F487329

General Info

Members Datasets Scaffolds Average Seq Length
979 296 1958 142

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10553977|Ga0157373_105539772
Length 160
Sequence VLGCTIVSIITFSEGEVTMAETQSTMTFAIIKPDAVRAGKIGGIIQRITDHGFKIRALKMVHMSRPVAEGFYAVHRERPFFNDLVQFMTSGPSVVMALEKENAVQAWRDLMGPTDATKAPKGTIRGDFGTSIQENATHGSDSSDNATSELSYFFNAMEFC

Samples

Sample ID Description Type Environment
1 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
14 3300003382 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM Metagenome Rhizosphere
15 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
16 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
17 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
18 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
32 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
33 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
34 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
41 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
42 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
43 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
44 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
45 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
48 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
49 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
56 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
62 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
63 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
64 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
65 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
66 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
67 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
68 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
69 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
70 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
71 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
72 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
73 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
74 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
75 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
76 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
77 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
78 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
79 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
80 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
81 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
82 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
83 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
84 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
85 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
86 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
87 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
88 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
89 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
90 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
91 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
92 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
93 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
94 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
95 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
96 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
97 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
98 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
99 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
100 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
101 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
102 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
103 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
104 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
105 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
106 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
107 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
108 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
109 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
110 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
111 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
112 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
113 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
114 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
115 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
116 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
117 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
118 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
119 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
120 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
122 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
123 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
124 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
125 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
126 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
127 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
128 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
129 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
130 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
131 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
132 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
133 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
134 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
135 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
136 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
137 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
138 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
139 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
140 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
141 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
142 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
143 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
144 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
145 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
146 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
147 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
148 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
149 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
150 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
151 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
152 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
153 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
154 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
155 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
156 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
157 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
158 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
159 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
160 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
161 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
162 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
163 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
164 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
165 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
166 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
167 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
168 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
169 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
170 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
171 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
172 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
173 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
174 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
175 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
176 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
177 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
178 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
179 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
180 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
182 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
183 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
184 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
211 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
214 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
215 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
216 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
217 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
218 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
219 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
220 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
221 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
222 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
223 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
224 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
225 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
226 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
227 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
228 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
229 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
230 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
231 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
237 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
238 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
239 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
240 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
241 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
242 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
243 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
244 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
245 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
246 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
247 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
248 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
249 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
250 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
251 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
252 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
253 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
254 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
255 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
256 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
