F487346

General Info

Members Datasets Scaffolds Average Seq Length
979 333 1958 632

Family's Representative Sequence

Representative Sequence 3300048912|Ga0496109_0101651|Ga0496109_0101651_572_2452
Length 626
Sequence VATATHVLTPEESEAHPPQEAVVVRFAGDSGDGMQLTGGQFTLSTALAGNDLATFPDFPAEIRAPQGTTFGVSAFQINFGSCAIDTAGDQPDVLIAMNPAALKVNVKALRDGGLIIADEGEFTARNLAKAGYDQNPLEDGSLAKWQLVHFNISQLTLDAVKPFGLGNKEALRCKNMWTLGLALWMFDRDREPIVDWLKSKFAKAPELAEANIAALNAGHAYGETTEMGGVHKHHLDAAPAEPGLYRTVTGAEALSIGLVAGAQLAGLDMFFGSYPITPASPLLHHLSRLKEFGITTFQAEDEIAAVCAAIGASYAGQLGVTSSSGPGIALKTEAIGLAIMTELPLVVVNSQRGGPSTGLPTKTEQSDLYQAVYGRNADAPLPVIAARSPSDAFECAIEACRIATRYMTPVMLLTDGYIANAAEPWKVPDTSKFEPFPVSFFDKAPAEGEGVMPYARNDELARPWIKPGTVGLEHRIGGIEKAPGSGNIDYSPEAHAEMTRIRAAKVDGVADSIPDQEVCLGEAGAKLAIVGWGSTYGPIHQAVRRARAKGQDVAHVHIRHIWPMPKNMAVLLKSFENILVPEMNTGQLKTLLRDQFLVDAKSLPKVSGQPFTIAEIEAAISEALKG

