| 479 | 3300038443 | Ga0395901_0027576 | Ga0395901_0027576_1533_2447 | 284 |
| 480 | 3300038443 | Ga0395901_0053698 | Ga0395901_0053698_1265_2179 | 284 |
| 481 | 3300038443 | Ga0395901_0225210 | Ga0395901_0225210_24_938 | 284 |
| 482 | 3300042435 | Ga0439434_0006693 | Ga0439434_0006693_509_1414 | 284 |
| 483 | 3300042876 | Ga0451577_0081047 | Ga0451577_0081047_1652_2560 | 284 |
| 484 | 3300044712 | Ga0453684_0781598 | Ga0453684_0781598_22_930 | 284 |
| 485 | 3300045051 | Ga0451576_0001486 | Ga0451576_0001486_37302_38210 | 284 |
| 486 | 3300046459 | Ga0495629_0166816 | Ga0495629_0166816_493_1416 | 284 |
| 487 | 3300046462 | Ga0495651_0000105 | Ga0495651_0000105_54744_55688 | 284 |
| 488 | 3300046512 | Ga0495610_0037643 | Ga0495610_0037643_821_1744 | 284 |
| 489 | 3300046513 | Ga0495616_0032520 | Ga0495616_0032520_535_1458 | 284 |
| 490 | 3300046515 | Ga0495620_0029572 | Ga0495620_0029572_208_1131 | 284 |
| 491 | 3300046518 | Ga0495631_0000530 | Ga0495631_0000530_23323_24246 | 284 |
| 492 | 3300046530 | Ga0495654_0090044 | Ga0495654_0090044_470_1393 | 284 |
| 493 | 3300046674 | Ga0495588_0101191 | Ga0495588_0101191_73_996 | 284 |
| 494 | 3300046675 | Ga0495657_0047921 | Ga0495657_0047921_450_1394 | 284 |
| 495 | 3300047321 | Ga0495676_0001586 | Ga0495676_0001586_1984_2907 | 284 |
| 496 | 3300047673 | Ga0495593_0027123 | Ga0495593_0027123_2131_3054 | 284 |
| 497 | 3300048089 | Ga0495614_0005764 | Ga0495614_0005764_3371_4294 | 284 |
| 498 | 3300048904 | Ga0496101_0017256 | Ga0496101_0017256_3466_4386 | 284 |
| 499 | 3300048920 | Ga0496117_0005063 | Ga0496117_0005063_11894_12811 | 284 |
| 500 | 3300048921 | Ga0496118_0070793 | Ga0496118_0070793_965_1882 | 284 |
| 501 | 3300048922 | Ga0496119_0166254 | Ga0496119_0166254_115_1038 | 284 |
| 502 | 3300048924 | Ga0496121_0140258 | Ga0496121_0140258_731_1654 | 284 |
| 503 | 3300048926 | Ga0496123_0027586 | Ga0496123_0027586_1089_2012 | 284 |
| 504 | 3300048927 | Ga0496124_0040881 | Ga0496124_0040881_2401_3318 | 284 |
| 505 | 3300048928 | Ga0496125_0061116 | Ga0496125_0061116_739_1656 | 284 |
| 506 | 3300049568 | Ga0501031_0004874 | Ga0501031_0004874_6372_7292 | 284 |
| 507 | 3300049569 | Ga0501032_0099172 | Ga0501032_0099172_698_1618 | 284 |
| 508 | 3300049570 | Ga0501033_0004194 | Ga0501033_0004194_931_1851 | 284 |
| 509 | 3300049572 | Ga0501036_0000096 | Ga0501036_0000096_40424_41344 | 284 |
| 510 | 3300049573 | Ga0501037_0042325 | Ga0501037_0042325_1097_2017 | 284 |
| 511 | 3300049574 | Ga0501038_0000791 | Ga0501038_0000791_12783_13703 | 284 |
| 512 | 3300049575 | Ga0501039_0008295 | Ga0501039_0008295_1126_2046 | 284 |
| 513 | 3300049575 | Ga0501039_0080615 | Ga0501039_0080615_408_1313 | 284 |
| 514 | 3300049576 | Ga0501040_0000395 | Ga0501040_0000395_19253_20173 | 284 |
| 515 | 3300049577 | Ga0501041_0000652 | Ga0501041_0000652_1366_2286 | 284 |
| 516 | 3300049577 | Ga0501041_0176156 | Ga0501041_0176156_141_1061 | 284 |
| 517 | 3300049577 | Ga0501041_0220872 | Ga0501041_0220872_259_1164 | 284 |
| 518 | 3300049578 | Ga0501042_0003069 | Ga0501042_0003069_8104_9024 | 284 |
| 519 | 3300049579 | Ga0501043_0023407 | Ga0501043_0023407_1238_2158 | 284 |
| 520 | 3300049580 | Ga0501046_0000200 | Ga0501046_0000200_35609_36529 | 284 |
| 521 | 3300049581 | Ga0501047_0105650 | Ga0501047_0105650_1226_2146 | 284 |
| 522 | 3300049582 | Ga0501048_0004765 | Ga0501048_0004765_1452_2372 | 284 |
| 523 | 3300049584 | Ga0501068_0010137 | Ga0501068_0010137_3167_4129 | 284 |
| 524 | 3300049584 | Ga0501068_0180297 | Ga0501068_0180297_226_1146 | 284 |
| 525 | 3300049587 | Ga0501071_0008613 | Ga0501071_0008613_1237_2199 | 284 |
| 526 | 3300049587 | Ga0501071_0041498 | Ga0501071_0041498_160_1065 | 284 |
| 527 | 3300049587 | Ga0501071_0174125 | Ga0501071_0174125_52_957 | 284 |
| 528 | 3300049588 | Ga0501072_0000765 | Ga0501072_0000765_8248_9168 | 284 |
| 529 | 3300049588 | Ga0501072_0029239 | Ga0501072_0029239_1237_2142 | 284 |
| 530 | 3300049588 | Ga0501072_0029789 | Ga0501072_0029789_1057_2019 | 284 |
| 531 | 3300049589 | Ga0501073_0003806 | Ga0501073_0003806_5837_6799 | 284 |
| 532 | 3300049589 | Ga0501073_0037854 | Ga0501073_0037854_974_1879 | 284 |
| 533 | 3300049590 | Ga0501074_0021069 | Ga0501074_0021069_2455_3417 | 284 |
| 534 | 3300049590 | Ga0501074_0274560 | Ga0501074_0274560_132_1037 | 284 |
| 535 | 3300049591 | Ga0501075_0000232 | Ga0501075_0000232_1487_2407 | 284 |
| 536 | 3300049591 | Ga0501075_0093945 | Ga0501075_0093945_192_1097 | 284 |
| 537 | 3300049591 | Ga0501075_0098814 | Ga0501075_0098814_1118_2080 | 284 |
| 538 | 3300049591 | Ga0501075_0168446 | Ga0501075_0168446_81_1001 | 284 |
| 539 | 3300049592 | Ga0501076_0005762 | Ga0501076_0005762_567_1487 | 284 |
| 540 | 3300049592 | Ga0501076_0059613 | Ga0501076_0059613_2098_3003 | 284 |