257 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
258 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
259 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
263 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
277 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
278 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
279 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
280 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
281 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
282 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
283 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
284 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
285 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
286 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
288 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
289 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
290 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
291 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
292 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
293 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
294 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
295 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
296 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.94
Metatranscriptomes 3.06
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.7
Nodule 0
Rhizoplane 0.31
Rhizosphere 93.05
Stem 0
Stem Tuber 0
Unclassified 0.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157373_10553977 3300013100 Bacteria 834
2 JGI24736J21556_1003317 3300001904 Bacteria 2801
3 JGI24741J21665_1002928 3300001915 Bacteria 4265
4 JGI24740J21852_10054901 3300001979 Bacteria 1123
5 JGI25162J39368_1001468 3300002737 Bacteria 12407
6 JGI25157J39369_1006069 3300002741 Bacteria 1885
7 JGI25164J39214_1000061 3300002772 Bacteria 110617
8 JGI25150J39212_1000383 3300002774 Bacteria 21138
9 JGI25159J45721_1053824 3300002987 Bacteria 543
10 JGI25151J46595_10000041 3300003187 Bacteria 174472
11 JGI25151J46595_10000176 3300003187 Bacteria 82143
12 JGI25151J46595_10121738 3300003187 Bacteria 664
13 JGI25165J46597_1000151 3300003214 Bacteria 114835
14 JGI25153J46596_10000129 3300003215 Bacteria 82143
15 JGI26145J50221_1000774 3300003371 Bacteria 2626
16 JGI26139J50223_101325 3300003382 Bacteria 745
17 JGI26143J51219_1000579 3300003502 Bacteria 1409
18 JGI26141J51220_1006671 3300003503 Bacteria 730
19 JGI25404J52841_10027329 3300003659 Bacteria 1227
20 Ga0055527_1003993 3300003760 Bacteria 2090
21 Ga0055535_1000865 3300003761 Bacteria 21372
22 Ga0055535_1001393 3300003761 Bacteria 12498
23 Ga0055542_1001551 3300003762 Bacteria 10870
24 Ga0055529_1000140 3300003763 Bacteria 102393
25 Ga0055526_1000527 3300003771 Bacteria 30369
26 Ga0055526_1004038 3300003771 Bacteria 9017
27 Ga0055537_1000226 3300003773 Bacteria 41255
28 Ga0055537_1001085 3300003773 Bacteria 11959
29 Ga0055524_1000041 3300003775 Bacteria 156728
30 Ga0055524_1020562 3300003775 Bacteria 2219
31 Ga0055524_1023764 3300003775 Bacteria 1966
32 Ga0055536_1011555 3300003781 Bacteria 3370
33 Ga0055536_1011574 3300003781 Bacteria 3364
34 Ga0055536_1048316 3300003781 Bacteria 953
35 Ga0055534_1000258 3300003784 Bacteria 36880
36 Ga0055534_1000462 3300003784 Bacteria 23363
37 Ga0055528_1000017 3300003790 Bacteria 156728
38 Ga0055528_1000065 3300003790 Bacteria 85294
39 Ga0055530_10005173 3300003791 Bacteria 6354
40 Ga0055540_1023878 3300003792 Bacteria 1529
41 Ga0055540_1027592 3300003792 Bacteria 1356
42 Ga0055531_10041268 3300003794 Bacteria 1338
43 Ga0055531_10041284 3300003794 Bacteria 1338
44 Ga0058862_12012037 3300004803 Bacteria 554
45 Ga0065704_10000509 3300005289 Bacteria 25144
46 Ga0065704_10070536 3300005289 Bacteria 21377
47 Ga0065704_10355230 3300005289 Unclassified 761
48 Ga0065712_10221377 3300005290 Bacteria 1040
49 Ga0065712_10327211 3300005290 Bacteria 819
50 Ga0065712_10384698 3300005290 Bacteria 748
51 Ga0065707_10096544 3300005295 Bacteria 3258
52 Ga0065707_10762043 3300005295 Bacteria 614
53 Ga0070658_10016772 3300005327 Bacteria 5863
54 Ga0070658_10209746 3300005327 Bacteria 1645
55 Ga0070658_10450903 3300005327 Bacteria 1108
56 Ga0070658_10493005 3300005327 Bacteria 1058
57 Ga0070658_10596763 3300005327 Bacteria 957
58 Ga0070676_10875115 3300005328 Bacteria 668
59 Ga0070683_100002931 3300005329 Bacteria 13673
60 Ga0070683_100028755 3300005329 Bacteria 5026
61 Ga0070683_100173398 3300005329 Bacteria 2048
62 Ga0070683_100382786 3300005329 Bacteria 1341
63 Ga0070690_100001791 3300005330 Bacteria 11362
64 Ga0070690_100002128 3300005330 Bacteria 10585
65 Ga0070690_100110502 3300005330 Bacteria 1834
66 Ga0070690_100401850 3300005330 Bacteria 1006
67 Ga0070670_100038033 3300005331 Bacteria 4137
68 Ga0070670_100049700 3300005331 Bacteria 3605
69 Ga0070670_100162524 3300005331 Bacteria 1935
70 Ga0070670_100576152 3300005331 Bacteria 1006
71 Ga0070670_100671462 3300005331 Bacteria 930
72 Ga0070670_101682689 3300005331 Bacteria 584
73 Ga0070677_10009329 3300005333 Bacteria 3324
74 Ga0070677_10169164 3300005333 Bacteria 1032
75 Ga0068869_100003399 3300005334 Bacteria 9719
76 Ga0068869_100029486 3300005334 Bacteria 3845
77 Ga0068869_100136718 3300005334 Bacteria 1889
78 Ga0068869_100202217 3300005334 Bacteria 1567
79 Ga0068869_100709745 3300005334 Bacteria 858
80 Ga0068869_100755350 3300005334 Bacteria 833
81 Ga0070666_10012971 3300005335 Bacteria 5275
82 Ga0070666_10026468 3300005335 Bacteria 3790
83 Ga0070666_10224765 3300005335 Bacteria 1325
84 Ga0070666_10248559 3300005335 Bacteria 1259
85 Ga0070666_10479192 3300005335 Bacteria 901
86 Ga0070666_10487820 3300005335 Bacteria 892
87 Ga0070666_10499181 3300005335 Bacteria 882
88 Ga0070680_100006209 3300005336 Bacteria 9065
89 Ga0070680_100254423 3300005336 Bacteria 1485
90 Ga0070680_100481788 3300005336 Bacteria 1060
91 Ga0070680_101151041 3300005336 Bacteria 671
92 Ga0070682_100001534 3300005337 Bacteria 12954
93 Ga0070682_100037676 3300005337 Bacteria 2962
94 Ga0070682_100070478 3300005337 Bacteria 2235
95 Ga0070682_100092744 3300005337 Bacteria 1979
96 Ga0070682_100326997 3300005337 Bacteria 1135
97 Ga0068868_100000449 3300005338 Bacteria 27621
98 Ga0068868_100069679 3300005338 Bacteria 2803
99 Ga0068868_100132092 3300005338 Bacteria 2044
100 Ga0068868_100159903 3300005338 Bacteria 1860
101 Ga0068868_100220707 3300005338 Bacteria 1587
102 Ga0068868_100521117 3300005338 Bacteria 1043
103 Ga0068868_101526401 3300005338 Bacteria 626
104 Ga0068868_101591049 3300005338 Bacteria 614
105 Ga0070660_100023184 3300005339 Bacteria 4597
106 Ga0070660_100048476 3300005339 Bacteria 3263
107 Ga0070660_100065261 3300005339 Bacteria 2833
108 Ga0070660_100081848 3300005339 Bacteria 2534
109 Ga0070660_100110353 3300005339 Bacteria 2188
110 Ga0070689_100003068 3300005340 Bacteria 11000
111 Ga0070689_100005157 3300005340 Bacteria 8890
112 Ga0070689_100197011 3300005340 Bacteria 1643
113 Ga0070689_100333275 3300005340 Bacteria 1269
114 Ga0070691_10003998 3300005341 Bacteria 6673
115 Ga0070687_100001173 3300005343 Bacteria 9067
116 Ga0070687_100054204 3300005343 Bacteria 2088
117 Ga0070687_100087071 3300005343 Bacteria 1718
118 Ga0070687_100259698 3300005343 Bacteria 1083
119 Ga0070661_100019534 3300005344 Bacteria 4829
120 Ga0070661_100022752 3300005344 Bacteria 4488
121 Ga0070661_100040264 3300005344 Bacteria 3408
122 Ga0070661_100048603 3300005344 Bacteria 3105
123 Ga0070661_100198614 3300005344 Bacteria 1532
124 Ga0070661_100374210 3300005344 Bacteria 1122
125 Ga0070661_101852008 3300005344 Bacteria 512
126 Ga0070692_10003648 3300005345 Bacteria 6292
127 Ga0070692_10009813 3300005345 Bacteria 4334
128 Ga0070692_10103255 3300005345 Bacteria 1565
129 Ga0070668_100017141 3300005347 Bacteria 5420
130 Ga0070668_100020959 3300005347 Bacteria 4938
131 Ga0070668_100070838 3300005347 Bacteria 2715
132 Ga0070668_100130618 3300005347 Bacteria 2016
133 Ga0070668_100760921 3300005347 Bacteria 858
134 Ga0070668_101110664 3300005347 Bacteria 714
135 Ga0070668_101228029 3300005347 Bacteria 680
136 Ga0070669_100028567 3300005353 Bacteria 4016
137 Ga0070669_100136318 3300005353 Bacteria 1888
138 Ga0070669_100279731 3300005353 Bacteria 1337
139 Ga0070669_100504785 3300005353 Bacteria 1004
140 Ga0070675_100012719 3300005354 Bacteria 6601
141 Ga0070675_100091010 3300005354 Bacteria 2555
142 Ga0070675_100099094 3300005354 Bacteria 2453
143 Ga0070675_100195352 3300005354 Bacteria 1755
144 Ga0070675_100234656 3300005354 Bacteria 1601
145 Ga0070675_100262850 3300005354 Bacteria 1513
146 Ga0070675_100381666 3300005354 Bacteria 1254
147 Ga0070675_100431240 3300005354 Bacteria 1180
148 Ga0070675_100478369 3300005354 Bacteria 1120
149 Ga0070675_101246025 3300005354 Bacteria 685
150 Ga0070675_101488491 3300005354 Bacteria 624
151 Ga0070671_100021508 3300005355 Bacteria 5268
152 Ga0070671_100174455 3300005355 Bacteria 1818
153 Ga0070671_100187217 3300005355 Bacteria 1754
154 Ga0070671_100415416 3300005355 Bacteria 1152
155 Ga0070671_100506220 3300005355 Bacteria 1039
156 Ga0070671_100732715 3300005355 Bacteria 859
157 Ga0070671_101171361 3300005355 Bacteria 676
158 Ga0070671_101714693 3300005355 Bacteria 558
159 Ga0070674_100011157 3300005356 Bacteria 5458
160 Ga0070674_100165328 3300005356 Bacteria 1682
161 Ga0070674_100262814 3300005356 Bacteria 1360
162 Ga0070674_100434807 3300005356 Bacteria 1080
163 Ga0070674_100826507 3300005356 Bacteria 802
164 Ga0070673_100003634 3300005364 Bacteria 9655
165 Ga0070673_100122042 3300005364 Bacteria 2175
166 Ga0070673_100220361 3300005364 Bacteria 1642
167 Ga0070673_100279574 3300005364 Bacteria 1464
168 Ga0070673_100971424 3300005364 Bacteria 790
169 Ga0070673_100991445 3300005364 Bacteria 782
170 Ga0070673_101666379 3300005364 Bacteria 603
171 Ga0070688_100013144 3300005365 Bacteria 4661
172 Ga0070688_100133868 3300005365 Bacteria 1676
173 Ga0070659_100002192 3300005366 Bacteria 13900
174 Ga0070659_100002678 3300005366 Bacteria 12665
175 Ga0070659_100074394 3300005366 Bacteria 2706
176 Ga0070659_100193207 3300005366 Bacteria 1673
177 Ga0070659_100217176 3300005366 Bacteria 1577
178 Ga0070667_100016049 3300005367 Bacteria 6195
179 Ga0070667_100033628 3300005367 Bacteria 4287
180 Ga0070667_100166906 3300005367 Bacteria 1942
181 Ga0070667_100227568 3300005367 Bacteria 1662
182 Ga0070667_100287883 3300005367 Bacteria 1477
183 Ga0070667_100451580 3300005367 Bacteria 1175
184 Ga0070667_100802526 3300005367 Bacteria 874
185 Ga0070667_100889553 3300005367 Bacteria 829
186 Ga0070667_101149912 3300005367 Bacteria 726
187 Ga0070667_101592888 3300005367 Bacteria 614
188 Ga0070703_10075575 3300005406 Bacteria 1135
189 Ga0070709_10599312 3300005434 Bacteria 848