Samples

Sample ID Description Type Environment
1 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
117 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
120 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
124 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
177 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
182 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
185 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
186 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
187 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
188 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
189 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
207 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
208 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
209 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
210 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
211 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
212 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
213 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
214 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
215 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
216 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
217 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
218 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
219 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
220 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
221 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
224 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
225 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
226 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
227 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
228 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
229 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
230 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
231 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
232 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
233 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
234 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
235 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
236 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
237 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
238 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
239 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
240 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
241 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
242 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
243 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
244 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
245 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
246 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
247 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
248 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
249 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
250 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
251 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
252 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
253 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
254 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
255 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
262 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
263 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
264 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
265 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
266 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
267 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
268 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
269 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
270 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
271 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
272 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
273 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
274 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
275 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
276 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
277 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
278 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
284 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
285 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
286 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
287 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
288 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
289 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
292 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
293 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
294 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
295 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
296 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
297 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
298 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
299 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
300 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
301 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
302 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
303 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
304 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
305 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
306 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
307 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
308 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
309 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
310 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
311 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
312 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
313 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
314 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
315 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
316 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
317 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
318 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
319 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
320 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
321 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
322 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
323 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
324 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
325 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
326 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
327 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
328 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
329 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
330 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
331 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
332 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
333 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.06
Metatranscriptomes 0
Isolates 1.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.84
Nodule 0
Rhizoplane 5.01
Rhizosphere 84.07
Stem 0
Stem Tuber 0.1
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496109_0101651 3300048912 Bacteria 2668
2 SwRhRL2b_contig_2799799 2162886007 Bacteria 27953
3 JGI24736J21556_1000056 3300001904 Bacteria 18329
4 JGI24752J21851_1000367 3300001976 Bacteria 6293
5 JGI24740J21852_10007712 3300001979 Bacteria 4352
6 JGI24740J21852_10008209 3300001979 Bacteria 4182
7 JGI24739J22299_10001645 3300001989 Bacteria 8484
8 JGI24739J22299_10003318 3300001989 Bacteria 6140
9 JGI24737J22298_10000117 3300001990 Bacteria 24179
10 JGI24743J22301_10000482 3300001991 Bacteria 4600
11 JGI24735J21928_10002989 3300002067 Bacteria 5820
12 JGI24735J21928_10007292 3300002067 Bacteria 3608
13 JGI24750J21931_1000004 3300002070 Bacteria 25671
14 JGI24748J21848_1000044 3300002074 Bacteria 59119
15 JGI24738J21930_10001953 3300002075 Bacteria 5558
16 JGI24738J21930_10003826 3300002075 Bacteria 3759
17 JGI24738J21930_10004092 3300002075 Bacteria 3600
18 JGI24738J21930_10007579 3300002075 Bacteria 2499
19 JGI24034J26672_10000020 3300002239 Bacteria 122643
20 JGI24751J29686_10000242 3300002459 Bacteria 21927
21 JGI25165J46597_1000573 3300003214 Bacteria 32867
22 JGI25153J46596_10000113 3300003215 Bacteria 92345
23 Ga0055525_1000051 3300003759 Bacteria 240942
24 Ga0055542_1000020 3300003762 Bacteria 335745
25 Ga0055529_1000016 3300003763 Bacteria 364775
26 Ga0055536_1000643 3300003781 Bacteria 23754
27 Ga0055536_1003408 3300003781 Bacteria 8552
28 Ga0055536_1008388 3300003781 Bacteria 4448
29 Ga0055530_10000035 3300003791 Bacteria 117598
30 Ga0055531_10003431 3300003794 Bacteria 10111
31 Ga0065704_10000222 3300005289 Bacteria 73073
32 Ga0065712_10077447 3300005290 Bacteria 3494
33 Ga0065715_10096385 3300005293 Bacteria 3884
34 Ga0065707_10083820 3300005295 Bacteria 8173
35 Ga0065707_10086495 3300005295 Bacteria 5432
36 Ga0070658_10000001 3300005327 Bacteria 856789
37 Ga0070658_10000305 3300005327 Bacteria 42490
38 Ga0070658_10000351 3300005327 Bacteria 39857
39 Ga0070658_10019495 3300005327 Bacteria 5431
40 Ga0070658_10064228 3300005327 Bacteria 2994
41 Ga0070658_10085268 3300005327 Bacteria 2597
42 Ga0070683_100001218 3300005329 Bacteria 19546
43 Ga0070683_100009155 3300005329 Bacteria 8451
44 Ga0070683_100035894 3300005329 Bacteria 4534
45 Ga0070690_100000180 3300005330 Bacteria 32463
46 Ga0070690_100037867 3300005330 Bacteria 3041
47 Ga0070670_100001900 3300005331 Bacteria 17083
48 Ga0070670_100002485 3300005331 Bacteria 15200
49 Ga0070670_100004196 3300005331 Bacteria 12063
50 Ga0070670_100006931 3300005331 Bacteria 9606
51 Ga0070670_100028646 3300005331 Bacteria 4793
52 Ga0070670_100035673 3300005331 Bacteria 4281
53 Ga0070670_100036174 3300005331 Bacteria 4250
54 Ga0070670_100062929 3300005331 Bacteria 3185
55 Ga0070677_10000358 3300005333 Bacteria 15980
56 Ga0068869_100001958 3300005334 Bacteria 12336
57 Ga0068869_100053556 3300005334 Bacteria 2934
58 Ga0070666_10000027 3300005335 Bacteria 151010
59 Ga0070666_10000033 3300005335 Bacteria 121625
60 Ga0070666_10000555 3300005335 Bacteria 22543
61 Ga0070666_10000788 3300005335 Bacteria 19216
62 Ga0070666_10002098 3300005335 Bacteria 12117
63 Ga0070666_10020931 3300005335 Bacteria 4234
64 Ga0070666_10034090 3300005335 Bacteria 3374
65 Ga0070680_100000228 3300005336 Bacteria 37094
66 Ga0070680_100000949 3300005336 Bacteria 20532
67 Ga0070680_100041578 3300005336 Bacteria 3727
68 Ga0068868_100000001 3300005338 Bacteria 282170
69 Ga0068868_100000041 3300005338 Bacteria 69601
70 Ga0068868_100000211 3300005338 Bacteria 39269
71 Ga0068868_100000572 3300005338 Bacteria 24682
72 Ga0068868_100017275 3300005338 Bacteria 5371
73 Ga0068868_100049966 3300005338 Bacteria 3283
74 Ga0070660_100000051 3300005339 Bacteria 68568
75 Ga0070660_100000129 3300005339 Bacteria 47402
76 Ga0070660_100005925 3300005339 Bacteria 8452
77 Ga0070660_100007167 3300005339 Bacteria 7755
78 Ga0070660_100025232 3300005339 Bacteria 4417
79 Ga0070660_100064465 3300005339 Bacteria 2850
80 Ga0070689_100051235 3300005340 Bacteria 3191
81 Ga0070661_100000014 3300005344 Bacteria 158652
82 Ga0070661_100000033 3300005344 Bacteria 111757
83 Ga0070661_100008952 3300005344 Bacteria 6929
84 Ga0070661_100023721 3300005344 Bacteria 4399
85 Ga0070661_100049814 3300005344 Bacteria 3066
86 Ga0070668_100000123 3300005347 Bacteria 48192
87 Ga0070669_100000075 3300005353 Bacteria 98073
88 Ga0070669_100000099 3300005353 Bacteria 85328
89 Ga0070669_100000471 3300005353 Bacteria 30589
90 Ga0070669_100000556 3300005353 Bacteria 27730
91 Ga0070669_100043759 3300005353 Bacteria 3262
92 Ga0070675_100000406 3300005354 Bacteria 29300
93 Ga0070675_100007861 3300005354 Bacteria 8265
94 Ga0070671_100000015 3300005355 Bacteria 166132
95 Ga0070671_100000050 3300005355 Bacteria 80843
96 Ga0070671_100000752 3300005355 Bacteria 23230
97 Ga0070671_100000800 3300005355 Bacteria 22726
98 Ga0070671_100001477 3300005355 Bacteria 17556
99 Ga0070671_100001615 3300005355 Bacteria 16981
100 Ga0070671_100001659 3300005355 Bacteria 16838
101 Ga0070671_100002991 3300005355 Bacteria 13155
102 Ga0070671_100003305 3300005355 Bacteria 12584
103 Ga0070671_100011910 3300005355 Bacteria 6995
104 Ga0070671_100015456 3300005355 Bacteria 6166
105 Ga0070671_100020477 3300005355 Bacteria 5395
106 Ga0070671_100028321 3300005355 Bacteria 4613
107 Ga0070674_100000415 3300005356 Bacteria 21461
108 Ga0070673_100001837 3300005364 Bacteria 12679
109 Ga0070673_100027333 3300005364 Bacteria 4228
110 Ga0070673_100031392 3300005364 Bacteria 3986
111 Ga0070673_100032558 3300005364 Bacteria 3927
112 Ga0070673_100077258 3300005364 Bacteria 2690
113 Ga0070688_100010650 3300005365 Bacteria 5079
114 Ga0070659_100000001 3300005366 Bacteria 576390
115 Ga0070659_100000142 3300005366 Bacteria 55216