| 541 | 3300049592 | Ga0501076_0447199 | Ga0501076_0447199_114_1034 | 284 |
| 542 | 3300049593 | Ga0501077_0004846 | Ga0501077_0004846_1320_2282 | 284 |
| 543 | 3300049741 | Ga0501079_0000385 | Ga0501079_0000385_4749_5711 | 284 |
| 544 | 3300049741 | Ga0501079_0003631 | Ga0501079_0003631_3900_4820 | 284 |
| 545 | 3300049742 | Ga0501080_0000663 | Ga0501080_0000663_24858_25820 | 284 |
| 546 | 3300049742 | Ga0501080_0091510 | Ga0501080_0091510_1848_2753 | 284 |
| 547 | 3300049742 | Ga0501080_0140046 | Ga0501080_0140046_1176_2096 | 284 |
| 548 | 3300049743 | Ga0501081_0002360 | Ga0501081_0002360_1612_2532 | 284 |
| 549 | 3300049743 | Ga0501081_0176812 | Ga0501081_0176812_309_1214 | 284 |
| 550 | 3300049744 | Ga0501083_0031006 | Ga0501083_0031006_1796_2716 | 284 |
| 551 | 3300049744 | Ga0501083_0051358 | Ga0501083_0051358_1686_2591 | 284 |
| 552 | 3300049822 | Ga0501035_0087952 | Ga0501035_0087952_550_1470 | 284 |
| 553 | 3300049823 | Ga0501044_0100778 | Ga0501044_0100778_289_1209 | 284 |
| 554 | 3300049824 | Ga0501045_0000087 | Ga0501045_0000087_28561_29481 | 284 |
| 555 | 3300050490 | nmdc:mga03n38_101880_c1 | nmdc:mga03n38_101880_c1_150_1151 | 284 |
| 556 | 3300050491 | nmdc:mga00v17_43064_c1 | nmdc:mga00v17_43064_c1_1545_2546 | 284 |
| 557 | 3300050493 | nmdc:mga0k408_5475_c1 | nmdc:mga0k408_5475_c1_1040_2041 | 284 |
| 558 | 3300050495 | nmdc:mga04h51_8520_c1 | nmdc:mga04h51_8520_c1_1545_2546 | 284 |
| 559 | 3300050496 | nmdc:mga07m45_60505_c1 | nmdc:mga07m45_60505_c1_912_1937 | 284 |
| 560 | 3300053110 | Ga0500571_000117 | Ga0500571_000117_1352_2275 | 284 |
| 561 | 3300053118 | Ga0500594_0002816 | Ga0500594_0002816_2327_3250 | 284 |
| 562 | 3300053134 | Ga0500658_0000018 | Ga0500658_0000018_130481_131404 | 284 |
| 563 | 3300053139 | Ga0500568_0058483 | Ga0500568_0058483_229_1152 | 284 |
| 564 | 3300054114 | Ga0501084_0004143 | Ga0501084_0004143_9487_10407 | 284 |
| 565 | 3300054114 | Ga0501084_0028455 | Ga0501084_0028455_528_1490 | 284 |
| 566 | 3300054114 | Ga0501084_0105847 | Ga0501084_0105847_1387_2292 | 284 |
| 567 | 3300060353 | Ga0501082_0010273 | Ga0501082_0010273_6167_7087 | 284 |
| 568 | 3300060353 | Ga0501082_0104173 | Ga0501082_0104173_420_1382 | 284 |
| 569 | 3300061734 | Ga0530510_0044260 | Ga0530510_0044260_1027_1947 | 284 |
| 570 | iso_pu_bacteria | 2599185214 | 2599620667 | 284 |
| 571 | iso_pu_bacteria | 2599185226 | 2599673966 | 284 |
| 572 | iso_pu_bacteria | 2599185227 | 2599678717 | 284 |
| 573 | iso_pu_bacteria | 2599185229 | 2599690178 | 284 |
| 574 | iso_pu_bacteria | 2721755523 | 2722884581 | 284 |
| 575 | iso_pu_bacteria | 2738541277 | 2738722272 | 284 |
| 576 | iso_pu_bacteria | 2738543019 | 2739282636 | 284 |
| 577 | iso_pu_bacteria | 2818991446 | 2819598656 | 284 |
| 578 | iso_pu_bacteria | 2831265667 | 2831266556 | 284 |
| 579 | iso_pu_bacteria | 2838054893 | 2838057322 | 284 |
| 580 | iso_pu_bacteria | 2839138175 | 2839143179 | 284 |
| 581 | iso_pu_bacteria | 2899924645 | 2899926727 | 284 |
| 582 | iso_pu_bacteria | 2928037797 | 2928043824 | 284 |
| 583 | iso_pu_bacteria | 2928044640 | 2928050591 | 284 |
| 584 | iso_pu_bacteria | 2928051484 | 2928056947 | 284 |
| 585 | iso_pu_bacteria | 2928064002 | 2928070715 | 284 |
| 586 | iso_pu_bacteria | 2928070936 | 2928073383 | 284 |
| 587 | iso_pu_bacteria | 2928084124 | 2928084601 | 284 |
| 588 | 3300003578 | Ga0006562J51391_1033060 | Ga0006562J51391_10330603 | 285 |
| 589 | 3300003773 | Ga0055537_1000068 | Ga0055537_100006849 | 285 |
| 590 | 3300003784 | Ga0055534_1000080 | Ga0055534_100008049 | 285 |
| 591 | 3300003790 | Ga0055528_1000159 | Ga0055528_100015936 | 285 |
| 592 | 3300003790 | Ga0055528_1000520 | Ga0055528_10005204 | 285 |
| 593 | 3300003792 | Ga0055540_1004478 | Ga0055540_10044787 | 285 |
| 594 | 3300005288 | Ga0065714_10010832 | Ga0065714_100108323 | 285 |
| 595 | 3300005288 | Ga0065714_10069048 | Ga0065714_100690482 | 285 |
| 596 | 3300005289 | Ga0065704_10086797 | Ga0065704_100867973 | 285 |
| 597 | 3300005328 | Ga0070676_10068230 | Ga0070676_100682302 | 285 |
| 598 | 3300005328 | Ga0070676_10210770 | Ga0070676_102107703 | 285 |
| 599 | 3300005331 | Ga0070670_100109243 | Ga0070670_1001092432 | 285 |
| 600 | 3300005333 | Ga0070677_10116408 | Ga0070677_101164082 | 285 |
| 601 | 3300005334 | Ga0068869_100154241 | Ga0068869_1001542412 | 285 |
| 602 | 3300005335 | Ga0070666_10098764 | Ga0070666_100987642 | 285 |
| 603 | 3300005338 | Ga0068868_100143982 | Ga0068868_1001439824 | 285 |
| 604 | 3300005338 | Ga0068868_100389487 | Ga0068868_1003894872 | 285 |
| 605 | 3300005347 | Ga0070668_100023220 | Ga0070668_1000232205 | 285 |
| 606 | 3300005353 | Ga0070669_100089023 | Ga0070669_1000890232 | 285 |
| 607 | 3300005353 | Ga0070669_100142582 | Ga0070669_1001425824 | 285 |
| 608 | 3300005354 | Ga0070675_100055658 | Ga0070675_1000556582 | 285 |
