F487346
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 979 | 333 | 1958 | 632 |
Family's Representative Sequence
| Representative Sequence | 3300048912|Ga0496109_0101651|Ga0496109_0101651_572_2452 |
| Length | 626 |
| Sequence | VATATHVLTPEESEAHPPQEAVVVRFAGDSGDGMQLTGGQFTLSTALAGNDLATFPDFPAEIRAPQGTTFGVSAFQINFGSCAIDTAGDQPDVLIAMNPAALKVNVKALRDGGLIIADEGEFTARNLAKAGYDQNPLEDGSLAKWQLVHFNISQLTLDAVKPFGLGNKEALRCKNMWTLGLALWMFDRDREPIVDWLKSKFAKAPELAEANIAALNAGHAYGETTEMGGVHKHHLDAAPAEPGLYRTVTGAEALSIGLVAGAQLAGLDMFFGSYPITPASPLLHHLSRLKEFGITTFQAEDEIAAVCAAIGASYAGQLGVTSSSGPGIALKTEAIGLAIMTELPLVVVNSQRGGPSTGLPTKTEQSDLYQAVYGRNADAPLPVIAARSPSDAFECAIEACRIATRYMTPVMLLTDGYIANAAEPWKVPDTSKFEPFPVSFFDKAPAEGEGVMPYARNDELARPWIKPGTVGLEHRIGGIEKAPGSGNIDYSPEAHAEMTRIRAAKVDGVADSIPDQEVCLGEAGAKLAIVGWGSTYGPIHQAVRRARAKGQDVAHVHIRHIWPMPKNMAVLLKSFENILVPEMNTGQLKTLLRDQFLVDAKSLPKVSGQPFTIAEIEAAISEALKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 11 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 12 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 13 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 14 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 15 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 16 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 17 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 25 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 83 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 115 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 116 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 117 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 182 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 183 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 184 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 185 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 186 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 187 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 188 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 189 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 190 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 191 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 192 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 193 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 194 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 195 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 196 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 197 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 199 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 200 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 201 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 202 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 203 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 204 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 205 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 206 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 207 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 208 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 209 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 210 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 211 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 212 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 213 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 214 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 215 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 216 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 217 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 218 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 219 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 220 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 221 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 222 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 223 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 257 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 258 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 259 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 260 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 261 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 262 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 264 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 265 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 266 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 267 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 268 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 269 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 270 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 271 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 272 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 273 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 274 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 275 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 276 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 277 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 278 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 285 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 286 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 287 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 288 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 289 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 292 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 293 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 294 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 295 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 296 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 297 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 298 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 299 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 301 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 302 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 303 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 304 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 305 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 306 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 307 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 308 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 309 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 310 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 311 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 312 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 313 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 314 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 315 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 316 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 317 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 318 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 319 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 320 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 321 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 322 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 323 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 324 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 325 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 326 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 327 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 328 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 329 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 330 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 331 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 332 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 333 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.06 |
| Metatranscriptomes | 0 |
| Isolates | 1.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.84 |
| Nodule | 0 |
| Rhizoplane | 5.01 |
| Rhizosphere | 84.07 |
| Stem | 0 |
| Stem Tuber | 0.1 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496109_0101651 | 3300048912 | Bacteria | 2668 |
| 2 | SwRhRL2b_contig_2799799 | 2162886007 | Bacteria | 27953 |
| 3 | JGI24736J21556_1000056 | 3300001904 | Bacteria | 18329 |
| 4 | JGI24752J21851_1000367 | 3300001976 | Bacteria | 6293 |
| 5 | JGI24740J21852_10007712 | 3300001979 | Bacteria | 4352 |
| 6 | JGI24740J21852_10008209 | 3300001979 | Bacteria | 4182 |
| 7 | JGI24739J22299_10001645 | 3300001989 | Bacteria | 8484 |
| 8 | JGI24739J22299_10003318 | 3300001989 | Bacteria | 6140 |
| 9 | JGI24737J22298_10000117 | 3300001990 | Bacteria | 24179 |
| 10 | JGI24743J22301_10000482 | 3300001991 | Bacteria | 4600 |
| 11 | JGI24735J21928_10002989 | 3300002067 | Bacteria | 5820 |
| 12 | JGI24735J21928_10007292 | 3300002067 | Bacteria | 3608 |
| 13 | JGI24750J21931_1000004 | 3300002070 | Bacteria | 25671 |
| 14 | JGI24748J21848_1000044 | 3300002074 | Bacteria | 59119 |
| 15 | JGI24738J21930_10001953 | 3300002075 | Bacteria | 5558 |
| 16 | JGI24738J21930_10003826 | 3300002075 | Bacteria | 3759 |
| 17 | JGI24738J21930_10004092 | 3300002075 | Bacteria | 3600 |
| 18 | JGI24738J21930_10007579 | 3300002075 | Bacteria | 2499 |
| 19 | JGI24034J26672_10000020 | 3300002239 | Bacteria | 122643 |
| 20 | JGI24751J29686_10000242 | 3300002459 | Bacteria | 21927 |
| 21 | JGI25165J46597_1000573 | 3300003214 | Bacteria | 32867 |
| 22 | JGI25153J46596_10000113 | 3300003215 | Bacteria | 92345 |
| 23 | Ga0055525_1000051 | 3300003759 | Bacteria | 240942 |
| 24 | Ga0055542_1000020 | 3300003762 | Bacteria | 335745 |
| 25 | Ga0055529_1000016 | 3300003763 | Bacteria | 364775 |
| 26 | Ga0055536_1000643 | 3300003781 | Bacteria | 23754 |
| 27 | Ga0055536_1003408 | 3300003781 | Bacteria | 8552 |
| 28 | Ga0055536_1008388 | 3300003781 | Bacteria | 4448 |
| 29 | Ga0055530_10000035 | 3300003791 | Bacteria | 117598 |
| 30 | Ga0055531_10003431 | 3300003794 | Bacteria | 10111 |
| 31 | Ga0065704_10000222 | 3300005289 | Bacteria | 73073 |
| 32 | Ga0065712_10077447 | 3300005290 | Bacteria | 3494 |
| 33 | Ga0065715_10096385 | 3300005293 | Bacteria | 3884 |
| 34 | Ga0065707_10083820 | 3300005295 | Bacteria | 8173 |
| 35 | Ga0065707_10086495 | 3300005295 | Bacteria | 5432 |
| 36 | Ga0070658_10000001 | 3300005327 | Bacteria | 856789 |
| 37 | Ga0070658_10000305 | 3300005327 | Bacteria | 42490 |
| 38 | Ga0070658_10000351 | 3300005327 | Bacteria | 39857 |
| 39 | Ga0070658_10019495 | 3300005327 | Bacteria | 5431 |
| 40 | Ga0070658_10064228 | 3300005327 | Bacteria | 2994 |
| 41 | Ga0070658_10085268 | 3300005327 | Bacteria | 2597 |
| 42 | Ga0070683_100001218 | 3300005329 | Bacteria | 19546 |
| 43 | Ga0070683_100009155 | 3300005329 | Bacteria | 8451 |
| 44 | Ga0070683_100035894 | 3300005329 | Bacteria | 4534 |
| 45 | Ga0070690_100000180 | 3300005330 | Bacteria | 32463 |
| 46 | Ga0070690_100037867 | 3300005330 | Bacteria | 3041 |
| 47 | Ga0070670_100001900 | 3300005331 | Bacteria | 17083 |
| 48 | Ga0070670_100002485 | 3300005331 | Bacteria | 15200 |
| 49 | Ga0070670_100004196 | 3300005331 | Bacteria | 12063 |
| 50 | Ga0070670_100006931 | 3300005331 | Bacteria | 9606 |
| 51 | Ga0070670_100028646 | 3300005331 | Bacteria | 4793 |
| 52 | Ga0070670_100035673 | 3300005331 | Bacteria | 4281 |
| 53 | Ga0070670_100036174 | 3300005331 | Bacteria | 4250 |
| 54 | Ga0070670_100062929 | 3300005331 | Bacteria | 3185 |
| 55 | Ga0070677_10000358 | 3300005333 | Bacteria | 15980 |
| 56 | Ga0068869_100001958 | 3300005334 | Bacteria | 12336 |
| 57 | Ga0068869_100053556 | 3300005334 | Bacteria | 2934 |
| 58 | Ga0070666_10000027 | 3300005335 | Bacteria | 151010 |
| 59 | Ga0070666_10000033 | 3300005335 | Bacteria | 121625 |
| 60 | Ga0070666_10000555 | 3300005335 | Bacteria | 22543 |
| 61 | Ga0070666_10000788 | 3300005335 | Bacteria | 19216 |
| 62 | Ga0070666_10002098 | 3300005335 | Bacteria | 12117 |
| 63 | Ga0070666_10020931 | 3300005335 | Bacteria | 4234 |
| 64 | Ga0070666_10034090 | 3300005335 | Bacteria | 3374 |
| 65 | Ga0070680_100000228 | 3300005336 | Bacteria | 37094 |
| 66 | Ga0070680_100000949 | 3300005336 | Bacteria | 20532 |
| 67 | Ga0070680_100041578 | 3300005336 | Bacteria | 3727 |
| 68 | Ga0068868_100000001 | 3300005338 | Bacteria | 282170 |
| 69 | Ga0068868_100000041 | 3300005338 | Bacteria | 69601 |
| 70 | Ga0068868_100000211 | 3300005338 | Bacteria | 39269 |
| 71 | Ga0068868_100000572 | 3300005338 | Bacteria | 24682 |
| 72 | Ga0068868_100017275 | 3300005338 | Bacteria | 5371 |
| 73 | Ga0068868_100049966 | 3300005338 | Bacteria | 3283 |
| 74 | Ga0070660_100000051 | 3300005339 | Bacteria | 68568 |
| 75 | Ga0070660_100000129 | 3300005339 | Bacteria | 47402 |
| 76 | Ga0070660_100005925 | 3300005339 | Bacteria | 8452 |
| 77 | Ga0070660_100007167 | 3300005339 | Bacteria | 7755 |