116 Ga0070659_100004813 3300005366 Bacteria 9647
117 Ga0070659_100009061 3300005366 Bacteria 7302
118 Ga0070659_100013985 3300005366 Bacteria 5989
119 Ga0070659_100020857 3300005366 Bacteria 4983
120 Ga0070659_100091450 3300005366 Bacteria 2439
121 Ga0070659_100145559 3300005366 Bacteria 1930
122 Ga0070667_100000368 3300005367 Bacteria 49069
123 Ga0070667_100001014 3300005367 Bacteria 25719
124 Ga0070667_100003689 3300005367 Bacteria 13031
125 Ga0070667_100005056 3300005367 Bacteria 11037
126 Ga0070667_100008853 3300005367 Bacteria 8332
127 Ga0070667_100012088 3300005367 Bacteria 7147
128 Ga0070667_100012789 3300005367 Bacteria 6935
129 Ga0070667_100043981 3300005367 Bacteria 3749
130 Ga0070667_100047112 3300005367 Bacteria 3627
131 Ga0070667_100048374 3300005367 Bacteria 3579
132 Ga0070714_100084508 3300005435 Bacteria 2770
133 Ga0070713_100008902 3300005436 Bacteria 7149
134 Ga0070705_100002002 3300005440 Bacteria 10417
135 Ga0070663_100004959 3300005455 Bacteria 7859
136 Ga0070678_100000379 3300005456 Bacteria 20807
137 Ga0070678_100003813 3300005456 Bacteria 8456
138 Ga0070662_100000021 3300005457 Bacteria 93909
139 Ga0070662_100000733 3300005457 Bacteria 20056
140 Ga0070662_100000826 3300005457 Bacteria 19065
141 Ga0070662_100003298 3300005457 Bacteria 10055
142 Ga0070662_100008268 3300005457 Bacteria 6777
143 Ga0070662_100011909 3300005457 Bacteria 5750
144 Ga0070662_100016035 3300005457 Bacteria 5027
145 Ga0070662_100021330 3300005457 Bacteria 4422
146 Ga0070662_100072073 3300005457 Bacteria 2549
147 Ga0070681_10090371 3300005458 Bacteria 3013
148 Ga0068867_100011576 3300005459 Bacteria 6228
149 Ga0070685_10000238 3300005466 Bacteria 36209
150 Ga0070679_100000003 3300005530 Bacteria 307836
151 Ga0068853_100000377 3300005539 Bacteria 30591
152 Ga0068853_100003642 3300005539 Bacteria 11812
153 Ga0068853_100007738 3300005539 Bacteria 8617
154 Ga0068853_100046111 3300005539 Bacteria 3736
155 Ga0070672_100001912 3300005543 Bacteria 13063
156 Ga0070672_100012970 3300005543 Bacteria 5873
157 Ga0070686_100000010 3300005544 Bacteria 192116
158 Ga0070686_100003910 3300005544 Bacteria 8190
159 Ga0070696_100012945 3300005546 Bacteria 5602
160 Ga0070696_100014922 3300005546 Bacteria 5217
161 Ga0070693_100000142 3300005547 Bacteria 32335
162 Ga0070693_100021718 3300005547 Bacteria 3403
163 Ga0070665_100000044 3300005548 Bacteria 276702
164 Ga0070665_100000254 3300005548 Bacteria 88587
165 Ga0070665_100000511 3300005548 Bacteria 55709
166 Ga0070665_100000528 3300005548 Bacteria 53961
167 Ga0070665_100000531 3300005548 Bacteria 53926
168 Ga0070665_100000634 3300005548 Bacteria 47873
169 Ga0070665_100004137 3300005548 Bacteria 15260
170 Ga0070665_100009476 3300005548 Bacteria 9852
171 Ga0070665_100023751 3300005548 Bacteria 6176
172 Ga0070665_100028884 3300005548 Bacteria 5582
173 Ga0070665_100034620 3300005548 Bacteria 5079
174 Ga0070665_100071442 3300005548 Bacteria 3477
175 Ga0070665_100085282 3300005548 Bacteria 3163
176 Ga0070665_100089808 3300005548 Bacteria 3078
177 Ga0068855_100000745 3300005563 Bacteria 40001
178 Ga0068855_100008164 3300005563 Bacteria 12656
179 Ga0068855_100016149 3300005563 Bacteria 8976
180 Ga0068855_100021266 3300005563 Bacteria 7779
181 Ga0068855_100154338 3300005563 Bacteria 2609
182 Ga0070664_100000153 3300005564 Bacteria 47344
183 Ga0070664_100001180 3300005564 Bacteria 20792
184 Ga0070664_100007769 3300005564 Bacteria 8658
185 Ga0070664_100015803 3300005564 Bacteria 6179
186 Ga0070664_100037496 3300005564 Bacteria 4076
187 Ga0070664_100063739 3300005564 Bacteria 3142
188 Ga0068857_100007788 3300005577 Bacteria 9233
189 Ga0068857_100054112 3300005577 Bacteria 3561
190 Ga0068857_100066729 3300005577 Bacteria 3202
191 Ga0068854_100007709 3300005578 Bacteria 6883
192 Ga0068854_100025211 3300005578 Bacteria 4080
193 Ga0068854_100057460 3300005578 Bacteria 2806
194 Ga0068854_100101323 3300005578 Bacteria 2159
195 Ga0068856_100000177 3300005614 Bacteria 66207
196 Ga0068856_100000870 3300005614 Bacteria 32355
197 Ga0068856_100006572 3300005614 Bacteria 11403
198 Ga0068856_100015519 3300005614 Bacteria 7363
199 Ga0068852_100000075 3300005616 Bacteria 69379
200 Ga0068852_100000831 3300005616 Bacteria 20424
201 Ga0068852_100001121 3300005616 Bacteria 17696
202 Ga0068852_100015314 3300005616 Bacteria 5939
203 Ga0068852_100069059 3300005616 Bacteria 3095
204 Ga0068852_100071681 3300005616 Bacteria 3043
205 Ga0068852_100096354 3300005616 Bacteria 2659
206 Ga0068852_100110266 3300005616 Bacteria 2501
207 Ga0068859_100000194 3300005617 Bacteria 59075
208 Ga0068859_100000221 3300005617 Bacteria 56589
209 Ga0068859_100004830 3300005617 Bacteria 13721
210 Ga0068859_100017508 3300005617 Bacteria 7203
211 Ga0068859_100018251 3300005617 Bacteria 7053
212 Ga0068864_100000261 3300005618 Bacteria 47015
213 Ga0068864_100000721 3300005618 Bacteria 27640
214 Ga0068864_100001983 3300005618 Bacteria 16849
215 Ga0068864_100004528 3300005618 Bacteria 11411
216 Ga0068864_100020487 3300005618 Bacteria 5533
217 Ga0068864_100031594 3300005618 Bacteria 4493
218 Ga0068864_100047108 3300005618 Bacteria 3701
219 Ga0068861_100000198 3300005719 Bacteria 32191
220 Ga0068861_100005126 3300005719 Bacteria 8834
221 Ga0068861_100051612 3300005719 Bacteria 3122
222 Ga0068851_10002496 3300005834 Bacteria 8088
223 Ga0068851_10003867 3300005834 Bacteria 6705
224 Ga0068851_10014509 3300005834 Bacteria 3742
225 Ga0068863_100000020 3300005841 Bacteria 198519
226 Ga0068863_100000052 3300005841 Bacteria 125430
227 Ga0068863_100000775 3300005841 Bacteria 32088
228 Ga0068863_100001823 3300005841 Bacteria 21161
229 Ga0068863_100003774 3300005841 Bacteria 14981
230 Ga0068863_100008573 3300005841 Bacteria 9990
231 Ga0068863_100010798 3300005841 Bacteria 8856
232 Ga0068863_100012736 3300005841 Bacteria 8111
233 Ga0068858_100000530 3300005842 Bacteria 39968
234 Ga0068858_100000919 3300005842 Bacteria 30552
235 Ga0068858_100001368 3300005842 Bacteria 25138
236 Ga0068858_100002958 3300005842 Bacteria 17069
237 Ga0068858_100004078 3300005842 Bacteria 14394
238 Ga0068858_100004134 3300005842 Bacteria 14284
239 Ga0068858_100011992 3300005842 Bacteria 8170
240 Ga0068858_100017450 3300005842 Bacteria 6733
241 Ga0068858_100032886 3300005842 Bacteria 4816
242 Ga0068860_100000007 3300005843 Bacteria 429329
243 Ga0068860_100000080 3300005843 Bacteria 170152
244 Ga0068860_100000437 3300005843 Bacteria 52907
245 Ga0068860_100000867 3300005843 Bacteria 33656
246 Ga0068860_100005984 3300005843 Bacteria 12245
247 Ga0068860_100023975 3300005843 Bacteria 5898
248 Ga0068862_100000115 3300005844 Bacteria 94951
249 Ga0068862_100000135 3300005844 Bacteria 85248
250 Ga0068862_100000340 3300005844 Bacteria 50605
251 Ga0068862_100004671 3300005844 Bacteria 11530
252 Ga0068862_100019812 3300005844 Bacteria 5618
253 Ga0068862_100023550 3300005844 Bacteria 5161
254 Ga0068862_100038653 3300005844 Bacteria 4048
255 Ga0081455_10000545 3300005937 Bacteria 48941
256 Ga0081539_10018932 3300005985 Bacteria 4743
257 Ga0081539_10042244 3300005985 Bacteria 2658
258 Ga0075368_10000066 3300006042 Bacteria 25572
259 Ga0075364_10003309 3300006051 Bacteria 9139
260 Ga0075432_10005555 3300006058 Bacteria 4294
261 Ga0075362_10000083 3300006177 Bacteria 26049
262 Ga0075362_10000203 3300006177 Bacteria 16577
263 Ga0075367_10002111 3300006178 Bacteria 8929
264 Ga0075366_10001643 3300006195 Bacteria 11223
265 Ga0075366_10002219 3300006195 Bacteria 9909
266 Ga0097621_100012370 3300006237 Bacteria 6323
267 Ga0097621_100021964 3300006237 Bacteria 4946
268 Ga0097621_100025480 3300006237 Bacteria 4629
269 Ga0075370_10000017 3300006353 Bacteria 60451
270 Ga0075370_10003828 3300006353 Bacteria 7195
271 Ga0075370_10008260 3300006353 Bacteria 5347
272 Ga0068871_100010804 3300006358 Bacteria 6681
273 Ga0068871_100017472 3300006358 Bacteria 5429
274 Ga0075431_100121713 3300006847 Bacteria 2693
275 Ga0097620_100000194 3300006931 Bacteria 59075
276 Ga0097620_100000221 3300006931 Bacteria 56589
277 Ga0097620_100004830 3300006931 Bacteria 13721
278 Ga0097620_100017509 3300006931 Bacteria 7203
279 Ga0097620_100018253 3300006931 Bacteria 7053
280 Ga0105251_10003099 3300009011 Bacteria 12358
281 Ga0105251_10030588 3300009011 Bacteria 2702
282 Ga0105240_10016986 3300009093 Bacteria 9830
283 Ga0105240_10077983 3300009093 Bacteria 4081
284 Ga0105240_10093586 3300009093 Bacteria 3668
285 Ga0105245_10000433 3300009098 Bacteria 38731
286 Ga0105245_10005439 3300009098 Bacteria 11188
287 Ga0105245_10040803 3300009098 Bacteria 4136
288 Ga0105247_10020284 3300009101 Bacteria 3997
289 Ga0114129_10074815 3300009147 Bacteria 4717
290 Ga0105243_10000038 3300009148 Bacteria 174351
291 Ga0105248_10000442 3300009177 Bacteria 47089
292 Ga0105248_10000502 3300009177 Bacteria 44596
293 Ga0105248_10000604 3300009177 Bacteria 40877
294 Ga0105248_10000801 3300009177 Bacteria 35327
295 Ga0105248_10003885 3300009177 Bacteria 16517
296 Ga0105248_10009214 3300009177 Bacteria 10858
297 Ga0105248_10104307 3300009177 Bacteria 3196
298 Ga0105237_10106751 3300009545 Bacteria 2792
299 Ga0105238_10004331 3300009551 Bacteria 14084
300 Ga0105238_10023652 3300009551 Bacteria 6260
301 Ga0105249_10000064 3300009553 Bacteria 151646
302 Ga0105249_10000097 3300009553 Bacteria 120886
303 Ga0105249_10002825 3300009553 Bacteria 14980
304 Ga0105249_10018924 3300009553 Bacteria 6138
305 Ga0157371_10000146 3300013102 Bacteria 103290
306 Ga0157371_10073407 3300013102 Bacteria 2423
307 Ga0157370_10017554 3300013104 Bacteria 7219
308 Ga0157369_10021850 3300013105 Bacteria 7152
309 Ga0157369_10056748 3300013105 Bacteria 4225
310 Ga0157369_10069699 3300013105 Bacteria 3778
311 Ga0157369_10094835 3300013105 Bacteria 3185
312 Ga0157369_10105813 3300013105 Bacteria 2995
313 Ga0157374_10101468 3300013296 Bacteria 2759
314 Ga0157378_10011418 3300013297 Bacteria 7776
315 Ga0157378_10021971 3300013297 Bacteria 5611
316 Ga0163162_10014045 3300013306 Bacteria 7827
317 Ga0163162_10086284 3300013306 Bacteria 3216
318 Ga0163162_10098967 3300013306 Bacteria 3006
319 Ga0157372_10066187 3300013307 Bacteria 4059
320 Ga0157375_10083746 3300013308 Bacteria 3235
321 Ga0163163_10000164 3300014325 Bacteria 69244
322 Ga0163163_10001448 3300014325 Bacteria 20044
323 Ga0163163_10004133 3300014325 Bacteria 12362
324 Ga0163163_10031150 3300014325 Bacteria 5146
325 Ga0157380_10000086 3300014326 Bacteria 51604
326 Ga0157380_10000723 3300014326 Bacteria 20585
327 Ga0157379_10002697 3300014968 Bacteria 14964
328 Ga0157379_10004711 3300014968 Bacteria 11712
329 Ga0157379_10027193 3300014968 Bacteria 5093
330 Ga0157379_10089995 3300014968 Bacteria 2753
331 Ga0157376_10035122 3300014969 Bacteria 4053
332 Ga0163161_10000110 3300017792 Bacteria 78102
333 Ga0163161_10001335 3300017792 Bacteria 18330
334 Ga0213873_10000007 3300021358 Bacteria 309961
335 Ga0213876_10000005 3300021384 Bacteria 727326
336 Ga0213876_10000336 3300021384 Bacteria 40986
337 Ga0213875_10000105 3300021388 Bacteria 96051
338 Ga0209563_100019 3300025230 Bacteria 697828
339 Ga0209148_1000017 3300025254 Bacteria 787064
340 Ga0209233_1000414 3300025261 Bacteria 32922
341 Ga0209455_1000005 3300025272 Bacteria 1416756
342 Ga0209455_1009979 3300025272 Bacteria 2450
343 Ga0209675_1000076 3300025291 Bacteria 159428
344 Ga0209676_1000070 3300025292 Bacteria 312074
345 Ga0209676_1000454 3300025292 Bacteria 69136
346 Ga0209676_1000637 3300025292 Bacteria 50380
347 Ga0209758_1000035 3300025297 Bacteria 448190
348 Ga0209050_1000042 3300025298 Bacteria 402842
349 Ga0209050_1000929 3300025298 Bacteria 38383
350 Ga0209257_1000285 3300025304 Bacteria 112113
351 Ga0209257_1001860 3300025304 Bacteria 22903
352 Ga0209257_1002873 3300025304 Bacteria 16051
353 Ga0207697_10000215 3300025315 Bacteria 30925
354 Ga0207697_10000296 3300025315 Bacteria 27773
355 Ga0207656_10001865 3300025321 Bacteria 7011
356 Ga0207656_10005012 3300025321 Bacteria 4654
357 Ga0207656_10020325 3300025321 Bacteria 2638
358 Ga0207713_1007781 3300025735 Bacteria 6256
359 Ga0207682_10000194 3300025893 Bacteria 27727
360 Ga0207682_10000643 3300025893 Bacteria 16285
361 Ga0207682_10017553 3300025893 Bacteria 2795
362 Ga0207710_10001018 3300025900 Bacteria 14639
363 Ga0207680_10000009 3300025903 Bacteria 464571
364 Ga0207680_10000166 3300025903 Bacteria 32189
365 Ga0207680_10005824 3300025903 Bacteria 5915
366 Ga0207680_10069316 3300025903 Bacteria 2179
367 Ga0207647_10000684 3300025904 Bacteria 26599
368 Ga0207647_10000986 3300025904 Bacteria 22064
369 Ga0207647_10003840 3300025904 Bacteria 11240
370 Ga0207647_10006533 3300025904 Bacteria 8472
371 Ga0207647_10007669 3300025904 Bacteria 7776
372 Ga0207647_10016359 3300025904 Bacteria 5064
373 Ga0207647_10036609 3300025904 Bacteria 3117
374 Ga0207645_10008483 3300025907 Bacteria 7167
375 Ga0207645_10030311 3300025907 Bacteria 3485
376 Ga0207645_10038553 3300025907 Bacteria 3064
377 Ga0207705_10000002 3300025909 Bacteria 2046852
378 Ga0207705_10000075 3300025909 Bacteria 123551
379 Ga0207705_10000174 3300025909 Bacteria 68260
380 Ga0207705_10000220 3300025909 Bacteria 56835