| 609 | 3300005354 | Ga0070675_100066280 | Ga0070675_1000662802 | 285 |
| 610 | 3300005354 | Ga0070675_100161456 | Ga0070675_1001614562 | 285 |
| 611 | 3300005355 | Ga0070671_100057372 | Ga0070671_1000573722 | 285 |
| 612 | 3300005355 | Ga0070671_100148747 | Ga0070671_1001487472 | 285 |
| 613 | 3300005356 | Ga0070674_100099970 | Ga0070674_1000999702 | 285 |
| 614 | 3300005364 | Ga0070673_100061792 | Ga0070673_1000617922 | 285 |
| 615 | 3300005365 | Ga0070688_100043718 | Ga0070688_1000437184 | 285 |
| 616 | 3300005367 | Ga0070667_100026936 | Ga0070667_1000269363 | 285 |
| 617 | 3300005367 | Ga0070667_100137940 | Ga0070667_1001379404 | 285 |
| 618 | 3300005438 | Ga0070701_10067851 | Ga0070701_100678512 | 285 |
| 619 | 3300005438 | Ga0070701_10095451 | Ga0070701_100954512 | 285 |
| 620 | 3300005456 | Ga0070678_100018733 | Ga0070678_1000187336 | 285 |
| 621 | 3300005456 | Ga0070678_100238044 | Ga0070678_1002380444 | 285 |
| 622 | 3300005457 | Ga0070662_100181192 | Ga0070662_1001811922 | 285 |
| 623 | 3300005459 | Ga0068867_100068818 | Ga0068867_1000688184 | 285 |
| 624 | 3300005459 | Ga0068867_100367798 | Ga0068867_1003677982 | 285 |
| 625 | 3300005543 | Ga0070672_100065748 | Ga0070672_1000657482 | 285 |
| 626 | 3300005543 | Ga0070672_100152877 | Ga0070672_1001528773 | 285 |
| 627 | 3300005543 | Ga0070672_100350988 | Ga0070672_1003509881 | 285 |
| 628 | 3300005544 | Ga0070686_100042934 | Ga0070686_1000429345 | 285 |
| 629 | 3300005564 | Ga0070664_100075939 | Ga0070664_1000759393 | 285 |
| 630 | 3300005577 | Ga0068857_100328513 | Ga0068857_1003285131 | 285 |
| 631 | 3300005617 | Ga0068859_100140846 | Ga0068859_1001408462 | 285 |
| 632 | 3300005618 | Ga0068864_100067928 | Ga0068864_1000679285 | 285 |
| 633 | 3300005618 | Ga0068864_100198167 | Ga0068864_1001981674 | 285 |
| 634 | 3300005618 | Ga0068864_100199249 | Ga0068864_1001992492 | 285 |
| 635 | 3300005718 | Ga0068866_10136362 | Ga0068866_101363624 | 285 |
| 636 | 3300005840 | Ga0068870_10098928 | Ga0068870_100989284 | 285 |
| 637 | 3300005840 | Ga0068870_10144819 | Ga0068870_101448192 | 285 |
| 638 | 3300005841 | Ga0068863_100039081 | Ga0068863_1000390812 | 285 |
| 639 | 3300005841 | Ga0068863_100236748 | Ga0068863_1002367483 | 285 |
| 640 | 3300005843 | Ga0068860_100101198 | Ga0068860_1001011984 | 285 |
| 641 | 3300006038 | Ga0075365_10002031 | Ga0075365_100020314 | 285 |
| 642 | 3300006048 | Ga0075363_100002675 | Ga0075363_1000026757 | 285 |
| 643 | 3300006048 | Ga0075363_100057328 | Ga0075363_1000573282 | 285 |
| 644 | 3300006048 | Ga0075363_100073300 | Ga0075363_1000733002 | 285 |
| 645 | 3300006051 | Ga0075364_10007877 | Ga0075364_100078774 | 285 |
| 646 | 3300006058 | Ga0075432_10005523 | Ga0075432_100055233 | 285 |
| 647 | 3300006177 | Ga0075362_10008330 | Ga0075362_100083303 | 285 |
| 648 | 3300006177 | Ga0075362_10049758 | Ga0075362_100497583 | 285 |
| 649 | 3300006177 | Ga0075362_10052475 | Ga0075362_100524752 | 285 |
| 650 | 3300006195 | Ga0075366_10008587 | Ga0075366_100085876 | 285 |
| 651 | 3300006195 | Ga0075366_10014371 | Ga0075366_100143715 | 285 |
| 652 | 3300006237 | Ga0097621_100023062 | Ga0097621_1000230622 | 285 |
| 653 | 3300006237 | Ga0097621_100154921 | Ga0097621_1001549213 | 285 |
| 654 | 3300006237 | Ga0097621_100199990 | Ga0097621_1001999901 | 285 |
| 655 | 3300006353 | Ga0075370_10003278 | Ga0075370_100032784 | 285 |
| 656 | 3300006353 | Ga0075370_10131833 | Ga0075370_101318332 | 285 |
| 657 | 3300006358 | Ga0068871_100162978 | Ga0068871_1001629783 | 285 |
| 658 | 3300006358 | Ga0068871_100325007 | Ga0068871_1003250073 | 285 |
| 659 | 3300006931 | Ga0097620_100140849 | Ga0097620_1001408492 | 285 |
| 660 | 3300006946 | Ga0079104_1037793 | Ga0079104_10377932 | 285 |
| 661 | 3300006948 | Ga0099826_10000158 | Ga0099826_1000015821 | 285 |
| 662 | 3300006948 | Ga0099826_10173688 | Ga0099826_101736881 | 285 |
| 663 | 3300009094 | Ga0111539_10477850 | Ga0111539_104778503 | 285 |
| 664 | 3300009176 | Ga0105242_10004957 | Ga0105242_100049577 | 285 |
| 665 | 3300009176 | Ga0105242_10127021 | Ga0105242_101270214 | 285 |
| 666 | 3300011119 | Ga0105246_10142264 | Ga0105246_101422643 | 285 |
| 667 | 3300013100 | Ga0157373_10083856 | Ga0157373_100838564 | 285 |
| 668 | 3300013296 | Ga0157374_10089392 | Ga0157374_100893922 | 285 |
| 669 | 3300013306 | Ga0163162_10085086 | Ga0163162_100850863 | 285 |
| 670 | 3300013306 | Ga0163162_10450054 | Ga0163162_104500543 | 285 |
| 671 | 3300013306 | Ga0163162_10510596 | Ga0163162_105105962 | 285 |
| 672 | 3300013308 | Ga0157375_10194265 | Ga0157375_101942654 | 285 |
| 673 | 3300014326 | Ga0157380_10081167 | Ga0157380_100811674 | 285 |
| 674 | 3300014497 | Ga0182008_10003802 | Ga0182008_1000380210 | 285 |
| 675 | 3300014745 | Ga0157377_10128626 | Ga0157377_101286264 | 285 |