| 78 | Ga0070660_100025232 | 3300005339 | Bacteria | 4417 |
| 79 | Ga0070660_100064465 | 3300005339 | Bacteria | 2850 |
| 80 | Ga0070689_100051235 | 3300005340 | Bacteria | 3191 |
| 81 | Ga0070661_100000014 | 3300005344 | Bacteria | 158652 |
| 82 | Ga0070661_100000033 | 3300005344 | Bacteria | 111757 |
| 83 | Ga0070661_100008952 | 3300005344 | Bacteria | 6929 |
| 84 | Ga0070661_100023721 | 3300005344 | Bacteria | 4399 |
| 85 | Ga0070661_100049814 | 3300005344 | Bacteria | 3066 |
| 86 | Ga0070668_100000123 | 3300005347 | Bacteria | 48192 |
| 87 | Ga0070669_100000075 | 3300005353 | Bacteria | 98073 |
| 88 | Ga0070669_100000099 | 3300005353 | Bacteria | 85328 |
| 89 | Ga0070669_100000471 | 3300005353 | Bacteria | 30589 |
| 90 | Ga0070669_100000556 | 3300005353 | Bacteria | 27730 |
| 91 | Ga0070669_100043759 | 3300005353 | Bacteria | 3262 |
| 92 | Ga0070675_100000406 | 3300005354 | Bacteria | 29300 |
| 93 | Ga0070675_100007861 | 3300005354 | Bacteria | 8265 |
| 94 | Ga0070671_100000015 | 3300005355 | Bacteria | 166132 |
| 95 | Ga0070671_100000050 | 3300005355 | Bacteria | 80843 |
| 96 | Ga0070671_100000752 | 3300005355 | Bacteria | 23230 |
| 97 | Ga0070671_100000800 | 3300005355 | Bacteria | 22726 |
| 98 | Ga0070671_100001477 | 3300005355 | Bacteria | 17556 |
| 99 | Ga0070671_100001615 | 3300005355 | Bacteria | 16981 |
| 100 | Ga0070671_100001659 | 3300005355 | Bacteria | 16838 |
| 101 | Ga0070671_100002991 | 3300005355 | Bacteria | 13155 |
| 102 | Ga0070671_100003305 | 3300005355 | Bacteria | 12584 |
| 103 | Ga0070671_100011910 | 3300005355 | Bacteria | 6995 |
| 104 | Ga0070671_100015456 | 3300005355 | Bacteria | 6166 |
| 105 | Ga0070671_100020477 | 3300005355 | Bacteria | 5395 |
| 106 | Ga0070671_100028321 | 3300005355 | Bacteria | 4613 |
| 107 | Ga0070674_100000415 | 3300005356 | Bacteria | 21461 |
| 108 | Ga0070673_100001837 | 3300005364 | Bacteria | 12679 |
| 109 | Ga0070673_100027333 | 3300005364 | Bacteria | 4228 |
| 110 | Ga0070673_100031392 | 3300005364 | Bacteria | 3986 |
| 111 | Ga0070673_100032558 | 3300005364 | Bacteria | 3927 |
| 112 | Ga0070673_100077258 | 3300005364 | Bacteria | 2690 |
| 113 | Ga0070688_100010650 | 3300005365 | Bacteria | 5079 |
| 114 | Ga0070659_100000001 | 3300005366 | Bacteria | 576390 |
| 115 | Ga0070659_100000142 | 3300005366 | Bacteria | 55216 |
| 116 | Ga0070659_100004813 | 3300005366 | Bacteria | 9647 |
| 117 | Ga0070659_100009061 | 3300005366 | Bacteria | 7302 |
| 118 | Ga0070659_100013985 | 3300005366 | Bacteria | 5989 |
| 119 | Ga0070659_100020857 | 3300005366 | Bacteria | 4983 |
| 120 | Ga0070659_100091450 | 3300005366 | Bacteria | 2439 |
| 121 | Ga0070659_100145559 | 3300005366 | Bacteria | 1930 |
| 122 | Ga0070667_100000368 | 3300005367 | Bacteria | 49069 |
| 123 | Ga0070667_100001014 | 3300005367 | Bacteria | 25719 |
| 124 | Ga0070667_100003689 | 3300005367 | Bacteria | 13031 |
| 125 | Ga0070667_100005056 | 3300005367 | Bacteria | 11037 |
| 126 | Ga0070667_100008853 | 3300005367 | Bacteria | 8332 |
| 127 | Ga0070667_100012088 | 3300005367 | Bacteria | 7147 |
| 128 | Ga0070667_100012789 | 3300005367 | Bacteria | 6935 |
| 129 | Ga0070667_100043981 | 3300005367 | Bacteria | 3749 |
| 130 | Ga0070667_100047112 | 3300005367 | Bacteria | 3627 |
| 131 | Ga0070667_100048374 | 3300005367 | Bacteria | 3579 |
| 132 | Ga0070714_100084508 | 3300005435 | Bacteria | 2770 |
| 133 | Ga0070713_100008902 | 3300005436 | Bacteria | 7149 |
| 134 | Ga0070705_100002002 | 3300005440 | Bacteria | 10417 |
| 135 | Ga0070663_100004959 | 3300005455 | Bacteria | 7859 |
| 136 | Ga0070678_100000379 | 3300005456 | Bacteria | 20807 |
| 137 | Ga0070678_100003813 | 3300005456 | Bacteria | 8456 |
| 138 | Ga0070662_100000021 | 3300005457 | Bacteria | 93909 |
| 139 | Ga0070662_100000733 | 3300005457 | Bacteria | 20056 |
| 140 | Ga0070662_100000826 | 3300005457 | Bacteria | 19065 |
| 141 | Ga0070662_100003298 | 3300005457 | Bacteria | 10055 |
| 142 | Ga0070662_100008268 | 3300005457 | Bacteria | 6777 |
| 143 | Ga0070662_100011909 | 3300005457 | Bacteria | 5750 |
| 144 | Ga0070662_100016035 | 3300005457 | Bacteria | 5027 |
| 145 | Ga0070662_100021330 | 3300005457 | Bacteria | 4422 |
| 146 | Ga0070662_100072073 | 3300005457 | Bacteria | 2549 |
| 147 | Ga0070681_10090371 | 3300005458 | Bacteria | 3013 |
| 148 | Ga0068867_100011576 | 3300005459 | Bacteria | 6228 |
| 149 | Ga0070685_10000238 | 3300005466 | Bacteria | 36209 |
| 150 | Ga0070679_100000003 | 3300005530 | Bacteria | 307836 |
| 151 | Ga0068853_100000377 | 3300005539 | Bacteria | 30591 |
| 152 | Ga0068853_100003642 | 3300005539 | Bacteria | 11812 |
| 153 | Ga0068853_100007738 | 3300005539 | Bacteria | 8617 |
| 154 | Ga0068853_100046111 | 3300005539 | Bacteria | 3736 |
| 155 | Ga0070672_100001912 | 3300005543 | Bacteria | 13063 |
| 156 | Ga0070672_100012970 | 3300005543 | Bacteria | 5873 |
| 157 | Ga0070686_100000010 | 3300005544 | Bacteria | 192116 |
| 158 | Ga0070686_100003910 | 3300005544 | Bacteria | 8190 |
| 159 | Ga0070696_100012945 | 3300005546 | Bacteria | 5602 |
| 160 | Ga0070696_100014922 | 3300005546 | Bacteria | 5217 |
| 161 | Ga0070693_100000142 | 3300005547 | Bacteria | 32335 |
| 162 | Ga0070693_100021718 | 3300005547 | Bacteria | 3403 |
| 163 | Ga0070665_100000044 | 3300005548 | Bacteria | 276702 |
| 164 | Ga0070665_100000254 | 3300005548 | Bacteria | 88587 |
| 165 | Ga0070665_100000511 | 3300005548 | Bacteria | 55709 |
| 166 | Ga0070665_100000528 | 3300005548 | Bacteria | 53961 |
| 167 | Ga0070665_100000531 | 3300005548 | Bacteria | 53926 |
| 168 | Ga0070665_100000634 | 3300005548 | Bacteria | 47873 |
| 169 | Ga0070665_100004137 | 3300005548 | Bacteria | 15260 |
| 170 | Ga0070665_100009476 | 3300005548 | Bacteria | 9852 |
| 171 | Ga0070665_100023751 | 3300005548 | Bacteria | 6176 |
| 172 | Ga0070665_100028884 | 3300005548 | Bacteria | 5582 |
| 173 | Ga0070665_100034620 | 3300005548 | Bacteria | 5079 |
| 174 | Ga0070665_100071442 | 3300005548 | Bacteria | 3477 |
| 175 | Ga0070665_100085282 | 3300005548 | Bacteria | 3163 |
| 176 | Ga0070665_100089808 | 3300005548 | Bacteria | 3078 |
| 177 | Ga0068855_100000745 | 3300005563 | Bacteria | 40001 |
| 178 | Ga0068855_100008164 | 3300005563 | Bacteria | 12656 |
| 179 | Ga0068855_100016149 | 3300005563 | Bacteria | 8976 |
| 180 | Ga0068855_100021266 | 3300005563 | Bacteria | 7779 |
| 181 | Ga0068855_100154338 | 3300005563 | Bacteria | 2609 |
| 182 | Ga0070664_100000153 | 3300005564 | Bacteria | 47344 |
| 183 | Ga0070664_100001180 | 3300005564 | Bacteria | 20792 |
| 184 | Ga0070664_100007769 | 3300005564 | Bacteria | 8658 |
| 185 | Ga0070664_100015803 | 3300005564 | Bacteria | 6179 |
| 186 | Ga0070664_100037496 | 3300005564 | Bacteria | 4076 |
| 187 | Ga0070664_100063739 | 3300005564 | Bacteria | 3142 |
| 188 | Ga0068857_100007788 | 3300005577 | Bacteria | 9233 |
| 189 | Ga0068857_100054112 | 3300005577 | Bacteria | 3561 |
| 190 | Ga0068857_100066729 | 3300005577 | Bacteria | 3202 |
| 191 | Ga0068854_100007709 | 3300005578 | Bacteria | 6883 |
| 192 | Ga0068854_100025211 | 3300005578 | Bacteria | 4080 |
| 193 | Ga0068854_100057460 | 3300005578 | Bacteria | 2806 |
| 194 | Ga0068854_100101323 | 3300005578 | Bacteria | 2159 |
| 195 | Ga0068856_100000177 | 3300005614 | Bacteria | 66207 |
| 196 | Ga0068856_100000870 | 3300005614 | Bacteria | 32355 |
| 197 | Ga0068856_100006572 | 3300005614 | Bacteria | 11403 |
| 198 | Ga0068856_100015519 | 3300005614 | Bacteria | 7363 |
| 199 | Ga0068852_100000075 | 3300005616 | Bacteria | 69379 |
| 200 | Ga0068852_100000831 | 3300005616 | Bacteria | 20424 |
| 201 | Ga0068852_100001121 | 3300005616 | Bacteria | 17696 |
| 202 | Ga0068852_100015314 | 3300005616 | Bacteria | 5939 |
| 203 | Ga0068852_100069059 | 3300005616 | Bacteria | 3095 |
| 204 | Ga0068852_100071681 | 3300005616 | Bacteria | 3043 |
| 205 | Ga0068852_100096354 | 3300005616 | Bacteria | 2659 |
| 206 | Ga0068852_100110266 | 3300005616 | Bacteria | 2501 |
| 207 | Ga0068859_100000194 | 3300005617 | Bacteria | 59075 |
| 208 | Ga0068859_100000221 | 3300005617 | Bacteria | 56589 |
| 209 | Ga0068859_100004830 | 3300005617 | Bacteria | 13721 |
| 210 | Ga0068859_100017508 | 3300005617 | Bacteria | 7203 |
| 211 | Ga0068859_100018251 | 3300005617 | Bacteria | 7053 |
| 212 | Ga0068864_100000261 | 3300005618 | Bacteria | 47015 |
| 213 | Ga0068864_100000721 | 3300005618 | Bacteria | 27640 |
| 214 | Ga0068864_100001983 | 3300005618 | Bacteria | 16849 |
| 215 | Ga0068864_100004528 | 3300005618 | Bacteria | 11411 |
| 216 | Ga0068864_100020487 | 3300005618 | Bacteria | 5533 |
| 217 | Ga0068864_100031594 | 3300005618 | Bacteria | 4493 |
| 218 | Ga0068864_100047108 | 3300005618 | Bacteria | 3701 |
| 219 | Ga0068861_100000198 | 3300005719 | Bacteria | 32191 |
| 220 | Ga0068861_100005126 | 3300005719 | Bacteria | 8834 |
| 221 | Ga0068861_100051612 | 3300005719 | Bacteria | 3122 |
| 222 | Ga0068851_10002496 | 3300005834 | Bacteria | 8088 |
| 223 | Ga0068851_10003867 | 3300005834 | Bacteria | 6705 |
| 224 | Ga0068851_10014509 | 3300005834 | Bacteria | 3742 |
| 225 | Ga0068863_100000020 | 3300005841 | Bacteria | 198519 |
| 226 | Ga0068863_100000052 | 3300005841 | Bacteria | 125430 |
| 227 | Ga0068863_100000775 | 3300005841 | Bacteria | 32088 |
| 228 | Ga0068863_100001823 | 3300005841 | Bacteria | 21161 |
| 229 | Ga0068863_100003774 | 3300005841 | Bacteria | 14981 |
| 230 | Ga0068863_100008573 | 3300005841 | Bacteria | 9990 |
| 231 | Ga0068863_100010798 | 3300005841 | Bacteria | 8856 |
| 232 | Ga0068863_100012736 | 3300005841 | Bacteria | 8111 |
| 233 | Ga0068858_100000530 | 3300005842 | Bacteria | 39968 |
| 234 | Ga0068858_100000919 | 3300005842 | Bacteria | 30552 |
| 235 | Ga0068858_100001368 | 3300005842 | Bacteria | 25138 |
| 236 | Ga0068858_100002958 | 3300005842 | Bacteria | 17069 |
| 237 | Ga0068858_100004078 | 3300005842 | Bacteria | 14394 |
| 238 | Ga0068858_100004134 | 3300005842 | Bacteria | 14284 |
| 239 | Ga0068858_100011992 | 3300005842 | Bacteria | 8170 |
| 240 | Ga0068858_100017450 | 3300005842 | Bacteria | 6733 |
| 241 | Ga0068858_100032886 | 3300005842 | Bacteria | 4816 |
| 242 | Ga0068860_100000007 | 3300005843 | Bacteria | 429329 |
| 243 | Ga0068860_100000080 | 3300005843 | Bacteria | 170152 |
| 244 | Ga0068860_100000437 | 3300005843 | Bacteria | 52907 |
| 245 | Ga0068860_100000867 | 3300005843 | Bacteria | 33656 |
| 246 | Ga0068860_100005984 | 3300005843 | Bacteria | 12245 |
| 247 | Ga0068860_100023975 | 3300005843 | Bacteria | 5898 |
| 248 | Ga0068862_100000115 | 3300005844 | Bacteria | 94951 |
| 249 | Ga0068862_100000135 | 3300005844 | Bacteria | 85248 |
| 250 | Ga0068862_100000340 | 3300005844 | Bacteria | 50605 |
| 251 | Ga0068862_100004671 | 3300005844 | Bacteria | 11530 |
| 252 | Ga0068862_100019812 | 3300005844 | Bacteria | 5618 |
| 253 | Ga0068862_100023550 | 3300005844 | Bacteria | 5161 |
| 254 | Ga0068862_100038653 | 3300005844 | Bacteria | 4048 |
| 255 | Ga0081455_10000545 | 3300005937 | Bacteria | 48941 |
| 256 | Ga0081539_10018932 | 3300005985 | Bacteria | 4743 |
| 257 | Ga0081539_10042244 | 3300005985 | Bacteria | 2658 |
| 258 | Ga0075368_10000066 | 3300006042 | Bacteria | 25572 |
| 259 | Ga0075364_10003309 | 3300006051 | Bacteria | 9139 |
| 260 | Ga0075432_10005555 | 3300006058 | Bacteria | 4294 |
| 261 | Ga0075362_10000083 | 3300006177 | Bacteria | 26049 |
| 262 | Ga0075362_10000203 | 3300006177 | Bacteria | 16577 |
| 263 | Ga0075367_10002111 | 3300006178 | Bacteria | 8929 |
| 264 | Ga0075366_10001643 | 3300006195 | Bacteria | 11223 |
| 265 | Ga0075366_10002219 | 3300006195 | Bacteria | 9909 |
| 266 | Ga0097621_100012370 | 3300006237 | Bacteria | 6323 |
| 267 | Ga0097621_100021964 | 3300006237 | Bacteria | 4946 |
| 268 | Ga0097621_100025480 | 3300006237 | Bacteria | 4629 |
| 269 | Ga0075370_10000017 | 3300006353 | Bacteria | 60451 |
| 270 | Ga0075370_10003828 | 3300006353 | Bacteria | 7195 |
| 271 | Ga0075370_10008260 | 3300006353 | Bacteria | 5347 |
| 272 | Ga0068871_100010804 | 3300006358 | Bacteria | 6681 |
| 273 | Ga0068871_100017472 | 3300006358 | Bacteria | 5429 |
| 274 | Ga0075431_100121713 | 3300006847 | Bacteria | 2693 |
| 275 | Ga0097620_100000194 | 3300006931 | Bacteria | 59075 |
| 276 | Ga0097620_100000221 | 3300006931 | Bacteria | 56589 |
| 277 | Ga0097620_100004830 | 3300006931 | Bacteria | 13721 |
| 278 | Ga0097620_100017509 | 3300006931 | Bacteria | 7203 |
| 279 | Ga0097620_100018253 | 3300006931 | Bacteria | 7053 |
| 280 | Ga0105251_10003099 | 3300009011 | Bacteria | 12358 |
| 281 | Ga0105251_10030588 | 3300009011 | Bacteria | 2702 |
| 282 | Ga0105240_10016986 | 3300009093 | Bacteria | 9830 |
| 283 | Ga0105240_10077983 | 3300009093 | Bacteria | 4081 |
| 284 | Ga0105240_10093586 | 3300009093 | Bacteria | 3668 |
| 285 | Ga0105245_10000433 | 3300009098 | Bacteria | 38731 |
| 286 | Ga0105245_10005439 | 3300009098 | Bacteria | 11188 |