381 Ga0207705_10012782 3300025909 Bacteria 6060
382 Ga0207705_10014602 3300025909 Bacteria 5652
383 Ga0207705_10038837 3300025909 Bacteria 3410
384 Ga0207705_10086640 3300025909 Bacteria 2289
385 Ga0207707_10032753 3300025912 Bacteria 4549
386 Ga0207707_10080911 3300025912 Bacteria 2836
387 Ga0207695_10003071 3300025913 Bacteria 23930
388 Ga0207695_10006373 3300025913 Bacteria 15352
389 Ga0207695_10017590 3300025913 Bacteria 8308
390 Ga0207695_10100964 3300025913 Bacteria 2880
391 Ga0207671_10001965 3300025914 Bacteria 22681
392 Ga0207671_10011180 3300025914 Bacteria 7328
393 Ga0207671_10027346 3300025914 Bacteria 4265
394 Ga0207660_10000692 3300025917 Bacteria 22532
395 Ga0207660_10006353 3300025917 Bacteria 7661
396 Ga0207660_10009765 3300025917 Bacteria 6212
397 Ga0207660_10033018 3300025917 Bacteria 3576
398 Ga0207660_10049935 3300025917 Bacteria 2969
399 Ga0207657_10000173 3300025919 Bacteria 66220
400 Ga0207657_10000262 3300025919 Bacteria 55933
401 Ga0207657_10002388 3300025919 Bacteria 20300
402 Ga0207657_10003423 3300025919 Bacteria 16942
403 Ga0207657_10005157 3300025919 Bacteria 13704
404 Ga0207657_10008356 3300025919 Bacteria 10511
405 Ga0207657_10054380 3300025919 Bacteria 3462
406 Ga0207657_10076385 3300025919 Bacteria 2826
407 Ga0207657_10100930 3300025919 Bacteria 2395
408 Ga0207649_10000014 3300025920 Bacteria 255001
409 Ga0207649_10000055 3300025920 Bacteria 103054
410 Ga0207649_10000365 3300025920 Bacteria 33919
411 Ga0207649_10004475 3300025920 Bacteria 7584
412 Ga0207649_10025609 3300025920 Bacteria 3441
413 Ga0207649_10026407 3300025920 Bacteria 3397
414 Ga0207649_10032471 3300025920 Bacteria 3112
415 Ga0207652_10000004 3300025921 Bacteria 436303
416 Ga0207652_10004551 3300025921 Bacteria 11254
417 Ga0207681_10000002 3300025923 Bacteria 985597
418 Ga0207681_10000106 3300025923 Bacteria 71721
419 Ga0207681_10000174 3300025923 Bacteria 52934
420 Ga0207681_10034443 3300025923 Bacteria 3330
421 Ga0207694_10001479 3300025924 Bacteria 20088
422 Ga0207694_10021129 3300025924 Bacteria 4930
423 Ga0207694_10031031 3300025924 Bacteria 4081
424 Ga0207694_10036124 3300025924 Bacteria 3791
425 Ga0207650_10001849 3300025925 Bacteria 14923
426 Ga0207650_10005752 3300025925 Bacteria 8457
427 Ga0207650_10008430 3300025925 Bacteria 7035
428 Ga0207650_10012125 3300025925 Bacteria 5941
429 Ga0207650_10019778 3300025925 Bacteria 4736
430 Ga0207650_10037075 3300025925 Bacteria 3551
431 Ga0207650_10063445 3300025925 Bacteria 2762
432 Ga0207687_10045967 3300025927 Bacteria 3020
433 Ga0207687_10050169 3300025927 Bacteria 2904
434 Ga0207687_10101647 3300025927 Bacteria 2116
435 Ga0207664_10016602 3300025929 Bacteria 5376
436 Ga0207664_10094032 3300025929 Bacteria 2463
437 Ga0207644_10000002 3300025931 Bacteria 942221
438 Ga0207644_10000003 3300025931 Bacteria 585905
439 Ga0207644_10000061 3300025931 Bacteria 79079
440 Ga0207644_10000456 3300025931 Bacteria 26391
441 Ga0207644_10000530 3300025931 Bacteria 24696
442 Ga0207644_10000616 3300025931 Bacteria 22668
443 Ga0207644_10000919 3300025931 Bacteria 18675
444 Ga0207644_10002341 3300025931 Bacteria 12242
445 Ga0207644_10004475 3300025931 Bacteria 9075
446 Ga0207644_10015164 3300025931 Bacteria 5170
447 Ga0207644_10016202 3300025931 Bacteria 5015
448 Ga0207644_10035745 3300025931 Bacteria 3483
449 Ga0207644_10037956 3300025931 Bacteria 3391
450 Ga0207644_10045671 3300025931 Bacteria 3117
451 Ga0207690_10000051 3300025932 Bacteria 107367
452 Ga0207690_10000150 3300025932 Bacteria 55157
453 Ga0207690_10002274 3300025932 Bacteria 11712
454 Ga0207690_10006008 3300025932 Bacteria 7194
455 Ga0207690_10010440 3300025932 Bacteria 5519
456 Ga0207690_10036104 3300025932 Bacteria 3198
457 Ga0207690_10066241 3300025932 Bacteria 2473
458 Ga0207690_10069184 3300025932 Bacteria 2428
459 Ga0207706_10000103 3300025933 Bacteria 89756
460 Ga0207706_10000459 3300025933 Bacteria 43399
461 Ga0207706_10000479 3300025933 Bacteria 42802
462 Ga0207706_10004155 3300025933 Bacteria 13646
463 Ga0207706_10013288 3300025933 Bacteria 7490
464 Ga0207709_10000031 3300025935 Bacteria 329046
465 Ga0207669_10000057 3300025937 Bacteria 56270
466 Ga0207669_10008227 3300025937 Bacteria 4887
467 Ga0207669_10017984 3300025937 Bacteria 3641
468 Ga0207669_10065892 3300025937 Bacteria 2249
469 Ga0207704_10008556 3300025938 Bacteria 4899
470 Ga0207691_10001051 3300025940 Bacteria 27433
471 Ga0207691_10001329 3300025940 Bacteria 24679
472 Ga0207691_10015613 3300025940 Bacteria 7219
473 Ga0207691_10062346 3300025940 Bacteria 3383
474 Ga0207711_10000042 3300025941 Bacteria 158782
475 Ga0207711_10000526 3300025941 Bacteria 39259
476 Ga0207711_10001142 3300025941 Bacteria 25262
477 Ga0207711_10001694 3300025941 Bacteria 20284
478 Ga0207711_10002857 3300025941 Bacteria 15139
479 Ga0207711_10004897 3300025941 Bacteria 11367
480 Ga0207711_10014914 3300025941 Bacteria 6455
481 Ga0207711_10025172 3300025941 Bacteria 4993
482 Ga0207689_10018710 3300025942 Bacteria 5842
483 Ga0207661_10019846 3300025944 Bacteria 5015
484 Ga0207661_10032507 3300025944 Bacteria 4042
485 Ga0207679_10000874 3300025945 Bacteria 19215
486 Ga0207679_10004310 3300025945 Bacteria 8850
487 Ga0207679_10006770 3300025945 Bacteria 7260
488 Ga0207679_10017921 3300025945 Bacteria 4732
489 Ga0207667_10000552 3300025949 Bacteria 49276
490 Ga0207667_10001537 3300025949 Bacteria 29015
491 Ga0207667_10008643 3300025949 Bacteria 12077
492 Ga0207667_10015289 3300025949 Bacteria 8725
493 Ga0207667_10018486 3300025949 Bacteria 7814
494 Ga0207667_10069479 3300025949 Bacteria 3666
495 Ga0207667_10115870 3300025949 Bacteria 2762
496 Ga0207651_10002050 3300025960 Bacteria 9483
497 Ga0207651_10004326 3300025960 Bacteria 7133
498 Ga0207651_10005791 3300025960 Bacteria 6382
499 Ga0207651_10029392 3300025960 Bacteria 3481
500 Ga0207651_10049091 3300025960 Bacteria 2857
501 Ga0207712_10000044 3300025961 Bacteria 171240
502 Ga0207712_10000074 3300025961 Bacteria 120822
503 Ga0207712_10001308 3300025961 Bacteria 17062
504 Ga0207712_10001774 3300025961 Bacteria 14378
505 Ga0207668_10000085 3300025972 Bacteria 70401
506 Ga0207668_10002722 3300025972 Bacteria 10347
507 Ga0207668_10040021 3300025972 Bacteria 3159
508 Ga0207640_10000996 3300025981 Bacteria 15684
509 Ga0207640_10007677 3300025981 Bacteria 5961
510 Ga0207640_10054718 3300025981 Bacteria 2610
511 Ga0207658_10000340 3300025986 Bacteria 46680
512 Ga0207658_10000381 3300025986 Bacteria 43297
513 Ga0207658_10001750 3300025986 Bacteria 16338
514 Ga0207658_10001909 3300025986 Bacteria 15589
515 Ga0207658_10007570 3300025986 Bacteria 7396
516 Ga0207658_10007960 3300025986 Bacteria 7218
517 Ga0207658_10010162 3300025986 Bacteria 6397
518 Ga0207658_10010577 3300025986 Bacteria 6269
519 Ga0207658_10013379 3300025986 Bacteria 5604
520 Ga0207658_10021015 3300025986 Bacteria 4525
521 Ga0207677_10000013 3300026023 Bacteria 186519
522 Ga0207677_10001135 3300026023 Bacteria 14530
523 Ga0207677_10001325 3300026023 Bacteria 13285
524 Ga0207677_10006612 3300026023 Bacteria 6360
525 Ga0207703_10000484 3300026035 Bacteria 41489
526 Ga0207703_10002018 3300026035 Bacteria 17909
527 Ga0207703_10002526 3300026035 Bacteria 15808
528 Ga0207703_10003985 3300026035 Bacteria 12235
529 Ga0207703_10005559 3300026035 Bacteria 10116
530 Ga0207703_10011932 3300026035 Bacteria 6767
531 Ga0207703_10012583 3300026035 Bacteria 6595
532 Ga0207703_10026625 3300026035 Bacteria 4553
533 Ga0207703_10038745 3300026035 Bacteria 3806
534 Ga0207639_10000393 3300026041 Bacteria 30170
535 Ga0207639_10001063 3300026041 Bacteria 18630
536 Ga0207639_10001152 3300026041 Bacteria 17962
537 Ga0207639_10008338 3300026041 Bacteria 7102
538 Ga0207639_10032359 3300026041 Bacteria 3849
539 Ga0207639_10040928 3300026041 Bacteria 3463
540 Ga0207639_10065717 3300026041 Bacteria 2816
541 Ga0207678_10008943 3300026067 Bacteria 8819
542 Ga0207678_10010290 3300026067 Bacteria 8210
543 Ga0207678_10010565 3300026067 Bacteria 8111
544 Ga0207678_10070194 3300026067 Bacteria 3004
545 Ga0207702_10001262 3300026078 Bacteria 25506
546 Ga0207702_10001379 3300026078 Bacteria 24214
547 Ga0207702_10003005 3300026078 Bacteria 15678
548 Ga0207702_10005295 3300026078 Bacteria 11316
549 Ga0207702_10007361 3300026078 Bacteria 9400
550 Ga0207641_10000001 3300026088 Bacteria 1180841
551 Ga0207641_10000042 3300026088 Bacteria 186384
552 Ga0207641_10000415 3300026088 Bacteria 49760
553 Ga0207641_10005614 3300026088 Bacteria 10688
554 Ga0207641_10005984 3300026088 Bacteria 10308
555 Ga0207641_10009236 3300026088 Bacteria 8131
556 Ga0207641_10013949 3300026088 Bacteria 6589
557 Ga0207641_10019191 3300026088 Bacteria 5609
558 Ga0207641_10021901 3300026088 Bacteria 5254
559 Ga0207641_10023713 3300026088 Bacteria 5055
560 Ga0207641_10048153 3300026088 Bacteria 3597
561 Ga0207648_10001953 3300026089 Bacteria 22530
562 Ga0207648_10005222 3300026089 Bacteria 13134
563 Ga0207648_10009147 3300026089 Bacteria 9522
564 Ga0207676_10000456 3300026095 Bacteria 34458
565 Ga0207676_10002207 3300026095 Bacteria 14055
566 Ga0207676_10003783 3300026095 Bacteria 10696
567 Ga0207676_10003902 3300026095 Bacteria 10534
568 Ga0207676_10004793 3300026095 Bacteria 9599
569 Ga0207676_10010113 3300026095 Bacteria 6714
570 Ga0207676_10025535 3300026095 Bacteria 4383
571 Ga0207676_10026126 3300026095 Bacteria 4340
572 Ga0207676_10030259 3300026095 Bacteria 4062
573 Ga0207674_10000283 3300026116 Bacteria 64153
574 Ga0207674_10000632 3300026116 Bacteria 45854
575 Ga0207674_10002193 3300026116 Bacteria 24722
576 Ga0207674_10002478 3300026116 Bacteria 23285
577 Ga0207674_10004313 3300026116 Bacteria 17140
578 Ga0207674_10004629 3300026116 Bacteria 16511
579 Ga0207674_10031182 3300026116 Bacteria 5602
580 Ga0207674_10043855 3300026116 Bacteria 4610
581 Ga0207674_10108865 3300026116 Bacteria 2747
582 Ga0207674_10173638 3300026116 Bacteria 2108
583 Ga0207675_100000169 3300026118 Bacteria 58328
584 Ga0207675_100000207 3300026118 Bacteria 54791
585 Ga0207675_100000671 3300026118 Bacteria 33681
586 Ga0207683_10003996 3300026121 Bacteria 12787
587 Ga0207683_10004793 3300026121 Bacteria 11648
588 Ga0207698_10000005 3300026142 Bacteria 295687
589 Ga0207698_10000457 3300026142 Bacteria 23684
590 Ga0207698_10010915 3300026142 Bacteria 5867
591 Ga0207698_10019069 3300026142 Bacteria 4687
592 Ga0207698_10022589 3300026142 Bacteria 4375
593 Ga0207698_10029001 3300026142 Bacteria 3957
594 Ga0207698_10051140 3300026142 Bacteria 3157
595 Ga0207698_10091496 3300026142 Bacteria 2490
596 Ga0209813_10000402 3300027866 Bacteria 10625
597 Ga0209974_10006875 3300027876 Bacteria 3947
598 Ga0268266_10000002 3300028379 Bacteria 3059047
599 Ga0268266_10000069 3300028379 Bacteria 239714
600 Ga0268266_10000187 3300028379 Bacteria 110229
601 Ga0268266_10000215 3300028379 Bacteria 100801
602 Ga0268266_10000518 3300028379 Bacteria 54434
603 Ga0268266_10002822 3300028379 Bacteria 18125
604 Ga0268266_10003658 3300028379 Bacteria 15192
605 Ga0268266_10017014 3300028379 Bacteria 6212
606 Ga0268266_10019148 3300028379 Bacteria 5829
607 Ga0268266_10033464 3300028379 Bacteria 4369
608 Ga0268265_10000100 3300028380 Bacteria 108659
609 Ga0268265_10000152 3300028380 Bacteria 85229
610 Ga0268265_10000241 3300028380 Bacteria 62423
611 Ga0268265_10002755 3300028380 Bacteria 12978
612 Ga0268265_10007193 3300028380 Bacteria 7521
613 Ga0268265_10016778 3300028380 Bacteria 5040
614 Ga0268265_10025502 3300028380 Bacteria 4198
615 Ga0268265_10032662 3300028380 Bacteria 3774
616 Ga0268265_10046685 3300028380 Bacteria 3239
617 Ga0268265_10087442 3300028380 Bacteria 2479
618 Ga0268264_10000010 3300028381 Bacteria 596543
619 Ga0268264_10000131 3300028381 Bacteria 181459
620 Ga0268264_10000134 3300028381 Bacteria 179475
621 Ga0268264_10000710 3300028381 Bacteria 38345
622 Ga0268264_10001517 3300028381 Bacteria 21645
623 Ga0268264_10001849 3300028381 Bacteria 19271
624 Ga0268264_10011515 3300028381 Bacteria 7306
625 Ga0268264_10021234 3300028381 Bacteria 5304
626 Ga0268264_10035064 3300028381 Bacteria 4131
627 Ga0307517_10026378 3300028786 Bacteria 7045
628 Ga0307513_10004225 3300031456 Bacteria 19204
629 Ga0307408_100005051 3300031548 Bacteria 8852
630 Ga0307408_100035206 3300031548 Bacteria 3512
631 Ga0307408_100042401 3300031548 Bacteria 3232
632 Ga0307508_10000479 3300031616 Bacteria 48265
633 Ga0307508_10008321 3300031616 Bacteria 9593
634 Ga0307405_10007070 3300031731 Bacteria 5579
635 Ga0307405_10009125 3300031731 Bacteria 5072
636 Ga0307405_10011231 3300031731 Bacteria 4682
637 Ga0307405_10027898 3300031731 Bacteria 3281
638 Ga0307413_10002207 3300031824 Bacteria 7836
639 Ga0307410_10004659 3300031852 Bacteria 7126
640 Ga0307410_10006077 3300031852 Bacteria 6474
641 Ga0307410_10009323 3300031852 Bacteria 5499
642 Ga0307410_10010561 3300031852 Bacteria 5238
643 Ga0307410_10010875 3300031852 Bacteria 5181
644 Ga0307410_10017255 3300031852 Bacteria 4329
645 Ga0307410_10045348 3300031852 Bacteria 2926
646 Ga0307410_10066360 3300031852 Bacteria 2485
647 Ga0307410_10075233 3300031852 Bacteria 2354
648 Ga0307406_10005488 3300031901 Bacteria 6939