| 676 | 3300014968 | Ga0157379_10086742 | Ga0157379_100867422 | 285 |
| 677 | 3300015261 | Ga0182006_1089025 | Ga0182006_10890252 | 285 |
| 678 | 3300017792 | Ga0163161_10062469 | Ga0163161_100624692 | 285 |
| 679 | 3300021361 | Ga0213872_10026422 | Ga0213872_100264224 | 285 |
| 680 | 3300025263 | Ga0209565_1000073 | Ga0209565_1000073136 | 285 |
| 681 | 3300025273 | Ga0209673_1000127 | Ga0209673_100012731 | 285 |
| 682 | 3300025291 | Ga0209675_1000029 | Ga0209675_100002931 | 285 |
| 683 | 3300025303 | Ga0209051_1000298 | Ga0209051_100029858 | 285 |
| 684 | 3300025315 | Ga0207697_10005112 | Ga0207697_100051125 | 285 |
| 685 | 3300025893 | Ga0207682_10005184 | Ga0207682_100051845 | 285 |
| 686 | 3300025901 | Ga0207688_10008591 | Ga0207688_100085912 | 285 |
| 687 | 3300025908 | Ga0207643_10011009 | Ga0207643_100110098 | 285 |
| 688 | 3300025908 | Ga0207643_10039075 | Ga0207643_100390752 | 285 |
| 689 | 3300025923 | Ga0207681_10085785 | Ga0207681_100857852 | 285 |
| 690 | 3300025923 | Ga0207681_10433693 | Ga0207681_104336931 | 285 |
| 691 | 3300025925 | Ga0207650_10064331 | Ga0207650_100643315 | 285 |
| 692 | 3300025927 | Ga0207687_10231925 | Ga0207687_102319251 | 285 |
| 693 | 3300025931 | Ga0207644_10076074 | Ga0207644_100760743 | 285 |
| 694 | 3300025931 | Ga0207644_10086918 | Ga0207644_100869184 | 285 |
| 695 | 3300025933 | Ga0207706_10021932 | Ga0207706_100219327 | 285 |
| 696 | 3300025933 | Ga0207706_10022691 | Ga0207706_100226911 | 285 |
| 697 | 3300025940 | Ga0207691_10138889 | Ga0207691_101388893 | 285 |
| 698 | 3300025940 | Ga0207691_10194637 | Ga0207691_101946372 | 285 |
| 699 | 3300025940 | Ga0207691_10361337 | Ga0207691_103613371 | 285 |
| 700 | 3300025942 | Ga0207689_10266439 | Ga0207689_102664391 | 285 |
| 701 | 3300025945 | Ga0207679_10130641 | Ga0207679_101306414 | 285 |
| 702 | 3300025949 | Ga0207667_10153920 | Ga0207667_101539202 | 285 |
| 703 | 3300025986 | Ga0207658_10046245 | Ga0207658_100462453 | 285 |
| 704 | 3300025986 | Ga0207658_10079414 | Ga0207658_100794142 | 285 |
| 705 | 3300026023 | Ga0207677_10052706 | Ga0207677_100527062 | 285 |
| 706 | 3300026023 | Ga0207677_10528727 | Ga0207677_105287271 | 285 |
| 707 | 3300026035 | Ga0207703_10377606 | Ga0207703_103776061 | 285 |
| 708 | 3300026095 | Ga0207676_10003299 | Ga0207676_100032999 | 285 |
| 709 | 3300026121 | Ga0207683_10112578 | Ga0207683_101125782 | 285 |
| 710 | 3300026121 | Ga0207683_10226209 | Ga0207683_102262093 | 285 |
| 711 | 3300026121 | Ga0207683_10334477 | Ga0207683_103344774 | 285 |
| 712 | 3300027111 | Ga0209281_1014544 | Ga0209281_10145442 | 285 |
| 713 | 3300027666 | Ga0209282_1015352 | Ga0209282_10153524 | 285 |
| 714 | 3300027907 | Ga0207428_10047701 | Ga0207428_100477013 | 285 |
| 715 | 3300028577 | Ga0265318_10002709 | Ga0265318_1000270910 | 285 |
| 716 | 3300028794 | Ga0307515_10013496 | Ga0307515_100134964 | 285 |
| 717 | 3300030731 | Ga0316177_1003817 | Ga0316177_10038176 | 285 |
| 718 | 3300030732 | Ga0316176_1149365 | Ga0316176_11493653 | 285 |
| 719 | 3300030733 | Ga0314311_1083999 | Ga0314311_10839994 | 285 |
| 720 | 3300030734 | Ga0316179_1085170 | Ga0316179_10851703 | 285 |
| 721 | 3300030735 | Ga0316178_1017927 | Ga0316178_10179272 | 285 |
| 722 | 3300030736 | Ga0316180_1046521 | Ga0316180_10465212 | 285 |
| 723 | 3300030742 | Ga0316183_1151240 | Ga0316183_11512405 | 285 |
| 724 | 3300030745 | Ga0316182_1058328 | Ga0316182_10583282 | 285 |
| 725 | 3300030745 | Ga0316182_1410417 | Ga0316182_14104172 | 285 |
| 726 | 3300031238 | Ga0265332_10003349 | Ga0265332_100033496 | 285 |
| 727 | 3300031239 | Ga0265328_10008502 | Ga0265328_100085023 | 285 |
| 728 | 3300031242 | Ga0265329_10011235 | Ga0265329_100112352 | 285 |
| 729 | 3300031250 | Ga0265331_10003732 | Ga0265331_100037328 | 285 |
| 730 | 3300031344 | Ga0265316_10010873 | Ga0265316_100108732 | 285 |
| 731 | 3300031548 | Ga0307408_100039531 | Ga0307408_1000395314 | 285 |
| 732 | 3300031548 | Ga0307408_100050469 | Ga0307408_1000504692 | 285 |
| 733 | 3300031548 | Ga0307408_100064395 | Ga0307408_1000643954 | 285 |
| 734 | 3300031649 | Ga0307514_10071427 | Ga0307514_100714274 | 285 |
| 735 | 3300031711 | Ga0265314_10001467 | Ga0265314_1000146713 | 285 |
| 736 | 3300031901 | Ga0307406_10003021 | Ga0307406_100030214 | 285 |
| 737 | 3300032004 | Ga0307414_10121866 | Ga0307414_101218662 | 285 |
| 738 | 3300032004 | Ga0307414_10202554 | Ga0307414_102025542 | 285 |
| 739 | 3300035725 | Ga0373947_0118636 | Ga0373947_0118636_440_1378 | 285 |
| 740 | 3300036401 | Ga0373937_0153344 | Ga0373937_0153344_194_1108 | 285 |
| 741 | 3300039447 | Ga0436361_0931472 | Ga0436361_0931472_568_1491 | 285 |
| 742 | 3300042134 | Ga0450898_008466 | Ga0450898_008466_473_1390 | 285 |
| 743 | 3300042184 | Ga0450908_015792 | Ga0450908_015792_249_1160 | 285 |