| 287 | Ga0105245_10040803 | 3300009098 | Bacteria | 4136 |
| 288 | Ga0105247_10020284 | 3300009101 | Bacteria | 3997 |
| 289 | Ga0114129_10074815 | 3300009147 | Bacteria | 4717 |
| 290 | Ga0105243_10000038 | 3300009148 | Bacteria | 174351 |
| 291 | Ga0105248_10000442 | 3300009177 | Bacteria | 47089 |
| 292 | Ga0105248_10000502 | 3300009177 | Bacteria | 44596 |
| 293 | Ga0105248_10000604 | 3300009177 | Bacteria | 40877 |
| 294 | Ga0105248_10000801 | 3300009177 | Bacteria | 35327 |
| 295 | Ga0105248_10003885 | 3300009177 | Bacteria | 16517 |
| 296 | Ga0105248_10009214 | 3300009177 | Bacteria | 10858 |
| 297 | Ga0105248_10104307 | 3300009177 | Bacteria | 3196 |
| 298 | Ga0105237_10106751 | 3300009545 | Bacteria | 2792 |
| 299 | Ga0105238_10004331 | 3300009551 | Bacteria | 14084 |
| 300 | Ga0105238_10023652 | 3300009551 | Bacteria | 6260 |
| 301 | Ga0105249_10000064 | 3300009553 | Bacteria | 151646 |
| 302 | Ga0105249_10000097 | 3300009553 | Bacteria | 120886 |
| 303 | Ga0105249_10002825 | 3300009553 | Bacteria | 14980 |
| 304 | Ga0105249_10018924 | 3300009553 | Bacteria | 6138 |
| 305 | Ga0157371_10000146 | 3300013102 | Bacteria | 103290 |
| 306 | Ga0157371_10073407 | 3300013102 | Bacteria | 2423 |
| 307 | Ga0157370_10017554 | 3300013104 | Bacteria | 7219 |
| 308 | Ga0157369_10021850 | 3300013105 | Bacteria | 7152 |
| 309 | Ga0157369_10056748 | 3300013105 | Bacteria | 4225 |
| 310 | Ga0157369_10069699 | 3300013105 | Bacteria | 3778 |
| 311 | Ga0157369_10094835 | 3300013105 | Bacteria | 3185 |
| 312 | Ga0157369_10105813 | 3300013105 | Bacteria | 2995 |
| 313 | Ga0157374_10101468 | 3300013296 | Bacteria | 2759 |
| 314 | Ga0157378_10011418 | 3300013297 | Bacteria | 7776 |
| 315 | Ga0157378_10021971 | 3300013297 | Bacteria | 5611 |
| 316 | Ga0163162_10014045 | 3300013306 | Bacteria | 7827 |
| 317 | Ga0163162_10086284 | 3300013306 | Bacteria | 3216 |
| 318 | Ga0163162_10098967 | 3300013306 | Bacteria | 3006 |
| 319 | Ga0157372_10066187 | 3300013307 | Bacteria | 4059 |
| 320 | Ga0157375_10083746 | 3300013308 | Bacteria | 3235 |
| 321 | Ga0163163_10000164 | 3300014325 | Bacteria | 69244 |
| 322 | Ga0163163_10001448 | 3300014325 | Bacteria | 20044 |
| 323 | Ga0163163_10004133 | 3300014325 | Bacteria | 12362 |
| 324 | Ga0163163_10031150 | 3300014325 | Bacteria | 5146 |
| 325 | Ga0157380_10000086 | 3300014326 | Bacteria | 51604 |
| 326 | Ga0157380_10000723 | 3300014326 | Bacteria | 20585 |
| 327 | Ga0157379_10002697 | 3300014968 | Bacteria | 14964 |
| 328 | Ga0157379_10004711 | 3300014968 | Bacteria | 11712 |
| 329 | Ga0157379_10027193 | 3300014968 | Bacteria | 5093 |
| 330 | Ga0157379_10089995 | 3300014968 | Bacteria | 2753 |
| 331 | Ga0157376_10035122 | 3300014969 | Bacteria | 4053 |
| 332 | Ga0163161_10000110 | 3300017792 | Bacteria | 78102 |
| 333 | Ga0163161_10001335 | 3300017792 | Bacteria | 18330 |
| 334 | Ga0213873_10000007 | 3300021358 | Bacteria | 309961 |
| 335 | Ga0213876_10000005 | 3300021384 | Bacteria | 727326 |
| 336 | Ga0213876_10000336 | 3300021384 | Bacteria | 40986 |
| 337 | Ga0213875_10000105 | 3300021388 | Bacteria | 96051 |
| 338 | Ga0209563_100019 | 3300025230 | Bacteria | 697828 |
| 339 | Ga0209148_1000017 | 3300025254 | Bacteria | 787064 |
| 340 | Ga0209233_1000414 | 3300025261 | Bacteria | 32922 |
| 341 | Ga0209455_1000005 | 3300025272 | Bacteria | 1416756 |
| 342 | Ga0209455_1009979 | 3300025272 | Bacteria | 2450 |
| 343 | Ga0209675_1000076 | 3300025291 | Bacteria | 159428 |
| 344 | Ga0209676_1000070 | 3300025292 | Bacteria | 312074 |
| 345 | Ga0209676_1000454 | 3300025292 | Bacteria | 69136 |
| 346 | Ga0209676_1000637 | 3300025292 | Bacteria | 50380 |
| 347 | Ga0209758_1000035 | 3300025297 | Bacteria | 448190 |
| 348 | Ga0209050_1000042 | 3300025298 | Bacteria | 402842 |
| 349 | Ga0209050_1000929 | 3300025298 | Bacteria | 38383 |
| 350 | Ga0209257_1000285 | 3300025304 | Bacteria | 112113 |
| 351 | Ga0209257_1001860 | 3300025304 | Bacteria | 22903 |
| 352 | Ga0209257_1002873 | 3300025304 | Bacteria | 16051 |
| 353 | Ga0207697_10000215 | 3300025315 | Bacteria | 30925 |
| 354 | Ga0207697_10000296 | 3300025315 | Bacteria | 27773 |
| 355 | Ga0207656_10001865 | 3300025321 | Bacteria | 7011 |
| 356 | Ga0207656_10005012 | 3300025321 | Bacteria | 4654 |
| 357 | Ga0207656_10020325 | 3300025321 | Bacteria | 2638 |
| 358 | Ga0207713_1007781 | 3300025735 | Bacteria | 6256 |
| 359 | Ga0207682_10000194 | 3300025893 | Bacteria | 27727 |
| 360 | Ga0207682_10000643 | 3300025893 | Bacteria | 16285 |
| 361 | Ga0207682_10017553 | 3300025893 | Bacteria | 2795 |
| 362 | Ga0207710_10001018 | 3300025900 | Bacteria | 14639 |
| 363 | Ga0207680_10000009 | 3300025903 | Bacteria | 464571 |
| 364 | Ga0207680_10000166 | 3300025903 | Bacteria | 32189 |
| 365 | Ga0207680_10005824 | 3300025903 | Bacteria | 5915 |
| 366 | Ga0207680_10069316 | 3300025903 | Bacteria | 2179 |
| 367 | Ga0207647_10000684 | 3300025904 | Bacteria | 26599 |
| 368 | Ga0207647_10000986 | 3300025904 | Bacteria | 22064 |
| 369 | Ga0207647_10003840 | 3300025904 | Bacteria | 11240 |
| 370 | Ga0207647_10006533 | 3300025904 | Bacteria | 8472 |
| 371 | Ga0207647_10007669 | 3300025904 | Bacteria | 7776 |
| 372 | Ga0207647_10016359 | 3300025904 | Bacteria | 5064 |
| 373 | Ga0207647_10036609 | 3300025904 | Bacteria | 3117 |
| 374 | Ga0207645_10008483 | 3300025907 | Bacteria | 7167 |
| 375 | Ga0207645_10030311 | 3300025907 | Bacteria | 3485 |
| 376 | Ga0207645_10038553 | 3300025907 | Bacteria | 3064 |
| 377 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 378 | Ga0207705_10000075 | 3300025909 | Bacteria | 123551 |
| 379 | Ga0207705_10000174 | 3300025909 | Bacteria | 68260 |
| 380 | Ga0207705_10000220 | 3300025909 | Bacteria | 56835 |
| 381 | Ga0207705_10012782 | 3300025909 | Bacteria | 6060 |
| 382 | Ga0207705_10014602 | 3300025909 | Bacteria | 5652 |
| 383 | Ga0207705_10038837 | 3300025909 | Bacteria | 3410 |
| 384 | Ga0207705_10086640 | 3300025909 | Bacteria | 2289 |
| 385 | Ga0207707_10032753 | 3300025912 | Bacteria | 4549 |
| 386 | Ga0207707_10080911 | 3300025912 | Bacteria | 2836 |
| 387 | Ga0207695_10003071 | 3300025913 | Bacteria | 23930 |
| 388 | Ga0207695_10006373 | 3300025913 | Bacteria | 15352 |
| 389 | Ga0207695_10017590 | 3300025913 | Bacteria | 8308 |
| 390 | Ga0207695_10100964 | 3300025913 | Bacteria | 2880 |
| 391 | Ga0207671_10001965 | 3300025914 | Bacteria | 22681 |
| 392 | Ga0207671_10011180 | 3300025914 | Bacteria | 7328 |
| 393 | Ga0207671_10027346 | 3300025914 | Bacteria | 4265 |
| 394 | Ga0207660_10000692 | 3300025917 | Bacteria | 22532 |
| 395 | Ga0207660_10006353 | 3300025917 | Bacteria | 7661 |
| 396 | Ga0207660_10009765 | 3300025917 | Bacteria | 6212 |
| 397 | Ga0207660_10033018 | 3300025917 | Bacteria | 3576 |
| 398 | Ga0207660_10049935 | 3300025917 | Bacteria | 2969 |
| 399 | Ga0207657_10000173 | 3300025919 | Bacteria | 66220 |
| 400 | Ga0207657_10000262 | 3300025919 | Bacteria | 55933 |
| 401 | Ga0207657_10002388 | 3300025919 | Bacteria | 20300 |
| 402 | Ga0207657_10003423 | 3300025919 | Bacteria | 16942 |
| 403 | Ga0207657_10005157 | 3300025919 | Bacteria | 13704 |
| 404 | Ga0207657_10008356 | 3300025919 | Bacteria | 10511 |
| 405 | Ga0207657_10054380 | 3300025919 | Bacteria | 3462 |
| 406 | Ga0207657_10076385 | 3300025919 | Bacteria | 2826 |
| 407 | Ga0207657_10100930 | 3300025919 | Bacteria | 2395 |
| 408 | Ga0207649_10000014 | 3300025920 | Bacteria | 255001 |
| 409 | Ga0207649_10000055 | 3300025920 | Bacteria | 103054 |
| 410 | Ga0207649_10000365 | 3300025920 | Bacteria | 33919 |
| 411 | Ga0207649_10004475 | 3300025920 | Bacteria | 7584 |
| 412 | Ga0207649_10025609 | 3300025920 | Bacteria | 3441 |
| 413 | Ga0207649_10026407 | 3300025920 | Bacteria | 3397 |
| 414 | Ga0207649_10032471 | 3300025920 | Bacteria | 3112 |
| 415 | Ga0207652_10000004 | 3300025921 | Bacteria | 436303 |
| 416 | Ga0207652_10004551 | 3300025921 | Bacteria | 11254 |
| 417 | Ga0207681_10000002 | 3300025923 | Bacteria | 985597 |
| 418 | Ga0207681_10000106 | 3300025923 | Bacteria | 71721 |
| 419 | Ga0207681_10000174 | 3300025923 | Bacteria | 52934 |
| 420 | Ga0207681_10034443 | 3300025923 | Bacteria | 3330 |
| 421 | Ga0207694_10001479 | 3300025924 | Bacteria | 20088 |
| 422 | Ga0207694_10021129 | 3300025924 | Bacteria | 4930 |
| 423 | Ga0207694_10031031 | 3300025924 | Bacteria | 4081 |
| 424 | Ga0207694_10036124 | 3300025924 | Bacteria | 3791 |
| 425 | Ga0207650_10001849 | 3300025925 | Bacteria | 14923 |
| 426 | Ga0207650_10005752 | 3300025925 | Bacteria | 8457 |
| 427 | Ga0207650_10008430 | 3300025925 | Bacteria | 7035 |
| 428 | Ga0207650_10012125 | 3300025925 | Bacteria | 5941 |
| 429 | Ga0207650_10019778 | 3300025925 | Bacteria | 4736 |
| 430 | Ga0207650_10037075 | 3300025925 | Bacteria | 3551 |
| 431 | Ga0207650_10063445 | 3300025925 | Bacteria | 2762 |
| 432 | Ga0207687_10045967 | 3300025927 | Bacteria | 3020 |
| 433 | Ga0207687_10050169 | 3300025927 | Bacteria | 2904 |
| 434 | Ga0207687_10101647 | 3300025927 | Bacteria | 2116 |
| 435 | Ga0207664_10016602 | 3300025929 | Bacteria | 5376 |
| 436 | Ga0207664_10094032 | 3300025929 | Bacteria | 2463 |
| 437 | Ga0207644_10000002 | 3300025931 | Bacteria | 942221 |
| 438 | Ga0207644_10000003 | 3300025931 | Bacteria | 585905 |
| 439 | Ga0207644_10000061 | 3300025931 | Bacteria | 79079 |
| 440 | Ga0207644_10000456 | 3300025931 | Bacteria | 26391 |
| 441 | Ga0207644_10000530 | 3300025931 | Bacteria | 24696 |
| 442 | Ga0207644_10000616 | 3300025931 | Bacteria | 22668 |
| 443 | Ga0207644_10000919 | 3300025931 | Bacteria | 18675 |
| 444 | Ga0207644_10002341 | 3300025931 | Bacteria | 12242 |
| 445 | Ga0207644_10004475 | 3300025931 | Bacteria | 9075 |
| 446 | Ga0207644_10015164 | 3300025931 | Bacteria | 5170 |
| 447 | Ga0207644_10016202 | 3300025931 | Bacteria | 5015 |
| 448 | Ga0207644_10035745 | 3300025931 | Bacteria | 3483 |
| 449 | Ga0207644_10037956 | 3300025931 | Bacteria | 3391 |
| 450 | Ga0207644_10045671 | 3300025931 | Bacteria | 3117 |
| 451 | Ga0207690_10000051 | 3300025932 | Bacteria | 107367 |
| 452 | Ga0207690_10000150 | 3300025932 | Bacteria | 55157 |
| 453 | Ga0207690_10002274 | 3300025932 | Bacteria | 11712 |
| 454 | Ga0207690_10006008 | 3300025932 | Bacteria | 7194 |
| 455 | Ga0207690_10010440 | 3300025932 | Bacteria | 5519 |
| 456 | Ga0207690_10036104 | 3300025932 | Bacteria | 3198 |
| 457 | Ga0207690_10066241 | 3300025932 | Bacteria | 2473 |
| 458 | Ga0207690_10069184 | 3300025932 | Bacteria | 2428 |
| 459 | Ga0207706_10000103 | 3300025933 | Bacteria | 89756 |
| 460 | Ga0207706_10000459 | 3300025933 | Bacteria | 43399 |
| 461 | Ga0207706_10000479 | 3300025933 | Bacteria | 42802 |
| 462 | Ga0207706_10004155 | 3300025933 | Bacteria | 13646 |
| 463 | Ga0207706_10013288 | 3300025933 | Bacteria | 7490 |
| 464 | Ga0207709_10000031 | 3300025935 | Bacteria | 329046 |
| 465 | Ga0207669_10000057 | 3300025937 | Bacteria | 56270 |
| 466 | Ga0207669_10008227 | 3300025937 | Bacteria | 4887 |
| 467 | Ga0207669_10017984 | 3300025937 | Bacteria | 3641 |
| 468 | Ga0207669_10065892 | 3300025937 | Bacteria | 2249 |
| 469 | Ga0207704_10008556 | 3300025938 | Bacteria | 4899 |
| 470 | Ga0207691_10001051 | 3300025940 | Bacteria | 27433 |
| 471 | Ga0207691_10001329 | 3300025940 | Bacteria | 24679 |
| 472 | Ga0207691_10015613 | 3300025940 | Bacteria | 7219 |
| 473 | Ga0207691_10062346 | 3300025940 | Bacteria | 3383 |
| 474 | Ga0207711_10000042 | 3300025941 | Bacteria | 158782 |
| 475 | Ga0207711_10000526 | 3300025941 | Bacteria | 39259 |
| 476 | Ga0207711_10001142 | 3300025941 | Bacteria | 25262 |
| 477 | Ga0207711_10001694 | 3300025941 | Bacteria | 20284 |
| 478 | Ga0207711_10002857 | 3300025941 | Bacteria | 15139 |
| 479 | Ga0207711_10004897 | 3300025941 | Bacteria | 11367 |
| 480 | Ga0207711_10014914 | 3300025941 | Bacteria | 6455 |
| 481 | Ga0207711_10025172 | 3300025941 | Bacteria | 4993 |
| 482 | Ga0207689_10018710 | 3300025942 | Bacteria | 5842 |
| 483 | Ga0207661_10019846 | 3300025944 | Bacteria | 5015 |
| 484 | Ga0207661_10032507 | 3300025944 | Bacteria | 4042 |
| 485 | Ga0207679_10000874 | 3300025945 | Bacteria | 19215 |
| 486 | Ga0207679_10004310 | 3300025945 | Bacteria | 8850 |
| 487 | Ga0207679_10006770 | 3300025945 | Bacteria | 7260 |
| 488 | Ga0207679_10017921 | 3300025945 | Bacteria | 4732 |
| 489 | Ga0207667_10000552 | 3300025949 | Bacteria | 49276 |
| 490 | Ga0207667_10001537 | 3300025949 | Bacteria | 29015 |
| 491 | Ga0207667_10008643 | 3300025949 | Bacteria | 12077 |
| 492 | Ga0207667_10015289 | 3300025949 | Bacteria | 8725 |
| 493 | Ga0207667_10018486 | 3300025949 | Bacteria | 7814 |
| 494 | Ga0207667_10069479 | 3300025949 | Bacteria | 3666 |
| 495 | Ga0207667_10115870 | 3300025949 | Bacteria | 2762 |
| 496 | Ga0207651_10002050 | 3300025960 | Bacteria | 9483 |
| 497 | Ga0207651_10004326 | 3300025960 | Bacteria | 7133 |