649 Ga0307406_10025358 3300031901 Bacteria 3549
650 Ga0307406_10071997 3300031901 Bacteria 2267
651 Ga0307407_10035879 3300031903 Bacteria 2727
652 Ga0307412_10006578 3300031911 Bacteria 6581
653 Ga0307412_10007459 3300031911 Bacteria 6205
654 Ga0307412_10020528 3300031911 Bacteria 4022
655 Ga0307412_10030265 3300031911 Bacteria 3406
656 Ga0307412_10043661 3300031911 Bacteria 2920
657 Ga0307409_100007554 3300031995 Bacteria 6514
658 Ga0307409_100050467 3300031995 Bacteria 3177
659 Ga0307409_100063402 3300031995 Bacteria 2898
660 Ga0307409_100069309 3300031995 Bacteria 2793
661 Ga0307409_100075339 3300031995 Bacteria 2701
662 Ga0307409_100083438 3300031995 Bacteria 2591
663 Ga0307409_100147381 3300031995 Bacteria 2037
664 Ga0307416_100004453 3300032002 Bacteria 8447
665 Ga0307416_100056406 3300032002 Bacteria 3170
666 Ga0307416_100129765 3300032002 Bacteria 2266
667 Ga0307414_10001217 3300032004 Bacteria 13256
668 Ga0307414_10002805 3300032004 Bacteria 9179
669 Ga0307414_10004094 3300032004 Bacteria 7868
670 Ga0307414_10010149 3300032004 Bacteria 5449
671 Ga0307414_10016511 3300032004 Bacteria 4490
672 Ga0307414_10034082 3300032004 Bacteria 3371
673 Ga0307414_10037112 3300032004 Bacteria 3260
674 Ga0307414_10083811 3300032004 Bacteria 2342
675 Ga0307411_10001507 3300032005 Bacteria 9583
676 Ga0307411_10001967 3300032005 Bacteria 8805
677 Ga0307411_10005401 3300032005 Bacteria 6272
678 Ga0307411_10009354 3300032005 Bacteria 5146
679 Ga0307411_10013451 3300032005 Bacteria 4516
680 Ga0307411_10016664 3300032005 Bacteria 4163
681 Ga0307411_10023501 3300032005 Bacteria 3653
682 Ga0307411_10045292 3300032005 Bacteria 2829
683 Ga0307415_100000799 3300032126 Bacteria 14309
684 Ga0307415_100002317 3300032126 Bacteria 9455
685 Ga0307415_100009039 3300032126 Bacteria 5560
686 Ga0307415_100029131 3300032126 Bacteria 3524
687 Ga0307415_100031045 3300032126 Bacteria 3437
688 Ga0307415_100034705 3300032126 Bacteria 3288
689 Ga0373943_0034418 3300035170 Bacteria 2416
690 Ga0373931_0049228 3300035691 Bacteria 2237
691 Ga0316582_0019261 3300036647 Bacteria 3990
692 Ga0395899_0000691 3300037312 Bacteria 33969
693 Ga0395899_0000936 3300037312 Bacteria 27504
694 Ga0395899_0006865 3300037312 Bacteria 8818
695 Ga0395899_0020623 3300037312 Bacteria 4996
696 Ga0395899_0022042 3300037312 Bacteria 4830
697 Ga0395899_0032052 3300037312 Bacteria 3947
698 Ga0395899_0050993 3300037312 Bacteria 3072
699 Ga0395900_0000316 3300037418 Bacteria 71497
700 Ga0395900_0000902 3300037418 Bacteria 39078
701 Ga0395900_0006286 3300037418 Bacteria 12391
702 Ga0395900_0006902 3300037418 Bacteria 11783
703 Ga0395900_0013536 3300037418 Bacteria 8333
704 Ga0395900_0014211 3300037418 Bacteria 8127
705 Ga0395900_0020006 3300037418 Bacteria 6824
706 Ga0395900_0020055 3300037418 Bacteria 6818
707 Ga0395900_0024222 3300037418 Bacteria 6214
708 Ga0395900_0035040 3300037418 Bacteria 5169
709 Ga0395900_0041989 3300037418 Bacteria 4712
710 Ga0395900_0048835 3300037418 Bacteria 4358
711 Ga0395900_0058611 3300037418 Bacteria 3964
712 Ga0395900_0066890 3300037418 Bacteria 3693
713 Ga0395900_0073751 3300037418 Bacteria 3509
714 Ga0395900_0077014 3300037418 Bacteria 3427
715 Ga0395900_0163801 3300037418 Bacteria 2267
716 Ga0395900_0165863 3300037418 Bacteria 2251
717 Ga0395900_0183529 3300037418 Bacteria 2124
718 Ga0395900_0189156 3300037418 Bacteria 2089
719 Ga0395898_0000192 3300037466 Bacteria 156121
720 Ga0395898_0001190 3300037466 Bacteria 39469
721 Ga0395898_0002752 3300037466 Bacteria 20261
722 Ga0395898_0034317 3300037466 Bacteria 5057
723 Ga0395898_0057225 3300037466 Bacteria 3800
724 Ga0395898_0077797 3300037466 Bacteria 3202
725 Ga0395898_0108699 3300037466 Bacteria 2659
726 Ga0395905_0000066 3300037471 Bacteria 183121
727 Ga0395905_0000916 3300037471 Bacteria 38099
728 Ga0395905_0001950 3300037471 Bacteria 23641
729 Ga0395905_0002085 3300037471 Bacteria 22730
730 Ga0395905_0002298 3300037471 Bacteria 21443
731 Ga0395905_0014596 3300037471 Bacteria 7493
732 Ga0395905_0023489 3300037471 Bacteria 5824
733 Ga0395905_0027904 3300037471 Bacteria 5322
734 Ga0395905_0028256 3300037471 Bacteria 5287
735 Ga0395905_0033675 3300037471 Bacteria 4811
736 Ga0395905_0036693 3300037471 Bacteria 4604
737 Ga0395905_0037639 3300037471 Bacteria 4541
738 Ga0395905_0081710 3300037471 Bacteria 3028
739 Ga0395905_0087525 3300037471 Bacteria 2920
740 Ga0395905_0106829 3300037471 Bacteria 2628
741 Ga0395905_0130752 3300037471 Bacteria 2361
742 Ga0395905_0145437 3300037471 Bacteria 2230
743 Ga0436364_0184827 3300037853 Bacteria 146498
744 Ga0395901_0000203 3300038443 Bacteria 74605
745 Ga0395901_0000232 3300038443 Bacteria 69963
746 Ga0395901_0000468 3300038443 Bacteria 46939
747 Ga0395901_0003002 3300038443 Bacteria 17020
748 Ga0395901_0006424 3300038443 Bacteria 11912
749 Ga0395901_0007762 3300038443 Bacteria 10825
750 Ga0395901_0018702 3300038443 Bacteria 7076
751 Ga0395901_0026159 3300038443 Bacteria 5991
752 Ga0395901_0051451 3300038443 Bacteria 4283
753 Ga0395901_0055613 3300038443 Bacteria 4115
754 Ga0395901_0060872 3300038443 Bacteria 3929
755 Ga0395901_0088978 3300038443 Bacteria 3230
756 Ga0395901_0096457 3300038443 Bacteria 3099
757 Ga0395901_0112625 3300038443 Bacteria 2857
758 Ga0395901_0117755 3300038443 Bacteria 2791
759 Ga0395901_0206534 3300038443 Bacteria 2057
760 Ga0436365_0393854 3300039437 Bacteria 34290
761 Ga0436365_0607739 3300039437 Bacteria 2110
762 Ga0436365_1728108 3300039437 Bacteria 56121
763 Ga0436362_0976836 3300039453 Bacteria 135942
764 Ga0439445_0000259 3300042004 Bacteria 10116
765 Ga0439448_0003663 3300042005 Bacteria 4278
766 Ga0439462_0000190 3300042015 Bacteria 10515
767 Ga0450912_000100 3300042116 Bacteria 3009
768 Ga0450905_000562 3300042142 Bacteria 4567
769 Ga0439458_0002875 3300042157 Bacteria 4140
770 Ga0439458_0003632 3300042157 Bacteria 3588
771 Ga0466969_0011914 3300044656 Bacteria 4597
772 Ga0466961_0039856 3300044693 Bacteria 3011
773 Ga0466963_0007220 3300044694 Bacteria 6624
774 Ga0466963_0041404 3300044694 Bacteria 3021
775 Ga0466963_0044084 3300044694 Bacteria 2935
776 Ga0453684_0122144 3300044712 Bacteria 3143
777 Ga0466971_0025269 3300044719 Bacteria 2652
778 Ga0466957_0013383 3300044842 Bacteria 4759
779 Ga0466957_0014646 3300044842 Bacteria 4569
780 Ga0466959_0025239 3300045049 Bacteria 4404
781 Ga0451576_0091666 3300045051 Bacteria 3161
782 Ga0466958_0001866 3300045836 Bacteria 10292
783 Ga0466958_0015322 3300045836 Bacteria 4391
784 Ga0466958_0072874 3300045836 Bacteria 2103
785 Ga0466967_0002854 3300045976 Bacteria 10973
786 Ga0466967_0005893 3300045976 Bacteria 8585
787 Ga0466967_0007661 3300045976 Bacteria 7817
788 Ga0466967_0028082 3300045976 Bacteria 4692
789 Ga0466967_0029613 3300045976 Bacteria 4584
790 Ga0466967_0057970 3300045976 Bacteria 3421
791 Ga0495627_000197 3300046453 Bacteria 66158
792 Ga0495638_0000980 3300046460 Bacteria 28747
793 Ga0495650_0000058 3300046471 Bacteria 302308
794 Ga0495650_0001171 3300046471 Bacteria 28029
795 Ga0495596_0000074 3300046500 Bacteria 70574
796 Ga0495583_0002103 3300046506 Bacteria 17916
797 Ga0495606_0001775 3300046507 Bacteria 27610
798 Ga0495610_0000022 3300046512 Bacteria 317107
799 Ga0495610_0002818 3300046512 Bacteria 14175
800 Ga0495620_0017337 3300046515 Bacteria 3592
801 Ga0495643_0001911 3300046522 Bacteria 17582
802 Ga0495643_0002032 3300046522 Bacteria 16834
803 Ga0495643_0016512 3300046522 Bacteria 4336
804 Ga0495643_0017609 3300046522 Bacteria 4172
805 Ga0495643_0019171 3300046522 Bacteria 3962
806 Ga0495648_0000698 3300046524 Bacteria 35854
807 Ga0495663_0000248 3300046525 Bacteria 21093
808 Ga0495663_0001615 3300046525 Bacteria 7046
809 Ga0495663_0002089 3300046525 Bacteria 6111
810 Ga0495642_0007434 3300046528 Bacteria 4198
811 Ga0495654_0000224 3300046530 Bacteria 52709
812 Ga0495598_0002444 3300046537 Bacteria 3841
813 Ga0495621_0000267 3300046539 Bacteria 12474
814 Ga0495621_0000754 3300046539 Bacteria 8186
815 Ga0495622_0006416 3300046557 Bacteria 5456
816 Ga0495633_0001330 3300046558 Bacteria 19396
817 Ga0495668_0000001 3300046616 Bacteria 1013420
818 Ga0495668_0000007 3300046616 Bacteria 552902
819 Ga0495668_0001200 3300046616 Bacteria 26319
820 Ga0495668_0014866 3300046616 Bacteria 4555
821 Ga0495625_0000167 3300046660 Bacteria 102783
822 Ga0495625_0000237 3300046660 Bacteria 86257
823 Ga0495625_0006053 3300046660 Bacteria 10857
824 Ga0495659_0007180 3300046664 Bacteria 3528
825 Ga0495661_0046112 3300046665 Bacteria 2663
826 Ga0495669_0000110 3300046684 Bacteria 52962
827 Ga0495669_0000854 3300046684 Bacteria 12893
828 Ga0495669_0001549 3300046684 Bacteria 9448
829 Ga0495669_0001606 3300046684 Bacteria 9276
830 Ga0495669_0003119 3300046684 Bacteria 6819
831 Ga0495670_0027880 3300046691 Bacteria 2799
832 Ga0495671_0017917 3300046692 Bacteria 3766
833 Ga0495600_0003414 3300046809 Bacteria 9341
834 Ga0495683_0007930 3300047323 Bacteria 5698
835 Ga0495687_000178 3300047443 Bacteria 93234
836 Ga0495687_000211 3300047443 Bacteria 83788
837 Ga0495681_0000123 3300047470 Bacteria 68069
838 Ga0495681_0002869 3300047470 Bacteria 12180
839 Ga0495686_0000191 3300047472 Bacteria 114738
840 Ga0495615_0000131 3300048090 Bacteria 18922
841 Ga0495626_0005587 3300048091 Bacteria 7295
842 Ga0496100_0009750 3300048903 Bacteria 5406
843 Ga0496100_0018618 3300048903 Bacteria 4123
844 Ga0496101_0017464 3300048904 Bacteria 4867
845 Ga0496101_0066423 3300048904 Bacteria 2631
846 Ga0496101_0073935 3300048904 Bacteria 2505
847 Ga0496102_0075802 3300048905 Bacteria 3092
848 Ga0496103_0016658 3300048906 Bacteria 4388
849 Ga0496103_0055116 3300048906 Bacteria 2465
850 Ga0496104_0017845 3300048907 Bacteria 6470
851 Ga0496104_0085174 3300048907 Bacteria 3016
852 Ga0496105_0000435 3300048908 Bacteria 27394
853 Ga0496105_0000866 3300048908 Bacteria 20693
854 Ga0496106_0004254 3300048909 Bacteria 10656
855 Ga0496106_0024444 3300048909 Bacteria 4492
856 Ga0496107_0001028 3300048910 Bacteria 16666
857 Ga0496107_0005617 3300048910 Bacteria 8589
858 Ga0496107_0024445 3300048910 Bacteria 4273
859 Ga0496107_0029493 3300048910 Bacteria 3903
860 Ga0496107_0036600 3300048910 Bacteria 3520
861 Ga0496107_0039309 3300048910 Bacteria 3393
862 Ga0496108_0001167 3300048911 Bacteria 20498
863 Ga0496108_0002014 3300048911 Bacteria 16270
864 Ga0496108_0004348 3300048911 Bacteria 11394
865 Ga0496108_0013160 3300048911 Bacteria 6742
866 Ga0496109_0007854 3300048912 Bacteria 9037
867 Ga0496109_0014218 3300048912 Bacteria 6923
868 Ga0496109_0023009 3300048912 Bacteria 5525
869 Ga0496110_0001813 3300048913 Bacteria 15734
870 Ga0496110_0003336 3300048913 Bacteria 12270
871 Ga0496110_0005174 3300048913 Bacteria 10202
872 Ga0496110_0020631 3300048913 Bacteria 5566
873 Ga0496110_0025581 3300048913 Bacteria 5046
874 Ga0496110_0031828 3300048913 Bacteria 4553
875 Ga0496110_0041411 3300048913 Bacteria 4019
876 Ga0496110_0067027 3300048913 Bacteria 3175
877 Ga0496111_0010795 3300048914 Bacteria 6140
878 Ga0496111_0026781 3300048914 Bacteria 4073
879 Ga0496111_0042746 3300048914 Bacteria 3255
880 Ga0496112_0037146 3300048915 Bacteria 4754
881 Ga0496112_0050899 3300048915 Bacteria 4062
882 Ga0496113_0000943 3300048916 Bacteria 15457
883 Ga0496113_0001600 3300048916 Bacteria 12735
884 Ga0496113_0002498 3300048916 Bacteria 10715
885 Ga0496113_0094055 3300048916 Bacteria 2315
886 Ga0496114_0000006 3300048917 Bacteria 472921
887 Ga0496114_0189808 3300048917 Bacteria 1797
888 Ga0496115_0000042 3300048918 Bacteria 118348
889 Ga0496115_0010928 3300048918 Bacteria 6796
890 Ga0496116_0000035 3300048919 Bacteria 402424
891 Ga0496116_0001662 3300048919 Bacteria 24440
892 Ga0496116_0033685 3300048919 Bacteria 3630
893 Ga0496116_0056202 3300048919 Bacteria 2581
894 Ga0496117_0013881 3300048920 Bacteria 6985
895 Ga0496118_0000109 3300048921 Bacteria 153067
896 Ga0496118_0016413 3300048921 Bacteria 6795
897 Ga0496118_0032274 3300048921 Bacteria 4319
898 Ga0496119_0031303 3300048922 Bacteria 3571
899 Ga0496121_0000070 3300048924 Bacteria 249187
900 Ga0496121_0000740 3300048924 Bacteria 60212
901 Ga0496121_0002895 3300048924 Bacteria 25241
902 Ga0496121_0069828 3300048924 Bacteria 2833
903 Ga0496123_0001169 3300048926 Bacteria 38781
904 Ga0496123_0006066 3300048926 Bacteria 11861
905 Ga0496124_0003117 3300048927 Bacteria 20575
906 Ga0496125_0000638 3300048928 Bacteria 58580
907 Ga0496125_0025119 3300048928 Bacteria 5464
908 Ga0496126_0000084 3300048929 Bacteria 217111
909 Ga0496126_0052607 3300048929 Bacteria 3700
910 Ga0501032_0022445 3300049569 Bacteria 4374
911 Ga0501033_0019441 3300049570 Bacteria 5136
912 Ga0501034_0066514 3300049571 Bacteria 3617
913 Ga0501042_0005275 3300049578 Bacteria 8308
914 Ga0501047_0047289 3300049581 Bacteria 4157
915 Ga0501067_0041216 3300049583 Bacteria 2564
916 Ga0501067_0055782 3300049583 Bacteria 2189
917 Ga0501223_000116 3300049663 Bacteria 22926
918 Ga0501223_004154 3300049663 Bacteria 3120
919 Ga0501223_004213 3300049663 Bacteria 3097
920 Ga0501224_000011 3300049664 Bacteria 93275
921 Ga0501233_000190 3300049668 Bacteria 9097
922 Ga0501257_000144 3300049686 Bacteria 15686