| 744 | 3300042439 | Ga0439464_0034703 | Ga0439464_0034703_439_1356 | 285 |
| 745 | 3300042531 | Ga0450918_014549 | Ga0450918_014549_65_976 | 285 |
| 746 | 3300044673 | Ga0453683_0001302 | Ga0453683_0001302_8820_9740 | 285 |
| 747 | 3300045051 | Ga0451576_0007943 | Ga0451576_0007943_1345_2265 | 285 |
| 748 | 3300046459 | Ga0495629_0079155 | Ga0495629_0079155_1290_2228 | 285 |
| 749 | 3300046475 | Ga0495639_0032738 | Ga0495639_0032738_501_1421 | 285 |
| 750 | 3300046660 | Ga0495625_0000301 | Ga0495625_0000301_47020_47931 | 285 |
| 751 | 3300046683 | Ga0495658_0103737 | Ga0495658_0103737_571_1509 | 285 |
| 752 | 3300046684 | Ga0495669_0122501 | Ga0495669_0122501_187_1107 | 285 |
| 753 | 3300048903 | Ga0496100_0067238 | Ga0496100_0067238_361_1281 | 285 |
| 754 | 3300048905 | Ga0496102_0007543 | Ga0496102_0007543_1323_2243 | 285 |
| 755 | 3300048905 | Ga0496102_0406185 | Ga0496102_0406185_162_1088 | 285 |
| 756 | 3300048908 | Ga0496105_0039488 | Ga0496105_0039488_1241_2161 | 285 |
| 757 | 3300048909 | Ga0496106_0045843 | Ga0496106_0045843_766_1680 | 285 |
| 758 | 3300048910 | Ga0496107_0040387 | Ga0496107_0040387_1539_2459 | 285 |
| 759 | 3300048912 | Ga0496109_0050631 | Ga0496109_0050631_697_1617 | 285 |
| 760 | 3300048912 | Ga0496109_0407723 | Ga0496109_0407723_133_1059 | 285 |
| 761 | 3300048913 | Ga0496110_0111368 | Ga0496110_0111368_435_1355 | 285 |
| 762 | 3300048913 | Ga0496110_0498723 | Ga0496110_0498723_104_1024 | 285 |
| 763 | 3300048914 | Ga0496111_0067637 | Ga0496111_0067637_1249_2169 | 285 |
| 764 | 3300048925 | Ga0496122_0001420 | Ga0496122_0001420_1620_2537 | 285 |
| 765 | 3300048926 | Ga0496123_0000600 | Ga0496123_0000600_1281_2198 | 285 |
| 766 | 3300048927 | Ga0496124_0071187 | Ga0496124_0071187_1123_2040 | 285 |
| 767 | 3300048929 | Ga0496126_0251682 | Ga0496126_0251682_180_1097 | 285 |
| 768 | 3300049572 | Ga0501036_0038821 | Ga0501036_0038821_1787_2695 | 285 |
| 769 | 3300049575 | Ga0501039_0026073 | Ga0501039_0026073_1272_2180 | 285 |
| 770 | 3300049576 | Ga0501040_0105749 | Ga0501040_0105749_779_1687 | 285 |
| 771 | 3300049577 | Ga0501041_0010232 | Ga0501041_0010232_900_1808 | 285 |
| 772 | 3300049578 | Ga0501042_0005972 | Ga0501042_0005972_1362_2270 | 285 |
| 773 | 3300049582 | Ga0501048_0022496 | Ga0501048_0022496_13_921 | 285 |
| 774 | 3300049582 | Ga0501048_0147469 | Ga0501048_0147469_580_1488 | 285 |
| 775 | 3300049587 | Ga0501071_0003384 | Ga0501071_0003384_7265_8173 | 285 |
| 776 | 3300049588 | Ga0501072_0048278 | Ga0501072_0048278_426_1334 | 285 |
| 777 | 3300049590 | Ga0501074_0051128 | Ga0501074_0051128_2003_2911 | 285 |
| 778 | 3300049592 | Ga0501076_0002129 | Ga0501076_0002129_10861_11769 | 285 |
| 779 | 3300049592 | Ga0501076_0051916 | Ga0501076_0051916_1947_2855 | 285 |
| 780 | 3300049593 | Ga0501077_0121118 | Ga0501077_0121118_458_1381 | 285 |
| 781 | 3300049742 | Ga0501080_0003450 | Ga0501080_0003450_11211_12119 | 285 |
| 782 | 3300049759 | Ga0501262_000019 | Ga0501262_000019_1420_2334 | 285 |
| 783 | 3300049824 | Ga0501045_0001611 | Ga0501045_0001611_10986_11894 | 285 |
| 784 | 3300049824 | Ga0501045_0061952 | Ga0501045_0061952_866_1774 | 285 |
| 785 | 3300050489 | nmdc:mga03683_12565_c1 | nmdc:mga03683_12565_c1_1863_2777 | 285 |
| 786 | 3300050489 | nmdc:mga03683_44813_c1 | nmdc:mga03683_44813_c1_461_1372 | 285 |
| 787 | 3300050489 | nmdc:mga03683_48867_c1 | nmdc:mga03683_48867_c1_171_1082 | 285 |
| 788 | 3300050490 | nmdc:mga03n38_94249_c1 | nmdc:mga03n38_94249_c1_374_1285 | 285 |
| 789 | 3300050491 | nmdc:mga00v17_7571_c1 | nmdc:mga00v17_7571_c1_585_1496 | 285 |
| 790 | 3300050492 | nmdc:mga0yw44_8270_c1 | nmdc:mga0yw44_8270_c1_1863_2774 | 285 |
| 791 | 3300050493 | nmdc:mga0k408_140243_c1 | nmdc:mga0k408_140243_c1_335_1246 | 285 |
| 792 | 3300050493 | nmdc:mga0k408_74029_c1 | nmdc:mga0k408_74029_c1_350_1264 | 285 |
| 793 | 3300050496 | nmdc:mga07m45_31312_c1 | nmdc:mga07m45_31312_c1_634_1545 | 285 |
| 794 | 3300053108 | Ga0500562_016884 | Ga0500562_016884_954_1862 | 285 |
| 795 | 3300054114 | Ga0501084_0027732 | Ga0501084_0027732_44_952 | 285 |
| 796 | 3300060353 | Ga0501082_0179587 | Ga0501082_0179587_762_1670 | 285 |
| 797 | 3300061734 | Ga0530510_0004510 | Ga0530510_0004510_7118_8026 | 285 |
| 798 | 3300061734 | Ga0530510_0080253 | Ga0530510_0080253_1248_2156 | 285 |
| 799 | iso_pu_bacteria | 2643221628 | 2644159708 | 285 |
| 800 | iso_pu_bacteria | 2842677519 | 2842678547 | 285 |
| 801 | iso_pu_bacteria | 2904449895 | 2904454282 | 285 |
| 802 | iso_pu_bacteria | 2904456579 | 2904462722 | 285 |
| 803 | iso_pu_bacteria | 2919462493 | 2919465038 | 285 |
| 804 | iso_pu_bacteria | 2928115317 | 2928116237 | 285 |
| 805 | iso_pu_bacteria | 2929520902 | 2929527170 | 285 |
| 806 | iso_pu_bacteria | 2954767861 | 2954772190 | 285 |