| 498 | Ga0207651_10005791 | 3300025960 | Bacteria | 6382 |
| 499 | Ga0207651_10029392 | 3300025960 | Bacteria | 3481 |
| 500 | Ga0207651_10049091 | 3300025960 | Bacteria | 2857 |
| 501 | Ga0207712_10000044 | 3300025961 | Bacteria | 171240 |
| 502 | Ga0207712_10000074 | 3300025961 | Bacteria | 120822 |
| 503 | Ga0207712_10001308 | 3300025961 | Bacteria | 17062 |
| 504 | Ga0207712_10001774 | 3300025961 | Bacteria | 14378 |
| 505 | Ga0207668_10000085 | 3300025972 | Bacteria | 70401 |
| 506 | Ga0207668_10002722 | 3300025972 | Bacteria | 10347 |
| 507 | Ga0207668_10040021 | 3300025972 | Bacteria | 3159 |
| 508 | Ga0207640_10000996 | 3300025981 | Bacteria | 15684 |
| 509 | Ga0207640_10007677 | 3300025981 | Bacteria | 5961 |
| 510 | Ga0207640_10054718 | 3300025981 | Bacteria | 2610 |
| 511 | Ga0207658_10000340 | 3300025986 | Bacteria | 46680 |
| 512 | Ga0207658_10000381 | 3300025986 | Bacteria | 43297 |
| 513 | Ga0207658_10001750 | 3300025986 | Bacteria | 16338 |
| 514 | Ga0207658_10001909 | 3300025986 | Bacteria | 15589 |
| 515 | Ga0207658_10007570 | 3300025986 | Bacteria | 7396 |
| 516 | Ga0207658_10007960 | 3300025986 | Bacteria | 7218 |
| 517 | Ga0207658_10010162 | 3300025986 | Bacteria | 6397 |
| 518 | Ga0207658_10010577 | 3300025986 | Bacteria | 6269 |
| 519 | Ga0207658_10013379 | 3300025986 | Bacteria | 5604 |
| 520 | Ga0207658_10021015 | 3300025986 | Bacteria | 4525 |
| 521 | Ga0207677_10000013 | 3300026023 | Bacteria | 186519 |
| 522 | Ga0207677_10001135 | 3300026023 | Bacteria | 14530 |
| 523 | Ga0207677_10001325 | 3300026023 | Bacteria | 13285 |
| 524 | Ga0207677_10006612 | 3300026023 | Bacteria | 6360 |
| 525 | Ga0207703_10000484 | 3300026035 | Bacteria | 41489 |
| 526 | Ga0207703_10002018 | 3300026035 | Bacteria | 17909 |
| 527 | Ga0207703_10002526 | 3300026035 | Bacteria | 15808 |
| 528 | Ga0207703_10003985 | 3300026035 | Bacteria | 12235 |
| 529 | Ga0207703_10005559 | 3300026035 | Bacteria | 10116 |
| 530 | Ga0207703_10011932 | 3300026035 | Bacteria | 6767 |
| 531 | Ga0207703_10012583 | 3300026035 | Bacteria | 6595 |
| 532 | Ga0207703_10026625 | 3300026035 | Bacteria | 4553 |
| 533 | Ga0207703_10038745 | 3300026035 | Bacteria | 3806 |
| 534 | Ga0207639_10000393 | 3300026041 | Bacteria | 30170 |
| 535 | Ga0207639_10001063 | 3300026041 | Bacteria | 18630 |
| 536 | Ga0207639_10001152 | 3300026041 | Bacteria | 17962 |
| 537 | Ga0207639_10008338 | 3300026041 | Bacteria | 7102 |
| 538 | Ga0207639_10032359 | 3300026041 | Bacteria | 3849 |
| 539 | Ga0207639_10040928 | 3300026041 | Bacteria | 3463 |
| 540 | Ga0207639_10065717 | 3300026041 | Bacteria | 2816 |
| 541 | Ga0207678_10008943 | 3300026067 | Bacteria | 8819 |
| 542 | Ga0207678_10010290 | 3300026067 | Bacteria | 8210 |
| 543 | Ga0207678_10010565 | 3300026067 | Bacteria | 8111 |
| 544 | Ga0207678_10070194 | 3300026067 | Bacteria | 3004 |
| 545 | Ga0207702_10001262 | 3300026078 | Bacteria | 25506 |
| 546 | Ga0207702_10001379 | 3300026078 | Bacteria | 24214 |
| 547 | Ga0207702_10003005 | 3300026078 | Bacteria | 15678 |
| 548 | Ga0207702_10005295 | 3300026078 | Bacteria | 11316 |
| 549 | Ga0207702_10007361 | 3300026078 | Bacteria | 9400 |
| 550 | Ga0207641_10000001 | 3300026088 | Bacteria | 1180841 |
| 551 | Ga0207641_10000042 | 3300026088 | Bacteria | 186384 |
| 552 | Ga0207641_10000415 | 3300026088 | Bacteria | 49760 |
| 553 | Ga0207641_10005614 | 3300026088 | Bacteria | 10688 |
| 554 | Ga0207641_10005984 | 3300026088 | Bacteria | 10308 |
| 555 | Ga0207641_10009236 | 3300026088 | Bacteria | 8131 |
| 556 | Ga0207641_10013949 | 3300026088 | Bacteria | 6589 |
| 557 | Ga0207641_10019191 | 3300026088 | Bacteria | 5609 |
| 558 | Ga0207641_10021901 | 3300026088 | Bacteria | 5254 |
| 559 | Ga0207641_10023713 | 3300026088 | Bacteria | 5055 |
| 560 | Ga0207641_10048153 | 3300026088 | Bacteria | 3597 |
| 561 | Ga0207648_10001953 | 3300026089 | Bacteria | 22530 |
| 562 | Ga0207648_10005222 | 3300026089 | Bacteria | 13134 |
| 563 | Ga0207648_10009147 | 3300026089 | Bacteria | 9522 |
| 564 | Ga0207676_10000456 | 3300026095 | Bacteria | 34458 |
| 565 | Ga0207676_10002207 | 3300026095 | Bacteria | 14055 |
| 566 | Ga0207676_10003783 | 3300026095 | Bacteria | 10696 |
| 567 | Ga0207676_10003902 | 3300026095 | Bacteria | 10534 |
| 568 | Ga0207676_10004793 | 3300026095 | Bacteria | 9599 |
| 569 | Ga0207676_10010113 | 3300026095 | Bacteria | 6714 |
| 570 | Ga0207676_10025535 | 3300026095 | Bacteria | 4383 |
| 571 | Ga0207676_10026126 | 3300026095 | Bacteria | 4340 |
| 572 | Ga0207676_10030259 | 3300026095 | Bacteria | 4062 |
| 573 | Ga0207674_10000283 | 3300026116 | Bacteria | 64153 |
| 574 | Ga0207674_10000632 | 3300026116 | Bacteria | 45854 |
| 575 | Ga0207674_10002193 | 3300026116 | Bacteria | 24722 |
| 576 | Ga0207674_10002478 | 3300026116 | Bacteria | 23285 |
| 577 | Ga0207674_10004313 | 3300026116 | Bacteria | 17140 |
| 578 | Ga0207674_10004629 | 3300026116 | Bacteria | 16511 |
| 579 | Ga0207674_10031182 | 3300026116 | Bacteria | 5602 |
| 580 | Ga0207674_10043855 | 3300026116 | Bacteria | 4610 |
| 581 | Ga0207674_10108865 | 3300026116 | Bacteria | 2747 |
| 582 | Ga0207674_10173638 | 3300026116 | Bacteria | 2108 |
| 583 | Ga0207675_100000169 | 3300026118 | Bacteria | 58328 |
| 584 | Ga0207675_100000207 | 3300026118 | Bacteria | 54791 |
| 585 | Ga0207675_100000671 | 3300026118 | Bacteria | 33681 |
| 586 | Ga0207683_10003996 | 3300026121 | Bacteria | 12787 |
| 587 | Ga0207683_10004793 | 3300026121 | Bacteria | 11648 |
| 588 | Ga0207698_10000005 | 3300026142 | Bacteria | 295687 |
| 589 | Ga0207698_10000457 | 3300026142 | Bacteria | 23684 |
| 590 | Ga0207698_10010915 | 3300026142 | Bacteria | 5867 |
| 591 | Ga0207698_10019069 | 3300026142 | Bacteria | 4687 |
| 592 | Ga0207698_10022589 | 3300026142 | Bacteria | 4375 |
| 593 | Ga0207698_10029001 | 3300026142 | Bacteria | 3957 |
| 594 | Ga0207698_10051140 | 3300026142 | Bacteria | 3157 |
| 595 | Ga0207698_10091496 | 3300026142 | Bacteria | 2490 |
| 596 | Ga0209813_10000402 | 3300027866 | Bacteria | 10625 |
| 597 | Ga0209974_10006875 | 3300027876 | Bacteria | 3947 |
| 598 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 599 | Ga0268266_10000069 | 3300028379 | Bacteria | 239714 |
| 600 | Ga0268266_10000187 | 3300028379 | Bacteria | 110229 |
| 601 | Ga0268266_10000215 | 3300028379 | Bacteria | 100801 |
| 602 | Ga0268266_10000518 | 3300028379 | Bacteria | 54434 |
| 603 | Ga0268266_10002822 | 3300028379 | Bacteria | 18125 |
| 604 | Ga0268266_10003658 | 3300028379 | Bacteria | 15192 |
| 605 | Ga0268266_10017014 | 3300028379 | Bacteria | 6212 |
| 606 | Ga0268266_10019148 | 3300028379 | Bacteria | 5829 |
| 607 | Ga0268266_10033464 | 3300028379 | Bacteria | 4369 |
| 608 | Ga0268265_10000100 | 3300028380 | Bacteria | 108659 |
| 609 | Ga0268265_10000152 | 3300028380 | Bacteria | 85229 |
| 610 | Ga0268265_10000241 | 3300028380 | Bacteria | 62423 |
| 611 | Ga0268265_10002755 | 3300028380 | Bacteria | 12978 |
| 612 | Ga0268265_10007193 | 3300028380 | Bacteria | 7521 |
| 613 | Ga0268265_10016778 | 3300028380 | Bacteria | 5040 |
| 614 | Ga0268265_10025502 | 3300028380 | Bacteria | 4198 |
| 615 | Ga0268265_10032662 | 3300028380 | Bacteria | 3774 |
| 616 | Ga0268265_10046685 | 3300028380 | Bacteria | 3239 |
| 617 | Ga0268265_10087442 | 3300028380 | Bacteria | 2479 |
| 618 | Ga0268264_10000010 | 3300028381 | Bacteria | 596543 |
| 619 | Ga0268264_10000131 | 3300028381 | Bacteria | 181459 |
| 620 | Ga0268264_10000134 | 3300028381 | Bacteria | 179475 |
| 621 | Ga0268264_10000710 | 3300028381 | Bacteria | 38345 |
| 622 | Ga0268264_10001517 | 3300028381 | Bacteria | 21645 |
| 623 | Ga0268264_10001849 | 3300028381 | Bacteria | 19271 |
| 624 | Ga0268264_10011515 | 3300028381 | Bacteria | 7306 |
| 625 | Ga0268264_10021234 | 3300028381 | Bacteria | 5304 |
| 626 | Ga0268264_10035064 | 3300028381 | Bacteria | 4131 |
| 627 | Ga0307517_10026378 | 3300028786 | Bacteria | 7045 |
| 628 | Ga0307513_10004225 | 3300031456 | Bacteria | 19204 |
| 629 | Ga0307408_100005051 | 3300031548 | Bacteria | 8852 |
| 630 | Ga0307408_100035206 | 3300031548 | Bacteria | 3512 |
| 631 | Ga0307408_100042401 | 3300031548 | Bacteria | 3232 |
| 632 | Ga0307508_10000479 | 3300031616 | Bacteria | 48265 |
| 633 | Ga0307508_10008321 | 3300031616 | Bacteria | 9593 |
| 634 | Ga0307405_10007070 | 3300031731 | Bacteria | 5579 |
| 635 | Ga0307405_10009125 | 3300031731 | Bacteria | 5072 |
| 636 | Ga0307405_10011231 | 3300031731 | Bacteria | 4682 |
| 637 | Ga0307405_10027898 | 3300031731 | Bacteria | 3281 |
| 638 | Ga0307413_10002207 | 3300031824 | Bacteria | 7836 |
| 639 | Ga0307410_10004659 | 3300031852 | Bacteria | 7126 |
| 640 | Ga0307410_10006077 | 3300031852 | Bacteria | 6474 |
| 641 | Ga0307410_10009323 | 3300031852 | Bacteria | 5499 |
| 642 | Ga0307410_10010561 | 3300031852 | Bacteria | 5238 |
| 643 | Ga0307410_10010875 | 3300031852 | Bacteria | 5181 |
| 644 | Ga0307410_10017255 | 3300031852 | Bacteria | 4329 |
| 645 | Ga0307410_10045348 | 3300031852 | Bacteria | 2926 |
| 646 | Ga0307410_10066360 | 3300031852 | Bacteria | 2485 |
| 647 | Ga0307410_10075233 | 3300031852 | Bacteria | 2354 |
| 648 | Ga0307406_10005488 | 3300031901 | Bacteria | 6939 |
| 649 | Ga0307406_10025358 | 3300031901 | Bacteria | 3549 |
| 650 | Ga0307406_10071997 | 3300031901 | Bacteria | 2267 |
| 651 | Ga0307407_10035879 | 3300031903 | Bacteria | 2727 |
| 652 | Ga0307412_10006578 | 3300031911 | Bacteria | 6581 |
| 653 | Ga0307412_10007459 | 3300031911 | Bacteria | 6205 |
| 654 | Ga0307412_10020528 | 3300031911 | Bacteria | 4022 |
| 655 | Ga0307412_10030265 | 3300031911 | Bacteria | 3406 |
| 656 | Ga0307412_10043661 | 3300031911 | Bacteria | 2920 |
| 657 | Ga0307409_100007554 | 3300031995 | Bacteria | 6514 |
| 658 | Ga0307409_100050467 | 3300031995 | Bacteria | 3177 |
| 659 | Ga0307409_100063402 | 3300031995 | Bacteria | 2898 |
| 660 | Ga0307409_100069309 | 3300031995 | Bacteria | 2793 |
| 661 | Ga0307409_100075339 | 3300031995 | Bacteria | 2701 |
| 662 | Ga0307409_100083438 | 3300031995 | Bacteria | 2591 |
| 663 | Ga0307409_100147381 | 3300031995 | Bacteria | 2037 |
| 664 | Ga0307416_100004453 | 3300032002 | Bacteria | 8447 |
| 665 | Ga0307416_100056406 | 3300032002 | Bacteria | 3170 |
| 666 | Ga0307416_100129765 | 3300032002 | Bacteria | 2266 |
| 667 | Ga0307414_10001217 | 3300032004 | Bacteria | 13256 |
| 668 | Ga0307414_10002805 | 3300032004 | Bacteria | 9179 |
| 669 | Ga0307414_10004094 | 3300032004 | Bacteria | 7868 |
| 670 | Ga0307414_10010149 | 3300032004 | Bacteria | 5449 |
| 671 | Ga0307414_10016511 | 3300032004 | Bacteria | 4490 |
| 672 | Ga0307414_10034082 | 3300032004 | Bacteria | 3371 |
| 673 | Ga0307414_10037112 | 3300032004 | Bacteria | 3260 |
| 674 | Ga0307414_10083811 | 3300032004 | Bacteria | 2342 |
| 675 | Ga0307411_10001507 | 3300032005 | Bacteria | 9583 |
| 676 | Ga0307411_10001967 | 3300032005 | Bacteria | 8805 |
| 677 | Ga0307411_10005401 | 3300032005 | Bacteria | 6272 |
| 678 | Ga0307411_10009354 | 3300032005 | Bacteria | 5146 |
| 679 | Ga0307411_10013451 | 3300032005 | Bacteria | 4516 |
| 680 | Ga0307411_10016664 | 3300032005 | Bacteria | 4163 |
| 681 | Ga0307411_10023501 | 3300032005 | Bacteria | 3653 |
| 682 | Ga0307411_10045292 | 3300032005 | Bacteria | 2829 |
| 683 | Ga0307415_100000799 | 3300032126 | Bacteria | 14309 |
| 684 | Ga0307415_100002317 | 3300032126 | Bacteria | 9455 |
| 685 | Ga0307415_100009039 | 3300032126 | Bacteria | 5560 |
| 686 | Ga0307415_100029131 | 3300032126 | Bacteria | 3524 |
| 687 | Ga0307415_100031045 | 3300032126 | Bacteria | 3437 |
| 688 | Ga0307415_100034705 | 3300032126 | Bacteria | 3288 |
| 689 | Ga0373943_0034418 | 3300035170 | Bacteria | 2416 |
| 690 | Ga0373931_0049228 | 3300035691 | Bacteria | 2237 |
| 691 | Ga0316582_0019261 | 3300036647 | Bacteria | 3990 |
| 692 | Ga0395899_0000691 | 3300037312 | Bacteria | 33969 |
| 693 | Ga0395899_0000936 | 3300037312 | Bacteria | 27504 |
| 694 | Ga0395899_0006865 | 3300037312 | Bacteria | 8818 |
| 695 | Ga0395899_0020623 | 3300037312 | Bacteria | 4996 |
| 696 | Ga0395899_0022042 | 3300037312 | Bacteria | 4830 |
| 697 | Ga0395899_0032052 | 3300037312 | Bacteria | 3947 |
| 698 | Ga0395899_0050993 | 3300037312 | Bacteria | 3072 |
| 699 | Ga0395900_0000316 | 3300037418 | Bacteria | 71497 |
| 700 | Ga0395900_0000902 | 3300037418 | Bacteria | 39078 |
| 701 | Ga0395900_0006286 | 3300037418 | Bacteria | 12391 |
| 702 | Ga0395900_0006902 | 3300037418 | Bacteria | 11783 |
| 703 | Ga0395900_0013536 | 3300037418 | Bacteria | 8333 |
| 704 | Ga0395900_0014211 | 3300037418 | Bacteria | 8127 |
| 705 | Ga0395900_0020006 | 3300037418 | Bacteria | 6824 |
| 706 | Ga0395900_0020055 | 3300037418 | Bacteria | 6818 |
| 707 | Ga0395900_0024222 | 3300037418 | Bacteria | 6214 |
| 708 | Ga0395900_0035040 | 3300037418 | Bacteria | 5169 |
| 709 | Ga0395900_0041989 | 3300037418 | Bacteria | 4712 |