190 Ga0070714_100026877 3300005435 Bacteria 4760
191 Ga0070714_100417079 3300005435 Bacteria 1271
192 Ga0070713_100015294 3300005436 Bacteria 5728
193 Ga0070710_10106637 3300005437 Bacteria 1677
194 Ga0070701_10000241 3300005438 Bacteria 17477
195 Ga0070701_10104013 3300005438 Bacteria 1577
196 Ga0070701_10171255 3300005438 Bacteria 1264
197 Ga0070711_100927963 3300005439 Bacteria 744
198 Ga0070705_100000525 3300005440 Bacteria 22115
199 Ga0070705_100913974 3300005440 Bacteria 707
200 Ga0070700_100001732 3300005441 Bacteria 10966
201 Ga0070700_100309830 3300005441 Bacteria 1156
202 Ga0070700_100394433 3300005441 Bacteria 1039
203 Ga0070700_100814664 3300005441 Bacteria 753
204 Ga0070694_100002752 3300005444 Bacteria 10430
205 Ga0070708_100173550 3300005445 Bacteria 2014
206 Ga0070708_100406380 3300005445 Bacteria 1284
207 Ga0070663_100028500 3300005455 Bacteria 3802
208 Ga0070663_100035433 3300005455 Bacteria 3463
209 Ga0070663_100062333 3300005455 Bacteria 2688
210 Ga0070663_100103036 3300005455 Bacteria 2132
211 Ga0070663_100258059 3300005455 Bacteria 1382
212 Ga0070678_100030377 3300005456 Bacteria 3714
213 Ga0070678_100223991 3300005456 Bacteria 1564
214 Ga0070678_100316157 3300005456 Bacteria 1332
215 Ga0070678_100846434 3300005456 Bacteria 833
216 Ga0070662_100036198 3300005457 Bacteria 3490
217 Ga0070662_100121210 3300005457 Bacteria 2005
218 Ga0070662_100626676 3300005457 Bacteria 906
219 Ga0070662_101172558 3300005457 Bacteria 660
220 Ga0070662_101188362 3300005457 Bacteria 655
221 Ga0070662_101934545 3300005457 Bacteria 509
222 Ga0070681_10001890 3300005458 Bacteria 18902
223 Ga0070681_10003645 3300005458 Bacteria 14455
224 Ga0070681_10004343 3300005458 Bacteria 13479
225 Ga0070681_10004511 3300005458 Bacteria 13284
226 Ga0070681_10023625 3300005458 Bacteria 6185
227 Ga0070681_10035133 3300005458 Bacteria 5035
228 Ga0070681_10044220 3300005458 Bacteria 4457
229 Ga0070681_10085224 3300005458 Bacteria 3112
230 Ga0070681_10096902 3300005458 Bacteria 2897
231 Ga0068867_100010574 3300005459 Bacteria 6510
232 Ga0068867_100042713 3300005459 Bacteria 3318
233 Ga0068867_100314378 3300005459 Bacteria 1295
234 Ga0068867_101206600 3300005459 Bacteria 695
235 Ga0070685_10001309 3300005466 Bacteria 13102
236 Ga0070685_10021564 3300005466 Bacteria 3503
237 Ga0070685_10045633 3300005466 Bacteria 2514
238 Ga0070706_100414158 3300005467 Bacteria 1254
239 Ga0070706_100432763 3300005467 Bacteria 1224
240 Ga0070706_100469414 3300005467 Bacteria 1171
241 Ga0070706_101191274 3300005467 Bacteria 700
242 Ga0070707_100000093 3300005468 Bacteria 80391
243 Ga0070707_100281954 3300005468 Unclassified 1615
244 Ga0070698_100397170 3300005471 Bacteria 1312
245 Ga0070698_100788491 3300005471 Bacteria 894
246 Ga0070699_100002043 3300005518 Bacteria 18236
247 Ga0070699_100113604 3300005518 Bacteria 2379
248 Ga0070699_100121901 3300005518 Bacteria 2293
249 Ga0070699_100622817 3300005518 Bacteria 984
250 Ga0070679_100014414 3300005530 Bacteria 7593
251 Ga0070679_100014735 3300005530 Bacteria 7513
252 Ga0070679_100014740 3300005530 Bacteria 7511
253 Ga0070679_100018597 3300005530 Bacteria 6746
254 Ga0070679_100032886 3300005530 Bacteria 5132
255 Ga0070679_100040235 3300005530 Bacteria 4650
256 Ga0070679_100051101 3300005530 Bacteria 4117
257 Ga0070679_100090416 3300005530 Bacteria 3050
258 Ga0070679_100180414 3300005530 Bacteria 2084
259 Ga0070679_100244452 3300005530 Bacteria 1751
260 Ga0070679_100813465 3300005530 Bacteria 878
261 Ga0070684_100003194 3300005535 Bacteria 12248
262 Ga0070684_100003635 3300005535 Bacteria 11617
263 Ga0070684_100046582 3300005535 Bacteria 3757
264 Ga0070684_100315970 3300005535 Bacteria 1434
265 Ga0070684_100523494 3300005535 Bacteria 1099
266 Ga0070697_100107681 3300005536 Bacteria 2319
267 Ga0070697_100890196 3300005536 Bacteria 789
268 Ga0070697_101013134 3300005536 Bacteria 738
269 Ga0068853_100002360 3300005539 Bacteria 14123
270 Ga0068853_100006433 3300005539 Bacteria 9334
271 Ga0068853_100037472 3300005539 Bacteria 4126
272 Ga0068853_100137837 3300005539 Bacteria 2189
273 Ga0068853_100138764 3300005539 Bacteria 2181
274 Ga0068853_100312795 3300005539 Bacteria 1454
275 Ga0068853_100624024 3300005539 Bacteria 1025
276 Ga0068853_100714377 3300005539 Bacteria 956
277 Ga0068853_100900876 3300005539 Bacteria 849
278 Ga0068853_100903893 3300005539 Bacteria 848
279 Ga0068853_100948077 3300005539 Bacteria 827
280 Ga0070672_100002016 3300005543 Bacteria 12773
281 Ga0070672_100005555 3300005543 Bacteria 8378
282 Ga0070672_100007880 3300005543 Bacteria 7270
283 Ga0070672_100077642 3300005543 Bacteria 2656
284 Ga0070672_100272775 3300005543 Bacteria 1429
285 Ga0070672_100382504 3300005543 Bacteria 1204
286 Ga0070672_100492281 3300005543 Bacteria 1060
287 Ga0070686_100004387 3300005544 Bacteria 7778
288 Ga0070686_100026663 3300005544 Bacteria 3490
289 Ga0070686_100169330 3300005544 Bacteria 1544
290 Ga0070695_100001112 3300005545 Bacteria 14731
291 Ga0070695_100138130 3300005545 Bacteria 1687
292 Ga0070696_100000073 3300005546 Bacteria 49104
293 Ga0070696_100013805 3300005546 Bacteria 5424
294 Ga0070696_100100320 3300005546 Bacteria 2074
295 Ga0070696_100162392 3300005546 Bacteria 1647
296 Ga0070696_100182141 3300005546 Bacteria 1559
297 Ga0070693_100000174 3300005547 Bacteria 29811
298 Ga0070693_100011913 3300005547 Bacteria 4388
299 Ga0070693_100033216 3300005547 Bacteria 2845
300 Ga0070693_100057781 3300005547 Bacteria 2243
301 Ga0070693_100144255 3300005547 Bacteria 1502
302 Ga0070693_100488051 3300005547 Bacteria 872
303 Ga0070693_101628727 3300005547 Bacteria 507
304 Ga0070665_100092865 3300005548 Bacteria 3023
305 Ga0070665_100118823 3300005548 Bacteria 2646
306 Ga0070665_100149142 3300005548 Bacteria 2342
307 Ga0070665_100572000 3300005548 Bacteria 1143
308 Ga0070665_100970072 3300005548 Bacteria 862
309 Ga0070704_100001537 3300005549 Bacteria 12455
310 Ga0070704_100257218 3300005549 Unclassified 1436
311 Ga0068855_100004109 3300005563 Bacteria 17753
312 Ga0068855_100007320 3300005563 Bacteria 13374
313 Ga0068855_100019981 3300005563 Bacteria 8044
314 Ga0068855_100057393 3300005563 Bacteria 4564
315 Ga0068855_100208192 3300005563 Bacteria 2199
316 Ga0068855_100543362 3300005563 Bacteria 1259
317 Ga0068855_100651730 3300005563 Bacteria 1131
318 Ga0068855_100731573 3300005563 Bacteria 1056
319 Ga0068855_100826768 3300005563 Bacteria 983
320 Ga0068855_101132149 3300005563 Bacteria 817
321 Ga0068855_102102088 3300005563 Bacteria 569
322 Ga0070664_100008001 3300005564 Bacteria 8541
323 Ga0070664_100050912 3300005564 Bacteria 3506
324 Ga0070664_100075530 3300005564 Bacteria 2894
325 Ga0070664_100275014 3300005564 Bacteria 1518
326 Ga0070664_100368106 3300005564 Bacteria 1310
327 Ga0070664_100692242 3300005564 Bacteria 949
328 Ga0070664_100784110 3300005564 Bacteria 890
329 Ga0068857_100014732 3300005577 Bacteria 6822
330 Ga0068857_100018427 3300005577 Bacteria 6125
331 Ga0068857_100156288 3300005577 Bacteria 2068
332 Ga0068857_100168897 3300005577 Bacteria 1987
333 Ga0068857_100196218 3300005577 Bacteria 1839
334 Ga0068857_100232717 3300005577 Bacteria 1686
335 Ga0068857_100287549 3300005577 Bacteria 1513
336 Ga0068857_100476052 3300005577 Bacteria 1170
337 Ga0068857_100523110 3300005577 Bacteria 1115
338 Ga0068857_100734680 3300005577 Bacteria 939
339 Ga0068854_100003562 3300005578 Bacteria 9736
340 Ga0068854_100005419 3300005578 Bacteria 8053
341 Ga0068854_100029304 3300005578 Bacteria 3810
342 Ga0068854_100050948 3300005578 Bacteria 2964
343 Ga0068854_100337822 3300005578 Bacteria 1229
344 Ga0068854_100404918 3300005578 Bacteria 1130
345 Ga0068854_100618673 3300005578 Bacteria 926
346 Ga0068854_100838915 3300005578 Bacteria 804
347 Ga0068854_100876109 3300005578 Bacteria 788
348 Ga0068856_100002613 3300005614 Bacteria 18528
349 Ga0068856_100003530 3300005614 Bacteria 15771
350 Ga0068856_100005606 3300005614 Bacteria 12354
351 Ga0068856_100016156 3300005614 Bacteria 7218
352 Ga0068856_100087749 3300005614 Bacteria 3093
353 Ga0068856_100174367 3300005614 Bacteria 2163
354 Ga0068856_100290949 3300005614 Bacteria 1650
355 Ga0068856_100323413 3300005614 Bacteria 1560
356 Ga0068856_101289315 3300005614 Bacteria 746
357 Ga0070702_100000064 3300005615 Bacteria 30037
358 Ga0070702_100027072 3300005615 Bacteria 3089
359 Ga0070702_100278791 3300005615 Bacteria 1147
360 Ga0070702_100364571 3300005615 Bacteria 1022
361 Ga0068852_100017923 3300005616 Bacteria 5568
362 Ga0068852_100195448 3300005616 Bacteria 1911
363 Ga0068852_100317734 3300005616 Bacteria 1511
364 Ga0068852_100329092 3300005616 Bacteria 1486
365 Ga0068852_100526011 3300005616 Bacteria 1180
366 Ga0068852_100803702 3300005616 Bacteria 955
367 Ga0068852_101397068 3300005616 Bacteria 722
368 Ga0068859_100002133 3300005617 Bacteria 20138
369 Ga0068859_100010947 3300005617 Bacteria 9129
370 Ga0068859_100019805 3300005617 Bacteria 6754
371 Ga0068859_100020867 3300005617 Bacteria 6575
372 Ga0068859_100067851 3300005617 Bacteria 3602
373 Ga0068859_100106087 3300005617 Bacteria 2869
374 Ga0068859_100279341 3300005617 Bacteria 1762
375 Ga0068859_101210553 3300005617 Bacteria 832
376 Ga0068864_100016372 3300005618 Bacteria 6172
377 Ga0068864_100019136 3300005618 Bacteria 5724
378 Ga0068864_100122331 3300005618 Bacteria 2328
379 Ga0068864_100195764 3300005618 Bacteria 1854
380 Ga0068864_100296215 3300005618 Bacteria 1513
381 Ga0068864_100436384 3300005618 Bacteria 1250
382 Ga0068864_101023491 3300005618 Bacteria 820
383 Ga0068866_10000766 3300005718 Bacteria 14492
384 Ga0068861_100011229 3300005719 Bacteria 6217
385 Ga0068861_100044182 3300005719 Bacteria 3349
386 Ga0068861_100339560 3300005719 Bacteria 1314
387 Ga0068851_10009360 3300005834 Bacteria 4552
388 Ga0068851_10014712 3300005834 Bacteria 3718
389 Ga0068851_10539283 3300005834 Bacteria 704
390 Ga0068863_100000945 3300005841 Bacteria 29155
391 Ga0068863_100012630 3300005841 Bacteria 8148
392 Ga0068863_100038641 3300005841 Bacteria 4540
393 Ga0068863_100041187 3300005841 Bacteria 4391
394 Ga0068863_100042745 3300005841 Bacteria 4305
395 Ga0068863_100046523 3300005841 Bacteria 4118
396 Ga0068863_100052920 3300005841 Bacteria 3847
397 Ga0068863_100148826 3300005841 Bacteria 2240
398 Ga0068863_100581867 3300005841 Bacteria 1107
399 Ga0068858_100051452 3300005842 Bacteria 3811
400 Ga0068858_100057947 3300005842 Bacteria 3580
401 Ga0068858_100082573 3300005842 Bacteria 2987
402 Ga0068858_100172839 3300005842 Bacteria 2038
403 Ga0068858_100506145 3300005842 Bacteria 1167
404 Ga0068858_100600149 3300005842 Bacteria 1068
405 Ga0068858_100674709 3300005842 Bacteria 1005
406 Ga0068858_100837360 3300005842 Bacteria 898
407 Ga0068858_100970744 3300005842 Bacteria 832
408 Ga0068860_100001333 3300005843 Bacteria 26831
409 Ga0068860_100017551 3300005843 Bacteria 6974
410 Ga0068860_100080959 3300005843 Bacteria 3088
411 Ga0068860_100103106 3300005843 Bacteria 2723
412 Ga0068860_100112297 3300005843 Bacteria 2606
413 Ga0068860_100145252 3300005843 Bacteria 2282
414 Ga0068860_100692037 3300005843 Bacteria 1029
415 Ga0068860_100969904 3300005843 Bacteria 867
416 Ga0068862_100000707 3300005844 Bacteria 34098
417 Ga0068862_100004610 3300005844 Bacteria 11617
418 Ga0068862_100061345 3300005844 Bacteria 3232
419 Ga0068862_100089863 3300005844 Bacteria 2674
420 Ga0068862_100146422 3300005844 Bacteria 2099
421 Ga0068862_100180869 3300005844 Bacteria 1892
422 Ga0068862_100291040 3300005844 Bacteria 1500
423 Ga0068862_100492492 3300005844 Unclassified 1162
424 Ga0068862_101418788 3300005844 Bacteria 698
425 Ga0081455_10001633 3300005937 Bacteria 27345
426 Ga0081455_10218978 3300005937 Bacteria 1412
427 Ga0081540_1001899 3300005983 Bacteria 17494
428 Ga0081540_1075042 3300005983 Unclassified 1546
429 Ga0081539_10000232 3300005985 Bacteria 131067
430 Ga0081539_10074162 3300005985 Bacteria 1813
431 Ga0081539_10100800 3300005985 Bacteria 1472
432 Ga0081539_10284996 3300005985 Bacteria 717
433 Ga0075365_10056509 3300006038 Bacteria 2609
434 Ga0075364_10000928 3300006051 Bacteria 15498
435 Ga0075364_10174026 3300006051 Bacteria 1455
436 Ga0075364_10981729 3300006051 Bacteria 574
437 Ga0070716_100349499 3300006173 Bacteria 1046
438 Ga0070712_100128158 3300006175 Bacteria 1920
439 Ga0075367_10009991 3300006178 Bacteria 4975
440 Ga0075369_10014137 3300006186 Bacteria 3184
441 Ga0075369_10115920 3300006186 Bacteria 1210
442 Ga0075427_10078789 3300006194 Bacteria 594
443 Ga0075366_10234916 3300006195 Bacteria 1117
444 Ga0075366_10535292 3300006195 Bacteria 725
445 Ga0075366_10700717 3300006195 Bacteria 629
446 Ga0097621_100003083 3300006237 Bacteria 11429
447 Ga0097621_100030305 3300006237 Bacteria 4281
448 Ga0097621_100060094 3300006237 Bacteria 3114
449 Ga0097621_100064924 3300006237 Bacteria 3003
450 Ga0097621_100074679 3300006237 Bacteria 2808
451 Ga0097621_100199576 3300006237 Bacteria 1736
452 Ga0097621_100416806 3300006237 Bacteria 1205
453 Ga0097621_100447358 3300006237 Bacteria 1163
454 Ga0097621_100472207 3300006237 Bacteria 1133
455 Ga0097621_101752186 3300006237 Bacteria 592
456 Ga0075370_10135903 3300006353 Bacteria 1436
457 Ga0068871_100008915 3300006358 Bacteria 7237
458 Ga0068871_100027477 3300006358 Bacteria 4451
459 Ga0068871_100069699 3300006358 Bacteria 2888
460 Ga0068871_100100645 3300006358 Bacteria 2421
461 Ga0068871_101643591 3300006358 Bacteria 609
462 Ga0075428_100003071 3300006844 Bacteria 18219
463 Ga0075428_100459604 3300006844 Bacteria 1363
464 Ga0075428_101213679 3300006844 Bacteria 795
465 Ga0075430_100077464 3300006846 Bacteria 2786
466 Ga0075430_100353361 3300006846 Bacteria 1214
467 Ga0075430_100373141 3300006846 Bacteria 1178
468 Ga0075430_100394865 3300006846 Bacteria 1141
469 Ga0075430_101090621 3300006846 Bacteria 658
470 Ga0075431_100007135 3300006847 Bacteria 11101
471 Ga0075431_100046320 3300006847 Bacteria 4484
472 Ga0075431_100309790 3300006847 Bacteria 1594
473 Ga0075431_100339314 3300006847 Bacteria 1512
474 Ga0075431_100457241 3300006847 Bacteria 1271
475 Ga0075431_100787845 3300006847 Bacteria 924
476 Ga0075433_10498109 3300006852 Bacteria 1072
477 Ga0075434_100122549 3300006871 Bacteria 2616
478 Ga0075434_100183522 3300006871 Bacteria 2113
479 Ga0075434_100280546 3300006871 Bacteria 1686
480 Ga0075434_100305094 3300006871 Bacteria 1612
481 Ga0075434_100308980 3300006871 Bacteria 1601
482 Ga0075434_101390250 3300006871 Bacteria 712
483 Ga0075429_100005146 3300006880 Bacteria 11248
484 Ga0068865_100000441 3300006881 Bacteria 23086
485 Ga0068865_100010048 3300006881 Bacteria 5887
486 Ga0068865_100049966 3300006881 Bacteria 2886
487 Ga0068865_100059623 3300006881 Bacteria 2670
488 Ga0068865_100528298 3300006881 Bacteria 988
489 Ga0075436_100012856 3300006914 Bacteria 5738
490 Ga0075436_100053047 3300006914 Bacteria 2799
491 Ga0097620_100002133 3300006931 Bacteria 20138
492 Ga0097620_100010947 3300006931 Bacteria 9129
493 Ga0097620_100019806 3300006931 Bacteria 6754
494 Ga0097620_100020866 3300006931 Bacteria 6575
495 Ga0097620_100067850 3300006931 Bacteria 3602
496 Ga0097620_100106092 3300006931 Bacteria 2869
497 Ga0097620_100279324 3300006931 Bacteria 1762
498 Ga0097620_101210601 3300006931 Bacteria 832
499 Ga0075435_100001831 3300007076 Bacteria 13810
500 Ga0075435_100131095 3300007076 Bacteria 2098
501 Ga0075435_101111965 3300007076 Bacteria 691
502 Ga0105251_10000450 3300009011 Bacteria 39635
503 Ga0105251_10017454 3300009011 Bacteria 3845
504 Ga0105244_10094302 3300009036 Bacteria 1470
505 Ga0105250_10052396 3300009092 Bacteria 1637
506 Ga0105240_10001034 3300009093 Bacteria 49457
507 Ga0105240_10018043 3300009093 Bacteria 9490
508 Ga0105240_10022491 3300009093 Bacteria 8355
509 Ga0105240_10034189 3300009093 Bacteria 6559
510 Ga0105240_10185328 3300009093 Bacteria 2452
511 Ga0105240_10356625 3300009093 Bacteria 1658
512 Ga0105240_10376170 3300009093 Bacteria 1605
513 Ga0105240_10559788 3300009093 Bacteria 1264
514 Ga0105240_10929165 3300009093 Bacteria 934
515 Ga0105240_11274762 3300009093 Bacteria 776
516 Ga0111539_10063462 3300009094 Bacteria 4372
517 Ga0111539_10066443 3300009094 Bacteria 4260
518 Ga0111539_10103645 3300009094 Bacteria 3338
519 Ga0111539_10163479 3300009094 Bacteria 2603
520 Ga0111539_10717080 3300009094 Bacteria 1164
521 Ga0111539_10777757 3300009094 Bacteria 1114
522 Ga0105245_10007522 3300009098 Bacteria 9546
523 Ga0105245_10221116 3300009098 Bacteria 1827
524 Ga0105245_10953780 3300009098 Bacteria 901
525 Ga0105245_11597511 3300009098 Bacteria 704
526 Ga0105247_10355284 3300009101 Bacteria 1032
527 Ga0114129_10000467 3300009147 Bacteria 48450
528 Ga0114129_10095036 3300009147 Bacteria 4128
529 Ga0114129_10117407 3300009147 Bacteria 3666
530 Ga0114129_10853151 3300009147 Bacteria 1158
531 Ga0105243_10167468 3300009148 Bacteria 1900
532 Ga0105243_10782671 3300009148 Bacteria 938
533 Ga0105241_10010963 3300009174 Bacteria 6645
534 Ga0105241_10011152 3300009174 Bacteria 6588
535 Ga0105241_10024998 3300009174 Bacteria 4438
536 Ga0105241_10114277 3300009174 Bacteria 2165
537 Ga0105241_10339673 3300009174 Bacteria 1301
538 Ga0105241_10610067 3300009174 Bacteria 987
539 Ga0105241_11403566 3300009174 Bacteria 669
540 Ga0105242_10000524 3300009176 Bacteria 30157
541 Ga0105242_10000862 3300009176 Bacteria 23518
542 Ga0105242_10113577 3300009176 Bacteria 2313
543 Ga0105242_10329496 3300009176 Bacteria 1403
544 Ga0105242_11270012 3300009176 Bacteria 759
545 Ga0105248_10009513 3300009177 Bacteria 10697
546 Ga0105248_10049058 3300009177 Bacteria 4736
547 Ga0105248_10143451 3300009177 Bacteria 2695
548 Ga0105248_10179890 3300009177 Bacteria 2383
549 Ga0105248_10204228 3300009177 Bacteria 2227
550 Ga0105248_10419114 3300009177 Bacteria 1508
551 Ga0105248_10427784 3300009177 Bacteria 1491
552 Ga0105248_10458208 3300009177 Bacteria 1437
553 Ga0105248_11041063 3300009177 Bacteria 925
554 Ga0105248_11167953 3300009177 Bacteria 870
555 Ga0105248_11666514 3300009177 Bacteria 723
556 Ga0105248_12113373 3300009177 Bacteria 640
557 Ga0105237_10000371 3300009545 Bacteria 63699
558 Ga0105237_10013282 3300009545 Bacteria 8640
559 Ga0105237_10014025 3300009545 Bacteria 8383
560 Ga0105237_10034971 3300009545 Bacteria 5085
561 Ga0105237_10040100 3300009545 Bacteria 4723
562 Ga0105237_10132847 3300009545 Bacteria 2483
563 Ga0105237_10279368 3300009545 Bacteria 1672
564 Ga0105237_10639161 3300009545 Bacteria 1071
565 Ga0105238_10001167 3300009551 Bacteria 26450
566 Ga0105238_10014211 3300009551 Bacteria 8050
567 Ga0105238_10025373 3300009551 Bacteria 6043
568 Ga0105238_10141303 3300009551 Bacteria 2384
569 Ga0105238_10160597 3300009551 Bacteria 2223
570 Ga0105238_10267348 3300009551 Bacteria 1690
571 Ga0105238_11121485 3300009551 Bacteria 810
572 Ga0105238_12274515 3300009551 Bacteria 577
573 Ga0105249_10004718 3300009553 Bacteria 11767
574 Ga0105249_10037838 3300009553 Bacteria 4379
575 Ga0105249_11557890 3300009553 Bacteria 733
576 Ga0105239_10000063 3300010375 Bacteria 151845
577 Ga0105239_10004199 3300010375 Bacteria 17302
578 Ga0105239_10011975 3300010375 Bacteria 9670
579 Ga0105239_10020971 3300010375 Bacteria 7211
580 Ga0105239_10026783 3300010375 Bacteria 6345
581 Ga0105239_10029639 3300010375 Bacteria 6017
582 Ga0105239_10106578 3300010375 Bacteria 3105
583 Ga0105239_10160834 3300010375 Bacteria 2508
584 Ga0105239_10215388 3300010375 Bacteria 2153
585 Ga0105239_10614190 3300010375 Bacteria 1240
586 Ga0105246_10070137 3300011119 Bacteria 2464
587 Ga0105246_10078960 3300011119 Bacteria 2339
588 Ga0105246_10591035 3300011119 Bacteria 958
589 Ga0105246_10652211 3300011119 Bacteria 916
590 Ga0105246_11062324 3300011119 Bacteria 737
591 Ga0105246_11593498 3300011119 Bacteria 617
592 Ga0105246_11868189 3300011119 Bacteria 576
593 Ga0157328_1015561 3300012478 Bacteria 589
594 Ga0157346_1007329 3300012480 Bacteria 734
595 Ga0157346_1015841 3300012480 Bacteria 608
596 Ga0157337_1016490 3300012483 Bacteria 640
597 Ga0157322_1013320 3300012490 Bacteria 705
598 Ga0157335_1006325 3300012492 Bacteria 856
599 Ga0157323_1007289 3300012495 Bacteria 794
600 Ga0157314_1003720 3300012500 Bacteria 1094
601 Ga0157313_1054668 3300012503 Bacteria 529
602 Ga0157315_1002376 3300012508 Bacteria 1172
603 Ga0157315_1019516 3300012508 Bacteria 703
604 Ga0157316_1009936 3300012510 Bacteria 864
605 Ga0157327_1000853 3300012512 Bacteria 1768
606 Ga0157373_10009440 3300013100 Bacteria 7207
607 Ga0157373_10031695 3300013100 Bacteria 3805
608 Ga0157373_10177594 3300013100 Bacteria 1499
609 Ga0157373_10312537 3300013100 Bacteria 1117
610 Ga0157373_10860451 3300013100 Bacteria 671
611 Ga0157371_10024547 3300013102 Bacteria 4400
612 Ga0157371_10033870 3300013102 Bacteria 3668
613 Ga0157371_10079291 3300013102 Bacteria 2326
614 Ga0157371_10206478 3300013102 Bacteria 1409
615 Ga0157371_10207800 3300013102 Bacteria 1404
616 Ga0157371_10823314 3300013102 Bacteria 701
617 Ga0157371_10826286 3300013102 Bacteria 699
618 Ga0157370_10023253 3300013104 Bacteria 6154
619 Ga0157370_10024547 3300013104 Bacteria 5970
620 Ga0157370_10068303 3300013104 Bacteria 3359
621 Ga0157370_10082566 3300013104 Bacteria 3022
622 Ga0157370_10088208 3300013104 Bacteria 2913
623 Ga0157370_10163289 3300013104 Bacteria 2072
624 Ga0157369_10000027 3300013105 Bacteria 213988
625 Ga0157369_10001075 3300013105 Bacteria 34218
626 Ga0157369_10006171 3300013105 Bacteria 13910
627 Ga0157369_10039495 3300013105 Bacteria 5157
628 Ga0157369_10096997 3300013105 Bacteria 3145
629 Ga0157369_10209787 3300013105 Bacteria 2042
630 Ga0157369_10298078 3300013105 Bacteria 1677
631 Ga0157369_10548820 3300013105 Bacteria 1194
632 Ga0157374_10000895 3300013296 Bacteria 25972
633 Ga0157374_10029789 3300013296 Bacteria 4949
634 Ga0157374_10039520 3300013296 Bacteria 4342
635 Ga0157374_10069913 3300013296 Bacteria 3307
636 Ga0157374_10183373 3300013296 Bacteria 2046
637 Ga0157374_10273909 3300013296 Bacteria 1665
638 Ga0157374_10791665 3300013296 Bacteria 964
639 Ga0157378_10002315 3300013297 Bacteria 16942
640 Ga0157378_10012903 3300013297 Bacteria 7315
641 Ga0157378_10014157 3300013297 Bacteria 6980
642 Ga0157378_10037698 3300013297 Bacteria 4284
643 Ga0157378_10657256 3300013297 Bacteria 1064
644 Ga0157378_10740580 3300013297 Bacteria 1005
645 Ga0157378_11001764 3300013297 Bacteria 870
646 Ga0157378_11089294 3300013297 Bacteria 836
647 Ga0157378_12201752 3300013297 Bacteria 602
648 Ga0163162_10005036 3300013306 Bacteria 12733
649 Ga0163162_10020014 3300013306 Bacteria 6573
650 Ga0163162_10030444 3300013306 Bacteria 5348
651 Ga0163162_10070103 3300013306 Bacteria 3557
652 Ga0163162_10089559 3300013306 Bacteria 3158
653 Ga0163162_10182276 3300013306 Bacteria 2226
654 Ga0163162_10256213 3300013306 Bacteria 1882
655 Ga0163162_10295745 3300013306 Bacteria 1751
656 Ga0163162_11053453 3300013306 Bacteria 921
657 Ga0163162_12994824 3300013306 Bacteria 543
658 Ga0157372_10000662 3300013307 Bacteria 37834
659 Ga0157372_10002799 3300013307 Bacteria 18842
660 Ga0157372_10005146 3300013307 Bacteria 13902
661 Ga0157372_10037571 3300013307 Bacteria 5343
662 Ga0157372_10069317 3300013307 Bacteria 3966
663 Ga0157372_10090801 3300013307 Bacteria 3473
664 Ga0157372_10149613 3300013307 Bacteria 2694
665 Ga0157372_10162856 3300013307 Bacteria 2578
666 Ga0157372_10164345 3300013307 Bacteria 2566
667 Ga0157372_10296136 3300013307 Bacteria 1882
668 Ga0157372_11073642 3300013307 Bacteria 932
669 Ga0157375_10006575 3300013308 Bacteria 10118
670 Ga0157375_10012067 3300013308 Bacteria 7652
671 Ga0157375_10039074 3300013308 Bacteria 4563
672 Ga0157375_10062762 3300013308 Bacteria 3693
673 Ga0157375_10565322 3300013308 Bacteria 1298
674 Ga0157375_10699439 3300013308 Bacteria 1167
675 Ga0157375_11372285 3300013308 Bacteria 832
676 Ga0157375_13240118 3300013308 Bacteria 543
677 Ga0157375_13691741 3300013308 Bacteria 509
678 Ga0163163_10005615 3300014325 Bacteria 10868
679 Ga0163163_10006006 3300014325 Bacteria 10564
680 Ga0163163_10012750 3300014325 Bacteria 7668
681 Ga0163163_10062567 3300014325 Bacteria 3688
682 Ga0163163_10118382 3300014325 Bacteria 2681
683 Ga0163163_10123065 3300014325 Bacteria 2629
684 Ga0163163_10154568 3300014325 Bacteria 2338
685 Ga0163163_10425277 3300014325 Bacteria 1387
686 Ga0157380_10008616 3300014326 Bacteria 7289
687 Ga0157380_10125323 3300014326 Bacteria 2182
688 Ga0157380_10359568 3300014326 Bacteria 1365
689 Ga0157380_11495317 3300014326 Bacteria 728
690 Ga0157380_11894701 3300014326 Bacteria 657
691 Ga0182008_10081517 3300014497 Bacteria 1592
692 Ga0182008_10310151 3300014497 Bacteria 828
693 Ga0182008_10323199 3300014497 Bacteria 812
694 Ga0157377_10017138 3300014745 Bacteria 3742
695 Ga0157377_10032748 3300014745 Bacteria 2833
696 Ga0157377_10440002 3300014745 Bacteria 897
697 Ga0157377_10474411 3300014745 Bacteria 869
698 Ga0157379_10002463 3300014968 Bacteria 15500
699 Ga0157379_10015332 3300014968 Bacteria 6723
700 Ga0157379_10018889 3300014968 Bacteria 6083
701 Ga0157379_10173231 3300014968 Bacteria 1948
702 Ga0157379_10325248 3300014968 Bacteria 1404
703 Ga0157379_10474708 3300014968 Bacteria 1157
704 Ga0157379_10624589 3300014968 Bacteria 1007
705 Ga0157376_10005343 3300014969 Bacteria 8969
706 Ga0157376_10028214 3300014969 Bacteria 4459
707 Ga0157376_10029971 3300014969 Bacteria 4337
708 Ga0157376_10030644 3300014969 Bacteria 4298
709 Ga0157376_10051784 3300014969 Bacteria 3411
710 Ga0157376_10139211 3300014969 Bacteria 2175
711 Ga0157376_10195931 3300014969 Bacteria 1856
712 Ga0157376_10263037 3300014969 Bacteria 1617
713 Ga0157376_10349602 3300014969 Bacteria 1414
714 Ga0157376_10597097 3300014969 Bacteria 1098
715 Ga0157376_10688565 3300014969 Bacteria 1026
716 Ga0182006_1029504 3300015261 Bacteria 2221
717 Ga0182007_10001075 3300015262 Bacteria 14873
718 Ga0182005_1008264 3300015265 Bacteria 3074
719 Ga0206351_10437662 3300020077 Bacteria 653
720 Ga0206354_11037185 3300020081 Bacteria 6003
721 Ga0154015_1012287 3300020610 Bacteria 3005
722 Ga0213876_10697908 3300021384 Bacteria 540
723 Ga0224712_10010620 3300022467 Bacteria 2824
724 Ga0209233_1006030 3300025261 Bacteria 3949
725 Ga0207647_10002942 3300025904 Bacteria 12815
726 Ga0207705_10006128 3300025909 Bacteria 8948
727 Ga0207705_10012528 3300025909 Bacteria 6121
728 Ga0207707_10000344 3300025912 Bacteria 49213
729 Ga0207707_10498942 3300025912 Bacteria 1038
730 Ga0207695_10003549 3300025913 Bacteria 21856
731 Ga0207695_10005328 3300025913 Bacteria 17120
732 Ga0207660_10048030 3300025917 Bacteria 3020
733 Ga0207657_10398087 3300025919 Bacteria 1083
734 Ga0207649_10021450 3300025920 Bacteria 3719
735 Ga0207649_10035859 3300025920 Bacteria 2983
736 Ga0207652_10008836 3300025921 Bacteria 8116
737 Ga0207646_10000177 3300025922 Bacteria 86754
738 Ga0207646_10232702 3300025922 Bacteria 1665
739 Ga0207646_10621339 3300025922 Bacteria 969
740 Ga0207646_11656849 3300025922 Bacteria 550
741 Ga0207659_10417029 3300025926 Bacteria 1125
742 Ga0207670_10431051 3300025936 Bacteria 1060
743 Ga0207670_11399551 3300025936 Bacteria 594
744 Ga0207689_10647918 3300025942 Bacteria 890
745 Ga0207679_10057019 3300025945 Bacteria 2887
746 Ga0207667_10003638 3300025949 Bacteria 19009
747 Ga0207712_10054683 3300025961 Bacteria 2805
748 Ga0207640_10000883 3300025981 Bacteria 17000
749 Ga0207703_10394589 3300026035 Bacteria 1283
750 Ga0207639_10087618 3300026041 Bacteria 2482
751 Ga0207678_10518523 3300026067 Bacteria 1040
752 Ga0207702_10001451 3300026078 Bacteria 23586
753 Ga0207702_10170182 3300026078 Bacteria 1997
754 Ga0207702_10740487 3300026078 Bacteria 970
755 Ga0207641_10032481 3300026088 Bacteria 4333
756 Ga0207648_10576470 3300026089 Bacteria 1035
757 Ga0207676_10024516 3300026095 Bacteria 4465
758 Ga0207674_10164534 3300026116 Bacteria 2172
759 Ga0207698_10001632 3300026142 Bacteria 13067
760 Ga0209967_1011329 3300027364 Bacteria 1249
761 Ga0207428_10008489 3300027907 Bacteria 9277
762 Ga0268265_10034187 3300028380 Bacteria 3703
763 Ga0268265_10085557 3300028380 Bacteria 2503
764 Ga0268265_10129522 3300028380 Bacteria 2094
765 Ga0268265_10520511 3300028380 Unclassified 1124
766 Ga0268264_10675325 3300028381 Bacteria 1024
767 Ga0265319_1001621 3300028563 Bacteria 13118
768 Ga0265319_1077366 3300028563 Unclassified 1060
769 Ga0265318_10026110 3300028577 Unclassified 2302
770 Ga0265318_10202491 3300028577 Bacteria 725
771 Ga0265318_10373676 3300028577 Bacteria 520
772 Ga0265320_10002342 3300031240 Bacteria 13275
773 Ga0265320_10013999 3300031240 Bacteria 4591
774 Ga0265320_10068487 3300031240 Bacteria 1677
775 Ga0265327_10003280 3300031251 Bacteria 15675
776 Ga0265327_10298355 3300031251 Bacteria 710
777 Ga0265316_10028683 3300031344 Bacteria 4588
778 Ga0316575_10010769 3300031665 Bacteria 3369
779 Ga0316575_10170809 3300031665 Bacteria 901
780 Ga0316575_10239963 3300031665 Bacteria 759
781 Ga0316579_10001592 3300031691 Bacteria 8297
782 Ga0316579_10006273 3300031691 Bacteria 4844
783 Ga0316579_10154251 3300031691 Bacteria 1109
784 Ga0316579_10434217 3300031691 Bacteria 635
785 Ga0265314_10015957 3300031711 Bacteria 5948
786 Ga0265314_10054110 3300031711 Bacteria 2779
787 Ga0316576_10009486 3300031727 Bacteria 6284
788 Ga0316576_10286461 3300031727 Bacteria 1233
789 Ga0316576_10323562 3300031727 Bacteria 1150
790 Ga0316576_10825396 3300031727 Bacteria 666
791 Ga0316578_10034042 3300031728 Bacteria 2923
792 Ga0316578_10050502 3300031728 Bacteria 2433
793 Ga0316578_10051895 3300031728 Bacteria 2402
794 Ga0316578_10107307 3300031728 Bacteria 1676
795 Ga0307405_10722511 3300031731 Bacteria 827
796 Ga0316577_10078792 3300031733 Bacteria 1840
797 Ga0316577_10105919 3300031733 Bacteria 1577
798 Ga0316577_10318466 3300031733 Bacteria 882
799 Ga0316577_10358109 3300031733 Bacteria 828
800 Ga0307410_10483217 3300031852 Bacteria 1016
801 Ga0307407_10164277 3300031903 Bacteria 1456
802 Ga0307409_100262842 3300031995 Bacteria 1585
803 Ga0307416_100632411 3300032002 Bacteria 1153
804 Ga0316583_10011891 3300032133 Bacteria 3141
805 Ga0316583_10022697 3300032133 Bacteria 2246
806 Ga0316583_10084664 3300032133 Bacteria 1107
807 Ga0316583_10177364 3300032133 Bacteria 741
808 Ga0316585_10228543 3300032137 Bacteria 616
809 Ga0316593_10000022 3300032168 Bacteria 15802
810 Ga0316593_10000063 3300032168 Bacteria 12542
811 Ga0316593_10000528 3300032168 Bacteria 7114
812 Ga0316593_10002956 3300032168 Bacteria 4134
813 Ga0316593_10005283 3300032168 Bacteria 3390
814 Ga0316593_10009676 3300032168 Bacteria 2733
815 Ga0316593_10010401 3300032168 Bacteria 2667
816 Ga0316593_10022414 3300032168 Bacteria 1984
817 Ga0316593_10041084 3300032168 Bacteria 1538
818 Ga0316593_10053805 3300032168 Bacteria 1365
819 Ga0316592_1002734 3300033524 Bacteria 3085
820 Ga0316588_1080632 3300033528 Bacteria 806
821 Ga0316588_1093735 3300033528 Bacteria 749
822 Ga0316587_1000145 3300033529 Bacteria 5686
823 Ga0316587_1004485 3300033529 Bacteria 2034
824 Ga0316587_1050349 3300033529 Bacteria 762
825 Ga0316587_1053632 3300033529 Bacteria 741
826 Ga0316587_1054631 3300033529 Bacteria 735
827 Ga0316587_1085700 3300033529 Bacteria 598
828 Ga0316596_1000099 3300033541 Bacteria 10813
829 Ga0316596_1001288 3300033541 Bacteria 4980
830 Ga0316596_1033412 3300033541 Bacteria 1340
831 Ga0316596_1099989 3300033541 Bacteria 784
832 Ga0316596_1130779 3300033541 Bacteria 685
833 Ga0316596_1171495 3300033541 Bacteria 599
834 Ga0316574_0000893 3300035398 Bacteria 13204
835 Ga0316574_0002750 3300035398 Bacteria 8926
836 Ga0316574_0013618 3300035398 Bacteria 4680
837 Ga0316574_0023508 3300035398 Bacteria 3680
838 Ga0316574_0037469 3300035398 Bacteria 2974
839 Ga0316574_0084014 3300035398 Bacteria 2025
840 Ga0316574_0134111 3300035398 Bacteria 1594
841 Ga0316574_0156893 3300035398 Bacteria 1466
842 Ga0316574_0497018 3300035398 Bacteria 761
843 Ga0316574_0892630 3300035398 Bacteria 538
844 Ga0316574_0930373 3300035398 Bacteria 525
845 Ga0373924_0067327 3300035410 Bacteria 1506
846 Ga0373937_0174199 3300036401 Bacteria 2019
847 Ga0316582_0001138 3300036647 Bacteria 11320
848 Ga0316582_0003304 3300036647 Bacteria 7870
849 Ga0316582_0040294 3300036647 Bacteria 2914
850 Ga0316582_0162970 3300036647 Bacteria 1511
851 Ga0316582_0519501 3300036647 Bacteria 820
852 Ga0316584_0003189 3300036712 Bacteria 10613
853 Ga0316584_0040869 3300036712 Bacteria 3456
854 Ga0316584_0319130 3300036712 Bacteria 1121
855 Ga0316584_0482051 3300036712 Bacteria 873
856 Ga0395898_0721855 3300037466 Bacteria 938
857 Ga0395898_0813834 3300037466 Bacteria 874
858 Ga0316581_0017508 3300037588 Bacteria 2070
859 Ga0316581_0060719 3300037588 Bacteria 1160
860 Ga0316581_0131302 3300037588 Bacteria 772
861 Ga0400484_13138 3300038725 Bacteria 12289
862 Ga0400484_19117 3300038725 Bacteria 6442
863 Ga0400484_27580 3300038725 Bacteria 2420
864 Ga0400490_12170 3300038726 Bacteria 70825
865 Ga0400490_13333 3300038726 Bacteria 21967
866 Ga0400490_21722 3300038726 Bacteria 8577
867 Ga0400491_01396 3300038727 Bacteria 2697
868 Ga0400488_59405 3300038741 Bacteria 2412
869 Ga0400486_00582 3300038742 Bacteria 4133
870 Ga0400486_28223 3300038742 Bacteria 1041
871 Ga0400483_038949 3300039062 Bacteria 9943
872 Ga0400483_054265 3300039062 Bacteria 16722
873 Ga0400483_234572 3300039062 Bacteria 7332
874 Ga0400483_268123 3300039062 Bacteria 2028
875 Ga0400487_39531 3300039110 Bacteria 1954
876 Ga0400487_62691 3300039110 Bacteria 1486
877 Ga0436365_1280613 3300039437 Bacteria 1268
878 Ga0439433_0089973 3300041999 Bacteria 754
879 Ga0439455_0051590 3300042012 Bacteria 1076
880 Ga0451577_0001920 3300042876 Bacteria 26339
881 Ga0451577_0017596 3300042876 Bacteria 6603
882 Ga0451577_0222679 3300042876 Bacteria 1705
883 Ga0451577_0299952 3300042876 Bacteria 1456
884 Ga0451577_1917577 3300042876 Bacteria 519
885 Ga0453683_0126649 3300044673 Bacteria 1608
886 Ga0453684_0000045 3300044712 Bacteria 582917
887 Ga0453684_0004072 3300044712 Bacteria 31763
888 Ga0453684_0009686 3300044712 Bacteria 16774
889 Ga0453684_0260618 3300044712 Bacteria 1986
890 Ga0453684_2359664 3300044712 Unclassified 528
891 Ga0495594_0720128 3300046499 Bacteria 564
892 Ga0495652_0444607 3300046529 Bacteria 909
893 Ga0495667_0153621 3300046559 Bacteria 1482
894 Ga0495676_0555962 3300047321 Bacteria 750
895 Ga0496102_1364917 3300048905 Bacteria 628
896 Ga0496109_0000015 3300048912 Bacteria 214913
897 Ga0496112_0220963 3300048915 Bacteria 1851
898 Ga0501032_0684995 3300049569 Bacteria 650
899 Ga0501033_0137855 3300049570 Bacteria 1765
900 Ga0501034_0010811 3300049571 Bacteria 9481
901 Ga0501034_0025544 3300049571 Bacteria 6015
902 Ga0501034_0076994 3300049571 Bacteria 3342
903 Ga0501034_0319779 3300049571 Bacteria 1485
904 Ga0501036_0137195 3300049572 Bacteria 2065
905 Ga0501036_0285914 3300049572 Bacteria 1380
906 Ga0501036_0760418 3300049572 Bacteria 799
907 Ga0501037_0029536 3300049573 Bacteria 4050
908 Ga0501037_0085311 3300049573 Bacteria 2286
909 Ga0501037_0113468 3300049573 Bacteria 1951
910 Ga0501038_0047031 3300049574 Bacteria 3739
911 Ga0501038_0109290 3300049574 Bacteria 2291
912 Ga0501039_0036054 3300049575 Bacteria 3816
913 Ga0501040_0252857 3300049576 Bacteria 1257
914 Ga0501042_0933232 3300049578 Bacteria 632
915 Ga0501043_0375541 3300049579 Bacteria 1077
916 Ga0501043_0632990 3300049579 Bacteria 787
917 Ga0501046_0002183 3300049580 Bacteria 18469
918 Ga0501046_0527338 3300049580 Bacteria 844
919 Ga0501047_0003913 3300049581 Bacteria 14006
920 Ga0501047_0004879 3300049581 Bacteria 12600
921 Ga0501047_0067238 3300049581 Bacteria 3454
922 Ga0501047_0110912 3300049581 Bacteria 2626
923 Ga0501047_0195366 3300049581 Bacteria 1886
924 Ga0501047_0756280 3300049581 Bacteria 788
925 Ga0501048_0888216 3300049582 Bacteria 641
926 Ga0501048_0998025 3300049582 Bacteria 602
927 Ga0501068_0227487 3300049584 Bacteria 1186
928 Ga0501069_0130923 3300049585 Bacteria 1436
929 Ga0501069_0134401 3300049585 Bacteria 1417
930 Ga0501069_0159519 3300049585 Bacteria 1298
931 Ga0501070_0007684 3300049586 Bacteria 9148
932 Ga0501070_0037155 3300049586 Bacteria 4066
933 Ga0501070_0069275 3300049586 Bacteria 2920
934 Ga0501070_0087574 3300049586 Bacteria 2577
935 Ga0501070_0093004 3300049586 Bacteria 2495
936 Ga0501070_0094497 3300049586 Bacteria 2474
937 Ga0501070_0097842 3300049586 Bacteria 2427
938 Ga0501073_0234840 3300049589 Bacteria 1266
939 Ga0501074_0000231 3300049590 Bacteria 31148
940 Ga0501074_0005942 3300049590 Bacteria 8801
941 Ga0501074_0336454 3300049590 Bacteria 1071
942 Ga0501074_0370338 3300049590 Bacteria 1016
943 Ga0501074_0954917 3300049590 Bacteria 603
944 Ga0501075_0064588 3300049591 Bacteria 2761
945 Ga0501076_1142489 3300049592 Bacteria 641
946 Ga0501079_0793421 3300049741 Bacteria 746
947 Ga0501080_0000859 3300049742 Bacteria 24880
948 Ga0501080_0001158 3300049742 Bacteria 21765
949 Ga0501080_0037409 3300049742 Bacteria 4533
950 Ga0501080_0125680 3300049742 Bacteria 2375
951 Ga0501080_0135333 3300049742 Bacteria 2280
952 Ga0501083_0454172 3300049744 Bacteria 834
953 Ga0501035_0009888 3300049822 Bacteria 8855
954 Ga0501035_0104984 3300049822 Bacteria 2477
955 Ga0501035_0122488 3300049822 Bacteria 2272
956 Ga0501035_0224767 3300049822 Bacteria 1602
957 Ga0501035_0802142 3300049822 Bacteria 752
958 Ga0501044_0011416 3300049823 Bacteria 9623
959 Ga0501044_0023273 3300049823 Bacteria 6591
960 Ga0501044_0031547 3300049823 Bacteria 5576
961 Ga0501044_0142220 3300049823 Bacteria 2387
962 nmdc:mga05p37_1724100_c1 3300050507 Bacteria 609
963 nmdc:mga05p37_676927_c1 3300050507 Bacteria 1151
964 nmdc:mga0qj67_212735_c1 3300050509 Bacteria 1570
965 nmdc:mga0qj67_302746_c1 3300050509 Bacteria 1295
966 nmdc:mga0qj67_874134_c1 3300050509 Bacteria 709
967 nmdc:mga06r32_103537_c1 3300050510 Bacteria 2795
968 nmdc:mga06r32_177491_c1 3300050510 Bacteria 2115
969 nmdc:mga06r32_39292_c1 3300050510 Bacteria 4489
970 nmdc:mga06r32_409413_c1 3300050510 Bacteria 1338
971 nmdc:mga08y16_1764570_c1 3300050511 Bacteria 573
972 nmdc:mga08y16_75959_c1 3300050511 Bacteria 3502
973 nmdc:mga08y16_825239_c1 3300050511 Bacteria 918
974 nmdc:mga0n895_156994_c1 3300050512 Bacteria 2306
975 nmdc:mga0a205_316249_c1 3300050515 Bacteria 1433
976 Ga0500555_015028 3300053103 Bacteria 2232
977 Ga0501084_0133885 3300054114 Bacteria 2086
978 Ga0501084_0981366 3300054114 Bacteria 710
979 Ga0501082_0377042 3300060353 Bacteria 1238
980 Ga0157373_10553977
981 JGI24736J21556_1003317
982 JGI24741J21665_1002928
983 JGI24740J21852_10054901
984 JGI25162J39368_1001468
985 JGI25157J39369_1006069
986 JGI25164J39214_1000061
987 JGI25150J39212_1000383
988 JGI25159J45721_1053824
989 JGI25151J46595_10000041
990 JGI25151J46595_10000176
991 JGI25151J46595_10121738
992 JGI25165J46597_1000151
993 JGI25153J46596_10000129
994 JGI26145J50221_1000774
995 JGI26139J50223_101325
996 JGI26143J51219_1000579
997 JGI26141J51220_1006671
998 JGI25404J52841_10027329
999 Ga0055527_1003993
1000 Ga0055535_1000865
1001 Ga0055535_1001393
1002 Ga0055542_1001551
1003 Ga0055529_1000140
1004 Ga0055526_1000527
1005 Ga0055526_1004038
1006 Ga0055537_1000226
1007 Ga0055537_1001085
1008 Ga0055524_1000041
1009 Ga0055524_1020562
1010 Ga0055524_1023764
1011 Ga0055536_1011555
1012 Ga0055536_1011574
1013 Ga0055536_1048316
1014 Ga0055534_1000258
1015 Ga0055534_1000462
1016 Ga0055528_1000017
1017 Ga0055528_1000065
1018 Ga0055530_10005173
1019 Ga0055540_1023878
1020 Ga0055540_1027592
1021 Ga0055531_10041268
1022 Ga0055531_10041284
1023 Ga0058862_12012037
1024 Ga0065704_10000509
1025 Ga0065704_10070536
1026 Ga0065704_10355230
1027 Ga0065712_10221377
1028 Ga0065712_10327211
1029 Ga0065712_10384698
1030 Ga0065707_10096544
1031 Ga0065707_10762043
1032 Ga0070658_10016772
1033 Ga0070658_10209746
1034 Ga0070658_10450903
1035 Ga0070658_10493005
1036 Ga0070658_10596763
1037 Ga0070676_10875115
1038 Ga0070683_100002931
1039 Ga0070683_100028755
1040 Ga0070683_100173398
1041 Ga0070683_100382786
1042 Ga0070690_100001791
1043 Ga0070690_100002128
1044 Ga0070690_100110502
1045 Ga0070690_100401850
1046 Ga0070670_100038033
1047 Ga0070670_100049700
1048 Ga0070670_100162524
1049 Ga0070670_100576152
1050 Ga0070670_100671462
1051 Ga0070670_101682689
1052 Ga0070677_10009329
1053 Ga0070677_10169164
1054 Ga0068869_100003399
1055 Ga0068869_100029486
1056 Ga0068869_100136718
1057 Ga0068869_100202217
1058 Ga0068869_100709745
1059 Ga0068869_100755350
1060 Ga0070666_10012971
1061 Ga0070666_10026468
1062 Ga0070666_10224765
1063 Ga0070666_10248559
1064 Ga0070666_10479192
1065 Ga0070666_10487820
1066 Ga0070666_10499181
1067 Ga0070680_100006209
1068 Ga0070680_100254423
1069 Ga0070680_100481788
1070 Ga0070680_101151041
1071 Ga0070682_100001534
1072 Ga0070682_100037676
1073 Ga0070682_100070478
1074 Ga0070682_100092744
1075 Ga0070682_100326997
1076 Ga0068868_100000449
1077 Ga0068868_100069679
1078 Ga0068868_100132092
1079 Ga0068868_100159903
1080 Ga0068868_100220707
1081 Ga0068868_100521117
1082 Ga0068868_101526401
1083 Ga0068868_101591049
1084 Ga0070660_100023184
1085 Ga0070660_100048476
1086 Ga0070660_100065261
1087 Ga0070660_100081848
1088 Ga0070660_100110353
1089 Ga0070689_100003068
1090 Ga0070689_100005157
1091 Ga0070689_100197011
1092 Ga0070689_100333275
1093 Ga0070691_10003998
1094 Ga0070687_100001173
1095 Ga0070687_100054204
1096 Ga0070687_100087071
1097 Ga0070687_100259698
1098 Ga0070661_100019534
1099 Ga0070661_100022752
1100 Ga0070661_100040264
1101 Ga0070661_100048603
1102 Ga0070661_100198614
1103 Ga0070661_100374210
1104 Ga0070661_101852008
1105 Ga0070692_10003648
1106 Ga0070692_10009813
1107 Ga0070692_10103255
1108 Ga0070668_100017141
1109 Ga0070668_100020959
1110 Ga0070668_100070838
1111 Ga0070668_100130618
1112 Ga0070668_100760921
1113 Ga0070668_101110664
1114 Ga0070668_101228029
1115 Ga0070669_100028567
1116 Ga0070669_100136318
1117 Ga0070669_100279731
1118 Ga0070669_100504785
1119 Ga0070675_100012719
1120 Ga0070675_100091010
1121 Ga0070675_100099094
1122 Ga0070675_100195352
1123 Ga0070675_100234656
1124 Ga0070675_100262850
1125 Ga0070675_100381666
1126 Ga0070675_100431240
1127 Ga0070675_100478369
1128 Ga0070675_101246025
1129 Ga0070675_101488491
1130 Ga0070671_100021508
1131 Ga0070671_100174455
1132 Ga0070671_100187217
1133 Ga0070671_100415416
1134 Ga0070671_100506220
1135 Ga0070671_100732715
1136 Ga0070671_101171361
1137 Ga0070671_101714693
1138 Ga0070674_100011157
1139 Ga0070674_100165328
1140 Ga0070674_100262814
1141 Ga0070674_100434807
1142 Ga0070674_100826507
1143 Ga0070673_100003634
1144 Ga0070673_100122042
1145 Ga0070673_100220361
1146 Ga0070673_100279574
1147 Ga0070673_100971424
1148 Ga0070673_100991445
1149 Ga0070673_101666379
1150 Ga0070688_100013144
1151 Ga0070688_100133868
1152 Ga0070659_100002192
1153 Ga0070659_100002678
1154 Ga0070659_100074394
1155 Ga0070659_100193207
1156 Ga0070659_100217176
1157 Ga0070667_100016049
1158 Ga0070667_100033628
1159 Ga0070667_100166906
1160 Ga0070667_100227568
1161 Ga0070667_100287883
1162 Ga0070667_100451580
1163 Ga0070667_100802526
1164 Ga0070667_100889553
1165 Ga0070667_101149912
1166 Ga0070667_101592888
1167 Ga0070703_10075575
1168 Ga0070709_10599312
1169 Ga0070714_100026877
1170 Ga0070714_100417079
1171 Ga0070713_100015294
1172 Ga0070710_10106637
1173 Ga0070701_10000241
1174 Ga0070701_10104013
1175 Ga0070701_10171255
1176 Ga0070711_100927963
1177 Ga0070705_100000525
1178 Ga0070705_100913974
1179 Ga0070700_100001732
1180 Ga0070700_100309830
1181 Ga0070700_100394433
1182 Ga0070700_100814664
1183 Ga0070694_100002752
1184 Ga0070708_100173550
1185 Ga0070708_100406380
1186 Ga0070663_100028500
1187 Ga0070663_100035433
1188 Ga0070663_100062333
1189 Ga0070663_100103036
1190 Ga0070663_100258059
1191 Ga0070678_100030377
1192 Ga0070678_100223991
1193 Ga0070678_100316157
1194 Ga0070678_100846434
1195 Ga0070662_100036198
1196 Ga0070662_100121210
1197 Ga0070662_100626676
1198 Ga0070662_101172558
1199 Ga0070662_101188362
1200 Ga0070662_101934545
1201 Ga0070681_10001890
1202 Ga0070681_10003645
1203 Ga0070681_10004343
1204 Ga0070681_10004511
1205 Ga0070681_10023625
1206 Ga0070681_10035133
1207 Ga0070681_10044220
1208 Ga0070681_10085224
1209 Ga0070681_10096902
1210 Ga0068867_100010574
1211 Ga0068867_100042713
1212 Ga0068867_100314378
1213 Ga0068867_101206600
1214 Ga0070685_10001309
1215 Ga0070685_10021564
1216 Ga0070685_10045633
1217 Ga0070706_100414158
1218 Ga0070706_100432763
1219 Ga0070706_100469414
1220 Ga0070706_101191274
1221 Ga0070707_100000093
1222 Ga0070707_100281954
1223 Ga0070698_100397170
1224 Ga0070698_100788491
1225 Ga0070699_100002043
1226 Ga0070699_100113604
1227 Ga0070699_100121901
1228 Ga0070699_100622817
1229 Ga0070679_100014414
1230 Ga0070679_100014735
1231 Ga0070679_100014740
1232 Ga0070679_100018597
1233 Ga0070679_100032886
1234 Ga0070679_100040235
1235 Ga0070679_100051101
1236 Ga0070679_100090416
1237 Ga0070679_100180414
1238 Ga0070679_100244452
1239 Ga0070679_100813465
1240 Ga0070684_100003194
1241 Ga0070684_100003635
1242 Ga0070684_100046582
1243 Ga0070684_100315970
1244 Ga0070684_100523494
1245 Ga0070697_100107681
1246 Ga0070697_100890196
1247 Ga0070697_101013134
1248 Ga0068853_100002360
1249 Ga0068853_100006433
1250 Ga0068853_100037472
1251 Ga0068853_100137837
1252 Ga0068853_100138764
1253 Ga0068853_100312795
1254 Ga0068853_100624024
1255 Ga0068853_100714377
1256 Ga0068853_100900876
1257 Ga0068853_100903893
1258 Ga0068853_100948077
1259 Ga0070672_100002016
1260 Ga0070672_100005555
1261 Ga0070672_100007880
1262 Ga0070672_100077642
1263 Ga0070672_100272775
1264 Ga0070672_100382504
1265 Ga0070672_100492281
1266 Ga0070686_100004387
1267 Ga0070686_100026663
1268 Ga0070686_100169330
1269 Ga0070695_100001112
1270 Ga0070695_100138130
1271 Ga0070696_100000073
1272 Ga0070696_100013805
1273 Ga0070696_100100320
1274 Ga0070696_100162392
1275 Ga0070696_100182141
1276 Ga0070693_100000174
1277 Ga0070693_100011913
1278 Ga0070693_100033216
1279 Ga0070693_100057781
1280 Ga0070693_100144255
1281 Ga0070693_100488051
1282 Ga0070693_101628727
1283 Ga0070665_100092865
1284 Ga0070665_100118823
1285 Ga0070665_100149142
1286 Ga0070665_100572000
1287 Ga0070665_100970072
1288 Ga0070704_100001537
1289 Ga0070704_100257218
1290 Ga0068855_100004109
1291 Ga0068855_100007320
1292 Ga0068855_100019981
1293 Ga0068855_100057393
1294 Ga0068855_100208192
1295 Ga0068855_100543362
1296 Ga0068855_100651730
1297 Ga0068855_100731573
1298 Ga0068855_100826768
1299 Ga0068855_101132149
1300 Ga0068855_102102088
1301 Ga0070664_100008001
1302 Ga0070664_100050912
1303 Ga0070664_100075530
1304 Ga0070664_100275014
1305 Ga0070664_100368106
1306 Ga0070664_100692242
1307 Ga0070664_100784110
1308 Ga0068857_100014732
1309 Ga0068857_100018427
1310 Ga0068857_100156288
1311 Ga0068857_100168897
1312 Ga0068857_100196218
1313 Ga0068857_100232717
1314 Ga0068857_100287549
1315 Ga0068857_100476052
1316 Ga0068857_100523110
1317 Ga0068857_100734680
1318 Ga0068854_100003562
1319 Ga0068854_100005419
1320 Ga0068854_100029304
1321 Ga0068854_100050948
1322 Ga0068854_100337822
1323 Ga0068854_100404918
1324 Ga0068854_100618673
1325 Ga0068854_100838915
1326 Ga0068854_100876109
1327 Ga0068856_100002613
1328 Ga0068856_100003530
1329 Ga0068856_100005606
1330 Ga0068856_100016156
1331 Ga0068856_100087749
1332 Ga0068856_100174367
1333 Ga0068856_100290949
1334 Ga0068856_100323413
1335 Ga0068856_101289315
1336 Ga0070702_100000064
1337 Ga0070702_100027072
1338 Ga0070702_100278791
1339 Ga0070702_100364571
1340 Ga0068852_100017923
1341 Ga0068852_100195448
1342 Ga0068852_100317734
1343 Ga0068852_100329092
1344 Ga0068852_100526011
1345 Ga0068852_100803702
1346 Ga0068852_101397068
1347 Ga0068859_100002133
1348 Ga0068859_100010947
1349 Ga0068859_100019805
1350 Ga0068859_100020867
1351 Ga0068859_100067851
1352 Ga0068859_100106087
1353 Ga0068859_100279341
1354 Ga0068859_101210553
1355 Ga0068864_100016372
1356 Ga0068864_100019136
1357 Ga0068864_100122331
1358 Ga0068864_100195764
1359 Ga0068864_100296215
1360 Ga0068864_100436384
1361 Ga0068864_101023491
1362 Ga0068866_10000766
1363 Ga0068861_100011229
1364 Ga0068861_100044182
1365 Ga0068861_100339560
1366 Ga0068851_10009360
1367 Ga0068851_10014712
1368 Ga0068851_10539283
1369 Ga0068863_100000945
1370 Ga0068863_100012630
1371 Ga0068863_100038641
1372 Ga0068863_100041187
1373 Ga0068863_100042745
1374 Ga0068863_100046523
1375 Ga0068863_100052920
1376 Ga0068863_100148826
1377 Ga0068863_100581867
1378 Ga0068858_100051452
1379 Ga0068858_100057947
1380 Ga0068858_100082573
1381 Ga0068858_100172839
1382 Ga0068858_100506145
1383 Ga0068858_100600149
1384 Ga0068858_100674709
1385 Ga0068858_100837360
1386 Ga0068858_100970744
1387 Ga0068860_100001333
1388 Ga0068860_100017551
1389 Ga0068860_100080959
1390 Ga0068860_100103106
1391 Ga0068860_100112297
1392 Ga0068860_100145252
1393 Ga0068860_100692037
1394 Ga0068860_100969904
1395 Ga0068862_100000707
1396 Ga0068862_100004610
1397 Ga0068862_100061345
1398 Ga0068862_100089863
1399 Ga0068862_100146422
1400 Ga0068862_100180869
1401 Ga0068862_100291040
1402 Ga0068862_100492492
1403 Ga0068862_101418788
1404 Ga0081455_10001633
1405 Ga0081455_10218978
1406 Ga0081540_1001899
1407 Ga0081540_1075042
1408 Ga0081539_10000232
1409 Ga0081539_10074162
1410 Ga0081539_10100800
1411 Ga0081539_10284996
1412 Ga0075365_10056509
1413 Ga0075364_10000928
1414 Ga0075364_10174026
1415 Ga0075364_10981729
1416 Ga0070716_100349499
1417 Ga0070712_100128158
1418 Ga0075367_10009991
1419 Ga0075369_10014137
1420 Ga0075369_10115920
1421 Ga0075427_10078789
1422 Ga0075366_10234916
1423 Ga0075366_10535292
1424 Ga0075366_10700717
1425 Ga0097621_100003083
1426 Ga0097621_100030305
1427 Ga0097621_100060094
1428 Ga0097621_100064924
1429 Ga0097621_100074679
1430 Ga0097621_100199576
1431 Ga0097621_100416806
1432 Ga0097621_100447358
1433 Ga0097621_100472207
1434 Ga0097621_101752186
1435 Ga0075370_10135903
1436 Ga0068871_100008915
1437 Ga0068871_100027477
1438 Ga0068871_100069699
1439 Ga0068871_100100645
1440 Ga0068871_101643591
1441 Ga0075428_100003071
1442 Ga0075428_100459604
1443 Ga0075428_101213679
1444 Ga0075430_100077464
1445 Ga0075430_100353361
1446 Ga0075430_100373141
1447 Ga0075430_100394865
1448 Ga0075430_101090621
1449 Ga0075431_100007135
1450 Ga0075431_100046320
1451 Ga0075431_100309790
1452 Ga0075431_100339314
1453 Ga0075431_100457241
1454 Ga0075431_100787845
1455 Ga0075433_10498109
1456 Ga0075434_100122549
1457 Ga0075434_100183522
1458 Ga0075434_100280546
1459 Ga0075434_100305094
1460 Ga0075434_100308980
1461 Ga0075434_101390250
1462 Ga0075429_100005146
1463 Ga0068865_100000441
1464 Ga0068865_100010048
1465 Ga0068865_100049966
1466 Ga0068865_100059623
1467 Ga0068865_100528298
1468 Ga0075436_100012856
1469 Ga0075436_100053047
1470 Ga0097620_100002133
1471 Ga0097620_100010947
1472 Ga0097620_100019806
1473 Ga0097620_100020866
1474 Ga0097620_100067850
1475 Ga0097620_100106092
1476 Ga0097620_100279324
1477 Ga0097620_101210601
1478 Ga0075435_100001831
1479 Ga0075435_100131095
1480 Ga0075435_101111965
1481 Ga0105251_10000450
1482 Ga0105251_10017454
1483 Ga0105244_10094302
1484 Ga0105250_10052396
1485 Ga0105240_10001034
1486 Ga0105240_10018043
1487 Ga0105240_10022491
1488 Ga0105240_10034189
1489 Ga0105240_10185328
1490 Ga0105240_10356625
1491 Ga0105240_10376170
1492 Ga0105240_10559788
1493 Ga0105240_10929165
1494 Ga0105240_11274762
1495 Ga0111539_10063462
1496 Ga0111539_10066443
1497 Ga0111539_10103645
1498 Ga0111539_10163479
1499 Ga0111539_10717080
1500 Ga0111539_10777757
1501 Ga0105245_10007522
1502 Ga0105245_10221116
1503 Ga0105245_10953780
1504 Ga0105245_11597511
1505 Ga0105247_10355284
1506 Ga0114129_10000467
1507 Ga0114129_10095036
1508 Ga0114129_10117407
1509 Ga0114129_10853151
1510 Ga0105243_10167468
1511 Ga0105243_10782671
1512 Ga0105241_10010963
1513 Ga0105241_10011152
1514 Ga0105241_10024998
1515 Ga0105241_10114277
1516 Ga0105241_10339673
1517 Ga0105241_10610067
1518 Ga0105241_11403566
1519 Ga0105242_10000524
1520 Ga0105242_10000862
1521 Ga0105242_10113577
1522 Ga0105242_10329496
1523 Ga0105242_11270012
1524 Ga0105248_10009513
1525 Ga0105248_10049058
1526 Ga0105248_10143451
1527 Ga0105248_10179890
1528 Ga0105248_10204228
1529 Ga0105248_10419114
1530 Ga0105248_10427784
1531 Ga0105248_10458208
1532 Ga0105248_11041063
1533 Ga0105248_11167953
1534 Ga0105248_11666514
1535 Ga0105248_12113373
1536 Ga0105237_10000371
1537 Ga0105237_10013282
1538 Ga0105237_10014025
1539 Ga0105237_10034971
1540 Ga0105237_10040100
1541 Ga0105237_10132847
1542 Ga0105237_10279368
1543 Ga0105237_10639161
1544 Ga0105238_10001167
1545 Ga0105238_10014211
1546 Ga0105238_10025373
1547 Ga0105238_10141303
1548 Ga0105238_10160597
1549 Ga0105238_10267348
1550 Ga0105238_11121485
1551 Ga0105238_12274515
1552 Ga0105249_10004718
1553 Ga0105249_10037838
1554 Ga0105249_11557890
1555 Ga0105239_10000063
1556 Ga0105239_10004199
1557 Ga0105239_10011975
1558 Ga0105239_10020971
1559 Ga0105239_10026783
1560 Ga0105239_10029639
1561 Ga0105239_10106578
1562 Ga0105239_10160834
1563 Ga0105239_10215388
1564 Ga0105239_10614190
1565 Ga0105246_10070137
1566 Ga0105246_10078960
1567 Ga0105246_10591035
1568 Ga0105246_10652211
1569 Ga0105246_11062324
1570 Ga0105246_11593498
1571 Ga0105246_11868189
1572 Ga0157328_1015561
1573 Ga0157346_1007329
1574 Ga0157346_1015841
1575 Ga0157337_1016490
1576 Ga0157322_1013320
1577 Ga0157335_1006325
1578 Ga0157323_1007289
1579 Ga0157314_1003720
1580 Ga0157313_1054668
1581 Ga0157315_1002376
1582 Ga0157315_1019516
1583 Ga0157316_1009936
1584 Ga0157327_1000853
1585 Ga0157373_10009440
1586 Ga0157373_10031695
1587 Ga0157373_10177594
1588 Ga0157373_10312537
1589 Ga0157373_10860451
1590 Ga0157371_10024547
1591 Ga0157371_10033870
1592 Ga0157371_10079291
1593 Ga0157371_10206478
1594 Ga0157371_10207800
1595 Ga0157371_10823314
1596 Ga0157371_10826286
1597 Ga0157370_10023253
1598 Ga0157370_10024547
1599 Ga0157370_10068303
1600 Ga0157370_10082566
1601 Ga0157370_10088208
1602 Ga0157370_10163289
1603 Ga0157369_10000027
1604 Ga0157369_10001075
1605 Ga0157369_10006171
1606 Ga0157369_10039495
1607 Ga0157369_10096997
1608 Ga0157369_10209787
1609 Ga0157369_10298078
1610 Ga0157369_10548820
1611 Ga0157374_10000895
1612 Ga0157374_10029789
1613 Ga0157374_10039520
1614 Ga0157374_10069913
1615 Ga0157374_10183373
1616 Ga0157374_10273909
1617 Ga0157374_10791665
1618 Ga0157378_10002315
1619 Ga0157378_10012903
1620 Ga0157378_10014157
1621 Ga0157378_10037698
1622 Ga0157378_10657256
1623 Ga0157378_10740580
1624 Ga0157378_11001764
1625 Ga0157378_11089294
1626 Ga0157378_12201752
1627 Ga0163162_10005036
1628 Ga0163162_10020014
1629 Ga0163162_10030444
1630 Ga0163162_10070103
1631 Ga0163162_10089559
1632 Ga0163162_10182276
1633 Ga0163162_10256213
1634 Ga0163162_10295745
1635 Ga0163162_11053453
1636 Ga0163162_12994824
1637 Ga0157372_10000662
1638 Ga0157372_10002799
1639 Ga0157372_10005146
1640 Ga0157372_10037571
1641 Ga0157372_10069317
1642 Ga0157372_10090801
1643 Ga0157372_10149613
1644 Ga0157372_10162856
1645 Ga0157372_10164345
1646 Ga0157372_10296136
1647 Ga0157372_11073642
1648 Ga0157375_10006575
1649 Ga0157375_10012067
1650 Ga0157375_10039074
1651 Ga0157375_10062762
1652 Ga0157375_10565322
1653 Ga0157375_10699439
1654 Ga0157375_11372285
1655 Ga0157375_13240118
1656 Ga0157375_13691741
1657 Ga0163163_10005615
1658 Ga0163163_10006006
1659 Ga0163163_10012750
1660 Ga0163163_10062567
1661 Ga0163163_10118382
1662 Ga0163163_10123065
1663 Ga0163163_10154568
1664 Ga0163163_10425277
1665 Ga0157380_10008616
1666 Ga0157380_10125323
1667 Ga0157380_10359568
1668 Ga0157380_11495317
1669 Ga0157380_11894701
1670 Ga0182008_10081517
1671 Ga0182008_10310151
1672 Ga0182008_10323199
1673 Ga0157377_10017138
1674 Ga0157377_10032748
1675 Ga0157377_10440002
1676 Ga0157377_10474411
1677 Ga0157379_10002463
1678 Ga0157379_10015332
1679 Ga0157379_10018889
1680 Ga0157379_10173231
1681 Ga0157379_10325248
1682 Ga0157379_10474708
1683 Ga0157379_10624589
1684 Ga0157376_10005343
1685 Ga0157376_10028214
1686 Ga0157376_10029971
1687 Ga0157376_10030644
1688 Ga0157376_10051784
1689 Ga0157376_10139211
1690 Ga0157376_10195931
1691 Ga0157376_10263037
1692 Ga0157376_10349602
1693 Ga0157376_10597097
1694 Ga0157376_10688565
1695 Ga0182006_1029504
1696 Ga0182007_10001075
1697 Ga0182005_1008264
1698 Ga0206351_10437662
1699 Ga0206354_11037185
1700 Ga0154015_1012287
1701 Ga0213876_10697908
1702 Ga0224712_10010620
1703 Ga0209233_1006030
1704 Ga0207647_10002942
1705 Ga0207705_10006128
1706 Ga0207705_10012528
1707 Ga0207707_10000344
1708 Ga0207707_10498942
1709 Ga0207695_10003549
1710 Ga0207695_10005328
1711 Ga0207660_10048030
1712 Ga0207657_10398087
1713 Ga0207649_10021450
1714 Ga0207649_10035859
1715 Ga0207652_10008836
1716 Ga0207646_10000177
1717 Ga0207646_10232702
1718 Ga0207646_10621339
1719 Ga0207646_11656849
1720 Ga0207659_10417029
1721 Ga0207670_10431051
1722 Ga0207670_11399551
1723 Ga0207689_10647918
1724 Ga0207679_10057019
1725 Ga0207667_10003638
1726 Ga0207712_10054683
1727 Ga0207640_10000883
1728 Ga0207703_10394589
1729 Ga0207639_10087618
1730 Ga0207678_10518523
1731 Ga0207702_10001451
1732 Ga0207702_10170182
1733 Ga0207702_10740487
1734 Ga0207641_10032481
1735 Ga0207648_10576470
1736 Ga0207676_10024516
1737 Ga0207674_10164534
1738 Ga0207698_10001632
1739 Ga0209967_1011329
1740 Ga0207428_10008489
1741 Ga0268265_10034187
1742 Ga0268265_10085557
1743 Ga0268265_10129522
1744 Ga0268265_10520511
1745 Ga0268264_10675325
1746 Ga0265319_1001621
1747 Ga0265319_1077366
1748 Ga0265318_10026110
1749 Ga0265318_10202491
1750 Ga0265318_10373676
1751 Ga0265320_10002342
1752 Ga0265320_10013999
1753 Ga0265320_10068487
1754 Ga0265327_10003280
1755 Ga0265327_10298355
1756 Ga0265316_10028683
1757 Ga0316575_10010769
1758 Ga0316575_10170809
1759 Ga0316575_10239963
1760 Ga0316579_10001592
1761 Ga0316579_10006273
1762 Ga0316579_10154251
1763 Ga0316579_10434217
1764 Ga0265314_10015957
1765 Ga0265314_10054110
1766 Ga0316576_10009486
1767 Ga0316576_10286461
1768 Ga0316576_10323562
1769 Ga0316576_10825396
1770 Ga0316578_10034042
1771 Ga0316578_10050502
1772 Ga0316578_10051895
1773 Ga0316578_10107307
1774 Ga0307405_10722511
1775 Ga0316577_10078792
1776 Ga0316577_10105919
1777 Ga0316577_10318466
1778 Ga0316577_10358109
1779 Ga0307410_10483217
1780 Ga0307407_10164277
1781 Ga0307409_100262842
1782 Ga0307416_100632411
1783 Ga0316583_10011891
1784 Ga0316583_10022697
1785 Ga0316583_10084664
1786 Ga0316583_10177364
1787 Ga0316585_10228543
1788 Ga0316593_10000022
1789 Ga0316593_10000063
1790 Ga0316593_10000528
1791 Ga0316593_10002956
1792 Ga0316593_10005283
1793 Ga0316593_10009676
1794 Ga0316593_10010401
1795 Ga0316593_10022414
1796 Ga0316593_10041084
1797 Ga0316593_10053805
1798 Ga0316592_1002734
1799 Ga0316588_1080632
1800 Ga0316588_1093735
1801 Ga0316587_1000145
1802 Ga0316587_1004485
1803 Ga0316587_1050349
1804 Ga0316587_1053632
1805 Ga0316587_1054631
1806 Ga0316587_1085700
1807 Ga0316596_1000099
1808 Ga0316596_1001288
1809 Ga0316596_1033412
1810 Ga0316596_1099989
1811 Ga0316596_1130779
1812 Ga0316596_1171495
1813 Ga0316574_0000893
1814 Ga0316574_0002750
1815 Ga0316574_0013618
1816 Ga0316574_0023508
1817 Ga0316574_0037469
1818 Ga0316574_0084014
1819 Ga0316574_0134111
1820 Ga0316574_0156893
1821 Ga0316574_0497018
1822 Ga0316574_0892630
1823 Ga0316574_0930373
1824 Ga0373924_0067327
1825 Ga0373937_0174199
1826 Ga0316582_0001138
1827 Ga0316582_0003304
1828 Ga0316582_0040294
1829 Ga0316582_0162970
1830 Ga0316582_0519501
1831 Ga0316584_0003189
1832 Ga0316584_0040869
1833 Ga0316584_0319130
1834 Ga0316584_0482051
1835 Ga0395898_0721855
1836 Ga0395898_0813834
1837 Ga0316581_0017508
1838 Ga0316581_0060719
1839 Ga0316581_0131302
1840 Ga0400484_13138
1841 Ga0400484_19117
1842 Ga0400484_27580
1843 Ga0400490_12170
1844 Ga0400490_13333
1845 Ga0400490_21722
1846 Ga0400491_01396
1847 Ga0400488_59405
1848 Ga0400486_00582
1849 Ga0400486_28223
1850 Ga0400483_038949
1851 Ga0400483_054265
1852 Ga0400483_234572
1853 Ga0400483_268123
1854 Ga0400487_39531
1855 Ga0400487_62691
1856 Ga0436365_1280613
1857 Ga0439433_0089973
1858 Ga0439455_0051590
1859 Ga0451577_0001920
1860 Ga0451577_0017596
1861 Ga0451577_0222679
1862 Ga0451577_0299952
1863 Ga0451577_1917577
1864 Ga0453683_0126649
1865 Ga0453684_0000045
1866 Ga0453684_0004072
1867 Ga0453684_0009686
1868 Ga0453684_0260618
1869 Ga0453684_2359664
1870 Ga0495594_0720128
1871 Ga0495652_0444607
1872 Ga0495667_0153621
1873 Ga0495676_0555962
1874 Ga0496102_1364917
1875 Ga0496109_0000015
1876 Ga0496112_0220963
1877 Ga0501032_0684995
1878 Ga0501033_0137855
1879 Ga0501034_0010811
1880 Ga0501034_0025544
1881 Ga0501034_0076994
1882 Ga0501034_0319779
1883 Ga0501036_0137195
1884 Ga0501036_0285914
1885 Ga0501036_0760418
1886 Ga0501037_0029536
1887 Ga0501037_0085311
1888 Ga0501037_0113468
1889 Ga0501038_0047031
1890 Ga0501038_0109290
1891 Ga0501039_0036054
1892 Ga0501040_0252857
1893 Ga0501042_0933232
1894 Ga0501043_0375541
1895 Ga0501043_0632990
1896 Ga0501046_0002183
1897 Ga0501046_0527338
1898 Ga0501047_0003913
1899 Ga0501047_0004879
1900 Ga0501047_0067238
1901 Ga0501047_0110912
1902 Ga0501047_0195366
1903 Ga0501047_0756280
1904 Ga0501048_0888216
1905 Ga0501048_0998025
1906 Ga0501068_0227487
1907 Ga0501069_0130923
1908 Ga0501069_0134401
1909 Ga0501069_0159519
1910 Ga0501070_0007684
1911 Ga0501070_0037155
1912 Ga0501070_0069275
1913 Ga0501070_0087574
1914 Ga0501070_0093004
1915 Ga0501070_0094497
1916 Ga0501070_0097842
1917 Ga0501073_0234840
1918 Ga0501074_0000231
1919 Ga0501074_0005942
1920 Ga0501074_0336454
1921 Ga0501074_0370338
1922 Ga0501074_0954917
1923 Ga0501075_0064588
1924 Ga0501076_1142489
1925 Ga0501079_0793421
1926 Ga0501080_0000859
1927 Ga0501080_0001158
1928 Ga0501080_0037409
1929 Ga0501080_0125680
1930 Ga0501080_0135333
1931 Ga0501083_0454172
1932 Ga0501035_0009888
1933 Ga0501035_0104984
1934 Ga0501035_0122488
1935 Ga0501035_0224767
1936 Ga0501035_0802142
1937 Ga0501044_0011416
1938 Ga0501044_0023273
1939 Ga0501044_0031547
1940 Ga0501044_0142220
1941 nmdc:mga05p37_1724100_c1
1942 nmdc:mga05p37_676927_c1
1943 nmdc:mga0qj67_212735_c1
1944 nmdc:mga0qj67_302746_c1
1945 nmdc:mga0qj67_874134_c1
1946 nmdc:mga06r32_103537_c1
1947 nmdc:mga06r32_177491_c1
1948 nmdc:mga06r32_39292_c1
1949 nmdc:mga06r32_409413_c1
1950 nmdc:mga08y16_1764570_c1
1951 nmdc:mga08y16_75959_c1
1952 nmdc:mga08y16_825239_c1
1953 nmdc:mga0n895_156994_c1
1954 nmdc:mga0a205_316249_c1
1955 Ga0500555_015028
1956 Ga0501084_0133885
1957 Ga0501084_0981366
1958 Ga0501082_0377042

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00334

NDK

Nucleoside diphosphate kinase

25

159

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ek2-assembly1.cif.gz_A the structure of nucleoside diphosphate kinase (ndk) from burkholderia thailandensis bound to deoxyadenosine monophosphate 0.9958 1 141
6ay1-assembly5.cif.gz_E crystal structure of a nucleoside diphosphate kinase ndk from helicobacter pylori 0.9958 4 138
3vgv-assembly8.cif.gz_O e134a mutant nucleoside diphosphate kinase derived from halomonas sp. 593 0.995 2 141
3vgu-assembly4.cif.gz_H e134a mutant nucleoside diphosphate kinase derived from halomonas sp. 593 0.9947 2 141
3vgv-assembly6.cif.gz_L e134a mutant nucleoside diphosphate kinase derived from halomonas sp. 593 0.9939 2 141
ID Description Score Start End Superfamily
6ay1G00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9923 4 138 3.30.70.141
af_Q6Z7E5_29_180_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9835 2 133 3.30.70.141
4w98A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9832 1 142 3.30.70.141
3vgvN00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9813 2 141 3.30.70.141
6ay1G00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.977 4 138 3.30.70.141
ID Description Score Start End GO Terms
AF-A0A1T4LWY9-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 1.004 1 141 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A3B9NY98-F1-model_v4 Multifunctional fusion protein [Includes: Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase); tRNA(Ile)-lysidine synthase (EC 6.3.4.19) (tRNA(Ile)-2-lysyl-cytidine synthase) (tRNA(Ile)-lysidine synthetase)] 1.004 2 141 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0006400
GO:0032267
GO:0046872
AF-J9GBN6-F1-model_v4 Nucleoside diphosphate kinase (EC 2.7.4.6) 1.004 7 141 GO:0004550
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-E7RVQ0-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 1.003 1 141 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A7Y0H8Y5-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 1.003 1 141 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872

Map