| 807 | 3300003775 | Ga0055524_1000113 | Ga0055524_100011321 | 286 |
| 808 | 3300003781 | Ga0055536_1000458 | Ga0055536_10004583 | 286 |
| 809 | 3300003792 | Ga0055540_1000268 | Ga0055540_100026835 | 286 |
| 810 | 3300003792 | Ga0055540_1018458 | Ga0055540_10184582 | 286 |
| 811 | 3300003794 | Ga0055531_10013596 | Ga0055531_100135964 | 286 |
| 812 | 3300005327 | Ga0070658_10177129 | Ga0070658_101771292 | 286 |
| 813 | 3300005366 | Ga0070659_100090075 | Ga0070659_1000900752 | 286 |
| 814 | 3300005441 | Ga0070700_100039937 | Ga0070700_1000399373 | 286 |
| 815 | 3300005457 | Ga0070662_100027067 | Ga0070662_1000270673 | 286 |
| 816 | 3300005548 | Ga0070665_100023711 | Ga0070665_1000237114 | 286 |
| 817 | 3300005564 | Ga0070664_100083686 | Ga0070664_1000836862 | 286 |
| 818 | 3300005617 | Ga0068859_100205797 | Ga0068859_1002057973 | 286 |
| 819 | 3300005844 | Ga0068862_100097995 | Ga0068862_1000979952 | 286 |
| 820 | 3300006051 | Ga0075364_10160220 | Ga0075364_101602203 | 286 |
| 821 | 3300006353 | Ga0075370_10056515 | Ga0075370_100565153 | 286 |
| 822 | 3300006358 | Ga0068871_100442201 | Ga0068871_1004422011 | 286 |
| 823 | 3300006931 | Ga0097620_100205783 | Ga0097620_1002057833 | 286 |
| 824 | 3300006946 | Ga0079104_1000056 | Ga0079104_1000056117 | 286 |
| 825 | 3300009036 | Ga0105244_10000730 | Ga0105244_1000073023 | 286 |
| 826 | 3300009148 | Ga0105243_10000392 | Ga0105243_100003922 | 286 |
| 827 | 3300009148 | Ga0105243_10002832 | Ga0105243_100028328 | 286 |
| 828 | 3300009174 | Ga0105241_10162914 | Ga0105241_101629142 | 286 |
| 829 | 3300009176 | Ga0105242_10177028 | Ga0105242_101770283 | 286 |
| 830 | 3300009551 | Ga0105238_10226513 | Ga0105238_102265132 | 286 |
| 831 | 3300011119 | Ga0105246_10020610 | Ga0105246_100206105 | 286 |
| 832 | 3300014497 | Ga0182008_10038117 | Ga0182008_100381172 | 286 |
| 833 | 3300015261 | Ga0182006_1000910 | Ga0182006_100091011 | 286 |
| 834 | 3300015262 | Ga0182007_10002257 | Ga0182007_1000225715 | 286 |
| 835 | 3300025291 | Ga0209675_1008282 | Ga0209675_10082822 | 286 |
| 836 | 3300025292 | Ga0209676_1000098 | Ga0209676_1000098108 | 286 |
| 837 | 3300025299 | Ga0209256_1000049 | Ga0209256_1000049238 | 286 |
| 838 | 3300025303 | Ga0209051_1000029 | Ga0209051_1000029238 | 286 |
| 839 | 3300025303 | Ga0209051_1000098 | Ga0209051_1000098108 | 286 |
| 840 | 3300025304 | Ga0209257_1000168 | Ga0209257_100016834 | 286 |
| 841 | 3300025304 | Ga0209257_1005944 | Ga0209257_10059449 | 286 |
| 842 | 3300025728 | Ga0207655_1001409 | Ga0207655_100140917 | 286 |
| 843 | 3300025905 | Ga0207685_10040174 | Ga0207685_100401743 | 286 |
| 844 | 3300025933 | Ga0207706_10006375 | Ga0207706_1000637511 | 286 |
| 845 | 3300025935 | Ga0207709_10000130 | Ga0207709_1000013041 | 286 |
| 846 | 3300025935 | Ga0207709_10002008 | Ga0207709_1000200813 | 286 |
| 847 | 3300025942 | Ga0207689_10021236 | Ga0207689_100212361 | 286 |
| 848 | 3300025945 | Ga0207679_10056475 | Ga0207679_100564754 | 286 |
| 849 | 3300025981 | Ga0207640_10182606 | Ga0207640_101826061 | 286 |
| 850 | 3300026088 | Ga0207641_10255090 | Ga0207641_102550901 | 286 |
| 851 | 3300026118 | Ga0207675_100052998 | Ga0207675_1000529984 | 286 |
| 852 | 3300027111 | Ga0209281_1000125 | Ga0209281_1000125125 | 286 |
| 853 | 3300028380 | Ga0268265_10036907 | Ga0268265_100369073 | 286 |
| 854 | 3300028794 | Ga0307515_10135551 | Ga0307515_101355512 | 286 |
| 855 | 3300031250 | Ga0265331_10000851 | Ga0265331_1000085110 | 286 |
| 856 | 3300031251 | Ga0265327_10000307 | Ga0265327_1000030770 | 286 |
| 857 | 3300031456 | Ga0307513_10027912 | Ga0307513_100279123 | 286 |
| 858 | 3300031456 | Ga0307513_10174518 | Ga0307513_101745183 | 286 |
| 859 | 3300036401 | Ga0373937_0150707 | Ga0373937_0150707_674_1603 | 286 |
| 860 | 3300037471 | Ga0395905_0030863 | Ga0395905_0030863_32_955 | 286 |
| 861 | 3300045051 | Ga0451576_0004712 | Ga0451576_0004712_10230_11126 | 286 |
| 862 | 3300046519 | Ga0495632_0038981 | Ga0495632_0038981_669_1601 | 286 |
| 863 | 3300048917 | Ga0496114_0003146 | Ga0496114_0003146_10456_11367 | 286 |
| 864 | 3300048917 | Ga0496114_0070605 | Ga0496114_0070605_1570_2520 | 286 |
| 865 | 3300048919 | Ga0496116_0011139 | Ga0496116_0011139_5309_6223 | 286 |
| 866 | 3300048920 | Ga0496117_0022171 | Ga0496117_0022171_385_1299 | 286 |
| 867 | 3300048921 | Ga0496118_0019623 | Ga0496118_0019623_4933_5847 | 286 |
| 868 | 3300048924 | Ga0496121_0084891 | Ga0496121_0084891_654_1568 | 286 |
| 869 | 3300048927 | Ga0496124_0077267 | Ga0496124_0077267_1310_2224 | 286 |
| 870 | 3300048928 | Ga0496125_0072287 | Ga0496125_0072287_978_1892 | 286 |
| 871 | 3300049742 | Ga0501080_0182297 | Ga0501080_0182297_82_1011 | 286 |
| 872 | 3300050493 | nmdc:mga0k408_42947_c1 | nmdc:mga0k408_42947_c1_968_1882 | 286 |
| 873 | 3300050496 | nmdc:mga07m45_54575_c1 | nmdc:mga07m45_54575_c1_340_1254 | 286 |