923 Ga0501225_0000152 3300049705 Bacteria 21223
924 Ga0501035_0026060 3300049822 Bacteria 5354
925 Ga0501044_0001099 3300049823 Bacteria 32196
926 Ga0501044_0027702 3300049823 Bacteria 5982
927 Ga0501226_000024 3300049853 Bacteria 93123
928 nmdc:mga03683_13_c1 3300050489 Bacteria 110533
929 nmdc:mga03683_289_c1 3300050489 Bacteria 14995
930 nmdc:mga03n38_3053_c1 3300050490 Bacteria 5306
931 nmdc:mga00v17_20204_c1 3300050491 Bacteria 3812
932 nmdc:mga0k408_8_c1 3300050493 Bacteria 161211
933 nmdc:mga06z11_573_c1 3300050494 Bacteria 13457
934 nmdc:mga04h51_76_c1 3300050495 Bacteria 31783
935 nmdc:mga07m45_38_c1 3300050496 Bacteria 65235
936 nmdc:mga07m45_3_c1 3300050496 Bacteria 421414
937 nmdc:mga07m45_618_c1 3300050496 Bacteria 15113
938 nmdc:mga05p37_45901_c1 3300050507 Bacteria 5373
939 Ga0500643_000001 3300053087 Bacteria 1440111
940 Ga0500643_000612 3300053087 Bacteria 24327
941 Ga0500643_000752 3300053087 Bacteria 21183
942 Ga0500643_000997 3300053087 Bacteria 17354
943 Ga0500556_0000027 3300053104 Bacteria 165855
944 Ga0500607_000048 3300053121 Bacteria 82363
945 Ga0500607_004691 3300053121 Bacteria 9288
946 Ga0500618_003695 3300053125 Bacteria 5157
947 Ga0500642_0000003 3300053130 Bacteria 544899
948 Ga0500573_0000045 3300053140 Bacteria 98878
949 Ga0500604_0000003 3300053151 Bacteria 148800
950 Ga0500616_0000128 3300053153 Bacteria 134307
951 Ga0500624_000045 3300053157 Bacteria 89838
952 Ga0500627_0000004 3300053158 Bacteria 174208
953 Ga0500627_0000278 3300053158 Bacteria 14608
954 Ga0500567_001083 3300053723 Bacteria 10567
955 Ga0500625_000010 3300053729 Bacteria 154401
956 Ga0500645_000011 3300053730 Bacteria 169616
957 Ga0500645_002144 3300053730 Bacteria 9063
958 Ga0500645_009600 3300053730 Bacteria 3243
959 Ga0500596_001714 3300053735 Bacteria 4441
960 Ga0466962_0005552 3300061719 Bacteria 6053
961 2511129618 2510917021 Bacteria 5705459
962 2643821418 2643221560 Bacteria 4801179
963 2643836012 2643221563 Bacteria 4726935
964 2643949078 2643221588 Bacteria 3692460
965 2644056937 2643221608 Bacteria 4724829
966 2739649757 2739367664 Bacteria 4114334
967 2740028230 2739367865 Bacteria 4114482
968 2819552610 2818991438 Bacteria 5793701
969 2852655535 2852653556 Bacteria 4050083
970 2852681033 2852680915 Bacteria 4100189
971 2882807420 2882806704 Bacteria 3007728
972 2885428726 2885427238 Bacteria 2291351
973 2895886104 2895880812 Bacteria 11255272
974 2896185021 2896184354 Bacteria 3258548
975 2896255410 2896253425 Bacteria 3418029
976 2896429792 2896429255 Bacteria 2557483
977 2919141676 2919138771 Bacteria 5281312
978 8054302721 8054302542 Bacteria 5698134
979 8057101778 8057101203 Bacteria 5034064
980 Ga0496109_0101651
981 SwRhRL2b_contig_2799799
982 JGI24736J21556_1000056
983 JGI24752J21851_1000367
984 JGI24740J21852_10007712
985 JGI24740J21852_10008209
986 JGI24739J22299_10001645
987 JGI24739J22299_10003318
988 JGI24737J22298_10000117
989 JGI24743J22301_10000482
990 JGI24735J21928_10002989
991 JGI24735J21928_10007292
992 JGI24750J21931_1000004
993 JGI24748J21848_1000044
994 JGI24738J21930_10001953
995 JGI24738J21930_10003826
996 JGI24738J21930_10004092
997 JGI24738J21930_10007579
998 JGI24034J26672_10000020
999 JGI24751J29686_10000242
1000 JGI25165J46597_1000573
1001 JGI25153J46596_10000113
1002 Ga0055525_1000051
1003 Ga0055542_1000020
1004 Ga0055529_1000016
1005 Ga0055536_1000643
1006 Ga0055536_1003408
1007 Ga0055536_1008388
1008 Ga0055530_10000035
1009 Ga0055531_10003431
1010 Ga0065704_10000222
1011 Ga0065712_10077447
1012 Ga0065715_10096385
1013 Ga0065707_10083820
1014 Ga0065707_10086495
1015 Ga0070658_10000001
1016 Ga0070658_10000305
1017 Ga0070658_10000351
1018 Ga0070658_10019495
1019 Ga0070658_10064228
1020 Ga0070658_10085268
1021 Ga0070683_100001218
1022 Ga0070683_100009155
1023 Ga0070683_100035894
1024 Ga0070690_100000180
1025 Ga0070690_100037867
1026 Ga0070670_100001900
1027 Ga0070670_100002485
1028 Ga0070670_100004196
1029 Ga0070670_100006931
1030 Ga0070670_100028646
1031 Ga0070670_100035673
1032 Ga0070670_100036174
1033 Ga0070670_100062929
1034 Ga0070677_10000358
1035 Ga0068869_100001958
1036 Ga0068869_100053556
1037 Ga0070666_10000027
1038 Ga0070666_10000033
1039 Ga0070666_10000555
1040 Ga0070666_10000788
1041 Ga0070666_10002098
1042 Ga0070666_10020931
1043 Ga0070666_10034090
1044 Ga0070680_100000228
1045 Ga0070680_100000949
1046 Ga0070680_100041578
1047 Ga0068868_100000001
1048 Ga0068868_100000041
1049 Ga0068868_100000211
1050 Ga0068868_100000572
1051 Ga0068868_100017275
1052 Ga0068868_100049966
1053 Ga0070660_100000051
1054 Ga0070660_100000129
1055 Ga0070660_100005925
1056 Ga0070660_100007167
1057 Ga0070660_100025232
1058 Ga0070660_100064465
1059 Ga0070689_100051235
1060 Ga0070661_100000014
1061 Ga0070661_100000033
1062 Ga0070661_100008952
1063 Ga0070661_100023721
1064 Ga0070661_100049814
1065 Ga0070668_100000123
1066 Ga0070669_100000075
1067 Ga0070669_100000099
1068 Ga0070669_100000471
1069 Ga0070669_100000556
1070 Ga0070669_100043759
1071 Ga0070675_100000406
1072 Ga0070675_100007861
1073 Ga0070671_100000015
1074 Ga0070671_100000050
1075 Ga0070671_100000752
1076 Ga0070671_100000800
1077 Ga0070671_100001477
1078 Ga0070671_100001615
1079 Ga0070671_100001659
1080 Ga0070671_100002991
1081 Ga0070671_100003305
1082 Ga0070671_100011910
1083 Ga0070671_100015456
1084 Ga0070671_100020477
1085 Ga0070671_100028321
1086 Ga0070674_100000415
1087 Ga0070673_100001837
1088 Ga0070673_100027333
1089 Ga0070673_100031392
1090 Ga0070673_100032558
1091 Ga0070673_100077258
1092 Ga0070688_100010650
1093 Ga0070659_100000001
1094 Ga0070659_100000142
1095 Ga0070659_100004813
1096 Ga0070659_100009061
1097 Ga0070659_100013985
1098 Ga0070659_100020857
1099 Ga0070659_100091450
1100 Ga0070659_100145559
1101 Ga0070667_100000368
1102 Ga0070667_100001014
1103 Ga0070667_100003689
1104 Ga0070667_100005056
1105 Ga0070667_100008853
1106 Ga0070667_100012088
1107 Ga0070667_100012789
1108 Ga0070667_100043981
1109 Ga0070667_100047112
1110 Ga0070667_100048374
1111 Ga0070714_100084508
1112 Ga0070713_100008902
1113 Ga0070705_100002002
1114 Ga0070663_100004959
1115 Ga0070678_100000379
1116 Ga0070678_100003813
1117 Ga0070662_100000021
1118 Ga0070662_100000733
1119 Ga0070662_100000826
1120 Ga0070662_100003298
1121 Ga0070662_100008268
1122 Ga0070662_100011909
1123 Ga0070662_100016035
1124 Ga0070662_100021330
1125 Ga0070662_100072073
1126 Ga0070681_10090371
1127 Ga0068867_100011576
1128 Ga0070685_10000238
1129 Ga0070679_100000003
1130 Ga0068853_100000377
1131 Ga0068853_100003642
1132 Ga0068853_100007738
1133 Ga0068853_100046111
1134 Ga0070672_100001912
1135 Ga0070672_100012970
1136 Ga0070686_100000010
1137 Ga0070686_100003910
1138 Ga0070696_100012945
1139 Ga0070696_100014922
1140 Ga0070693_100000142
1141 Ga0070693_100021718
1142 Ga0070665_100000044
1143 Ga0070665_100000254
1144 Ga0070665_100000511
1145 Ga0070665_100000528
1146 Ga0070665_100000531
1147 Ga0070665_100000634
1148 Ga0070665_100004137
1149 Ga0070665_100009476
1150 Ga0070665_100023751
1151 Ga0070665_100028884
1152 Ga0070665_100034620
1153 Ga0070665_100071442
1154 Ga0070665_100085282
1155 Ga0070665_100089808
1156 Ga0068855_100000745
1157 Ga0068855_100008164
1158 Ga0068855_100016149
1159 Ga0068855_100021266
1160 Ga0068855_100154338
1161 Ga0070664_100000153
1162 Ga0070664_100001180
1163 Ga0070664_100007769
1164 Ga0070664_100015803
1165 Ga0070664_100037496
1166 Ga0070664_100063739
1167 Ga0068857_100007788
1168 Ga0068857_100054112
1169 Ga0068857_100066729
1170 Ga0068854_100007709
1171 Ga0068854_100025211
1172 Ga0068854_100057460
1173 Ga0068854_100101323
1174 Ga0068856_100000177
1175 Ga0068856_100000870
1176 Ga0068856_100006572
1177 Ga0068856_100015519
1178 Ga0068852_100000075
1179 Ga0068852_100000831
1180 Ga0068852_100001121
1181 Ga0068852_100015314
1182 Ga0068852_100069059
1183 Ga0068852_100071681
1184 Ga0068852_100096354
1185 Ga0068852_100110266
1186 Ga0068859_100000194
1187 Ga0068859_100000221
1188 Ga0068859_100004830
1189 Ga0068859_100017508
1190 Ga0068859_100018251
1191 Ga0068864_100000261
1192 Ga0068864_100000721
1193 Ga0068864_100001983
1194 Ga0068864_100004528
1195 Ga0068864_100020487
1196 Ga0068864_100031594
1197 Ga0068864_100047108
1198 Ga0068861_100000198
1199 Ga0068861_100005126
1200 Ga0068861_100051612
1201 Ga0068851_10002496
1202 Ga0068851_10003867
1203 Ga0068851_10014509
1204 Ga0068863_100000020
1205 Ga0068863_100000052
1206 Ga0068863_100000775
1207 Ga0068863_100001823
1208 Ga0068863_100003774
1209 Ga0068863_100008573
1210 Ga0068863_100010798
1211 Ga0068863_100012736
1212 Ga0068858_100000530
1213 Ga0068858_100000919
1214 Ga0068858_100001368
1215 Ga0068858_100002958
1216 Ga0068858_100004078
1217 Ga0068858_100004134
1218 Ga0068858_100011992
1219 Ga0068858_100017450
1220 Ga0068858_100032886
1221 Ga0068860_100000007
1222 Ga0068860_100000080
1223 Ga0068860_100000437
1224 Ga0068860_100000867
1225 Ga0068860_100005984
1226 Ga0068860_100023975
1227 Ga0068862_100000115
1228 Ga0068862_100000135
1229 Ga0068862_100000340
1230 Ga0068862_100004671
1231 Ga0068862_100019812
1232 Ga0068862_100023550
1233 Ga0068862_100038653
1234 Ga0081455_10000545
1235 Ga0081539_10018932
1236 Ga0081539_10042244
1237 Ga0075368_10000066
1238 Ga0075364_10003309
1239 Ga0075432_10005555
1240 Ga0075362_10000083
1241 Ga0075362_10000203
1242 Ga0075367_10002111
1243 Ga0075366_10001643
1244 Ga0075366_10002219
1245 Ga0097621_100012370
1246 Ga0097621_100021964
1247 Ga0097621_100025480
1248 Ga0075370_10000017
1249 Ga0075370_10003828
1250 Ga0075370_10008260
1251 Ga0068871_100010804
1252 Ga0068871_100017472
1253 Ga0075431_100121713
1254 Ga0097620_100000194
1255 Ga0097620_100000221
1256 Ga0097620_100004830
1257 Ga0097620_100017509
1258 Ga0097620_100018253
1259 Ga0105251_10003099
1260 Ga0105251_10030588
1261 Ga0105240_10016986
1262 Ga0105240_10077983
1263 Ga0105240_10093586
1264 Ga0105245_10000433
1265 Ga0105245_10005439
1266 Ga0105245_10040803
1267 Ga0105247_10020284
1268 Ga0114129_10074815
1269 Ga0105243_10000038
1270 Ga0105248_10000442
1271 Ga0105248_10000502
1272 Ga0105248_10000604
1273 Ga0105248_10000801
1274 Ga0105248_10003885
1275 Ga0105248_10009214
1276 Ga0105248_10104307
1277 Ga0105237_10106751
1278 Ga0105238_10004331
1279 Ga0105238_10023652
1280 Ga0105249_10000064
1281 Ga0105249_10000097
1282 Ga0105249_10002825
1283 Ga0105249_10018924
1284 Ga0157371_10000146
1285 Ga0157371_10073407
1286 Ga0157370_10017554
1287 Ga0157369_10021850
1288 Ga0157369_10056748
1289 Ga0157369_10069699
1290 Ga0157369_10094835
1291 Ga0157369_10105813
1292 Ga0157374_10101468
1293 Ga0157378_10011418
1294 Ga0157378_10021971
1295 Ga0163162_10014045
1296 Ga0163162_10086284
1297 Ga0163162_10098967
1298 Ga0157372_10066187
1299 Ga0157375_10083746
1300 Ga0163163_10000164
1301 Ga0163163_10001448
1302 Ga0163163_10004133
1303 Ga0163163_10031150
1304 Ga0157380_10000086
1305 Ga0157380_10000723
1306 Ga0157379_10002697
1307 Ga0157379_10004711
1308 Ga0157379_10027193
1309 Ga0157379_10089995
1310 Ga0157376_10035122
1311 Ga0163161_10000110
1312 Ga0163161_10001335
1313 Ga0213873_10000007
1314 Ga0213876_10000005
1315 Ga0213876_10000336
1316 Ga0213875_10000105
1317 Ga0209563_100019
1318 Ga0209148_1000017
1319 Ga0209233_1000414
1320 Ga0209455_1000005
1321 Ga0209455_1009979
1322 Ga0209675_1000076
1323 Ga0209676_1000070
1324 Ga0209676_1000454
1325 Ga0209676_1000637
1326 Ga0209758_1000035
1327 Ga0209050_1000042
1328 Ga0209050_1000929
1329 Ga0209257_1000285
1330 Ga0209257_1001860
1331 Ga0209257_1002873
1332 Ga0207697_10000215
1333 Ga0207697_10000296
1334 Ga0207656_10001865
1335 Ga0207656_10005012
1336 Ga0207656_10020325
1337 Ga0207713_1007781
1338 Ga0207682_10000194
1339 Ga0207682_10000643
1340 Ga0207682_10017553
1341 Ga0207710_10001018
1342 Ga0207680_10000009
1343 Ga0207680_10000166
1344 Ga0207680_10005824
1345 Ga0207680_10069316
1346 Ga0207647_10000684
1347 Ga0207647_10000986
1348 Ga0207647_10003840
1349 Ga0207647_10006533
1350 Ga0207647_10007669
1351 Ga0207647_10016359
1352 Ga0207647_10036609
1353 Ga0207645_10008483
1354 Ga0207645_10030311
1355 Ga0207645_10038553
1356 Ga0207705_10000002
1357 Ga0207705_10000075
1358 Ga0207705_10000174
1359 Ga0207705_10000220
1360 Ga0207705_10012782
1361 Ga0207705_10014602
1362 Ga0207705_10038837
1363 Ga0207705_10086640
1364 Ga0207707_10032753
1365 Ga0207707_10080911
1366 Ga0207695_10003071
1367 Ga0207695_10006373
1368 Ga0207695_10017590
1369 Ga0207695_10100964
1370 Ga0207671_10001965
1371 Ga0207671_10011180
1372 Ga0207671_10027346
1373 Ga0207660_10000692
1374 Ga0207660_10006353
1375 Ga0207660_10009765
1376 Ga0207660_10033018
1377 Ga0207660_10049935
1378 Ga0207657_10000173
1379 Ga0207657_10000262
1380 Ga0207657_10002388
1381 Ga0207657_10003423
1382 Ga0207657_10005157
1383 Ga0207657_10008356
1384 Ga0207657_10054380
1385 Ga0207657_10076385
1386 Ga0207657_10100930
1387 Ga0207649_10000014
1388 Ga0207649_10000055
1389 Ga0207649_10000365
1390 Ga0207649_10004475
1391 Ga0207649_10025609
1392 Ga0207649_10026407
1393 Ga0207649_10032471
1394 Ga0207652_10000004
1395 Ga0207652_10004551
1396 Ga0207681_10000002
1397 Ga0207681_10000106
1398 Ga0207681_10000174
1399 Ga0207681_10034443
1400 Ga0207694_10001479
1401 Ga0207694_10021129
1402 Ga0207694_10031031
1403 Ga0207694_10036124
1404 Ga0207650_10001849
1405 Ga0207650_10005752
1406 Ga0207650_10008430
1407 Ga0207650_10012125
1408 Ga0207650_10019778
1409 Ga0207650_10037075
1410 Ga0207650_10063445
1411 Ga0207687_10045967
1412 Ga0207687_10050169
1413 Ga0207687_10101647
1414 Ga0207664_10016602
1415 Ga0207664_10094032
1416 Ga0207644_10000002
1417 Ga0207644_10000003
1418 Ga0207644_10000061
1419 Ga0207644_10000456
1420 Ga0207644_10000530
1421 Ga0207644_10000616
1422 Ga0207644_10000919
1423 Ga0207644_10002341
1424 Ga0207644_10004475
1425 Ga0207644_10015164
1426 Ga0207644_10016202
1427 Ga0207644_10035745
1428 Ga0207644_10037956
1429 Ga0207644_10045671
1430 Ga0207690_10000051
1431 Ga0207690_10000150
1432 Ga0207690_10002274
1433 Ga0207690_10006008
1434 Ga0207690_10010440
1435 Ga0207690_10036104
1436 Ga0207690_10066241
1437 Ga0207690_10069184
1438 Ga0207706_10000103
1439 Ga0207706_10000459
1440 Ga0207706_10000479
1441 Ga0207706_10004155
1442 Ga0207706_10013288
1443 Ga0207709_10000031
1444 Ga0207669_10000057
1445 Ga0207669_10008227
1446 Ga0207669_10017984
1447 Ga0207669_10065892
1448 Ga0207704_10008556
1449 Ga0207691_10001051
1450 Ga0207691_10001329
1451 Ga0207691_10015613
1452 Ga0207691_10062346
1453 Ga0207711_10000042
1454 Ga0207711_10000526
1455 Ga0207711_10001142
1456 Ga0207711_10001694
1457 Ga0207711_10002857
1458 Ga0207711_10004897
1459 Ga0207711_10014914
1460 Ga0207711_10025172
1461 Ga0207689_10018710
1462 Ga0207661_10019846
1463 Ga0207661_10032507
1464 Ga0207679_10000874
1465 Ga0207679_10004310
1466 Ga0207679_10006770
1467 Ga0207679_10017921
1468 Ga0207667_10000552
1469 Ga0207667_10001537
1470 Ga0207667_10008643
1471 Ga0207667_10015289
1472 Ga0207667_10018486
1473 Ga0207667_10069479
1474 Ga0207667_10115870
1475 Ga0207651_10002050
1476 Ga0207651_10004326
1477 Ga0207651_10005791
1478 Ga0207651_10029392
1479 Ga0207651_10049091
1480 Ga0207712_10000044
1481 Ga0207712_10000074
1482 Ga0207712_10001308
1483 Ga0207712_10001774
1484 Ga0207668_10000085
1485 Ga0207668_10002722
1486 Ga0207668_10040021
1487 Ga0207640_10000996
1488 Ga0207640_10007677
1489 Ga0207640_10054718
1490 Ga0207658_10000340
1491 Ga0207658_10000381
1492 Ga0207658_10001750
1493 Ga0207658_10001909
1494 Ga0207658_10007570
1495 Ga0207658_10007960
1496 Ga0207658_10010162
1497 Ga0207658_10010577
1498 Ga0207658_10013379
1499 Ga0207658_10021015
1500 Ga0207677_10000013
1501 Ga0207677_10001135
1502 Ga0207677_10001325
1503 Ga0207677_10006612
1504 Ga0207703_10000484
1505 Ga0207703_10002018
1506 Ga0207703_10002526
1507 Ga0207703_10003985
1508 Ga0207703_10005559
1509 Ga0207703_10011932
1510 Ga0207703_10012583
1511 Ga0207703_10026625
1512 Ga0207703_10038745
1513 Ga0207639_10000393
1514 Ga0207639_10001063
1515 Ga0207639_10001152
1516 Ga0207639_10008338
1517 Ga0207639_10032359
1518 Ga0207639_10040928
1519 Ga0207639_10065717
1520 Ga0207678_10008943
1521 Ga0207678_10010290
1522 Ga0207678_10010565
1523 Ga0207678_10070194
1524 Ga0207702_10001262
1525 Ga0207702_10001379
1526 Ga0207702_10003005
1527 Ga0207702_10005295
1528 Ga0207702_10007361
1529 Ga0207641_10000001
1530 Ga0207641_10000042
1531 Ga0207641_10000415
1532 Ga0207641_10005614
1533 Ga0207641_10005984
1534 Ga0207641_10009236
1535 Ga0207641_10013949
1536 Ga0207641_10019191
1537 Ga0207641_10021901
1538 Ga0207641_10023713
1539 Ga0207641_10048153
1540 Ga0207648_10001953
1541 Ga0207648_10005222
1542 Ga0207648_10009147
1543 Ga0207676_10000456
1544 Ga0207676_10002207
1545 Ga0207676_10003783
1546 Ga0207676_10003902
1547 Ga0207676_10004793
1548 Ga0207676_10010113
1549 Ga0207676_10025535
1550 Ga0207676_10026126
1551 Ga0207676_10030259
1552 Ga0207674_10000283
1553 Ga0207674_10000632
1554 Ga0207674_10002193
1555 Ga0207674_10002478
1556 Ga0207674_10004313
1557 Ga0207674_10004629
1558 Ga0207674_10031182
1559 Ga0207674_10043855
1560 Ga0207674_10108865
1561 Ga0207674_10173638
1562 Ga0207675_100000169
1563 Ga0207675_100000207
1564 Ga0207675_100000671
1565 Ga0207683_10003996
1566 Ga0207683_10004793
1567 Ga0207698_10000005
1568 Ga0207698_10000457
1569 Ga0207698_10010915
1570 Ga0207698_10019069
1571 Ga0207698_10022589
1572 Ga0207698_10029001
1573 Ga0207698_10051140
1574 Ga0207698_10091496
1575 Ga0209813_10000402
1576 Ga0209974_10006875
1577 Ga0268266_10000002
1578 Ga0268266_10000069
1579 Ga0268266_10000187
1580 Ga0268266_10000215
1581 Ga0268266_10000518
1582 Ga0268266_10002822
1583 Ga0268266_10003658
1584 Ga0268266_10017014
1585 Ga0268266_10019148
1586 Ga0268266_10033464
1587 Ga0268265_10000100
1588 Ga0268265_10000152
1589 Ga0268265_10000241
1590 Ga0268265_10002755
1591 Ga0268265_10007193
1592 Ga0268265_10016778
1593 Ga0268265_10025502
1594 Ga0268265_10032662
1595 Ga0268265_10046685
1596 Ga0268265_10087442
1597 Ga0268264_10000010
1598 Ga0268264_10000131
1599 Ga0268264_10000134
1600 Ga0268264_10000710
1601 Ga0268264_10001517
1602 Ga0268264_10001849
1603 Ga0268264_10011515
1604 Ga0268264_10021234
1605 Ga0268264_10035064
1606 Ga0307517_10026378
1607 Ga0307513_10004225
1608 Ga0307408_100005051
1609 Ga0307408_100035206
1610 Ga0307408_100042401
1611 Ga0307508_10000479
1612 Ga0307508_10008321
1613 Ga0307405_10007070
1614 Ga0307405_10009125
1615 Ga0307405_10011231
1616 Ga0307405_10027898
1617 Ga0307413_10002207
1618 Ga0307410_10004659
1619 Ga0307410_10006077
1620 Ga0307410_10009323
1621 Ga0307410_10010561
1622 Ga0307410_10010875
1623 Ga0307410_10017255
1624 Ga0307410_10045348
1625 Ga0307410_10066360
1626 Ga0307410_10075233
1627 Ga0307406_10005488
1628 Ga0307406_10025358
1629 Ga0307406_10071997
1630 Ga0307407_10035879
1631 Ga0307412_10006578
1632 Ga0307412_10007459
1633 Ga0307412_10020528
1634 Ga0307412_10030265
1635 Ga0307412_10043661
1636 Ga0307409_100007554
1637 Ga0307409_100050467
1638 Ga0307409_100063402
1639 Ga0307409_100069309
1640 Ga0307409_100075339
1641 Ga0307409_100083438
1642 Ga0307409_100147381
1643 Ga0307416_100004453
1644 Ga0307416_100056406
1645 Ga0307416_100129765
1646 Ga0307414_10001217
1647 Ga0307414_10002805
1648 Ga0307414_10004094
1649 Ga0307414_10010149
1650 Ga0307414_10016511
1651 Ga0307414_10034082
1652 Ga0307414_10037112
1653 Ga0307414_10083811
1654 Ga0307411_10001507
1655 Ga0307411_10001967
1656 Ga0307411_10005401
1657 Ga0307411_10009354
1658 Ga0307411_10013451
1659 Ga0307411_10016664
1660 Ga0307411_10023501
1661 Ga0307411_10045292
1662 Ga0307415_100000799
1663 Ga0307415_100002317
1664 Ga0307415_100009039
1665 Ga0307415_100029131
1666 Ga0307415_100031045
1667 Ga0307415_100034705
1668 Ga0373943_0034418
1669 Ga0373931_0049228
1670 Ga0316582_0019261
1671 Ga0395899_0000691
1672 Ga0395899_0000936
1673 Ga0395899_0006865
1674 Ga0395899_0020623
1675 Ga0395899_0022042
1676 Ga0395899_0032052
1677 Ga0395899_0050993
1678 Ga0395900_0000316
1679 Ga0395900_0000902
1680 Ga0395900_0006286
1681 Ga0395900_0006902
1682 Ga0395900_0013536
1683 Ga0395900_0014211
1684 Ga0395900_0020006
1685 Ga0395900_0020055
1686 Ga0395900_0024222
1687 Ga0395900_0035040
1688 Ga0395900_0041989
1689 Ga0395900_0048835
1690 Ga0395900_0058611
1691 Ga0395900_0066890
1692 Ga0395900_0073751
1693 Ga0395900_0077014
1694 Ga0395900_0163801
1695 Ga0395900_0165863
1696 Ga0395900_0183529
1697 Ga0395900_0189156
1698 Ga0395898_0000192
1699 Ga0395898_0001190
1700 Ga0395898_0002752
1701 Ga0395898_0034317
1702 Ga0395898_0057225
1703 Ga0395898_0077797
1704 Ga0395898_0108699
1705 Ga0395905_0000066
1706 Ga0395905_0000916
1707 Ga0395905_0001950
1708 Ga0395905_0002085
1709 Ga0395905_0002298
1710 Ga0395905_0014596
1711 Ga0395905_0023489
1712 Ga0395905_0027904
1713 Ga0395905_0028256
1714 Ga0395905_0033675
1715 Ga0395905_0036693
1716 Ga0395905_0037639
1717 Ga0395905_0081710
1718 Ga0395905_0087525
1719 Ga0395905_0106829
1720 Ga0395905_0130752
1721 Ga0395905_0145437
1722 Ga0436364_0184827
1723 Ga0395901_0000203
1724 Ga0395901_0000232
1725 Ga0395901_0000468
1726 Ga0395901_0003002
1727 Ga0395901_0006424
1728 Ga0395901_0007762
1729 Ga0395901_0018702
1730 Ga0395901_0026159
1731 Ga0395901_0051451
1732 Ga0395901_0055613
1733 Ga0395901_0060872
1734 Ga0395901_0088978
1735 Ga0395901_0096457
1736 Ga0395901_0112625
1737 Ga0395901_0117755
1738 Ga0395901_0206534
1739 Ga0436365_0393854
1740 Ga0436365_0607739
1741 Ga0436365_1728108
1742 Ga0436362_0976836
1743 Ga0439445_0000259
1744 Ga0439448_0003663
1745 Ga0439462_0000190
1746 Ga0450912_000100
1747 Ga0450905_000562
1748 Ga0439458_0002875
1749 Ga0439458_0003632
1750 Ga0466969_0011914
1751 Ga0466961_0039856
1752 Ga0466963_0007220
1753 Ga0466963_0041404
1754 Ga0466963_0044084
1755 Ga0453684_0122144
1756 Ga0466971_0025269
1757 Ga0466957_0013383
1758 Ga0466957_0014646
1759 Ga0466959_0025239
1760 Ga0451576_0091666
1761 Ga0466958_0001866
1762 Ga0466958_0015322
1763 Ga0466958_0072874
1764 Ga0466967_0002854
1765 Ga0466967_0005893
1766 Ga0466967_0007661
1767 Ga0466967_0028082
1768 Ga0466967_0029613
1769 Ga0466967_0057970
1770 Ga0495627_000197
1771 Ga0495638_0000980
1772 Ga0495650_0000058
1773 Ga0495650_0001171
1774 Ga0495596_0000074
1775 Ga0495583_0002103
1776 Ga0495606_0001775
1777 Ga0495610_0000022
1778 Ga0495610_0002818
1779 Ga0495620_0017337
1780 Ga0495643_0001911
1781 Ga0495643_0002032
1782 Ga0495643_0016512
1783 Ga0495643_0017609
1784 Ga0495643_0019171
1785 Ga0495648_0000698
1786 Ga0495663_0000248
1787 Ga0495663_0001615
1788 Ga0495663_0002089
1789 Ga0495642_0007434
1790 Ga0495654_0000224
1791 Ga0495598_0002444
1792 Ga0495621_0000267
1793 Ga0495621_0000754
1794 Ga0495622_0006416
1795 Ga0495633_0001330
1796 Ga0495668_0000001
1797 Ga0495668_0000007
1798 Ga0495668_0001200
1799 Ga0495668_0014866
1800 Ga0495625_0000167
1801 Ga0495625_0000237
1802 Ga0495625_0006053
1803 Ga0495659_0007180
1804 Ga0495661_0046112
1805 Ga0495669_0000110
1806 Ga0495669_0000854
1807 Ga0495669_0001549
1808 Ga0495669_0001606
1809 Ga0495669_0003119
1810 Ga0495670_0027880
1811 Ga0495671_0017917
1812 Ga0495600_0003414
1813 Ga0495683_0007930
1814 Ga0495687_000178
1815 Ga0495687_000211
1816 Ga0495681_0000123
1817 Ga0495681_0002869
1818 Ga0495686_0000191
1819 Ga0495615_0000131
1820 Ga0495626_0005587
1821 Ga0496100_0009750
1822 Ga0496100_0018618
1823 Ga0496101_0017464
1824 Ga0496101_0066423
1825 Ga0496101_0073935
1826 Ga0496102_0075802
1827 Ga0496103_0016658
1828 Ga0496103_0055116
1829 Ga0496104_0017845
1830 Ga0496104_0085174
1831 Ga0496105_0000435
1832 Ga0496105_0000866
1833 Ga0496106_0004254
1834 Ga0496106_0024444
1835 Ga0496107_0001028
1836 Ga0496107_0005617
1837 Ga0496107_0024445
1838 Ga0496107_0029493
1839 Ga0496107_0036600
1840 Ga0496107_0039309
1841 Ga0496108_0001167
1842 Ga0496108_0002014
1843 Ga0496108_0004348
1844 Ga0496108_0013160
1845 Ga0496109_0007854
1846 Ga0496109_0014218
1847 Ga0496109_0023009
1848 Ga0496110_0001813
1849 Ga0496110_0003336
1850 Ga0496110_0005174
1851 Ga0496110_0020631
1852 Ga0496110_0025581
1853 Ga0496110_0031828
1854 Ga0496110_0041411
1855 Ga0496110_0067027
1856 Ga0496111_0010795
1857 Ga0496111_0026781
1858 Ga0496111_0042746
1859 Ga0496112_0037146
1860 Ga0496112_0050899
1861 Ga0496113_0000943
1862 Ga0496113_0001600
1863 Ga0496113_0002498
1864 Ga0496113_0094055
1865 Ga0496114_0000006
1866 Ga0496114_0189808
1867 Ga0496115_0000042
1868 Ga0496115_0010928
1869 Ga0496116_0000035
1870 Ga0496116_0001662
1871 Ga0496116_0033685
1872 Ga0496116_0056202
1873 Ga0496117_0013881
1874 Ga0496118_0000109
1875 Ga0496118_0016413
1876 Ga0496118_0032274
1877 Ga0496119_0031303
1878 Ga0496121_0000070
1879 Ga0496121_0000740
1880 Ga0496121_0002895
1881 Ga0496121_0069828
1882 Ga0496123_0001169
1883 Ga0496123_0006066
1884 Ga0496124_0003117
1885 Ga0496125_0000638
1886 Ga0496125_0025119
1887 Ga0496126_0000084
1888 Ga0496126_0052607
1889 Ga0501032_0022445
1890 Ga0501033_0019441
1891 Ga0501034_0066514
1892 Ga0501042_0005275
1893 Ga0501047_0047289
1894 Ga0501067_0041216
1895 Ga0501067_0055782
1896 Ga0501223_000116
1897 Ga0501223_004154
1898 Ga0501223_004213
1899 Ga0501224_000011
1900 Ga0501233_000190
1901 Ga0501257_000144
1902 Ga0501225_0000152
1903 Ga0501035_0026060
1904 Ga0501044_0001099
1905 Ga0501044_0027702
1906 Ga0501226_000024
1907 nmdc:mga03683_13_c1
1908 nmdc:mga03683_289_c1
1909 nmdc:mga03n38_3053_c1
1910 nmdc:mga00v17_20204_c1
1911 nmdc:mga0k408_8_c1
1912 nmdc:mga06z11_573_c1
1913 nmdc:mga04h51_76_c1
1914 nmdc:mga07m45_38_c1
1915 nmdc:mga07m45_3_c1
1916 nmdc:mga07m45_618_c1
1917 nmdc:mga05p37_45901_c1
1918 Ga0500643_000001
1919 Ga0500643_000612
1920 Ga0500643_000752
1921 Ga0500643_000997
1922 Ga0500556_0000027
1923 Ga0500607_000048
1924 Ga0500607_004691
1925 Ga0500618_003695
1926 Ga0500642_0000003
1927 Ga0500573_0000045
1928 Ga0500604_0000003
1929 Ga0500616_0000128
1930 Ga0500624_000045
1931 Ga0500627_0000004
1932 Ga0500627_0000278
1933 Ga0500567_001083
1934 Ga0500625_000010
1935 Ga0500645_000011
1936 Ga0500645_002144
1937 Ga0500645_009600
1938 Ga0500596_001714
1939 Ga0466962_0005552
1940 2511129618
1941 2643821418
1942 2643836012
1943 2643949078
1944 2644056937
1945 2739649757
1946 2740028230
1947 2819552610
1948 2852655535
1949 2852681033
1950 2882807420
1951 2885428726
1952 2895886104
1953 2896185021
1954 2896255410
1955 2896429792
1956 2919141676
1957 8054302721
1958 8057101778

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01558

POR

Pyruvate ferredoxin/flavodoxin oxidoreductase

28

220

0.95

PF17147

PFOR_II

Pyruvate:ferredoxin oxidoreductase core domain II

525

615

0.89

PF01855

POR_N

Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-bdg

260

484

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yd7-assembly1.cif.gz_A conserved hypothetical protein pfu-1647980-001 from pyrococcus furiosus 0.8846 242 436
6n2o-assembly1.cif.gz_C 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound 0.8498 23 626
6n2o-assembly1.cif.gz_C 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound 0.8416 23 626
1yd7-assembly1.cif.gz_A conserved hypothetical protein pfu-1647980-001 from pyrococcus furiosus 0.8403 242 436
4wbx-assembly1.cif.gz_C conserved hypothetical protein pf1771 from pyrococcus furiosus solved by sulfur sad using swiss light source data 0.8282 242 621
ID Description Score Start End Superfamily
af_O53182_522_626_3.40.50.920 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9587 526 627 3.40.50.920
af_O53182_522_626_3.40.50.920 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9235 526 627 3.40.50.920
af_O53182_237_440_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9161 238 436 3.40.50.970
af_Q2FZ05_468_579_3.40.50.920 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8984 520 626 3.40.50.920
af_Q57724_1_190_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8939 247 432 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A3M0YTC5-F1-model_v4 2-oxoglutarate ferredoxin oxidoreductase subunit alpha 0.9686 488 628 GO:0003824
GO:0006979
AF-A0A534NMQ2-F1-model_v4 2-oxoglutarate ferredoxin oxidoreductase subunit alpha 0.9647 252 336 GO:0006979
GO:0016491
AF-A0A7X7J234-F1-model_v4 2-oxoglutarate ferredoxin oxidoreductase subunit alpha 0.9616 456 630 GO:0003824
GO:0006979
AF-A0A2A4MJJ5-F1-model_v4 2-oxoglutarate ferredoxin oxidoreductase subunit alpha 0.9599 99 628 GO:0006979
GO:0016903
AF-A0A383B6L0-F1-model_v4 Pyruvate flavodoxin/ferredoxin oxidoreductase pyrimidine binding domain-containing protein 0.9588 82 328 GO:0006979
GO:0016903

Map