| 710 | Ga0395900_0048835 | 3300037418 | Bacteria | 4358 |
| 711 | Ga0395900_0058611 | 3300037418 | Bacteria | 3964 |
| 712 | Ga0395900_0066890 | 3300037418 | Bacteria | 3693 |
| 713 | Ga0395900_0073751 | 3300037418 | Bacteria | 3509 |
| 714 | Ga0395900_0077014 | 3300037418 | Bacteria | 3427 |
| 715 | Ga0395900_0163801 | 3300037418 | Bacteria | 2267 |
| 716 | Ga0395900_0165863 | 3300037418 | Bacteria | 2251 |
| 717 | Ga0395900_0183529 | 3300037418 | Bacteria | 2124 |
| 718 | Ga0395900_0189156 | 3300037418 | Bacteria | 2089 |
| 719 | Ga0395898_0000192 | 3300037466 | Bacteria | 156121 |
| 720 | Ga0395898_0001190 | 3300037466 | Bacteria | 39469 |
| 721 | Ga0395898_0002752 | 3300037466 | Bacteria | 20261 |
| 722 | Ga0395898_0034317 | 3300037466 | Bacteria | 5057 |
| 723 | Ga0395898_0057225 | 3300037466 | Bacteria | 3800 |
| 724 | Ga0395898_0077797 | 3300037466 | Bacteria | 3202 |
| 725 | Ga0395898_0108699 | 3300037466 | Bacteria | 2659 |
| 726 | Ga0395905_0000066 | 3300037471 | Bacteria | 183121 |
| 727 | Ga0395905_0000916 | 3300037471 | Bacteria | 38099 |
| 728 | Ga0395905_0001950 | 3300037471 | Bacteria | 23641 |
| 729 | Ga0395905_0002085 | 3300037471 | Bacteria | 22730 |
| 730 | Ga0395905_0002298 | 3300037471 | Bacteria | 21443 |
| 731 | Ga0395905_0014596 | 3300037471 | Bacteria | 7493 |
| 732 | Ga0395905_0023489 | 3300037471 | Bacteria | 5824 |
| 733 | Ga0395905_0027904 | 3300037471 | Bacteria | 5322 |
| 734 | Ga0395905_0028256 | 3300037471 | Bacteria | 5287 |
| 735 | Ga0395905_0033675 | 3300037471 | Bacteria | 4811 |
| 736 | Ga0395905_0036693 | 3300037471 | Bacteria | 4604 |
| 737 | Ga0395905_0037639 | 3300037471 | Bacteria | 4541 |
| 738 | Ga0395905_0081710 | 3300037471 | Bacteria | 3028 |
| 739 | Ga0395905_0087525 | 3300037471 | Bacteria | 2920 |
| 740 | Ga0395905_0106829 | 3300037471 | Bacteria | 2628 |
| 741 | Ga0395905_0130752 | 3300037471 | Bacteria | 2361 |
| 742 | Ga0395905_0145437 | 3300037471 | Bacteria | 2230 |
| 743 | Ga0436364_0184827 | 3300037853 | Bacteria | 146498 |
| 744 | Ga0395901_0000203 | 3300038443 | Bacteria | 74605 |
| 745 | Ga0395901_0000232 | 3300038443 | Bacteria | 69963 |
| 746 | Ga0395901_0000468 | 3300038443 | Bacteria | 46939 |
| 747 | Ga0395901_0003002 | 3300038443 | Bacteria | 17020 |
| 748 | Ga0395901_0006424 | 3300038443 | Bacteria | 11912 |
| 749 | Ga0395901_0007762 | 3300038443 | Bacteria | 10825 |
| 750 | Ga0395901_0018702 | 3300038443 | Bacteria | 7076 |
| 751 | Ga0395901_0026159 | 3300038443 | Bacteria | 5991 |
| 752 | Ga0395901_0051451 | 3300038443 | Bacteria | 4283 |
| 753 | Ga0395901_0055613 | 3300038443 | Bacteria | 4115 |
| 754 | Ga0395901_0060872 | 3300038443 | Bacteria | 3929 |
| 755 | Ga0395901_0088978 | 3300038443 | Bacteria | 3230 |
| 756 | Ga0395901_0096457 | 3300038443 | Bacteria | 3099 |
| 757 | Ga0395901_0112625 | 3300038443 | Bacteria | 2857 |
| 758 | Ga0395901_0117755 | 3300038443 | Bacteria | 2791 |
| 759 | Ga0395901_0206534 | 3300038443 | Bacteria | 2057 |
| 760 | Ga0436365_0393854 | 3300039437 | Bacteria | 34290 |
| 761 | Ga0436365_0607739 | 3300039437 | Bacteria | 2110 |
| 762 | Ga0436365_1728108 | 3300039437 | Bacteria | 56121 |
| 763 | Ga0436362_0976836 | 3300039453 | Bacteria | 135942 |
| 764 | Ga0439445_0000259 | 3300042004 | Bacteria | 10116 |
| 765 | Ga0439448_0003663 | 3300042005 | Bacteria | 4278 |
| 766 | Ga0439462_0000190 | 3300042015 | Bacteria | 10515 |
| 767 | Ga0450912_000100 | 3300042116 | Bacteria | 3009 |
| 768 | Ga0450905_000562 | 3300042142 | Bacteria | 4567 |
| 769 | Ga0439458_0002875 | 3300042157 | Bacteria | 4140 |
| 770 | Ga0439458_0003632 | 3300042157 | Bacteria | 3588 |
| 771 | Ga0466969_0011914 | 3300044656 | Bacteria | 4597 |
| 772 | Ga0466961_0039856 | 3300044693 | Bacteria | 3011 |
| 773 | Ga0466963_0007220 | 3300044694 | Bacteria | 6624 |
| 774 | Ga0466963_0041404 | 3300044694 | Bacteria | 3021 |
| 775 | Ga0466963_0044084 | 3300044694 | Bacteria | 2935 |
| 776 | Ga0453684_0122144 | 3300044712 | Bacteria | 3143 |
| 777 | Ga0466971_0025269 | 3300044719 | Bacteria | 2652 |
| 778 | Ga0466957_0013383 | 3300044842 | Bacteria | 4759 |
| 779 | Ga0466957_0014646 | 3300044842 | Bacteria | 4569 |
| 780 | Ga0466959_0025239 | 3300045049 | Bacteria | 4404 |
| 781 | Ga0451576_0091666 | 3300045051 | Bacteria | 3161 |
| 782 | Ga0466958_0001866 | 3300045836 | Bacteria | 10292 |
| 783 | Ga0466958_0015322 | 3300045836 | Bacteria | 4391 |
| 784 | Ga0466958_0072874 | 3300045836 | Bacteria | 2103 |
| 785 | Ga0466967_0002854 | 3300045976 | Bacteria | 10973 |
| 786 | Ga0466967_0005893 | 3300045976 | Bacteria | 8585 |
| 787 | Ga0466967_0007661 | 3300045976 | Bacteria | 7817 |
| 788 | Ga0466967_0028082 | 3300045976 | Bacteria | 4692 |
| 789 | Ga0466967_0029613 | 3300045976 | Bacteria | 4584 |
| 790 | Ga0466967_0057970 | 3300045976 | Bacteria | 3421 |
| 791 | Ga0495627_000197 | 3300046453 | Bacteria | 66158 |
| 792 | Ga0495638_0000980 | 3300046460 | Bacteria | 28747 |
| 793 | Ga0495650_0000058 | 3300046471 | Bacteria | 302308 |
| 794 | Ga0495650_0001171 | 3300046471 | Bacteria | 28029 |
| 795 | Ga0495596_0000074 | 3300046500 | Bacteria | 70574 |
| 796 | Ga0495583_0002103 | 3300046506 | Bacteria | 17916 |
| 797 | Ga0495606_0001775 | 3300046507 | Bacteria | 27610 |
| 798 | Ga0495610_0000022 | 3300046512 | Bacteria | 317107 |
| 799 | Ga0495610_0002818 | 3300046512 | Bacteria | 14175 |
| 800 | Ga0495620_0017337 | 3300046515 | Bacteria | 3592 |
| 801 | Ga0495643_0001911 | 3300046522 | Bacteria | 17582 |
| 802 | Ga0495643_0002032 | 3300046522 | Bacteria | 16834 |
| 803 | Ga0495643_0016512 | 3300046522 | Bacteria | 4336 |
| 804 | Ga0495643_0017609 | 3300046522 | Bacteria | 4172 |
| 805 | Ga0495643_0019171 | 3300046522 | Bacteria | 3962 |
| 806 | Ga0495648_0000698 | 3300046524 | Bacteria | 35854 |
| 807 | Ga0495663_0000248 | 3300046525 | Bacteria | 21093 |
| 808 | Ga0495663_0001615 | 3300046525 | Bacteria | 7046 |
| 809 | Ga0495663_0002089 | 3300046525 | Bacteria | 6111 |
| 810 | Ga0495642_0007434 | 3300046528 | Bacteria | 4198 |
| 811 | Ga0495654_0000224 | 3300046530 | Bacteria | 52709 |
| 812 | Ga0495598_0002444 | 3300046537 | Bacteria | 3841 |
| 813 | Ga0495621_0000267 | 3300046539 | Bacteria | 12474 |
| 814 | Ga0495621_0000754 | 3300046539 | Bacteria | 8186 |
| 815 | Ga0495622_0006416 | 3300046557 | Bacteria | 5456 |
| 816 | Ga0495633_0001330 | 3300046558 | Bacteria | 19396 |
| 817 | Ga0495668_0000001 | 3300046616 | Bacteria | 1013420 |
| 818 | Ga0495668_0000007 | 3300046616 | Bacteria | 552902 |
| 819 | Ga0495668_0001200 | 3300046616 | Bacteria | 26319 |
| 820 | Ga0495668_0014866 | 3300046616 | Bacteria | 4555 |
| 821 | Ga0495625_0000167 | 3300046660 | Bacteria | 102783 |
| 822 | Ga0495625_0000237 | 3300046660 | Bacteria | 86257 |
| 823 | Ga0495625_0006053 | 3300046660 | Bacteria | 10857 |
| 824 | Ga0495659_0007180 | 3300046664 | Bacteria | 3528 |
| 825 | Ga0495661_0046112 | 3300046665 | Bacteria | 2663 |
| 826 | Ga0495669_0000110 | 3300046684 | Bacteria | 52962 |
| 827 | Ga0495669_0000854 | 3300046684 | Bacteria | 12893 |
| 828 | Ga0495669_0001549 | 3300046684 | Bacteria | 9448 |
| 829 | Ga0495669_0001606 | 3300046684 | Bacteria | 9276 |
| 830 | Ga0495669_0003119 | 3300046684 | Bacteria | 6819 |
| 831 | Ga0495670_0027880 | 3300046691 | Bacteria | 2799 |
| 832 | Ga0495671_0017917 | 3300046692 | Bacteria | 3766 |
| 833 | Ga0495600_0003414 | 3300046809 | Bacteria | 9341 |
| 834 | Ga0495683_0007930 | 3300047323 | Bacteria | 5698 |
| 835 | Ga0495687_000178 | 3300047443 | Bacteria | 93234 |
| 836 | Ga0495687_000211 | 3300047443 | Bacteria | 83788 |
| 837 | Ga0495681_0000123 | 3300047470 | Bacteria | 68069 |
| 838 | Ga0495681_0002869 | 3300047470 | Bacteria | 12180 |
| 839 | Ga0495686_0000191 | 3300047472 | Bacteria | 114738 |
| 840 | Ga0495615_0000131 | 3300048090 | Bacteria | 18922 |
| 841 | Ga0495626_0005587 | 3300048091 | Bacteria | 7295 |
| 842 | Ga0496100_0009750 | 3300048903 | Bacteria | 5406 |
| 843 | Ga0496100_0018618 | 3300048903 | Bacteria | 4123 |
| 844 | Ga0496101_0017464 | 3300048904 | Bacteria | 4867 |
| 845 | Ga0496101_0066423 | 3300048904 | Bacteria | 2631 |
| 846 | Ga0496101_0073935 | 3300048904 | Bacteria | 2505 |
| 847 | Ga0496102_0075802 | 3300048905 | Bacteria | 3092 |
| 848 | Ga0496103_0016658 | 3300048906 | Bacteria | 4388 |
| 849 | Ga0496103_0055116 | 3300048906 | Bacteria | 2465 |
| 850 | Ga0496104_0017845 | 3300048907 | Bacteria | 6470 |
| 851 | Ga0496104_0085174 | 3300048907 | Bacteria | 3016 |
| 852 | Ga0496105_0000435 | 3300048908 | Bacteria | 27394 |
| 853 | Ga0496105_0000866 | 3300048908 | Bacteria | 20693 |
| 854 | Ga0496106_0004254 | 3300048909 | Bacteria | 10656 |
| 855 | Ga0496106_0024444 | 3300048909 | Bacteria | 4492 |
| 856 | Ga0496107_0001028 | 3300048910 | Bacteria | 16666 |
| 857 | Ga0496107_0005617 | 3300048910 | Bacteria | 8589 |
| 858 | Ga0496107_0024445 | 3300048910 | Bacteria | 4273 |
| 859 | Ga0496107_0029493 | 3300048910 | Bacteria | 3903 |
| 860 | Ga0496107_0036600 | 3300048910 | Bacteria | 3520 |
| 861 | Ga0496107_0039309 | 3300048910 | Bacteria | 3393 |
| 862 | Ga0496108_0001167 | 3300048911 | Bacteria | 20498 |
| 863 | Ga0496108_0002014 | 3300048911 | Bacteria | 16270 |
| 864 | Ga0496108_0004348 | 3300048911 | Bacteria | 11394 |
| 865 | Ga0496108_0013160 | 3300048911 | Bacteria | 6742 |
| 866 | Ga0496109_0007854 | 3300048912 | Bacteria | 9037 |
| 867 | Ga0496109_0014218 | 3300048912 | Bacteria | 6923 |
| 868 | Ga0496109_0023009 | 3300048912 | Bacteria | 5525 |
| 869 | Ga0496110_0001813 | 3300048913 | Bacteria | 15734 |
| 870 | Ga0496110_0003336 | 3300048913 | Bacteria | 12270 |
| 871 | Ga0496110_0005174 | 3300048913 | Bacteria | 10202 |
| 872 | Ga0496110_0020631 | 3300048913 | Bacteria | 5566 |
| 873 | Ga0496110_0025581 | 3300048913 | Bacteria | 5046 |
| 874 | Ga0496110_0031828 | 3300048913 | Bacteria | 4553 |
| 875 | Ga0496110_0041411 | 3300048913 | Bacteria | 4019 |
| 876 | Ga0496110_0067027 | 3300048913 | Bacteria | 3175 |
| 877 | Ga0496111_0010795 | 3300048914 | Bacteria | 6140 |
| 878 | Ga0496111_0026781 | 3300048914 | Bacteria | 4073 |
| 879 | Ga0496111_0042746 | 3300048914 | Bacteria | 3255 |
| 880 | Ga0496112_0037146 | 3300048915 | Bacteria | 4754 |
| 881 | Ga0496112_0050899 | 3300048915 | Bacteria | 4062 |
| 882 | Ga0496113_0000943 | 3300048916 | Bacteria | 15457 |
| 883 | Ga0496113_0001600 | 3300048916 | Bacteria | 12735 |
| 884 | Ga0496113_0002498 | 3300048916 | Bacteria | 10715 |
| 885 | Ga0496113_0094055 | 3300048916 | Bacteria | 2315 |
| 886 | Ga0496114_0000006 | 3300048917 | Bacteria | 472921 |
| 887 | Ga0496114_0189808 | 3300048917 | Bacteria | 1797 |
| 888 | Ga0496115_0000042 | 3300048918 | Bacteria | 118348 |
| 889 | Ga0496115_0010928 | 3300048918 | Bacteria | 6796 |
| 890 | Ga0496116_0000035 | 3300048919 | Bacteria | 402424 |
| 891 | Ga0496116_0001662 | 3300048919 | Bacteria | 24440 |
| 892 | Ga0496116_0033685 | 3300048919 | Bacteria | 3630 |
| 893 | Ga0496116_0056202 | 3300048919 | Bacteria | 2581 |
| 894 | Ga0496117_0013881 | 3300048920 | Bacteria | 6985 |
| 895 | Ga0496118_0000109 | 3300048921 | Bacteria | 153067 |
| 896 | Ga0496118_0016413 | 3300048921 | Bacteria | 6795 |
| 897 | Ga0496118_0032274 | 3300048921 | Bacteria | 4319 |
| 898 | Ga0496119_0031303 | 3300048922 | Bacteria | 3571 |
| 899 | Ga0496121_0000070 | 3300048924 | Bacteria | 249187 |
| 900 | Ga0496121_0000740 | 3300048924 | Bacteria | 60212 |
| 901 | Ga0496121_0002895 | 3300048924 | Bacteria | 25241 |
| 902 | Ga0496121_0069828 | 3300048924 | Bacteria | 2833 |
| 903 | Ga0496123_0001169 | 3300048926 | Bacteria | 38781 |
| 904 | Ga0496123_0006066 | 3300048926 | Bacteria | 11861 |
| 905 | Ga0496124_0003117 | 3300048927 | Bacteria | 20575 |
| 906 | Ga0496125_0000638 | 3300048928 | Bacteria | 58580 |
| 907 | Ga0496125_0025119 | 3300048928 | Bacteria | 5464 |
| 908 | Ga0496126_0000084 | 3300048929 | Bacteria | 217111 |
| 909 | Ga0496126_0052607 | 3300048929 | Bacteria | 3700 |
| 910 | Ga0501032_0022445 | 3300049569 | Bacteria | 4374 |
| 911 | Ga0501033_0019441 | 3300049570 | Bacteria | 5136 |
| 912 | Ga0501034_0066514 | 3300049571 | Bacteria | 3617 |
| 913 | Ga0501042_0005275 | 3300049578 | Bacteria | 8308 |
| 914 | Ga0501047_0047289 | 3300049581 | Bacteria | 4157 |
| 915 | Ga0501067_0041216 | 3300049583 | Bacteria | 2564 |
| 916 | Ga0501067_0055782 | 3300049583 | Bacteria | 2189 |
| 917 | Ga0501223_000116 | 3300049663 | Bacteria | 22926 |
| 918 | Ga0501223_004154 | 3300049663 | Bacteria | 3120 |
| 919 | Ga0501223_004213 | 3300049663 | Bacteria | 3097 |
| 920 | Ga0501224_000011 | 3300049664 | Bacteria | 93275 |
| 921 | Ga0501233_000190 | 3300049668 | Bacteria | 9097 |
| 922 | Ga0501257_000144 | 3300049686 | Bacteria | 15686 |
| 923 | Ga0501225_0000152 | 3300049705 | Bacteria | 21223 |
| 924 | Ga0501035_0026060 | 3300049822 | Bacteria | 5354 |
| 925 | Ga0501044_0001099 | 3300049823 | Bacteria | 32196 |
| 926 | Ga0501044_0027702 | 3300049823 | Bacteria | 5982 |
| 927 | Ga0501226_000024 | 3300049853 | Bacteria | 93123 |
| 928 | nmdc:mga03683_13_c1 | 3300050489 | Bacteria | 110533 |
| 929 | nmdc:mga03683_289_c1 | 3300050489 | Bacteria | 14995 |
| 930 | nmdc:mga03n38_3053_c1 | 3300050490 | Bacteria | 5306 |
| 931 | nmdc:mga00v17_20204_c1 | 3300050491 | Bacteria | 3812 |
| 932 | nmdc:mga0k408_8_c1 | 3300050493 | Bacteria | 161211 |
| 933 | nmdc:mga06z11_573_c1 | 3300050494 | Bacteria | 13457 |
| 934 | nmdc:mga04h51_76_c1 | 3300050495 | Bacteria | 31783 |
| 935 | nmdc:mga07m45_38_c1 | 3300050496 | Bacteria | 65235 |
| 936 | nmdc:mga07m45_3_c1 | 3300050496 | Bacteria | 421414 |
| 937 | nmdc:mga07m45_618_c1 | 3300050496 | Bacteria | 15113 |
| 938 | nmdc:mga05p37_45901_c1 | 3300050507 | Bacteria | 5373 |
| 939 | Ga0500643_000001 | 3300053087 | Bacteria | 1440111 |
| 940 | Ga0500643_000612 | 3300053087 | Bacteria | 24327 |
| 941 | Ga0500643_000752 | 3300053087 | Bacteria | 21183 |
| 942 | Ga0500643_000997 | 3300053087 | Bacteria | 17354 |
| 943 | Ga0500556_0000027 | 3300053104 | Bacteria | 165855 |
| 944 | Ga0500607_000048 | 3300053121 | Bacteria | 82363 |
| 945 | Ga0500607_004691 | 3300053121 | Bacteria | 9288 |
| 946 | Ga0500618_003695 | 3300053125 | Bacteria | 5157 |
| 947 | Ga0500642_0000003 | 3300053130 | Bacteria | 544899 |
| 948 | Ga0500573_0000045 | 3300053140 | Bacteria | 98878 |
| 949 | Ga0500604_0000003 | 3300053151 | Bacteria | 148800 |
| 950 | Ga0500616_0000128 | 3300053153 | Bacteria | 134307 |
| 951 | Ga0500624_000045 | 3300053157 | Bacteria | 89838 |
| 952 | Ga0500627_0000004 | 3300053158 | Bacteria | 174208 |
| 953 | Ga0500627_0000278 | 3300053158 | Bacteria | 14608 |
| 954 | Ga0500567_001083 | 3300053723 | Bacteria | 10567 |
| 955 | Ga0500625_000010 | 3300053729 | Bacteria | 154401 |
| 956 | Ga0500645_000011 | 3300053730 | Bacteria | 169616 |
| 957 | Ga0500645_002144 | 3300053730 | Bacteria | 9063 |
| 958 | Ga0500645_009600 | 3300053730 | Bacteria | 3243 |
| 959 | Ga0500596_001714 | 3300053735 | Bacteria | 4441 |
| 960 | Ga0466962_0005552 | 3300061719 | Bacteria | 6053 |
| 961 | 2511129618 | 2510917021 | Bacteria | 5705459 |
| 962 | 2643821418 | 2643221560 | Bacteria | 4801179 |
| 963 | 2643836012 | 2643221563 | Bacteria | 4726935 |
| 964 | 2643949078 | 2643221588 | Bacteria | 3692460 |
| 965 | 2644056937 | 2643221608 | Bacteria | 4724829 |
| 966 | 2739649757 | 2739367664 | Bacteria | 4114334 |
| 967 | 2740028230 | 2739367865 | Bacteria | 4114482 |
| 968 | 2819552610 | 2818991438 | Bacteria | 5793701 |
| 969 | 2852655535 | 2852653556 | Bacteria | 4050083 |
| 970 | 2852681033 | 2852680915 | Bacteria | 4100189 |
| 971 | 2882807420 | 2882806704 | Bacteria | 3007728 |
| 972 | 2885428726 | 2885427238 | Bacteria | 2291351 |
| 973 | 2895886104 | 2895880812 | Bacteria | 11255272 |
| 974 | 2896185021 | 2896184354 | Bacteria | 3258548 |
| 975 | 2896255410 | 2896253425 | Bacteria | 3418029 |
| 976 | 2896429792 | 2896429255 | Bacteria | 2557483 |
| 977 | 2919141676 | 2919138771 | Bacteria | 5281312 |
| 978 | 8054302721 | 8054302542 | Bacteria | 5698134 |
| 979 | 8057101778 | 8057101203 | Bacteria | 5034064 |
| 980 | Ga0496109_0101651 | |||
| 981 | SwRhRL2b_contig_2799799 | |||
| 982 | JGI24736J21556_1000056 | |||
| 983 | JGI24752J21851_1000367 | |||
| 984 | JGI24740J21852_10007712 | |||
| 985 | JGI24740J21852_10008209 | |||
| 986 | JGI24739J22299_10001645 | |||
| 987 | JGI24739J22299_10003318 | |||
| 988 | JGI24737J22298_10000117 | |||
| 989 | JGI24743J22301_10000482 | |||
| 990 | JGI24735J21928_10002989 | |||
| 991 | JGI24735J21928_10007292 | |||
| 992 | JGI24750J21931_1000004 | |||
| 993 | JGI24748J21848_1000044 | |||
| 994 | JGI24738J21930_10001953 | |||
| 995 | JGI24738J21930_10003826 | |||
| 996 | JGI24738J21930_10004092 | |||
| 997 | JGI24738J21930_10007579 | |||
| 998 | JGI24034J26672_10000020 | |||
| 999 | JGI24751J29686_10000242 | |||
| 1000 | JGI25165J46597_1000573 | |||
| 1001 | JGI25153J46596_10000113 | |||
| 1002 | Ga0055525_1000051 | |||
| 1003 | Ga0055542_1000020 | |||
| 1004 | Ga0055529_1000016 | |||
| 1005 | Ga0055536_1000643 | |||
| 1006 | Ga0055536_1003408 | |||
| 1007 | Ga0055536_1008388 | |||
| 1008 | Ga0055530_10000035 | |||
| 1009 | Ga0055531_10003431 | |||
| 1010 | Ga0065704_10000222 | |||
| 1011 | Ga0065712_10077447 | |||
| 1012 | Ga0065715_10096385 | |||
| 1013 | Ga0065707_10083820 | |||
| 1014 | Ga0065707_10086495 | |||
| 1015 | Ga0070658_10000001 | |||
| 1016 | Ga0070658_10000305 | |||
| 1017 | Ga0070658_10000351 | |||
| 1018 | Ga0070658_10019495 | |||
| 1019 | Ga0070658_10064228 | |||
| 1020 | Ga0070658_10085268 | |||
| 1021 | Ga0070683_100001218 | |||
| 1022 | Ga0070683_100009155 | |||
| 1023 | Ga0070683_100035894 | |||
| 1024 | Ga0070690_100000180 | |||
| 1025 | Ga0070690_100037867 | |||
| 1026 | Ga0070670_100001900 | |||
| 1027 | Ga0070670_100002485 | |||
| 1028 | Ga0070670_100004196 | |||
| 1029 | Ga0070670_100006931 | |||
| 1030 | Ga0070670_100028646 | |||
| 1031 | Ga0070670_100035673 | |||
| 1032 | Ga0070670_100036174 | |||
| 1033 | Ga0070670_100062929 | |||
| 1034 | Ga0070677_10000358 | |||
| 1035 | Ga0068869_100001958 | |||
| 1036 | Ga0068869_100053556 | |||
| 1037 | Ga0070666_10000027 | |||
| 1038 | Ga0070666_10000033 | |||
| 1039 | Ga0070666_10000555 | |||
| 1040 | Ga0070666_10000788 | |||
| 1041 | Ga0070666_10002098 | |||
| 1042 | Ga0070666_10020931 | |||
| 1043 | Ga0070666_10034090 | |||
| 1044 | Ga0070680_100000228 | |||
| 1045 | Ga0070680_100000949 | |||
| 1046 | Ga0070680_100041578 | |||
| 1047 | Ga0068868_100000001 | |||
| 1048 | Ga0068868_100000041 | |||
| 1049 | Ga0068868_100000211 | |||
| 1050 | Ga0068868_100000572 | |||
| 1051 | Ga0068868_100017275 | |||
| 1052 | Ga0068868_100049966 | |||
| 1053 | Ga0070660_100000051 | |||
| 1054 | Ga0070660_100000129 | |||
| 1055 | Ga0070660_100005925 | |||
| 1056 | Ga0070660_100007167 | |||
| 1057 | Ga0070660_100025232 | |||
| 1058 | Ga0070660_100064465 | |||
| 1059 | Ga0070689_100051235 | |||
| 1060 | Ga0070661_100000014 | |||
| 1061 | Ga0070661_100000033 | |||
| 1062 | Ga0070661_100008952 | |||
| 1063 | Ga0070661_100023721 | |||
| 1064 | Ga0070661_100049814 | |||
| 1065 | Ga0070668_100000123 | |||
| 1066 | Ga0070669_100000075 | |||
| 1067 | Ga0070669_100000099 | |||
| 1068 | Ga0070669_100000471 | |||
| 1069 | Ga0070669_100000556 | |||
| 1070 | Ga0070669_100043759 | |||
| 1071 | Ga0070675_100000406 | |||
| 1072 | Ga0070675_100007861 | |||
| 1073 | Ga0070671_100000015 | |||
| 1074 | Ga0070671_100000050 | |||
| 1075 | Ga0070671_100000752 | |||
| 1076 | Ga0070671_100000800 | |||
| 1077 | Ga0070671_100001477 | |||
| 1078 | Ga0070671_100001615 | |||
| 1079 | Ga0070671_100001659 | |||
| 1080 | Ga0070671_100002991 | |||
| 1081 | Ga0070671_100003305 | |||
| 1082 | Ga0070671_100011910 | |||
| 1083 | Ga0070671_100015456 | |||
| 1084 | Ga0070671_100020477 | |||
| 1085 | Ga0070671_100028321 | |||
| 1086 | Ga0070674_100000415 | |||
| 1087 | Ga0070673_100001837 | |||
| 1088 | Ga0070673_100027333 | |||
| 1089 | Ga0070673_100031392 | |||
| 1090 | Ga0070673_100032558 | |||
| 1091 | Ga0070673_100077258 | |||
| 1092 | Ga0070688_100010650 | |||
| 1093 | Ga0070659_100000001 | |||
| 1094 | Ga0070659_100000142 | |||
| 1095 | Ga0070659_100004813 | |||
| 1096 | Ga0070659_100009061 | |||
| 1097 | Ga0070659_100013985 | |||
| 1098 | Ga0070659_100020857 | |||
| 1099 | Ga0070659_100091450 | |||
| 1100 | Ga0070659_100145559 | |||
| 1101 | Ga0070667_100000368 | |||
| 1102 | Ga0070667_100001014 | |||
| 1103 | Ga0070667_100003689 | |||
| 1104 | Ga0070667_100005056 | |||
| 1105 | Ga0070667_100008853 | |||
| 1106 | Ga0070667_100012088 | |||
| 1107 | Ga0070667_100012789 | |||
| 1108 | Ga0070667_100043981 | |||
| 1109 | Ga0070667_100047112 | |||
| 1110 | Ga0070667_100048374 | |||
| 1111 | Ga0070714_100084508 | |||
| 1112 | Ga0070713_100008902 | |||
| 1113 | Ga0070705_100002002 | |||
| 1114 | Ga0070663_100004959 | |||
| 1115 | Ga0070678_100000379 | |||
| 1116 | Ga0070678_100003813 | |||
| 1117 | Ga0070662_100000021 | |||
| 1118 | Ga0070662_100000733 | |||
| 1119 | Ga0070662_100000826 | |||
| 1120 | Ga0070662_100003298 | |||
| 1121 | Ga0070662_100008268 | |||
| 1122 | Ga0070662_100011909 | |||
| 1123 | Ga0070662_100016035 | |||
| 1124 | Ga0070662_100021330 | |||
| 1125 | Ga0070662_100072073 | |||
| 1126 | Ga0070681_10090371 | |||
| 1127 | Ga0068867_100011576 | |||
| 1128 | Ga0070685_10000238 | |||
| 1129 | Ga0070679_100000003 | |||
| 1130 | Ga0068853_100000377 | |||
| 1131 | Ga0068853_100003642 | |||
| 1132 | Ga0068853_100007738 | |||
| 1133 | Ga0068853_100046111 | |||
| 1134 | Ga0070672_100001912 | |||
| 1135 | Ga0070672_100012970 | |||
| 1136 | Ga0070686_100000010 | |||
| 1137 | Ga0070686_100003910 | |||
| 1138 | Ga0070696_100012945 | |||
| 1139 | Ga0070696_100014922 | |||
| 1140 | Ga0070693_100000142 | |||
| 1141 | Ga0070693_100021718 | |||
| 1142 | Ga0070665_100000044 | |||
| 1143 | Ga0070665_100000254 | |||
| 1144 | Ga0070665_100000511 | |||
| 1145 | Ga0070665_100000528 | |||
| 1146 | Ga0070665_100000531 | |||
| 1147 | Ga0070665_100000634 | |||
| 1148 | Ga0070665_100004137 | |||
| 1149 | Ga0070665_100009476 | |||
| 1150 | Ga0070665_100023751 | |||
| 1151 | Ga0070665_100028884 | |||
| 1152 | Ga0070665_100034620 | |||
| 1153 | Ga0070665_100071442 | |||
| 1154 | Ga0070665_100085282 | |||
| 1155 | Ga0070665_100089808 | |||
| 1156 | Ga0068855_100000745 | |||
| 1157 | Ga0068855_100008164 | |||
| 1158 | Ga0068855_100016149 | |||
| 1159 | Ga0068855_100021266 | |||
| 1160 | Ga0068855_100154338 | |||
| 1161 | Ga0070664_100000153 | |||
| 1162 | Ga0070664_100001180 | |||
| 1163 | Ga0070664_100007769 | |||
| 1164 | Ga0070664_100015803 | |||
| 1165 | Ga0070664_100037496 | |||
| 1166 | Ga0070664_100063739 | |||
| 1167 | Ga0068857_100007788 | |||
| 1168 | Ga0068857_100054112 | |||
| 1169 | Ga0068857_100066729 | |||
| 1170 | Ga0068854_100007709 | |||
| 1171 | Ga0068854_100025211 | |||
| 1172 | Ga0068854_100057460 | |||
| 1173 | Ga0068854_100101323 | |||
| 1174 | Ga0068856_100000177 | |||
| 1175 | Ga0068856_100000870 | |||
| 1176 | Ga0068856_100006572 | |||
| 1177 | Ga0068856_100015519 | |||
| 1178 | Ga0068852_100000075 | |||
| 1179 | Ga0068852_100000831 | |||
| 1180 | Ga0068852_100001121 | |||
| 1181 | Ga0068852_100015314 | |||
| 1182 | Ga0068852_100069059 | |||
| 1183 | Ga0068852_100071681 | |||
| 1184 | Ga0068852_100096354 | |||
| 1185 | Ga0068852_100110266 | |||
| 1186 | Ga0068859_100000194 | |||
| 1187 | Ga0068859_100000221 | |||
| 1188 | Ga0068859_100004830 | |||
| 1189 | Ga0068859_100017508 | |||
| 1190 | Ga0068859_100018251 | |||
| 1191 | Ga0068864_100000261 | |||
| 1192 | Ga0068864_100000721 | |||
| 1193 | Ga0068864_100001983 | |||
| 1194 | Ga0068864_100004528 | |||
| 1195 | Ga0068864_100020487 | |||
| 1196 | Ga0068864_100031594 | |||
| 1197 | Ga0068864_100047108 | |||
| 1198 | Ga0068861_100000198 | |||
| 1199 | Ga0068861_100005126 | |||
| 1200 | Ga0068861_100051612 | |||
| 1201 | Ga0068851_10002496 | |||
| 1202 | Ga0068851_10003867 | |||
| 1203 | Ga0068851_10014509 | |||
| 1204 | Ga0068863_100000020 | |||
| 1205 | Ga0068863_100000052 | |||
| 1206 | Ga0068863_100000775 | |||
| 1207 | Ga0068863_100001823 | |||
| 1208 | Ga0068863_100003774 | |||
| 1209 | Ga0068863_100008573 | |||
| 1210 | Ga0068863_100010798 | |||
| 1211 | Ga0068863_100012736 | |||
| 1212 | Ga0068858_100000530 | |||
| 1213 | Ga0068858_100000919 | |||
| 1214 | Ga0068858_100001368 | |||
| 1215 | Ga0068858_100002958 | |||
| 1216 | Ga0068858_100004078 | |||
| 1217 | Ga0068858_100004134 | |||
| 1218 | Ga0068858_100011992 | |||
| 1219 | Ga0068858_100017450 | |||
| 1220 | Ga0068858_100032886 | |||
| 1221 | Ga0068860_100000007 | |||
| 1222 | Ga0068860_100000080 | |||
| 1223 | Ga0068860_100000437 | |||
| 1224 | Ga0068860_100000867 | |||
| 1225 | Ga0068860_100005984 | |||
| 1226 | Ga0068860_100023975 | |||
| 1227 | Ga0068862_100000115 | |||
| 1228 | Ga0068862_100000135 | |||
| 1229 | Ga0068862_100000340 | |||
| 1230 | Ga0068862_100004671 | |||
| 1231 | Ga0068862_100019812 | |||
| 1232 | Ga0068862_100023550 | |||
| 1233 | Ga0068862_100038653 | |||
| 1234 | Ga0081455_10000545 | |||
| 1235 | Ga0081539_10018932 | |||
| 1236 | Ga0081539_10042244 | |||
| 1237 | Ga0075368_10000066 | |||
| 1238 | Ga0075364_10003309 | |||
| 1239 | Ga0075432_10005555 | |||
| 1240 | Ga0075362_10000083 | |||
| 1241 | Ga0075362_10000203 | |||
| 1242 | Ga0075367_10002111 | |||
| 1243 | Ga0075366_10001643 | |||
| 1244 | Ga0075366_10002219 | |||
| 1245 | Ga0097621_100012370 | |||
| 1246 | Ga0097621_100021964 | |||
| 1247 | Ga0097621_100025480 | |||
| 1248 | Ga0075370_10000017 | |||
| 1249 | Ga0075370_10003828 | |||
| 1250 | Ga0075370_10008260 | |||
| 1251 | Ga0068871_100010804 | |||
| 1252 | Ga0068871_100017472 | |||
| 1253 | Ga0075431_100121713 | |||
| 1254 | Ga0097620_100000194 | |||
| 1255 | Ga0097620_100000221 | |||
| 1256 | Ga0097620_100004830 | |||
| 1257 | Ga0097620_100017509 | |||
| 1258 | Ga0097620_100018253 | |||
| 1259 | Ga0105251_10003099 | |||
| 1260 | Ga0105251_10030588 | |||
| 1261 | Ga0105240_10016986 | |||
| 1262 | Ga0105240_10077983 | |||
| 1263 | Ga0105240_10093586 | |||
| 1264 | Ga0105245_10000433 | |||
| 1265 | Ga0105245_10005439 | |||
| 1266 | Ga0105245_10040803 | |||
| 1267 | Ga0105247_10020284 | |||
| 1268 | Ga0114129_10074815 | |||
| 1269 | Ga0105243_10000038 | |||
| 1270 | Ga0105248_10000442 | |||
| 1271 | Ga0105248_10000502 | |||
| 1272 | Ga0105248_10000604 | |||
| 1273 | Ga0105248_10000801 | |||
| 1274 | Ga0105248_10003885 | |||
| 1275 | Ga0105248_10009214 | |||
| 1276 | Ga0105248_10104307 | |||
| 1277 | Ga0105237_10106751 | |||
| 1278 | Ga0105238_10004331 | |||
| 1279 | Ga0105238_10023652 | |||
| 1280 | Ga0105249_10000064 | |||
| 1281 | Ga0105249_10000097 | |||
| 1282 | Ga0105249_10002825 | |||
| 1283 | Ga0105249_10018924 | |||
| 1284 | Ga0157371_10000146 | |||
| 1285 | Ga0157371_10073407 | |||
| 1286 | Ga0157370_10017554 | |||
| 1287 | Ga0157369_10021850 | |||
| 1288 | Ga0157369_10056748 | |||
| 1289 | Ga0157369_10069699 | |||
| 1290 | Ga0157369_10094835 | |||
| 1291 | Ga0157369_10105813 | |||
| 1292 | Ga0157374_10101468 | |||
| 1293 | Ga0157378_10011418 | |||
| 1294 | Ga0157378_10021971 | |||
| 1295 | Ga0163162_10014045 | |||
| 1296 | Ga0163162_10086284 | |||
| 1297 | Ga0163162_10098967 | |||
| 1298 | Ga0157372_10066187 | |||
| 1299 | Ga0157375_10083746 | |||
| 1300 | Ga0163163_10000164 | |||
| 1301 | Ga0163163_10001448 | |||
| 1302 | Ga0163163_10004133 | |||
| 1303 | Ga0163163_10031150 | |||
| 1304 | Ga0157380_10000086 | |||
| 1305 | Ga0157380_10000723 | |||
| 1306 | Ga0157379_10002697 | |||
| 1307 | Ga0157379_10004711 | |||
| 1308 | Ga0157379_10027193 | |||
| 1309 | Ga0157379_10089995 | |||
| 1310 | Ga0157376_10035122 | |||
| 1311 | Ga0163161_10000110 | |||
| 1312 | Ga0163161_10001335 | |||
| 1313 | Ga0213873_10000007 | |||
| 1314 | Ga0213876_10000005 | |||
| 1315 | Ga0213876_10000336 | |||
| 1316 | Ga0213875_10000105 | |||
| 1317 | Ga0209563_100019 | |||
| 1318 | Ga0209148_1000017 | |||
| 1319 | Ga0209233_1000414 | |||
| 1320 | Ga0209455_1000005 | |||
| 1321 | Ga0209455_1009979 | |||
| 1322 | Ga0209675_1000076 | |||
| 1323 | Ga0209676_1000070 | |||
| 1324 | Ga0209676_1000454 | |||
| 1325 | Ga0209676_1000637 | |||
| 1326 | Ga0209758_1000035 | |||
| 1327 | Ga0209050_1000042 | |||
| 1328 | Ga0209050_1000929 | |||
| 1329 | Ga0209257_1000285 | |||
| 1330 | Ga0209257_1001860 | |||
| 1331 | Ga0209257_1002873 | |||
| 1332 | Ga0207697_10000215 | |||
| 1333 | Ga0207697_10000296 | |||
| 1334 | Ga0207656_10001865 | |||
| 1335 | Ga0207656_10005012 | |||
| 1336 | Ga0207656_10020325 | |||
| 1337 | Ga0207713_1007781 | |||
| 1338 | Ga0207682_10000194 | |||
| 1339 | Ga0207682_10000643 | |||
| 1340 | Ga0207682_10017553 | |||
| 1341 | Ga0207710_10001018 | |||
| 1342 | Ga0207680_10000009 | |||
| 1343 | Ga0207680_10000166 | |||
| 1344 | Ga0207680_10005824 | |||
| 1345 | Ga0207680_10069316 | |||
| 1346 | Ga0207647_10000684 | |||
| 1347 | Ga0207647_10000986 | |||
| 1348 | Ga0207647_10003840 | |||
| 1349 | Ga0207647_10006533 | |||
| 1350 | Ga0207647_10007669 | |||
| 1351 | Ga0207647_10016359 | |||
| 1352 | Ga0207647_10036609 | |||
| 1353 | Ga0207645_10008483 | |||
| 1354 | Ga0207645_10030311 | |||
| 1355 | Ga0207645_10038553 | |||
| 1356 | Ga0207705_10000002 | |||
| 1357 | Ga0207705_10000075 | |||
| 1358 | Ga0207705_10000174 | |||
| 1359 | Ga0207705_10000220 | |||
| 1360 | Ga0207705_10012782 | |||
| 1361 | Ga0207705_10014602 | |||
| 1362 | Ga0207705_10038837 | |||
| 1363 | Ga0207705_10086640 | |||
| 1364 | Ga0207707_10032753 | |||
| 1365 | Ga0207707_10080911 | |||
| 1366 | Ga0207695_10003071 | |||
| 1367 | Ga0207695_10006373 | |||
| 1368 | Ga0207695_10017590 | |||
| 1369 | Ga0207695_10100964 | |||
| 1370 | Ga0207671_10001965 | |||
| 1371 | Ga0207671_10011180 | |||
| 1372 | Ga0207671_10027346 | |||
| 1373 | Ga0207660_10000692 | |||
| 1374 | Ga0207660_10006353 | |||
| 1375 | Ga0207660_10009765 | |||
| 1376 | Ga0207660_10033018 | |||
| 1377 | Ga0207660_10049935 | |||
| 1378 | Ga0207657_10000173 | |||
| 1379 | Ga0207657_10000262 | |||
| 1380 | Ga0207657_10002388 | |||
| 1381 | Ga0207657_10003423 | |||
| 1382 | Ga0207657_10005157 | |||
| 1383 | Ga0207657_10008356 | |||
| 1384 | Ga0207657_10054380 | |||
| 1385 | Ga0207657_10076385 | |||
| 1386 | Ga0207657_10100930 | |||
| 1387 | Ga0207649_10000014 | |||
| 1388 | Ga0207649_10000055 | |||
| 1389 | Ga0207649_10000365 | |||
| 1390 | Ga0207649_10004475 | |||
| 1391 | Ga0207649_10025609 | |||
| 1392 | Ga0207649_10026407 | |||
| 1393 | Ga0207649_10032471 | |||
| 1394 | Ga0207652_10000004 | |||
| 1395 | Ga0207652_10004551 | |||
| 1396 | Ga0207681_10000002 | |||
| 1397 | Ga0207681_10000106 | |||
| 1398 | Ga0207681_10000174 | |||
| 1399 | Ga0207681_10034443 | |||
| 1400 | Ga0207694_10001479 | |||
| 1401 | Ga0207694_10021129 | |||
| 1402 | Ga0207694_10031031 | |||
| 1403 | Ga0207694_10036124 | |||
| 1404 | Ga0207650_10001849 | |||
| 1405 | Ga0207650_10005752 | |||
| 1406 | Ga0207650_10008430 | |||
| 1407 | Ga0207650_10012125 | |||
| 1408 | Ga0207650_10019778 | |||
| 1409 | Ga0207650_10037075 | |||
| 1410 | Ga0207650_10063445 | |||
| 1411 | Ga0207687_10045967 | |||
| 1412 | Ga0207687_10050169 | |||
| 1413 | Ga0207687_10101647 | |||
| 1414 | Ga0207664_10016602 | |||
| 1415 | Ga0207664_10094032 | |||
| 1416 | Ga0207644_10000002 | |||
| 1417 | Ga0207644_10000003 | |||
| 1418 | Ga0207644_10000061 | |||
| 1419 | Ga0207644_10000456 | |||
| 1420 | Ga0207644_10000530 | |||
| 1421 | Ga0207644_10000616 | |||
| 1422 | Ga0207644_10000919 | |||
| 1423 | Ga0207644_10002341 | |||
| 1424 | Ga0207644_10004475 | |||
| 1425 | Ga0207644_10015164 | |||
| 1426 | Ga0207644_10016202 | |||
| 1427 | Ga0207644_10035745 | |||
| 1428 | Ga0207644_10037956 | |||
| 1429 | Ga0207644_10045671 | |||
| 1430 | Ga0207690_10000051 | |||
| 1431 | Ga0207690_10000150 | |||
| 1432 | Ga0207690_10002274 | |||
| 1433 | Ga0207690_10006008 | |||
| 1434 | Ga0207690_10010440 | |||
| 1435 | Ga0207690_10036104 | |||
| 1436 | Ga0207690_10066241 | |||
| 1437 | Ga0207690_10069184 | |||
| 1438 | Ga0207706_10000103 | |||
| 1439 | Ga0207706_10000459 | |||
| 1440 | Ga0207706_10000479 | |||
| 1441 | Ga0207706_10004155 | |||
| 1442 | Ga0207706_10013288 | |||
| 1443 | Ga0207709_10000031 | |||
| 1444 | Ga0207669_10000057 | |||
| 1445 | Ga0207669_10008227 | |||
| 1446 | Ga0207669_10017984 | |||
| 1447 | Ga0207669_10065892 | |||
| 1448 | Ga0207704_10008556 | |||
| 1449 | Ga0207691_10001051 | |||
| 1450 | Ga0207691_10001329 | |||
| 1451 | Ga0207691_10015613 | |||
| 1452 | Ga0207691_10062346 | |||
| 1453 | Ga0207711_10000042 | |||
| 1454 | Ga0207711_10000526 | |||
| 1455 | Ga0207711_10001142 | |||
| 1456 | Ga0207711_10001694 | |||
| 1457 | Ga0207711_10002857 | |||
| 1458 | Ga0207711_10004897 | |||
| 1459 | Ga0207711_10014914 | |||
| 1460 | Ga0207711_10025172 | |||
| 1461 | Ga0207689_10018710 | |||
| 1462 | Ga0207661_10019846 | |||
| 1463 | Ga0207661_10032507 | |||
| 1464 | Ga0207679_10000874 | |||
| 1465 | Ga0207679_10004310 | |||
| 1466 | Ga0207679_10006770 | |||
| 1467 | Ga0207679_10017921 | |||
| 1468 | Ga0207667_10000552 | |||
| 1469 | Ga0207667_10001537 | |||
| 1470 | Ga0207667_10008643 | |||
| 1471 | Ga0207667_10015289 | |||
| 1472 | Ga0207667_10018486 | |||
| 1473 | Ga0207667_10069479 | |||
| 1474 | Ga0207667_10115870 | |||
| 1475 | Ga0207651_10002050 | |||
| 1476 | Ga0207651_10004326 | |||
| 1477 | Ga0207651_10005791 | |||
| 1478 | Ga0207651_10029392 | |||
| 1479 | Ga0207651_10049091 | |||
| 1480 | Ga0207712_10000044 | |||
| 1481 | Ga0207712_10000074 | |||
| 1482 | Ga0207712_10001308 | |||
| 1483 | Ga0207712_10001774 | |||
| 1484 | Ga0207668_10000085 | |||
| 1485 | Ga0207668_10002722 | |||
| 1486 | Ga0207668_10040021 | |||
| 1487 | Ga0207640_10000996 | |||
| 1488 | Ga0207640_10007677 | |||
| 1489 | Ga0207640_10054718 | |||
| 1490 | Ga0207658_10000340 | |||
| 1491 | Ga0207658_10000381 | |||
| 1492 | Ga0207658_10001750 | |||
| 1493 | Ga0207658_10001909 | |||
| 1494 | Ga0207658_10007570 | |||
| 1495 | Ga0207658_10007960 | |||
| 1496 | Ga0207658_10010162 | |||
| 1497 | Ga0207658_10010577 | |||
| 1498 | Ga0207658_10013379 | |||
| 1499 | Ga0207658_10021015 | |||
| 1500 | Ga0207677_10000013 | |||
| 1501 | Ga0207677_10001135 | |||
| 1502 | Ga0207677_10001325 | |||
| 1503 | Ga0207677_10006612 | |||
| 1504 | Ga0207703_10000484 | |||
| 1505 | Ga0207703_10002018 | |||
| 1506 | Ga0207703_10002526 | |||
| 1507 | Ga0207703_10003985 | |||
| 1508 | Ga0207703_10005559 | |||
| 1509 | Ga0207703_10011932 | |||
| 1510 | Ga0207703_10012583 | |||
| 1511 | Ga0207703_10026625 | |||
| 1512 | Ga0207703_10038745 | |||
| 1513 | Ga0207639_10000393 | |||
| 1514 | Ga0207639_10001063 | |||
| 1515 | Ga0207639_10001152 | |||
| 1516 | Ga0207639_10008338 | |||
| 1517 | Ga0207639_10032359 | |||
| 1518 | Ga0207639_10040928 | |||
| 1519 | Ga0207639_10065717 | |||
| 1520 | Ga0207678_10008943 | |||
| 1521 | Ga0207678_10010290 | |||
| 1522 | Ga0207678_10010565 | |||
| 1523 | Ga0207678_10070194 | |||
| 1524 | Ga0207702_10001262 | |||
| 1525 | Ga0207702_10001379 | |||
| 1526 | Ga0207702_10003005 | |||
| 1527 | Ga0207702_10005295 | |||
| 1528 | Ga0207702_10007361 | |||
| 1529 | Ga0207641_10000001 | |||
| 1530 | Ga0207641_10000042 | |||
| 1531 | Ga0207641_10000415 | |||
| 1532 | Ga0207641_10005614 | |||
| 1533 | Ga0207641_10005984 | |||
| 1534 | Ga0207641_10009236 | |||
| 1535 | Ga0207641_10013949 | |||
| 1536 | Ga0207641_10019191 | |||
| 1537 | Ga0207641_10021901 | |||
| 1538 | Ga0207641_10023713 | |||
| 1539 | Ga0207641_10048153 | |||
| 1540 | Ga0207648_10001953 | |||
| 1541 | Ga0207648_10005222 | |||
| 1542 | Ga0207648_10009147 | |||
| 1543 | Ga0207676_10000456 | |||
| 1544 | Ga0207676_10002207 | |||
| 1545 | Ga0207676_10003783 | |||
| 1546 | Ga0207676_10003902 | |||
| 1547 | Ga0207676_10004793 | |||
| 1548 | Ga0207676_10010113 | |||
| 1549 | Ga0207676_10025535 | |||
| 1550 | Ga0207676_10026126 | |||
| 1551 | Ga0207676_10030259 | |||
| 1552 | Ga0207674_10000283 | |||
| 1553 | Ga0207674_10000632 | |||
| 1554 | Ga0207674_10002193 | |||
| 1555 | Ga0207674_10002478 | |||
| 1556 | Ga0207674_10004313 | |||
| 1557 | Ga0207674_10004629 | |||
| 1558 | Ga0207674_10031182 | |||
| 1559 | Ga0207674_10043855 | |||
| 1560 | Ga0207674_10108865 | |||
| 1561 | Ga0207674_10173638 | |||
| 1562 | Ga0207675_100000169 | |||
| 1563 | Ga0207675_100000207 | |||
| 1564 | Ga0207675_100000671 | |||
| 1565 | Ga0207683_10003996 | |||
| 1566 | Ga0207683_10004793 | |||
| 1567 | Ga0207698_10000005 | |||
| 1568 | Ga0207698_10000457 | |||
| 1569 | Ga0207698_10010915 | |||
| 1570 | Ga0207698_10019069 | |||
| 1571 | Ga0207698_10022589 | |||
| 1572 | Ga0207698_10029001 | |||
| 1573 | Ga0207698_10051140 | |||
| 1574 | Ga0207698_10091496 | |||
| 1575 | Ga0209813_10000402 | |||
| 1576 | Ga0209974_10006875 | |||
| 1577 | Ga0268266_10000002 | |||
| 1578 | Ga0268266_10000069 | |||
| 1579 | Ga0268266_10000187 | |||
| 1580 | Ga0268266_10000215 | |||
| 1581 | Ga0268266_10000518 | |||
| 1582 | Ga0268266_10002822 | |||
| 1583 | Ga0268266_10003658 | |||
| 1584 | Ga0268266_10017014 | |||
| 1585 | Ga0268266_10019148 | |||
| 1586 | Ga0268266_10033464 | |||
| 1587 | Ga0268265_10000100 | |||
| 1588 | Ga0268265_10000152 | |||
| 1589 | Ga0268265_10000241 | |||
| 1590 | Ga0268265_10002755 | |||
| 1591 | Ga0268265_10007193 | |||
| 1592 | Ga0268265_10016778 | |||
| 1593 | Ga0268265_10025502 | |||
| 1594 | Ga0268265_10032662 | |||
| 1595 | Ga0268265_10046685 | |||
| 1596 | Ga0268265_10087442 | |||
| 1597 | Ga0268264_10000010 | |||
| 1598 | Ga0268264_10000131 | |||
| 1599 | Ga0268264_10000134 | |||
| 1600 | Ga0268264_10000710 | |||
| 1601 | Ga0268264_10001517 | |||
| 1602 | Ga0268264_10001849 | |||
| 1603 | Ga0268264_10011515 | |||
| 1604 | Ga0268264_10021234 | |||
| 1605 | Ga0268264_10035064 | |||
| 1606 | Ga0307517_10026378 | |||
| 1607 | Ga0307513_10004225 | |||
| 1608 | Ga0307408_100005051 | |||
| 1609 | Ga0307408_100035206 | |||
| 1610 | Ga0307408_100042401 | |||
| 1611 | Ga0307508_10000479 | |||
| 1612 | Ga0307508_10008321 | |||
| 1613 | Ga0307405_10007070 | |||
| 1614 | Ga0307405_10009125 | |||
| 1615 | Ga0307405_10011231 | |||
| 1616 | Ga0307405_10027898 | |||
| 1617 | Ga0307413_10002207 | |||
| 1618 | Ga0307410_10004659 | |||
| 1619 | Ga0307410_10006077 | |||
| 1620 | Ga0307410_10009323 | |||
| 1621 | Ga0307410_10010561 | |||
| 1622 | Ga0307410_10010875 | |||
| 1623 | Ga0307410_10017255 | |||
| 1624 | Ga0307410_10045348 | |||
| 1625 | Ga0307410_10066360 | |||
| 1626 | Ga0307410_10075233 | |||
| 1627 | Ga0307406_10005488 | |||
| 1628 | Ga0307406_10025358 | |||
| 1629 | Ga0307406_10071997 | |||
| 1630 | Ga0307407_10035879 | |||
| 1631 | Ga0307412_10006578 | |||
| 1632 | Ga0307412_10007459 | |||
| 1633 | Ga0307412_10020528 | |||
| 1634 | Ga0307412_10030265 | |||
| 1635 | Ga0307412_10043661 | |||
| 1636 | Ga0307409_100007554 | |||
| 1637 | Ga0307409_100050467 | |||
| 1638 | Ga0307409_100063402 | |||
| 1639 | Ga0307409_100069309 | |||
| 1640 | Ga0307409_100075339 | |||
| 1641 | Ga0307409_100083438 | |||
| 1642 | Ga0307409_100147381 | |||
| 1643 | Ga0307416_100004453 | |||
| 1644 | Ga0307416_100056406 | |||
| 1645 | Ga0307416_100129765 | |||
| 1646 | Ga0307414_10001217 | |||
| 1647 | Ga0307414_10002805 | |||
| 1648 | Ga0307414_10004094 | |||
| 1649 | Ga0307414_10010149 | |||
| 1650 | Ga0307414_10016511 | |||
| 1651 | Ga0307414_10034082 | |||
| 1652 | Ga0307414_10037112 | |||
| 1653 | Ga0307414_10083811 | |||
| 1654 | Ga0307411_10001507 | |||
| 1655 | Ga0307411_10001967 | |||
| 1656 | Ga0307411_10005401 | |||
| 1657 | Ga0307411_10009354 | |||
| 1658 | Ga0307411_10013451 | |||
| 1659 | Ga0307411_10016664 | |||
| 1660 | Ga0307411_10023501 | |||
| 1661 | Ga0307411_10045292 | |||
| 1662 | Ga0307415_100000799 | |||
| 1663 | Ga0307415_100002317 | |||
| 1664 | Ga0307415_100009039 | |||
| 1665 | Ga0307415_100029131 | |||
| 1666 | Ga0307415_100031045 | |||
| 1667 | Ga0307415_100034705 | |||
| 1668 | Ga0373943_0034418 | |||
| 1669 | Ga0373931_0049228 | |||
| 1670 | Ga0316582_0019261 | |||
| 1671 | Ga0395899_0000691 | |||
| 1672 | Ga0395899_0000936 | |||
| 1673 | Ga0395899_0006865 | |||
| 1674 | Ga0395899_0020623 | |||
| 1675 | Ga0395899_0022042 | |||
| 1676 | Ga0395899_0032052 | |||
| 1677 | Ga0395899_0050993 | |||
| 1678 | Ga0395900_0000316 | |||
| 1679 | Ga0395900_0000902 | |||
| 1680 | Ga0395900_0006286 | |||
| 1681 | Ga0395900_0006902 | |||
| 1682 | Ga0395900_0013536 | |||
| 1683 | Ga0395900_0014211 | |||
| 1684 | Ga0395900_0020006 | |||
| 1685 | Ga0395900_0020055 | |||
| 1686 | Ga0395900_0024222 | |||
| 1687 | Ga0395900_0035040 | |||
| 1688 | Ga0395900_0041989 | |||
| 1689 | Ga0395900_0048835 | |||
| 1690 | Ga0395900_0058611 | |||
| 1691 | Ga0395900_0066890 | |||
| 1692 | Ga0395900_0073751 | |||
| 1693 | Ga0395900_0077014 | |||
| 1694 | Ga0395900_0163801 | |||
| 1695 | Ga0395900_0165863 | |||
| 1696 | Ga0395900_0183529 | |||
| 1697 | Ga0395900_0189156 | |||
| 1698 | Ga0395898_0000192 | |||
| 1699 | Ga0395898_0001190 | |||
| 1700 | Ga0395898_0002752 | |||
| 1701 | Ga0395898_0034317 | |||
| 1702 | Ga0395898_0057225 | |||
| 1703 | Ga0395898_0077797 | |||
| 1704 | Ga0395898_0108699 | |||
| 1705 | Ga0395905_0000066 | |||
| 1706 | Ga0395905_0000916 | |||
| 1707 | Ga0395905_0001950 | |||
| 1708 | Ga0395905_0002085 | |||
| 1709 | Ga0395905_0002298 | |||
| 1710 | Ga0395905_0014596 | |||
| 1711 | Ga0395905_0023489 | |||
| 1712 | Ga0395905_0027904 | |||
| 1713 | Ga0395905_0028256 | |||
| 1714 | Ga0395905_0033675 | |||
| 1715 | Ga0395905_0036693 | |||
| 1716 | Ga0395905_0037639 | |||
| 1717 | Ga0395905_0081710 | |||
| 1718 | Ga0395905_0087525 | |||
| 1719 | Ga0395905_0106829 | |||
| 1720 | Ga0395905_0130752 | |||
| 1721 | Ga0395905_0145437 | |||
| 1722 | Ga0436364_0184827 | |||
| 1723 | Ga0395901_0000203 | |||
| 1724 | Ga0395901_0000232 | |||
| 1725 | Ga0395901_0000468 | |||
| 1726 | Ga0395901_0003002 | |||
| 1727 | Ga0395901_0006424 | |||
| 1728 | Ga0395901_0007762 | |||
| 1729 | Ga0395901_0018702 | |||
| 1730 | Ga0395901_0026159 | |||
| 1731 | Ga0395901_0051451 | |||
| 1732 | Ga0395901_0055613 | |||
| 1733 | Ga0395901_0060872 | |||
| 1734 | Ga0395901_0088978 | |||
| 1735 | Ga0395901_0096457 | |||
| 1736 | Ga0395901_0112625 | |||
| 1737 | Ga0395901_0117755 | |||
| 1738 | Ga0395901_0206534 | |||
| 1739 | Ga0436365_0393854 | |||
| 1740 | Ga0436365_0607739 | |||
| 1741 | Ga0436365_1728108 | |||
| 1742 | Ga0436362_0976836 | |||
| 1743 | Ga0439445_0000259 | |||
| 1744 | Ga0439448_0003663 | |||
| 1745 | Ga0439462_0000190 | |||
| 1746 | Ga0450912_000100 | |||
| 1747 | Ga0450905_000562 | |||
| 1748 | Ga0439458_0002875 | |||
| 1749 | Ga0439458_0003632 | |||
| 1750 | Ga0466969_0011914 | |||
| 1751 | Ga0466961_0039856 | |||
| 1752 | Ga0466963_0007220 | |||
| 1753 | Ga0466963_0041404 | |||
| 1754 | Ga0466963_0044084 | |||
| 1755 | Ga0453684_0122144 | |||
| 1756 | Ga0466971_0025269 | |||
| 1757 | Ga0466957_0013383 | |||
| 1758 | Ga0466957_0014646 | |||
| 1759 | Ga0466959_0025239 | |||
| 1760 | Ga0451576_0091666 | |||
| 1761 | Ga0466958_0001866 | |||
| 1762 | Ga0466958_0015322 | |||
| 1763 | Ga0466958_0072874 | |||
| 1764 | Ga0466967_0002854 | |||
| 1765 | Ga0466967_0005893 | |||
| 1766 | Ga0466967_0007661 | |||
| 1767 | Ga0466967_0028082 | |||
| 1768 | Ga0466967_0029613 | |||
| 1769 | Ga0466967_0057970 | |||
| 1770 | Ga0495627_000197 | |||
| 1771 | Ga0495638_0000980 | |||
| 1772 | Ga0495650_0000058 | |||
| 1773 | Ga0495650_0001171 | |||
| 1774 | Ga0495596_0000074 | |||
| 1775 | Ga0495583_0002103 | |||
| 1776 | Ga0495606_0001775 | |||
| 1777 | Ga0495610_0000022 | |||
| 1778 | Ga0495610_0002818 | |||
| 1779 | Ga0495620_0017337 | |||
| 1780 | Ga0495643_0001911 | |||
| 1781 | Ga0495643_0002032 | |||
| 1782 | Ga0495643_0016512 | |||
| 1783 | Ga0495643_0017609 | |||
| 1784 | Ga0495643_0019171 | |||
| 1785 | Ga0495648_0000698 | |||
| 1786 | Ga0495663_0000248 | |||
| 1787 | Ga0495663_0001615 | |||
| 1788 | Ga0495663_0002089 | |||
| 1789 | Ga0495642_0007434 | |||
| 1790 | Ga0495654_0000224 | |||
| 1791 | Ga0495598_0002444 | |||
| 1792 | Ga0495621_0000267 | |||
| 1793 | Ga0495621_0000754 | |||
| 1794 | Ga0495622_0006416 | |||
| 1795 | Ga0495633_0001330 | |||
| 1796 | Ga0495668_0000001 | |||
| 1797 | Ga0495668_0000007 | |||
| 1798 | Ga0495668_0001200 | |||
| 1799 | Ga0495668_0014866 | |||
| 1800 | Ga0495625_0000167 | |||
| 1801 | Ga0495625_0000237 | |||
| 1802 | Ga0495625_0006053 | |||
| 1803 | Ga0495659_0007180 | |||
| 1804 | Ga0495661_0046112 | |||
| 1805 | Ga0495669_0000110 | |||
| 1806 | Ga0495669_0000854 | |||
| 1807 | Ga0495669_0001549 | |||
| 1808 | Ga0495669_0001606 | |||
| 1809 | Ga0495669_0003119 | |||
| 1810 | Ga0495670_0027880 | |||
| 1811 | Ga0495671_0017917 | |||
| 1812 | Ga0495600_0003414 | |||
| 1813 | Ga0495683_0007930 | |||
| 1814 | Ga0495687_000178 | |||
| 1815 | Ga0495687_000211 | |||
| 1816 | Ga0495681_0000123 | |||
| 1817 | Ga0495681_0002869 | |||
| 1818 | Ga0495686_0000191 | |||
| 1819 | Ga0495615_0000131 | |||
| 1820 | Ga0495626_0005587 | |||
| 1821 | Ga0496100_0009750 | |||
| 1822 | Ga0496100_0018618 | |||
| 1823 | Ga0496101_0017464 | |||
| 1824 | Ga0496101_0066423 | |||
| 1825 | Ga0496101_0073935 | |||
| 1826 | Ga0496102_0075802 | |||
| 1827 | Ga0496103_0016658 | |||
| 1828 | Ga0496103_0055116 | |||
| 1829 | Ga0496104_0017845 | |||
| 1830 | Ga0496104_0085174 | |||
| 1831 | Ga0496105_0000435 | |||
| 1832 | Ga0496105_0000866 | |||
| 1833 | Ga0496106_0004254 | |||
| 1834 | Ga0496106_0024444 | |||
| 1835 | Ga0496107_0001028 | |||
| 1836 | Ga0496107_0005617 | |||
| 1837 | Ga0496107_0024445 | |||
| 1838 | Ga0496107_0029493 | |||
| 1839 | Ga0496107_0036600 | |||
| 1840 | Ga0496107_0039309 | |||
| 1841 | Ga0496108_0001167 | |||
| 1842 | Ga0496108_0002014 | |||
| 1843 | Ga0496108_0004348 | |||
| 1844 | Ga0496108_0013160 | |||
| 1845 | Ga0496109_0007854 | |||
| 1846 | Ga0496109_0014218 | |||
| 1847 | Ga0496109_0023009 | |||
| 1848 | Ga0496110_0001813 | |||
| 1849 | Ga0496110_0003336 | |||
| 1850 | Ga0496110_0005174 | |||
| 1851 | Ga0496110_0020631 | |||
| 1852 | Ga0496110_0025581 | |||
| 1853 | Ga0496110_0031828 | |||
| 1854 | Ga0496110_0041411 | |||
| 1855 | Ga0496110_0067027 | |||
| 1856 | Ga0496111_0010795 | |||
| 1857 | Ga0496111_0026781 | |||
| 1858 | Ga0496111_0042746 | |||
| 1859 | Ga0496112_0037146 | |||
| 1860 | Ga0496112_0050899 | |||
| 1861 | Ga0496113_0000943 | |||
| 1862 | Ga0496113_0001600 | |||
| 1863 | Ga0496113_0002498 | |||
| 1864 | Ga0496113_0094055 | |||
| 1865 | Ga0496114_0000006 | |||
| 1866 | Ga0496114_0189808 | |||
| 1867 | Ga0496115_0000042 | |||
| 1868 | Ga0496115_0010928 | |||
| 1869 | Ga0496116_0000035 | |||
| 1870 | Ga0496116_0001662 | |||
| 1871 | Ga0496116_0033685 | |||
| 1872 | Ga0496116_0056202 | |||
| 1873 | Ga0496117_0013881 | |||
| 1874 | Ga0496118_0000109 | |||
| 1875 | Ga0496118_0016413 | |||
| 1876 | Ga0496118_0032274 | |||
| 1877 | Ga0496119_0031303 | |||
| 1878 | Ga0496121_0000070 | |||
| 1879 | Ga0496121_0000740 | |||
| 1880 | Ga0496121_0002895 | |||
| 1881 | Ga0496121_0069828 | |||
| 1882 | Ga0496123_0001169 | |||
| 1883 | Ga0496123_0006066 | |||
| 1884 | Ga0496124_0003117 | |||
| 1885 | Ga0496125_0000638 | |||
| 1886 | Ga0496125_0025119 | |||
| 1887 | Ga0496126_0000084 | |||
| 1888 | Ga0496126_0052607 | |||
| 1889 | Ga0501032_0022445 | |||
| 1890 | Ga0501033_0019441 | |||
| 1891 | Ga0501034_0066514 | |||
| 1892 | Ga0501042_0005275 | |||
| 1893 | Ga0501047_0047289 | |||
| 1894 | Ga0501067_0041216 | |||
| 1895 | Ga0501067_0055782 | |||
| 1896 | Ga0501223_000116 | |||
| 1897 | Ga0501223_004154 | |||
| 1898 | Ga0501223_004213 | |||
| 1899 | Ga0501224_000011 | |||
| 1900 | Ga0501233_000190 | |||
| 1901 | Ga0501257_000144 | |||
| 1902 | Ga0501225_0000152 | |||
| 1903 | Ga0501035_0026060 | |||
| 1904 | Ga0501044_0001099 | |||
| 1905 | Ga0501044_0027702 | |||
| 1906 | Ga0501226_000024 | |||
| 1907 | nmdc:mga03683_13_c1 | |||
| 1908 | nmdc:mga03683_289_c1 | |||
| 1909 | nmdc:mga03n38_3053_c1 | |||
| 1910 | nmdc:mga00v17_20204_c1 | |||
| 1911 | nmdc:mga0k408_8_c1 | |||
| 1912 | nmdc:mga06z11_573_c1 | |||
| 1913 | nmdc:mga04h51_76_c1 | |||
| 1914 | nmdc:mga07m45_38_c1 | |||
| 1915 | nmdc:mga07m45_3_c1 | |||
| 1916 | nmdc:mga07m45_618_c1 | |||
| 1917 | nmdc:mga05p37_45901_c1 | |||
| 1918 | Ga0500643_000001 | |||
| 1919 | Ga0500643_000612 | |||
| 1920 | Ga0500643_000752 | |||
| 1921 | Ga0500643_000997 | |||
| 1922 | Ga0500556_0000027 | |||
| 1923 | Ga0500607_000048 | |||
| 1924 | Ga0500607_004691 | |||
| 1925 | Ga0500618_003695 | |||
| 1926 | Ga0500642_0000003 | |||
| 1927 | Ga0500573_0000045 | |||
| 1928 | Ga0500604_0000003 | |||
| 1929 | Ga0500616_0000128 | |||
| 1930 | Ga0500624_000045 | |||
| 1931 | Ga0500627_0000004 | |||
| 1932 | Ga0500627_0000278 | |||
| 1933 | Ga0500567_001083 | |||
| 1934 | Ga0500625_000010 | |||
| 1935 | Ga0500645_000011 | |||
| 1936 | Ga0500645_002144 | |||
| 1937 | Ga0500645_009600 | |||
| 1938 | Ga0500596_001714 | |||
| 1939 | Ga0466962_0005552 | |||
| 1940 | 2511129618 | |||
| 1941 | 2643821418 | |||
| 1942 | 2643836012 | |||
| 1943 | 2643949078 | |||
| 1944 | 2644056937 | |||
| 1945 | 2739649757 | |||
| 1946 | 2740028230 | |||
| 1947 | 2819552610 | |||
| 1948 | 2852655535 | |||
| 1949 | 2852681033 | |||
| 1950 | 2882807420 | |||
| 1951 | 2885428726 | |||
| 1952 | 2895886104 | |||
| 1953 | 2896185021 | |||
| 1954 | 2896255410 | |||
| 1955 | 2896429792 | |||
| 1956 | 2919141676 | |||
| 1957 | 8054302721 | |||
| 1958 | 8057101778 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1yd7-assembly1.cif.gz_A | conserved hypothetical protein pfu-1647980-001 from pyrococcus furiosus | 0.8846 | 242 | 436 |
| 6n2o-assembly1.cif.gz_C | 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound | 0.8498 | 23 | 626 |
| 6n2o-assembly1.cif.gz_C | 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound | 0.8416 | 23 | 626 |
| 1yd7-assembly1.cif.gz_A | conserved hypothetical protein pfu-1647980-001 from pyrococcus furiosus | 0.8403 | 242 | 436 |
| 4wbx-assembly1.cif.gz_C | conserved hypothetical protein pf1771 from pyrococcus furiosus solved by sulfur sad using swiss light source data | 0.8282 | 242 | 621 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53182_522_626_3.40.50.920 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9587 | 526 | 627 | 3.40.50.920 |
| af_O53182_522_626_3.40.50.920 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9235 | 526 | 627 | 3.40.50.920 |
| af_O53182_237_440_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9161 | 238 | 436 | 3.40.50.970 |
| af_Q2FZ05_468_579_3.40.50.920 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8984 | 520 | 626 | 3.40.50.920 |
| af_Q57724_1_190_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.8939 | 247 | 432 | 3.40.50.970 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M0YTC5-F1-model_v4 | 2-oxoglutarate ferredoxin oxidoreductase subunit alpha | 0.9686 | 488 | 628 |
GO:0003824
GO:0006979 |
| AF-A0A534NMQ2-F1-model_v4 | 2-oxoglutarate ferredoxin oxidoreductase subunit alpha | 0.9647 | 252 | 336 |
GO:0006979
GO:0016491 |
| AF-A0A7X7J234-F1-model_v4 | 2-oxoglutarate ferredoxin oxidoreductase subunit alpha | 0.9616 | 456 | 630 |
GO:0003824
GO:0006979 |
| AF-A0A2A4MJJ5-F1-model_v4 | 2-oxoglutarate ferredoxin oxidoreductase subunit alpha | 0.9599 | 99 | 628 |
GO:0006979
GO:0016903 |
| AF-A0A383B6L0-F1-model_v4 | Pyruvate flavodoxin/ferredoxin oxidoreductase pyrimidine binding domain-containing protein | 0.9588 | 82 | 328 |
GO:0006979
GO:0016903 |