| 874 | 3300053122 | Ga0500608_025912 | Ga0500608_025912_1035_1967 | 286 |
| 875 | iso_pu_bacteria | 2513020051 | 2513228564 | 286 |
| 876 | iso_pu_bacteria | 2643221683 | 2644464790 | 286 |
| 877 | 3300005364 | Ga0070673_100199708 | Ga0070673_1001997083 | 287 |
| 878 | 3300005543 | Ga0070672_100148383 | Ga0070672_1001483833 | 287 |
| 879 | 3300005844 | Ga0068862_100261239 | Ga0068862_1002612393 | 287 |
| 880 | 3300025918 | Ga0207662_10209630 | Ga0207662_102096303 | 287 |
| 881 | 3300025920 | Ga0207649_10049039 | Ga0207649_100490393 | 287 |
| 882 | 3300025933 | Ga0207706_10201512 | Ga0207706_102015123 | 287 |
| 883 | 3300025936 | Ga0207670_10085152 | Ga0207670_100851523 | 287 |
| 884 | 3300025960 | Ga0207651_10153723 | Ga0207651_101537233 | 287 |
| 885 | 3300028380 | Ga0268265_10029776 | Ga0268265_100297765 | 287 |
| 886 | 3300031731 | Ga0307405_10275864 | Ga0307405_102758641 | 287 |
| 887 | 3300031824 | Ga0307413_10025594 | Ga0307413_100255944 | 287 |
| 888 | 3300031852 | Ga0307410_10022516 | Ga0307410_100225164 | 287 |
| 889 | 3300032005 | Ga0307411_10037715 | Ga0307411_100377154 | 287 |
| 890 | 3300005353 | Ga0070669_100061108 | Ga0070669_1000611083 | 288 |
| 891 | 3300005354 | Ga0070675_100034134 | Ga0070675_1000341344 | 288 |
| 892 | 3300005355 | Ga0070671_100325025 | Ga0070671_1003250252 | 288 |
| 893 | 3300005364 | Ga0070673_100507737 | Ga0070673_1005077371 | 288 |
| 894 | 3300005438 | Ga0070701_10064211 | Ga0070701_100642113 | 288 |
| 895 | 3300005563 | Ga0068855_100219120 | Ga0068855_1002191202 | 288 |
| 896 | 3300005578 | Ga0068854_100100719 | Ga0068854_1001007193 | 288 |
| 897 | 3300005614 | Ga0068856_100370997 | Ga0068856_1003709972 | 288 |
| 898 | 3300005719 | Ga0068861_100033223 | Ga0068861_1000332235 | 288 |
| 899 | 3300009094 | Ga0111539_10217357 | Ga0111539_102173573 | 288 |
| 900 | 3300013100 | Ga0157373_10034715 | Ga0157373_100347152 | 288 |
| 901 | 3300013105 | Ga0157369_10005435 | Ga0157369_1000543511 | 288 |
| 902 | 3300014326 | Ga0157380_10096386 | Ga0157380_100963863 | 288 |
| 903 | 3300017792 | Ga0163161_10397696 | Ga0163161_103976962 | 288 |
| 904 | 3300025908 | Ga0207643_10223152 | Ga0207643_102231522 | 288 |
| 905 | 3300025913 | Ga0207695_10023486 | Ga0207695_100234867 | 288 |
| 906 | 3300025923 | Ga0207681_10061572 | Ga0207681_100615723 | 288 |
| 907 | 3300025949 | Ga0207667_10042087 | Ga0207667_100420873 | 288 |
| 908 | 3300025960 | Ga0207651_10182012 | Ga0207651_101820122 | 288 |
| 909 | 3300025972 | Ga0207668_10144803 | Ga0207668_101448031 | 288 |
| 910 | 3300025981 | Ga0207640_10079885 | Ga0207640_100798852 | 288 |
| 911 | 3300026075 | Ga0207708_10026016 | Ga0207708_100260165 | 288 |
| 912 | 3300026118 | Ga0207675_100085814 | Ga0207675_1000858144 | 288 |
| 913 | 3300031507 | Ga0307509_10049938 | Ga0307509_100499384 | 288 |
| 914 | 3300031824 | Ga0307413_10028219 | Ga0307413_100282194 | 288 |
| 915 | 3300031852 | Ga0307410_10010931 | Ga0307410_100109315 | 288 |
| 916 | 3300032005 | Ga0307411_10043857 | Ga0307411_100438573 | 288 |
| 917 | 3300041486 | Ga0451807_2059420 | Ga0451807_2059420_240_1199 | 288 |
| 918 | 3300047320 | Ga0495672_0081770 | Ga0495672_0081770_501_1445 | 288 |
| 919 | 3300048925 | Ga0496122_0022636 | Ga0496122_0022636_89_1027 | 288 |
| 920 | 3300048926 | Ga0496123_0114229 | Ga0496123_0114229_466_1404 | 288 |
| 921 | 3300050511 | nmdc:mga08y16_289275_c1 | nmdc:mga08y16_289275_c1_150_1094 | 288 |
| 922 | 3300005290 | Ga0065712_10129000 | Ga0065712_101290003 | 291 |
| 923 | 3300005356 | Ga0070674_100221997 | Ga0070674_1002219971 | 291 |
| 924 | 3300005365 | Ga0070688_100107485 | Ga0070688_1001074851 | 291 |
| 925 | 3300005457 | Ga0070662_100242017 | Ga0070662_1002420173 | 291 |
| 926 | 3300005543 | Ga0070672_100151205 | Ga0070672_1001512053 | 291 |
| 927 | 3300005564 | Ga0070664_100148795 | Ga0070664_1001487952 | 291 |
| 928 | 3300005842 | Ga0068858_100039850 | Ga0068858_1000398503 | 291 |
| 929 | 3300017792 | Ga0163161_10065587 | Ga0163161_100655873 | 291 |
| 930 | 3300025321 | Ga0207656_10017243 | Ga0207656_100172434 | 291 |
| 931 | 3300025899 | Ga0207642_10057526 | Ga0207642_100575263 | 291 |
| 932 | 3300025919 | Ga0207657_10016156 | Ga0207657_100161569 | 291 |
| 933 | 3300025933 | Ga0207706_10009612 | Ga0207706_100096125 | 291 |
| 934 | 3300025941 | Ga0207711_10083054 | Ga0207711_100830543 | 291 |
| 935 | 3300025945 | Ga0207679_10476655 | Ga0207679_104766552 | 291 |
| 936 | 3300025949 | Ga0207667_10216026 | Ga0207667_102160263 | 291 |
| 937 | 3300025986 | Ga0207658_10062892 | Ga0207658_100628924 | 291 |
| 938 | 3300026089 | Ga0207648_10021970 | Ga0207648_100219703 | 291 |
| 939 | 3300026118 | Ga0207675_100011774 | Ga0207675_1000117746 | 291 |
| 940 | 3300035083 | Ga0373926_0088517 | Ga0373926_0088517_88_999 | 291 |
| 941 | 3300035116 | Ga0373945_0016993 | Ga0373945_0016993_1240_2151 | 291 |
| 942 | 3300035170 | Ga0373943_0163565 | Ga0373943_0163565_225_1136 | 291 |
| 943 | 3300037068 | Ga0373925_0081477 | Ga0373925_0081477_10_921 | 291 |
| 944 | 3300046472 | Ga0495580_0022385 | Ga0495580_0022385_2990_3901 | 291 |
| 945 | 3300048904 | Ga0496101_0034674 | Ga0496101_0034674_726_1637 | 291 |
| 946 | 3300048905 | Ga0496102_0123693 | Ga0496102_0123693_166_1077 | 291 |
| 947 | 3300048909 | Ga0496106_0040117 | Ga0496106_0040117_1008_1919 | 291 |
| 948 | 3300050511 | nmdc:mga08y16_149083_c1 | nmdc:mga08y16_149083_c1_253_1164 | 291 |
| 949 | 3300001915 | JGI24741J21665_1005020 | JGI24741J21665_10050202 | 292 |
| 950 | 3300001979 | JGI24740J21852_10000244 | JGI24740J21852_100002446 | 292 |
| 951 | 3300005337 | Ga0070682_100014615 | Ga0070682_1000146154 | 292 |
| 952 | 3300005366 | Ga0070659_100548543 | Ga0070659_1005485431 | 292 |
| 953 | 3300005564 | Ga0070664_100011657 | Ga0070664_1000116573 | 292 |
| 954 | 3300009093 | Ga0105240_10102054 | Ga0105240_101020542 | 292 |
| 955 | 3300009551 | Ga0105238_10001422 | Ga0105238_100014229 | 292 |
| 956 | 3300025904 | Ga0207647_10001513 | Ga0207647_1000151312 | 292 |
| 957 | 3300025912 | Ga0207707_10002857 | Ga0207707_100028576 | 292 |
| 958 | 3300025913 | Ga0207695_10479856 | Ga0207695_104798561 | 292 |
| 959 | 3300025917 | Ga0207660_10001862 | Ga0207660_100018624 | 292 |
| 960 | 3300025921 | Ga0207652_10000796 | Ga0207652_1000079614 | 292 |
| 961 | 3300025933 | Ga0207706_10013795 | Ga0207706_100137956 | 292 |
| 962 | 3300025944 | Ga0207661_10232938 | Ga0207661_102329383 | 292 |
| 963 | 3300025945 | Ga0207679_10287488 | Ga0207679_102874881 | 292 |
| 964 | 3300025981 | Ga0207640_10006832 | Ga0207640_100068326 | 292 |
| 965 | 3300026041 | Ga0207639_10102943 | Ga0207639_101029433 | 292 |
| 966 | 3300026067 | Ga0207678_10020101 | Ga0207678_100201013 | 292 |
| 967 | 3300026078 | Ga0207702_10063231 | Ga0207702_100632312 | 292 |
| 968 | 3300026116 | Ga0207674_10011742 | Ga0207674_100117424 | 292 |
| 969 | 3300049571 | Ga0501034_0061896 | Ga0501034_0061896_302_1213 | 292 |
| 970 | 3300049573 | Ga0501037_0004400 | Ga0501037_0004400_6506_7417 | 292 |
| 971 | 3300049581 | Ga0501047_0002970 | Ga0501047_0002970_12155_13066 | 292 |
| 972 | 3300049585 | Ga0501069_0010656 | Ga0501069_0010656_3288_4199 | 292 |
| 973 | 3300049586 | Ga0501070_0000395 | Ga0501070_0000395_3239_4150 | 292 |
| 974 | 3300049586 | Ga0501070_0006146 | Ga0501070_0006146_2389_3300 | 292 |
| 975 | 3300049587 | Ga0501071_0001339 | Ga0501071_0001339_9192_10103 | 292 |
| 976 | 3300049589 | Ga0501073_0002813 | Ga0501073_0002813_5607_6518 | 292 |
| 977 | 3300049590 | Ga0501074_0002220 | Ga0501074_0002220_7093_8004 | 292 |
| 978 | 3300049742 | Ga0501080_0016236 | Ga0501080_0016236_5722_6633 | 292 |
| 979 | 3300049822 | Ga0501035_0029066 | Ga0501035_0029066_1138_2049 | 292 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4wqb-assembly1.cif.gz_A | thiosulfate dehydrogenase (tsda) from allochromatium vinosum - bisulfite soak | 0.8524 | 120 | 149 |
| 4wqd-assembly1.cif.gz_A | thiosulfate dehydrogenase (tsda) from allochromatium vinosum - k208g mutant | 0.8351 | 118 | 149 |
| 4wq8-assembly1.cif.gz_A | thiosulfate dehydrogenase (tsda) from allochromatium vinosum - tetrathionate soak | 0.8341 | 118 | 149 |
| 2xts-assembly1.cif.gz_B | crystal structure of the sulfane dehydrogenase soxcd from paracoccus pantotrophus | 0.8278 | 118 | 152 |
| 4wqe-assembly1.cif.gz_A | thiosulfate dehydrogenase (tsda) from allochromatium vinosum - k208g mutant | 0.8223 | 120 | 149 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3mk7C02 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.9023 | 81 | 281 | 1.10.760.10 |
| 3mk7C02 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.8879 | 81 | 281 | 1.10.760.10 |
| 3mk7M03 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.8707 | 172 | 251 | 1.10.760.10 |
| 2xtsD01 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.8273 | 118 | 152 | 1.10.760.10 |
| 2c8sA00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.8209 | 113 | 165 | 1.10.760.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522KMC7-F1-model_v4 | C-type cytochrome | 0.9783 | 190 | 282 |
GO:0005506
GO:0009055 GO:0020037 |
| AF-A0A840A0G1-F1-model_v4 | Mono/diheme cytochrome c family protein | 0.9742 | 170 | 254 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A7Y2UED4-F1-model_v4 | C-type cytochrome | 0.9732 | 153 | 280 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A4Q3SSL5-F1-model_v4 | C-type cytochrome | 0.9732 | 170 | 279 |
GO:0005506
GO:0009055 GO:0020037 |
| AF-A0A7V5R1M8-F1-model_v4 | C-type cytochrome | 0.9707 | 152 | 282 |
GO:0009055
GO:0020037 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar