F487364

General Info

Members Datasets Scaffolds Average Seq Length
980 474 1960 173

Family's Representative Sequence

Representative Sequence 3300025929|Ga0207664_10333073|Ga0207664_103330733
Length 192
Sequence MSAAKSSAACSKGDEMSRIGKYPVTIPQGVTVEVAGQTITAKGKLGTIKLPVSGEVSAAVQDGKVVVKPKTETKRARVHWGTMRALVNNMVAGVSKGFTKNLEIEGVGYRAAVQGKNLVLQLGYSHDVVFPIPSDIKITCEKPTAITITGADRQRVGQTAAVIRAFRKPEPYKGKGIKYGDEHVRRKEGKKK

Samples

Sample ID Description Type Environment
1 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
8 3300002870 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003288 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_44 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
23 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
24 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
25 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
26 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
27 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
28 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
29 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
30 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
31 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
32 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
33 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
34 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
35 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
36 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
37 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
38 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
39 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
40 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
41 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
42 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
43 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
44 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
45 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
46 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
47 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
48 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
49 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
50 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
51 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
52 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
57 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
58 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
59 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
64 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
85 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
86 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
106 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
107 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
112 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
118 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
121 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
128 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
129 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
130 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
131 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
134 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
138 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
175 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
176 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
177 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
178 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
179 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
180 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
181 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
182 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
183 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
184 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
185 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
186 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
189 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
198 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
199 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
200 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
201 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
202 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
204 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
207 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
211 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
212 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
213 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
214 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
215 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
216 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
217 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
218 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
219 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
220 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
221 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
222 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
223 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
224 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
225 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
226 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
227 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
228 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
229 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
230 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
231 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
232 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
233 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
234 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
235 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
236 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
237 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
238 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
239 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
240 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
241 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
242 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
243 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
244 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
245 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
246 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
247 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
248 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
249 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
250 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
251 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
252 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
253 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
254 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
255 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
256 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
257 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
258 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
259 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
260 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
261 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
262 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
263 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
264 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
265 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
266 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
267 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
268 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
269 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
270 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
271 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
272 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
273 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
274 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
275 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
276 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
277 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
278 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
279 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
280 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
281 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
282 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
283 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
284 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
285 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
286 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
287 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
288 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
289 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
290 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
291 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
292 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
293 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
294 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
295 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
296 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
297 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
298 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
299 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
300 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
301 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
302 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
303 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
304 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
305 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
306 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
307 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
308 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
309 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
310 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
311 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
312 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
313 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
314 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
315 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
316 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
317 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
318 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
319 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
320 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
321 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
322 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
323 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
324 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
325 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
326 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
327 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
328 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
329 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
330 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
331 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
332 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
333 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
334 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
335 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
336 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
337 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
338 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
339 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
340 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
341 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
342 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
343 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
344 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
345 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
346 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
347 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
348 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
349 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
350 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
351 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
352 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
353 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
354 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
355 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
356 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
357 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
358 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
359 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
360 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
361 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
369 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
370 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
395 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
396 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
397 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
398 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
399 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
400 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
401 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
402 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
403 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
404 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
405 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
406 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
407 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
408 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
409 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
410 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
411 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
412 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
413 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300060247 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
452 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
453 2643221556 Massilia sp. Root1485 Isolate Unclassified
454 2643221645 Massilia sp. Root351 Isolate Unclassified
455 2643221664 Massilia sp. Root418 Isolate Unclassified
456 2643221684 Massilia sp. Root133 Isolate Unclassified
457 2738541280 Massilia sp. GV090 Isolate Unclassified
458 2738541297 Duganella sp. GV083 Isolate Unclassified
459 2738541300 Massilia sp. GV016 Isolate Unclassified
460 2738541357 Duganella sp. GV053 Isolate Unclassified
461 2738543003 Duganella sp. GV066 Isolate Unclassified
462 2738543018 Massilia sp. GV045 Isolate Unclassified
463 2738543026 Duganella sp. GV089 Isolate Unclassified
464 2738543029 Duganella sp. GV039 Isolate Unclassified
465 2738543030 Massilia sp. GV097 Isolate Unclassified
466 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
467 2818991436 Collimonas arenae 515 Isolate Unclassified
468 2842711865 Duganella sp. R-73148 Isolate Unclassified
469 2857553236 Duganella sp. R-74557 Isolate Unclassified
470 2857558681 Duganella sp. R-74565 Isolate Unclassified
471 2857564685 Duganella sp. R-74599 Isolate Unclassified
472 2904424332 Duganella sp. 1411 Isolate Rhizosphere
473 2919476304 Duganella sp. 3397 Isolate Unclassified
474 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.69
Metatranscriptomes 17.96
Isolates 2.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.49
Nodule 0.41
Rhizoplane 3.57
Rhizosphere 86.22
Stem 0
Stem Tuber 0
Unclassified 0.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207664_10333073 3300025929 Bacteria 1341
2 JGI24739J22299_10081927 3300001989 Bacteria 990
3 JGI24737J22298_10004492 3300001990 Bacteria 4859
4 JGI24735J21928_10116714 3300002067 Bacteria 768
5 JGI25162J39368_1000154 3300002737 Bacteria 75240
6 JGI25154J39366_1001042 3300002738 Bacteria 11063
7 JGI25158J39367_1000542 3300002739 Bacteria 7614
8 Ga0006763J43179_104166 3300002870 Bacteria 5040
9 Ga0006765J45826_105454 3300003161 Bacteria 4839
10 Ga0006778J45830_1013714 3300003162 Bacteria 8778
11 Ga0006759J45824_1007037 3300003163 Bacteria 1508
12 Ga0006759J45824_1018706 3300003163 Bacteria 1553
13 Ga0006759J45824_1019946 3300003163 Bacteria 12757
14 JGI25165J46597_1000239 3300003214 Bacteria 75240
15 JGI25153J46596_10024994 3300003215 Bacteria 2143
16 Ga0007428J48920_101526 3300003288 Bacteria 3934
17 Ga0006758J48902_1003545 3300003300 Bacteria 8441
18 Ga0006758J48902_1003546 3300003300 Bacteria 6400
19 Ga0006758J48902_1008911 3300003300 Bacteria 7674
20 Ga0006758J48902_1015405 3300003300 Bacteria 1839
21 Ga0006770J48903_1019658 3300003305 Bacteria 2060
22 Ga0006777J48905_1009816 3300003308 Bacteria 3090
23 rootH2_10116476 3300003320 Bacteria 1092
24 Ga0007417J51691_1002612 3300003544 Bacteria 14201
25 Ga0007417J51691_1011781 3300003544 Bacteria 8032
26 Ga0007417J51691_1016345 3300003544 Bacteria 771
27 Ga0007427J51700_104411 3300003559 Bacteria 3323
28 Ga0007427J51700_113492 3300003559 Bacteria 2911
29 Ga0006781J51513_1010997 3300003568 Bacteria 3463
30 Ga0007410J51695_1004597 3300003574 Bacteria 14339
31 Ga0007410J51695_1012689 3300003574 Bacteria 12724
32 Ga0007410J51695_1025455 3300003574 Bacteria 2936
33 Ga0007410J51695_1058196 3300003574 Bacteria 1167
34 Ga0007409J51694_1000685 3300003575 Bacteria 1950
35 Ga0007409J51694_1029110 3300003575 Bacteria 1244
36 Ga0007409J51694_1070581 3300003575 Bacteria 1247
37 Ga0007416J51690_1005292 3300003577 Bacteria 1546
38 Ga0007416J51690_1032863 3300003577 Bacteria 1290
39 Ga0007429J51699_1013730 3300003579 Bacteria 3438
40 Ga0007411J51799_103551 3300003611 Bacteria 13349
41 Ga0007411J51799_109076 3300003611 Bacteria 2033
42 Ga0007415J51800_102854 3300003613 Bacteria 5009
43 Ga0007415J51800_105493 3300003613 Bacteria 2566
44 Ga0007415J51800_109761 3300003613 Bacteria 1239
45 Ga0032354_1003171 3300003693 Bacteria 2717
46 Ga0006780_1003428 3300003735 Bacteria 4512
47 Ga0055538_1000094 3300003751 Bacteria 75240
48 Ga0055539_1000136 3300003752 Bacteria 76284
49 Ga0055533_1000143 3300003756 Bacteria 75240
50 Ga0055525_1000018 3300003759 Bacteria 393974
51 Ga0055525_1000188 3300003759 Bacteria 75240
52 Ga0055542_1007983 3300003762 Bacteria 2102
53 Ga0055529_1000079 3300003763 Bacteria 149370
54 Ga0055526_1008246 3300003771 Bacteria 5232
55 Ga0055526_1008253 3300003771 Bacteria 5230
56 Ga0055524_1000024 3300003775 Bacteria 217953
57 Ga0055541_1000092 3300003841 Bacteria 75240
58 Ga0058861_10170907 3300004800 Bacteria 1513
59 Ga0065165_1006561 3300005262 Bacteria 6061
60 Ga0065714_10022125 3300005288 Bacteria 1710
61 Ga0065714_10153472 3300005288 Bacteria 1090
62 Ga0070658_10375676 3300005327 Bacteria 1219
63 Ga0070658_11193996 3300005327 Bacteria 661
64 Ga0070676_10039416 3300005328 Bacteria 2732
65 Ga0070683_101033281 3300005329 Bacteria 789
66 Ga0068869_100134135 3300005334 Bacteria 1906
67 Ga0070680_100002604 3300005336 Bacteria 13361
68 Ga0070680_100028265 3300005336 Bacteria 4496
69 Ga0070680_100046385 3300005336 Bacteria 3535
70 Ga0070680_101014747 3300005336 Bacteria 717
71 Ga0070660_100133103 3300005339 Bacteria 1991
72 Ga0070660_100689087 3300005339 Bacteria 856
73 Ga0070661_100605006 3300005344 Bacteria 886
74 Ga0070692_10189273 3300005345 Bacteria 1198
75 Ga0070675_100276851 3300005354 Bacteria 1474
76 Ga0070671_100026292 3300005355 Bacteria 4782
77 Ga0070674_100370014 3300005356 Bacteria 1163
78 Ga0070673_100529641 3300005364 Bacteria 1068
79 Ga0070659_100293652 3300005366 Bacteria 1354
80 Ga0070659_100341638 3300005366 Bacteria 1254
81 Ga0070667_100412882 3300005367 Bacteria 1230
82 Ga0070667_100542226 3300005367 Bacteria 1069
83 Ga0070709_10045049 3300005434 Bacteria 2735
84 Ga0070714_100458199 3300005435 Bacteria 1212
85 Ga0070714_101141093 3300005435 Bacteria 760
86 Ga0070713_100322951 3300005436 Bacteria 1426
87 Ga0070713_100459605 3300005436 Bacteria 1197
88 Ga0070711_100043033 3300005439 Bacteria 3056
89 Ga0070663_100255852 3300005455 Bacteria 1387
90 Ga0070681_10001062 3300005458 Bacteria 23407
91 Ga0070681_10009391 3300005458 Bacteria 9625
92 Ga0070681_10035879 3300005458 Bacteria 4980
93 Ga0070681_10520790 3300005458 Bacteria 1102
94 Ga0068867_100076663 3300005459 Bacteria 2511
95 Ga0070706_100446918 3300005467 Bacteria 1203
96 Ga0070707_100321013 3300005468 Bacteria 1505
97 Ga0070679_100007538 3300005530 Bacteria 10174
98 Ga0070679_100043950 3300005530 Bacteria 4449
99 Ga0070679_100372080 3300005530 Bacteria 1376
100 Ga0070684_100098831 3300005535 Bacteria 2604
101 Ga0068853_100029320 3300005539 Bacteria 4637
102 Ga0070672_100442341 3300005543 Bacteria 1119
103 Ga0070693_100614552 3300005547 Bacteria 786
104 Ga0068855_101539437 3300005563 Bacteria 682
105 Ga0068857_100148498 3300005577 Bacteria 2122
106 Ga0068857_100999740 3300005577 Bacteria 805
107 Ga0068854_100069183 3300005578 Bacteria 2576
108 Ga0068856_100054238 3300005614 Bacteria 3953
109 Ga0068852_100141024 3300005616 Bacteria 2230
110 Ga0068866_10380290 3300005718 Bacteria 905
111 Ga0070717_10514606 3300006028 Bacteria 1082
112 Ga0070717_10803096 3300006028 Bacteria 856
113 Ga0075363_100057573 3300006048 Bacteria 2086
114 Ga0070716_100069058 3300006173 Bacteria 2070
115 Ga0070712_100418037 3300006175 Bacteria 1111
116 Ga0075362_10000565 3300006177 Bacteria 10784
117 Ga0068871_100015656 3300006358 Bacteria 5684
118 Ga0075434_100292233 3300006871 Bacteria 1650
119 Ga0075436_100027159 3300006914 Bacteria 3940
120 Ga0075436_100053121 3300006914 Bacteria 2797
121 Ga0079104_1004078 3300006946 Bacteria 6424
122 Ga0099826_10000010 3300006948 Bacteria 314346
123 Ga0105244_10028871 3300009036 Bacteria 2972
124 Ga0105244_10093441 3300009036 Bacteria 1478
125 Ga0105240_10108670 3300009093 Bacteria 3360
126 Ga0105240_10183485 3300009093 Bacteria 2467
127 Ga0105240_10302490 3300009093 Bacteria 1829
128 Ga0105245_10023078 3300009098 Bacteria 5460
129 Ga0105243_10006860 3300009148 Bacteria 8779
130 Ga0105241_10057980 3300009174 Bacteria 2972
131 Ga0105242_10007953 3300009176 Bacteria 8168
132 Ga0105237_10056847 3300009545 Bacteria 3915
133 Ga0105238_10181832 3300009551 Bacteria 2079
134 Ga0105239_10159405 3300010375 Bacteria 2520
135 Ga0105246_10631108 3300011119 Bacteria 930
136 Ga0157373_10015732 3300013100 Bacteria 5524
137 Ga0157371_10001564 3300013102 Bacteria 23533
138 Ga0157371_10061649 3300013102 Bacteria 2659
139 Ga0157370_10001390 3300013104 Bacteria 29988
140 Ga0157370_10062522 3300013104 Bacteria 3530
141 Ga0157370_10159747 3300013104 Bacteria 2097
142 Ga0157370_10383313 3300013104 Bacteria 1295
143 Ga0157369_10022775 3300013105 Bacteria 6985
144 Ga0157369_10093282 3300013105 Bacteria 3214
145 Ga0157374_11284784 3300013296 Bacteria 754
146 Ga0157378_10027087 3300013297 Bacteria 5057
147 Ga0157372_10466393 3300013307 Bacteria 1472
148 Ga0182008_10003186 3300014497 Bacteria 10028
149 Ga0182008_10014196 3300014497 Bacteria 4176
150 Ga0182008_10062305 3300014497 Bacteria 1838
151 Ga0182008_10140209 3300014497 Bacteria 1209
152 Ga0157376_10177756 3300014969 Bacteria 1943
153 Ga0182006_1000240 3300015261 Bacteria 51334
154 Ga0182006_1009882 3300015261 Bacteria 4266
155 Ga0182007_10055314 3300015262 Bacteria 1305
156 Ga0182005_1000016 3300015265 Bacteria 346889
157 Ga0182005_1000370 3300015265 Bacteria 24872
158 Ga0163161_10136578 3300017792 Bacteria 1854
159 Ga0197907_11499114 3300020069 Bacteria 1409
160 Ga0206356_10461406 3300020070 Bacteria 2184
161 Ga0206355_1124031 3300020076 Bacteria 900
162 Ga0206355_1623195 3300020076 Bacteria 1223
163 Ga0206351_10065238 3300020077 Bacteria 1639
164 Ga0206352_10851379 3300020078 Bacteria 1458
165 Ga0206350_10425581 3300020080 Bacteria 3340
166 Ga0206353_10343767 3300020082 Bacteria 2679
167 Ga0154015_1130987 3300020610 Bacteria 656
168 Ga0154015_1240091 3300020610 Bacteria 1026
169 Ga0213873_10016116 3300021358 Bacteria 1684
170 Ga0213872_10010693 3300021361 Bacteria 4359
171 Ga0213872_10095672 3300021361 Bacteria 1326
172 Ga0213872_10120400 3300021361 Bacteria 1161
173 Ga0213872_10157466 3300021361 Bacteria 989
174 Ga0213876_10029406 3300021384 Bacteria 2895
175 Ga0213876_10470897 3300021384 Bacteria 668
176 Ga0213875_10051551 3300021388 Bacteria 1927
177 Ga0213875_10309564 3300021388 Bacteria 748
178 Ga0224712_10010495 3300022467 Bacteria 2836
179 Ga0224712_10108908 3300022467 Bacteria 1186
180 Ga0209784_100010 3300025224 Bacteria 683664
181 Ga0209566_100008 3300025225 Bacteria 683664
182 Ga0209674_100019 3300025226 Bacteria 683664
183 Ga0209672_107144 3300025228 Bacteria 1747
184 Ga0209563_100011 3300025230 Bacteria 1187808
185 Ga0209563_100021 3300025230 Bacteria 683764
186 Ga0207427_100342 3300025231 Bacteria 30270
187 Ga0209437_100019 3300025233 Bacteria 683764
188 Ga0209437_111736 3300025233 Bacteria 1300
189 Ga0207425_1000845 3300025245 Bacteria 15112
190 Ga0209646_1000068 3300025246 Bacteria 233765
191 Ga0209677_100011 3300025253 Bacteria 683664
192 Ga0209677_107757 3300025253 Bacteria 2205
193 Ga0209148_1000444 3300025254 Bacteria 45400
194 Ga0209233_1000025 3300025261 Bacteria 683764
195 Ga0209565_1003095 3300025263 Bacteria 5581
196 Ga0209455_1000070 3300025272 Bacteria 307867
197 Ga0209564_1000027 3300025295 Bacteria 518458
198 Ga0209564_1000047 3300025295 Bacteria 368031
199 Ga0209758_1000322 3300025297 Bacteria 92458
200 Ga0209256_1000054 3300025299 Bacteria 298431
201 Ga0207655_1000499 3300025728 Bacteria 50341
202 Ga0207692_10024037 3300025898 Bacteria 2827
203 Ga0207642_10237198 3300025899 Bacteria 1028
204 Ga0207647_10029480 3300025904 Bacteria 3551
205 Ga0207699_10053227 3300025906 Bacteria 2399
206 Ga0207699_10165237 3300025906 Bacteria 1476
207 Ga0207645_10052858 3300025907 Bacteria 2596
208 Ga0207645_10908634 3300025907 Bacteria 598
209 Ga0207643_10227447 3300025908 Bacteria 1143
210 Ga0207705_10061747 3300025909 Bacteria 2707
211 Ga0207654_10002111 3300025911 Bacteria 10175
212 Ga0207707_10000624 3300025912 Bacteria 35078
213 Ga0207707_10072148 3300025912 Bacteria 3010
214 Ga0207707_10560144 3300025912 Bacteria 970
215 Ga0207695_10286070 3300025913 Bacteria 1542
216 Ga0207695_10518252 3300025913 Bacteria 1074
217 Ga0207671_10322971 3300025914 Bacteria 1222
218 Ga0207660_10003099 3300025917 Bacteria 10867
219 Ga0207660_10028410 3300025917 Bacteria 3825
220 Ga0207660_10035902 3300025917 Bacteria 3443
221 Ga0207660_10596541 3300025917 Bacteria 899
222 Ga0207657_10030110 3300025919 Bacteria 4931
223 Ga0207657_10117719 3300025919 Bacteria 2188
224 Ga0207649_10023804 3300025920 Bacteria 3551
225 Ga0207652_10002587 3300025921 Bacteria 15177
226 Ga0207652_10016091 3300025921 Bacteria 6099
227 Ga0207652_10047542 3300025921 Bacteria 3666
228 Ga0207652_10297798 3300025921 Bacteria 1456
229 Ga0207652_10574032 3300025921 Bacteria 1012
230 Ga0207694_10049485 3300025924 Bacteria 3254
231 Ga0207659_10041435 3300025926 Bacteria 3225
232 Ga0207659_10265034 3300025926 Bacteria 1399
233 Ga0207687_10038586 3300025927 Bacteria 3265
234 Ga0207700_10270259 3300025928 Bacteria 1459
235 Ga0207700_10379394 3300025928 Bacteria 1236
236 Ga0207700_11037856 3300025928 Bacteria 733
237 Ga0207664_10013077 3300025929 Bacteria 5949
238 Ga0207664_10117307 3300025929 Bacteria 2222
239 Ga0207664_11090312 3300025929 Bacteria 714
240 Ga0207644_10018270 3300025931 Bacteria 4742
241 Ga0207644_10070425 3300025931 Bacteria 2556
242 Ga0207690_10048382 3300025932 Bacteria 2827
243 Ga0207690_10086879 3300025932 Bacteria 2199
244 Ga0207706_10008025 3300025933 Bacteria 9741
245 Ga0207665_10007579 3300025939 Bacteria 7172
246 Ga0207665_10183966 3300025939 Bacteria 1515
247 Ga0207691_10384377 3300025940 Bacteria 1198
248 Ga0207667_10730553 3300025949 Bacteria 991
249 Ga0207667_11030979 3300025949 Bacteria 809
250 Ga0207640_10022226 3300025981 Bacteria 3792
251 Ga0207640_10409513 3300025981 Bacteria 1106
252 Ga0207658_10463889 3300025986 Bacteria 1123
253 Ga0207639_10120679 3300026041 Bacteria 2153
254 Ga0207678_10003236 3300026067 Bacteria 14714
255 Ga0207708_10317470 3300026075 Bacteria 1271
256 Ga0207702_10128885 3300026078 Bacteria 2274
257 Ga0207702_10269242 3300026078 Bacteria 1606
258 Ga0207648_10088414 3300026089 Bacteria 2705
259 Ga0207674_10033169 3300026116 Bacteria 5406
260 Ga0207674_10265308 3300026116 Bacteria 1664
261 Ga0207698_10059102 3300026142 Bacteria 2975
262 Ga0209281_1002282 3300027111 Bacteria 8082
263 Ga0209282_1000072 3300027666 Bacteria 81137
264 Ga0307517_10185945 3300028786 Bacteria 1330
265 Ga0307515_10301373 3300028794 Bacteria 1287
266 Ga0316177_1129821 3300030731 Bacteria 1104
267 Ga0314311_1250163 3300030733 Bacteria 1402
268 Ga0316179_1096110 3300030734 Bacteria 2738
269 Ga0316178_1118368 3300030735 Bacteria 945
270 Ga0316180_1056555 3300030736 Bacteria 3840
271 Ga0316183_1076598 3300030742 Bacteria 1906
272 Ga0316181_1197761 3300030744 Bacteria 2465
273 Ga0316182_1166049 3300030745 Bacteria 1011
274 Ga0316182_1185148 3300030745 Bacteria 750
275 Ga0307513_10124367 3300031456 Bacteria 2539
276 Ga0307408_100067624 3300031548 Bacteria 2628
277 Ga0307408_100876168 3300031548 Bacteria 820
278 Ga0265314_10280692 3300031711 Bacteria 942
279 Ga0307518_10004256 3300031838 Bacteria 10276
280 Ga0307410_11091250 3300031852 Bacteria 692
281 Ga0307414_10232447 3300032004 Bacteria 1521
282 Ga0307414_11194441 3300032004 Bacteria 704
283 Ga0316593_10000028 3300032168 Bacteria 15385
284 Ga0316593_10001205 3300032168 Bacteria 5552
285 Ga0316593_10010927 3300032168 Bacteria 2622
286 Ga0316593_10054650 3300032168 Bacteria 1355
287 Ga0316592_1000008 3300033524 Bacteria 14268
288 Ga0316588_1000407 3300033528 Bacteria 5694
289 Ga0316588_1078285 3300033528 Bacteria 816
290 Ga0316587_1006317 3300033529 Bacteria 1806
291 Ga0316596_1000064 3300033541 Bacteria 12159
292 Ga0316596_1000066 3300033541 Bacteria 12106
293 Ga0316596_1002127 3300033541 Bacteria 4184
294 Ga0316596_1007429 3300033541 Bacteria 2589
295 Ga0373940_0077156 3300035088 Bacteria 979
296 Ga0373932_0023950 3300035112 Bacteria 1638
297 Ga0373932_0030521 3300035112 Bacteria 1495
298 Ga0373945_0257013 3300035116 Bacteria 739
299 Ga0373954_0018067 3300035118 Bacteria 3172
300 Ga0373956_0026542 3300035119 Bacteria 2509
301 Ga0373924_0058992 3300035410 Bacteria 1602
302 Ga0373927_0257353 3300035695 Bacteria 1148
303 Ga0373933_0098957 3300035724 Bacteria 1807
304 Ga0373937_0010933 3300036401 Bacteria 7948
305 Ga0373937_0021961 3300036401 Bacteria 5731
306 Ga0316584_0005838 3300036712 Bacteria 8309
307 Ga0316584_0201759 3300036712 Unclassified 1467
308 Ga0395899_0000218 3300037312 Bacteria 79718
309 Ga0395900_0138621 3300037418 Bacteria 2492
310 Ga0395900_0330458 3300037418 Bacteria 1502
311 Ga0395905_0043124 3300037471 Bacteria 4232
312 Ga0395905_0255533 3300037471 Bacteria 1636
313 Ga0395905_0545515 3300037471 Bacteria 1060
314 Ga0436364_0616684 3300037853 Bacteria 34041
315 Ga0436364_0714149 3300037853 Bacteria 1257
316 Ga0436364_0834204 3300037853 Bacteria 1647
317 Ga0436364_1028033 3300037853 Bacteria 2361
318 Ga0400484_27221 3300038725 Bacteria 11015
319 Ga0400484_30405 3300038725 Bacteria 18960
320 Ga0400490_00204 3300038726 Bacteria 5822
321 Ga0400490_19939 3300038726 Bacteria 2587
322 Ga0400491_28158 3300038727 Bacteria 6406
323 Ga0400488_49716 3300038741 Bacteria 1077
324 Ga0436365_0441459 3300039437 Bacteria 7457
325 Ga0436365_0616754 3300039437 Bacteria 2204
326 Ga0436365_1763289 3300039437 Bacteria 1343
327 Ga0436360_0935816 3300039438 Bacteria 666
328 Ga0436361_0097588 3300039447 Bacteria 1419
329 Ga0436361_0378504 3300039447 Bacteria 3034
330 Ga0436361_0819770 3300039447 Bacteria 1150
331 Ga0436361_1134854 3300039447 Bacteria 1904
332 Ga0436361_1164878 3300039447 Bacteria 6643
333 Ga0436363_0600038 3300039450 Bacteria 788
334 Ga0436362_0456417 3300039453 Bacteria 1335
335 Ga0436362_0534119 3300039453 Bacteria 4119
336 Ga0439466_0092749 3300041411 Bacteria 946
337 Ga0451797_0130278 3300041453 Bacteria 655
338 Ga0451805_007804 3300041461 Bacteria 924
339 Ga0451833_1345593 3300041491 Bacteria 1238
340 Ga0439442_067695 3300042002 Bacteria 759
341 Ga0439448_0045174 3300042005 Bacteria 1433
342 Ga0439448_0081728 3300042005 Bacteria 1085
343 Ga0439449_0003878 3300042007 Bacteria 5800
344 Ga0439449_0036247 3300042007 Bacteria 1835
345 Ga0439450_002944 3300042008 Bacteria 2753
346 Ga0450911_004506 3300042115 Bacteria 2277
347 Ga0450911_013578 3300042115 Bacteria 1088
348 Ga0450920_033325 3300042122 Bacteria 1018
349 Ga0450890_005814 3300042127 Bacteria 1585
350 Ga0450895_002778 3300042132 Bacteria 1323
351 Ga0450898_005215 3300042134 Bacteria 1954
352 Ga0450898_022107 3300042134 Bacteria 1124
353 Ga0450904_000961 3300042139 Bacteria 4531
354 Ga0450906_012608 3300042145 Bacteria 1566
355 Ga0439458_0059447 3300042157 Bacteria 952
356 Ga0450893_0005540 3300042532 Bacteria 2029
357 Ga0466972_0130107 3300044658 Bacteria 1185
358 Ga0466972_0148097 3300044658 Bacteria 1104
359 Ga0466965_0093975 3300044683 Bacteria 1527
360 Ga0466965_0214040 3300044683 Bacteria 1025
361 Ga0466963_0313069 3300044694 Bacteria 1104
362 Ga0466964_0020973 3300044706 Bacteria 2522
363 Ga0453684_0035225 3300044712 Bacteria 6924
364 Ga0466968_0037110 3300044735 Bacteria 2043
365 Ga0466957_0508805 3300044842 Bacteria 835
366 Ga0466960_0348048 3300044901 Bacteria 844
367 Ga0466959_0891169 3300045049 Bacteria 593
368 Ga0466958_0126968 3300045836 Bacteria 1599
369 Ga0466967_0113077 3300045976 Bacteria 2497
370 Ga0466967_0166281 3300045976 Bacteria 2073
371 Ga0495617_000397 3300046452 Bacteria 24142
372 Ga0495617_000636 3300046452 Bacteria 17611
373 Ga0495617_000830 3300046452 Bacteria 14706
374 Ga0495627_000011 3300046453 Bacteria 354522
375 Ga0495627_008059 3300046453 Bacteria 3972
376 Ga0495627_026596 3300046453 Bacteria 1863
377 Ga0495592_0237935 3300046454 Bacteria 1209
378 Ga0495603_0001612 3300046455 Bacteria 13252
379 Ga0495603_0009392 3300046455 Bacteria 5909
380 Ga0495590_0000020 3300046457 Bacteria 212352
381 Ga0495590_0000632 3300046457 Bacteria 16341
382 Ga0495590_0001551 3300046457 Bacteria 9865
383 Ga0495590_0006208 3300046457 Bacteria 4677
384 Ga0495590_0113871 3300046457 Bacteria 966
385 Ga0495591_029494 3300046458 Bacteria 1665
386 Ga0495591_042271 3300046458 Bacteria 1289
387 Ga0495629_0007936 3300046459 Bacteria 7808
388 Ga0495629_0021816 3300046459 Bacteria 4570
389 Ga0495638_0000235 3300046460 Bacteria 75760
390 Ga0495638_0077642 3300046460 Bacteria 2021
391 Ga0495638_0426504 3300046460 Bacteria 682
392 Ga0495638_0470404 3300046460 Bacteria 638
393 Ga0495651_0138175 3300046462 Bacteria 1770
394 Ga0495653_0004702 3300046463 Bacteria 11053
395 Ga0495653_0102956 3300046463 Bacteria 2065
396 Ga0495650_0000200 3300046471 Bacteria 130223
397 Ga0495650_0002469 3300046471 Bacteria 14877
398 Ga0495650_0007290 3300046471 Bacteria 6684
399 Ga0495650_0109119 3300046471 Bacteria 1029
400 Ga0495580_0009003 3300046472 Bacteria 7881
401 Ga0495580_0184657 3300046472 Bacteria 1439
402 Ga0495580_0772514 3300046472 Bacteria 624
403 Ga0495582_0005108 3300046473 Bacteria 7350
404 Ga0495582_0116114 3300046473 Bacteria 1505
405 Ga0495582_0228048 3300046473 Bacteria 1066
406 Ga0495605_0005449 3300046474 Bacteria 7411
407 Ga0495605_0010393 3300046474 Bacteria 5209
408 Ga0495605_0013819 3300046474 Bacteria 4436
409 Ga0495605_0044149 3300046474 Bacteria 2205
410 Ga0495605_0070705 3300046474 Bacteria 1649
411 Ga0495605_0074651 3300046474 Bacteria 1595
412 Ga0495605_0282203 3300046474 Bacteria 705
413 Ga0495639_0106666 3300046475 Bacteria 1326
414 Ga0495639_0372301 3300046475 Bacteria 719
415 Ga0495584_0000636 3300046491 Bacteria 23364
416 Ga0495584_0011799 3300046491 Bacteria 4468
417 Ga0495584_0012155 3300046491 Bacteria 4399
418 Ga0495584_0036677 3300046491 Bacteria 2476
419 Ga0495584_0046813 3300046491 Bacteria 2181
420 Ga0495584_0070356 3300046491 Bacteria 1758
421 Ga0495584_0155594 3300046491 Bacteria 1161
422 Ga0495584_0372300 3300046491 Bacteria 725
423 Ga0495584_0436883 3300046491 Bacteria 665
424 Ga0495585_0006666 3300046492 Bacteria 7134
425 Ga0495585_0022456 3300046492 Bacteria 3621
426 Ga0495585_0041550 3300046492 Bacteria 2578
427 Ga0495585_0068953 3300046492 Bacteria 1930
428 Ga0495585_0094118 3300046492 Bacteria 1610
429 Ga0495585_0113007 3300046492 Bacteria 1442
430 Ga0495585_0125485 3300046492 Bacteria 1354
431 Ga0495585_0135390 3300046492 Bacteria 1293
432 Ga0495585_0176714 3300046492 Bacteria 1099
433 Ga0495585_0270387 3300046492 Bacteria 842
434 Ga0495594_0034748 3300046499 Bacteria 2743
435 Ga0495594_0044356 3300046499 Bacteria 2438
436 Ga0495594_0049733 3300046499 Bacteria 2304
437 Ga0495594_0050249 3300046499 Bacteria 2292
438 Ga0495594_0105645 3300046499 Bacteria 1585
439 Ga0495596_0001745 3300046500 Bacteria 12192
440 Ga0495596_0001963 3300046500 Bacteria 11349
441 Ga0495596_0044469 3300046500 Bacteria 1747
442 Ga0495596_0045347 3300046500 Bacteria 1728
443 Ga0495596_0070273 3300046500 Bacteria 1360
444 Ga0495596_0086780 3300046500 Bacteria 1214
445 Ga0495596_0235705 3300046500 Bacteria 710
446 Ga0495596_0325819 3300046500 Bacteria 597
447 Ga0495607_0019187 3300046501 Bacteria 4347
448 Ga0495607_0021914 3300046501 Bacteria 4018
449 Ga0495607_0042980 3300046501 Bacteria 2675
450 Ga0495607_0070470 3300046501 Bacteria 1953
451 Ga0495607_0093106 3300046501 Bacteria 1628
452 Ga0495607_0099229 3300046501 Bacteria 1562
453 Ga0495607_0163586 3300046501 Bacteria 1128
454 Ga0495583_0003152 3300046506 Bacteria 13002
455 Ga0495583_0004594 3300046506 Bacteria 9786
456 Ga0495583_0019465 3300046506 Bacteria 3542
457 Ga0495583_0024275 3300046506 Bacteria 3049
458 Ga0495583_0056580 3300046506 Bacteria 1767
459 Ga0495583_0063582 3300046506 Bacteria 1639
460 Ga0495583_0072580 3300046506 Bacteria 1510
461 Ga0495583_0125428 3300046506 Bacteria 1077
462 Ga0495583_0224861 3300046506 Bacteria 757
463 Ga0495583_0243926 3300046506 Bacteria 721
464 Ga0495606_0000433 3300046507 Bacteria 69506
465 Ga0495606_0032750 3300046507 Bacteria 3595
466 Ga0495606_0035831 3300046507 Bacteria 3387
467 Ga0495606_0038679 3300046507 Bacteria 3224
468 Ga0495606_0048233 3300046507 Bacteria 2802
469 Ga0495606_0073479 3300046507 Bacteria 2145
470 Ga0495606_0188818 3300046507 Bacteria 1182
471 Ga0495606_0240234 3300046507 Bacteria 1010
472 Ga0495606_0261711 3300046507 Bacteria 954
473 Ga0495606_0358617 3300046507 Bacteria 771
474 Ga0495610_0004520 3300046512 Bacteria 10242
475 Ga0495610_0035533 3300046512 Bacteria 2557
476 Ga0495616_0018110 3300046513 Bacteria 3874
477 Ga0495616_0028095 3300046513 Bacteria 2980
478 Ga0495616_0042318 3300046513 Bacteria 2319
479 Ga0495616_0091183 3300046513 Bacteria 1442
480 Ga0495616_0152195 3300046513 Bacteria 1045
481 Ga0495616_0241174 3300046513 Bacteria 779
482 Ga0495620_0001543 3300046515 Bacteria 13683
483 Ga0495628_0107716 3300046516 Bacteria 2145
484 Ga0495628_0325059 3300046516 Bacteria 1134
485 Ga0495630_0261706 3300046517 Bacteria 1321
486 Ga0495631_0019480 3300046518 Bacteria 3181
487 Ga0495631_0026488 3300046518 Bacteria 2661
488 Ga0495631_0040478 3300046518 Bacteria 2064
489 Ga0495631_0059518 3300046518 Bacteria 1659
490 Ga0495631_0106636 3300046518 Bacteria 1204
491 Ga0495631_0121050 3300046518 Bacteria 1125
492 Ga0495631_0241364 3300046518 Bacteria 770
493 Ga0495632_0018868 3300046519 Bacteria 3770
494 Ga0495632_0083186 3300046519 Bacteria 1524
495 Ga0495632_0162453 3300046519 Bacteria 1028
496 Ga0495632_0221455 3300046519 Bacteria 855
497 Ga0495637_0000053 3300046520 Bacteria 99739
498 Ga0495637_0001780 3300046520 Bacteria 12324
499 Ga0495637_0002190 3300046520 Bacteria 10923
500 Ga0495637_0094170 3300046520 Bacteria 1177
501 Ga0495637_0109064 3300046520 Bacteria 1074
502 Ga0495637_0109372 3300046520 Bacteria 1072
503 Ga0495643_0002891 3300046522 Bacteria 13023
504 Ga0495643_0014375 3300046522 Bacteria 4711
505 Ga0495643_0016892 3300046522 Bacteria 4279
506 Ga0495643_0040909 3300046522 Bacteria 2529
507 Ga0495643_0055349 3300046522 Bacteria 2120
508 Ga0495643_0060952 3300046522 Bacteria 2001
509 Ga0495643_0173422 3300046522 Bacteria 1053
510 Ga0495644_0003110 3300046523 Bacteria 6566
511 Ga0495644_0047750 3300046523 Bacteria 1607
512 Ga0495644_0056888 3300046523 Bacteria 1469
513 Ga0495644_0099407 3300046523 Bacteria 1100
514 Ga0495644_0128679 3300046523 Bacteria 964
515 Ga0495644_0266720 3300046523 Bacteria 666
516 Ga0495648_0056197 3300046524 Bacteria 2368
517 Ga0495648_0072602 3300046524 Bacteria 1990
518 Ga0495648_0205591 3300046524 Bacteria 982
519 Ga0495648_0238369 3300046524 Bacteria 886
520 Ga0495648_0243890 3300046524 Bacteria 871
521 Ga0495648_0287948 3300046524 Bacteria 775
522 Ga0495663_0028845 3300046525 Bacteria 1635
523 Ga0495663_0062920 3300046525 Bacteria 1169
524 Ga0495663_0125037 3300046525 Bacteria 863
525 Ga0495663_0230973 3300046525 Bacteria 652
526 Ga0495666_0009599 3300046526 Bacteria 4837
527 Ga0495666_0102712 3300046526 Bacteria 1346
528 Ga0495666_0211919 3300046526 Bacteria 888
529 Ga0495666_0238353 3300046526 Bacteria 830
530 Ga0495642_0005824 3300046528 Bacteria 4726
531 Ga0495642_0007577 3300046528 Bacteria 4159
532 Ga0495642_0008349 3300046528 Bacteria 3963
533 Ga0495642_0033338 3300046528 Bacteria 2070
534 Ga0495642_0037203 3300046528 Bacteria 1968
535 Ga0495642_0082123 3300046528 Bacteria 1358
536 Ga0495642_0273037 3300046528 Bacteria 740
537 Ga0495642_0293861 3300046528 Bacteria 712
538 Ga0495642_0318284 3300046528 Bacteria 682
539 Ga0495642_0326058 3300046528 Bacteria 674
540 Ga0495642_0456784 3300046528 Bacteria 564
541 Ga0495652_0019185 3300046529 Bacteria 6091
542 Ga0495652_0142778 3300046529 Bacteria 1881
543 Ga0495652_0260810 3300046529 Bacteria 1279
544 Ga0495654_0018887 3300046530 Bacteria 3607
545 Ga0495654_0192855 3300046530 Bacteria 876
546 Ga0495665_0008466 3300046531 Bacteria 5581
547 Ga0495665_0018585 3300046531 Bacteria 3734
548 Ga0495665_0099716 3300046531 Bacteria 1524
549 Ga0495640_0041811 3300046533 Bacteria 3201
550 Ga0495586_0070286 3300046535 Bacteria 1912
551 Ga0495586_0155133 3300046535 Bacteria 1289
552 Ga0495586_0155850 3300046535 Bacteria 1286
553 Ga0495586_0756939 3300046535 Bacteria 560
554 Ga0495587_0007790 3300046536 Bacteria 6919
555 Ga0495587_0028480 3300046536 Bacteria 3396
556 Ga0495609_0000007 3300046538 Bacteria 398812
557 Ga0495609_0018793 3300046538 Bacteria 3201
558 Ga0495609_0026889 3300046538 Bacteria 2631
559 Ga0495609_0046136 3300046538 Bacteria 1951
560 Ga0495609_0167336 3300046538 Bacteria 929
561 Ga0495597_0004273 3300046542 Bacteria 7899
562 Ga0495597_0007533 3300046542 Bacteria 5520
563 Ga0495597_0007961 3300046542 Bacteria 5336
564 Ga0495597_0022360 3300046542 Bacteria 2933
565 Ga0495597_0050127 3300046542 Bacteria 1843
566 Ga0495597_0123403 3300046542 Bacteria 1078
567 Ga0495597_0148630 3300046542 Bacteria 962
568 Ga0495597_0198440 3300046542 Bacteria 804
569 Ga0495597_0233802 3300046542 Bacteria 726
570 Ga0495645_0153398 3300046543 Bacteria 1598
571 Ga0495622_0012942 3300046557 Bacteria 3869
572 Ga0495622_0014615 3300046557 Bacteria 3646
573 Ga0495622_0033375 3300046557 Bacteria 2402
574 Ga0495622_0041061 3300046557 Bacteria 2151
575 Ga0495622_0086811 3300046557 Bacteria 1438
576 Ga0495633_0006566 3300046558 Bacteria 6874
577 Ga0495633_0017696 3300046558 Bacteria 3636
578 Ga0495633_0102739 3300046558 Bacteria 1326
579 Ga0495633_0103686 3300046558 Bacteria 1319
580 Ga0495633_0180912 3300046558 Bacteria 970
581 Ga0495633_0232073 3300046558 Bacteria 843
582 Ga0495633_0263396 3300046558 Bacteria 785
583 Ga0495633_0283515 3300046558 Bacteria 753
584 Ga0495633_0361734 3300046558 Bacteria 657
585 Ga0495633_0365351 3300046558 Bacteria 653
586 Ga0495656_0036295 3300046615 Bacteria 2029
587 Ga0495656_0077654 3300046615 Bacteria 1490
588 Ga0495656_0121688 3300046615 Bacteria 1232
589 Ga0495668_0002640 3300046616 Bacteria 14406
590 Ga0495668_0011342 3300046616 Bacteria 5343
591 Ga0495668_0018916 3300046616 Bacteria 3978
592 Ga0495668_0034324 3300046616 Bacteria 2846
593 Ga0495668_0134102 3300046616 Bacteria 1355
594 Ga0495668_0151367 3300046616 Bacteria 1270
595 Ga0495668_0223246 3300046616 Bacteria 1031
596 Ga0495668_0230437 3300046616 Bacteria 1014
597 Ga0495668_0590187 3300046616 Bacteria 613
598 Ga0495634_0014598 3300046642 Bacteria 5659
599 Ga0495634_0234705 3300046642 Bacteria 1127
600 Ga0495634_0587085 3300046642 Bacteria 647
601 Ga0495611_0001662 3300046648 Bacteria 10778
602 Ga0495611_0002069 3300046648 Bacteria 9442
603 Ga0495611_0005909 3300046648 Bacteria 5219
604 Ga0495611_0011467 3300046648 Bacteria 3757
605 Ga0495611_0031470 3300046648 Bacteria 2335
606 Ga0495611_0232931 3300046648 Bacteria 855
607 Ga0495611_0371160 3300046648 Bacteria 655
608 Ga0495625_0042626 3300046660 Bacteria 3296
609 Ga0495625_0176951 3300046660 Bacteria 1421
610 Ga0495625_0311060 3300046660 Bacteria 1005
611 Ga0495625_0371459 3300046660 Bacteria 899
612 Ga0495625_0411023 3300046660 Bacteria 843
613 Ga0495635_0008977 3300046663 Bacteria 6978
614 Ga0495635_0074819 3300046663 Bacteria 2320
615 Ga0495659_0007839 3300046664 Bacteria 3385
616 Ga0495659_0175125 3300046664 Bacteria 872
617 Ga0495659_0243115 3300046664 Bacteria 748
618 Ga0495661_0048413 3300046665 Bacteria 2582
619 Ga0495661_0141952 3300046665 Bacteria 1305
620 Ga0495661_0152056 3300046665 Bacteria 1249
621 Ga0495661_0173828 3300046665 Bacteria 1146
622 Ga0495661_0178330 3300046665 Bacteria 1127
623 Ga0495661_0196882 3300046665 Bacteria 1057
624 Ga0495661_0203066 3300046665 Bacteria 1036
625 Ga0495588_0009027 3300046674 Bacteria 4594
626 Ga0495588_0017870 3300046674 Bacteria 3451
627 Ga0495588_0022754 3300046674 Bacteria 3099
628 Ga0495588_0046528 3300046674 Bacteria 2225
629 Ga0495588_0067691 3300046674 Bacteria 1853
630 Ga0495588_0094469 3300046674 Bacteria 1567
631 Ga0495588_0121691 3300046674 Bacteria 1375
632 Ga0495588_0143878 3300046674 Bacteria 1259
633 Ga0495588_0232532 3300046674 Bacteria 972
634 Ga0495588_0272713 3300046674 Bacteria 891
635 Ga0495588_0310631 3300046674 Bacteria 829
636 Ga0495657_0173947 3300046675 Bacteria 1325
637 Ga0495657_0199806 3300046675 Bacteria 1219
638 Ga0495599_0001590 3300046678 Bacteria 13082
639 Ga0495599_0247626 3300046678 Bacteria 1085
640 Ga0495623_0008893 3300046679 Bacteria 6519
641 Ga0495623_0182525 3300046679 Bacteria 1218
642 Ga0495623_0379440 3300046679 Bacteria 764
643 Ga0495646_0043675 3300046680 Bacteria 2743
644 Ga0495646_0059870 3300046680 Bacteria 2273
645 Ga0495646_0168697 3300046680 Bacteria 1207
646 Ga0495669_0002717 3300046684 Bacteria 7249
647 Ga0495613_0106108 3300046689 Bacteria 2027
648 Ga0495624_0133574 3300046690 Bacteria 1521
649 Ga0495624_0792004 3300046690 Bacteria 560
650 Ga0495670_0031340 3300046691 Bacteria 2641
651 Ga0495670_0051413 3300046691 Bacteria 2062
652 Ga0495670_0055789 3300046691 Bacteria 1981
653 Ga0495670_0170012 3300046691 Bacteria 1147
654 Ga0495670_0205591 3300046691 Bacteria 1043
655 Ga0495670_0232931 3300046691 Bacteria 979
656 Ga0495670_0246090 3300046691 Bacteria 952
657 Ga0495671_0005005 3300046692 Bacteria 7807
658 Ga0495671_0291497 3300046692 Bacteria 785
659 Ga0495671_0294721 3300046692 Bacteria 780
660 Ga0495671_0315099 3300046692 Bacteria 751
661 Ga0495649_0012662 3300046694 Bacteria 4895
662 Ga0495649_0066300 3300046694 Bacteria 1937
663 Ga0495649_0101900 3300046694 Bacteria 1525
664 Ga0495649_0141389 3300046694 Bacteria 1267
665 Ga0495649_0186833 3300046694 Bacteria 1079
666 Ga0495649_0193639 3300046694 Bacteria 1057
667 Ga0495649_0259803 3300046694 Bacteria 890
668 Ga0495649_0266824 3300046694 Bacteria 876
669 Ga0495589_0030733 3300046794 Bacteria 2704
670 Ga0495589_0037560 3300046794 Bacteria 2426
671 Ga0495589_0053829 3300046794 Bacteria 1985
672 Ga0495589_0114942 3300046794 Bacteria 1297
673 Ga0495589_0141655 3300046794 Bacteria 1151
674 Ga0495589_0147423 3300046794 Bacteria 1124
675 Ga0495589_0207683 3300046794 Bacteria 922
676 Ga0495589_0279380 3300046794 Bacteria 776
677 Ga0495600_0004009 3300046809 Bacteria 8753
678 Ga0495600_0112057 3300046809 Bacteria 1776
679 Ga0495600_0132309 3300046809 Bacteria 1621
680 Ga0495660_0007547 3300046810 Bacteria 6384
681 Ga0495660_0011018 3300046810 Bacteria 5250
682 Ga0495660_0030532 3300046810 Bacteria 3035
683 Ga0495660_0034825 3300046810 Bacteria 2815
684 Ga0495660_0116918 3300046810 Bacteria 1353
685 Ga0495660_0153779 3300046810 Bacteria 1133
686 Ga0495660_0285950 3300046810 Bacteria 752
687 Ga0495581_0101745 3300047315 Bacteria 1669
688 Ga0495581_0114908 3300047315 Bacteria 1565
689 Ga0495581_0527910 3300047315 Bacteria 685
690 Ga0495581_0750282 3300047315 Bacteria 561
691 Ga0495604_0003421 3300047317 Bacteria 12655
692 Ga0495604_0010804 3300047317 Bacteria 7251
693 Ga0495604_0037248 3300047317 Bacteria 3831
694 Ga0495604_0311423 3300047317 Bacteria 1055
695 Ga0495636_0001434 3300047318 Bacteria 9014
696 Ga0495636_0006316 3300047318 Bacteria 4654
697 Ga0495674_0009303 3300047319 Bacteria 9338
698 Ga0495672_0000013 3300047320 Bacteria 511827
699 Ga0495672_0000157 3300047320 Bacteria 98544
700 Ga0495672_0007686 3300047320 Bacteria 8079
701 Ga0495672_0021784 3300047320 Bacteria 4174
702 Ga0495672_0084969 3300047320 Bacteria 1754
703 Ga0495676_0004545 3300047321 Bacteria 12688
704 Ga0495676_0024323 3300047321 Bacteria 5246
705 Ga0495676_0226652 3300047321 Bacteria 1285
706 Ga0495676_0253927 3300047321 Bacteria 1198
707 Ga0495676_0278351 3300047321 Bacteria 1133
708 Ga0495680_0213721 3300047322 Bacteria 1379
709 Ga0495680_0776926 3300047322 Bacteria 627
710 Ga0495683_0014031 3300047323 Bacteria 4174
711 Ga0495683_0057199 3300047323 Bacteria 1938
712 Ga0495683_0070987 3300047323 Bacteria 1709
713 Ga0495683_0128679 3300047323 Bacteria 1196
714 Ga0495683_0155573 3300047323 Bacteria 1060
715 Ga0495683_0238734 3300047323 Bacteria 802
716 Ga0495683_0239204 3300047323 Bacteria 801
717 Ga0495683_0241935 3300047323 Bacteria 795
718 Ga0495683_0263294 3300047323 Bacteria 752
719 Ga0495683_0446597 3300047323 Bacteria 531
720 Ga0495687_002781 3300047443 Bacteria 13521
721 Ga0495687_002921 3300047443 Bacteria 12995
722 Ga0495687_007470 3300047443 Bacteria 6428
723 Ga0495687_133110 3300047443 Bacteria 876
724 Ga0495675_0021158 3300047444 Bacteria 4140
725 Ga0495675_0072153 3300047444 Bacteria 2178
726 Ga0495675_0130020 3300047444 Bacteria 1565
727 Ga0495675_0288300 3300047444 Bacteria 977
728 Ga0495677_0037415 3300047445 Bacteria 1772
729 Ga0495677_0037798 3300047445 Bacteria 1763
730 Ga0495677_0123448 3300047445 Bacteria 988
731 Ga0495677_0131948 3300047445 Bacteria 956
732 Ga0495677_0332952 3300047445 Bacteria 599
733 Ga0495679_008349 3300047446 Bacteria 4218
734 Ga0495679_034795 3300047446 Bacteria 1601
735 Ga0495685_014389 3300047447 Bacteria 2688
736 Ga0495685_036127 3300047447 Bacteria 1696
737 Ga0495685_082500 3300047447 Bacteria 1070
738 Ga0495685_102862 3300047447 Bacteria 942
739 Ga0495673_0017349 3300047469 Bacteria 3660
740 Ga0495681_0011744 3300047470 Bacteria 5189
741 Ga0495681_0021475 3300047470 Bacteria 3477
742 Ga0495681_0047436 3300047470 Bacteria 2043
743 Ga0495681_0112030 3300047470 Bacteria 1180
744 Ga0495681_0131935 3300047470 Bacteria 1062
745 Ga0495681_0135941 3300047470 Bacteria 1042
746 Ga0495681_0154727 3300047470 Bacteria 959
747 Ga0495684_0135318 3300047471 Bacteria 1850
748 Ga0495686_0021073 3300047472 Bacteria 4336
749 Ga0495686_0061812 3300047472 Bacteria 2325
750 Ga0495686_0088035 3300047472 Bacteria 1888
751 Ga0495593_0002955 3300047673 Bacteria 10225
752 Ga0495593_0073060 3300047673 Bacteria 1779
753 Ga0495602_0044651 3300048088 Bacteria 4017
754 Ga0495602_0051607 3300048088 Bacteria 3661
755 Ga0495602_0205899 3300048088 Bacteria 1497
756 Ga0495614_0054920 3300048089 Bacteria 1708
757 Ga0495614_0111517 3300048089 Bacteria 1201
758 Ga0495615_0009239 3300048090 Bacteria 1932
759 Ga0495615_0009700 3300048090 Bacteria 1903
760 Ga0495615_0043836 3300048090 Bacteria 1127
761 Ga0495615_0050859 3300048090 Bacteria 1066
762 Ga0495626_0000227 3300048091 Bacteria 66048
763 Ga0495626_0002147 3300048091 Bacteria 14252
764 Ga0495626_0014493 3300048091 Bacteria 4062
765 Ga0495626_0081138 3300048091 Bacteria 1440
766 Ga0495626_0092701 3300048091 Bacteria 1326
767 Ga0495626_0185379 3300048091 Bacteria 860
768 Ga0495626_0227992 3300048091 Bacteria 754
769 Ga0495626_0242327 3300048091 Bacteria 725
770 Ga0495626_0285631 3300048091 Bacteria 654
771 Ga0495626_0312925 3300048091 Bacteria 618
772 Ga0495626_0327976 3300048091 Bacteria 600
773 Ga0496100_0014114 3300048903 Bacteria 4630
774 Ga0496100_0561774 3300048903 Bacteria 883
775 Ga0496101_0009727 3300048904 Bacteria 6329
776 Ga0496101_0160023 3300048904 Bacteria 1726
777 Ga0496102_0219122 3300048905 Bacteria 1793
778 Ga0496102_0222236 3300048905 Bacteria 1780
779 Ga0496102_0240111 3300048905 Bacteria 1708
780 Ga0496102_0608728 3300048905 Bacteria 1015
781 Ga0496102_1337507 3300048905 Bacteria 635
782 Ga0496103_0017021 3300048906 Bacteria 4345
783 Ga0496103_0020711 3300048906 Bacteria 3953
784 Ga0496103_0061076 3300048906 Bacteria 2343
785 Ga0496103_0135193 3300048906 Bacteria 1575
786 Ga0496103_0428895 3300048906 Bacteria 848
787 Ga0496104_1126081 3300048907 Bacteria 688
788 Ga0496105_0594350 3300048908 Bacteria 859
789 Ga0496106_0265208 3300048909 Bacteria 1375
790 Ga0496107_0210280 3300048910 Bacteria 1446
791 Ga0496107_0273009 3300048910 Bacteria 1258
792 Ga0496108_0116425 3300048911 Bacteria 2289
793 Ga0496109_1574807 3300048912 Bacteria 591
794 Ga0496110_0062981 3300048913 Bacteria 3277
795 Ga0496111_0101527 3300048914 Bacteria 2113
796 Ga0496111_0866486 3300048914 Bacteria 651
797 Ga0496112_0040118 3300048915 Bacteria 4577
798 Ga0496113_0180677 3300048916 Bacteria 1672
799 Ga0496114_0041004 3300048917 Bacteria 3836
800 Ga0496114_0208036 3300048917 Bacteria 1715
801 Ga0496114_0288875 3300048917 Bacteria 1447
802 Ga0496115_0050480 3300048918 Bacteria 3332
803 Ga0496115_0495924 3300048918 Bacteria 982
804 Ga0496115_0622063 3300048918 Bacteria 856
805 Ga0496120_0289890 3300048923 Bacteria 753
806 Ga0496121_0274189 3300048924 Bacteria 1158
807 Ga0496122_0158956 3300048925 Bacteria 1381
808 Ga0496123_0076261 3300048926 Bacteria 2064
809 Ga0496124_0052609 3300048927 Bacteria 3458
810 Ga0496125_0128609 3300048928 Bacteria 1788
811 Ga0496125_0249965 3300048928 Bacteria 1119
812 Ga0501306_000907 3300049127 Bacteria 2551
813 Ga0501308_000002 3300049128 Bacteria 13277
814 Ga0501308_000177 3300049128 Bacteria 3494
815 Ga0501309_000053 3300049129 Bacteria 5860
816 Ga0501310_003240 3300049130 Bacteria 1584
817 Ga0501310_006490 3300049130 Bacteria 1229
818 Ga0501310_007550 3300049130 Bacteria 1164
819 Ga0501310_023183 3300049130 Bacteria 788
820 Ga0501304_000001 3300049160 Bacteria 14569
821 Ga0501304_000110 3300049160 Bacteria 3123
822 Ga0501305_004893 3300049161 Bacteria 1597
823 Ga0501305_009203 3300049161 Bacteria 1294
824 Ga0501307_000295 3300049162 Bacteria 3069
825 Ga0501307_002501 3300049162 Bacteria 1720
826 Ga0501307_012966 3300049162 Bacteria 1000
827 Ga0495678_000010 3300049459 Bacteria 357896
828 Ga0495678_006909 3300049459 Bacteria 5955
829 Ga0495678_016621 3300049459 Bacteria 3359
830 Ga0495678_016940 3300049459 Bacteria 3315
831 Ga0495678_040403 3300049459 Bacteria 1875
832 Ga0495682_0035772 3300049460 Bacteria 1828
833 Ga0495682_0049156 3300049460 Bacteria 1536
834 Ga0495682_0141958 3300049460 Bacteria 857
835 Ga0501311_002363 3300049527 Bacteria 1802
836 Ga0501311_006367 3300049527 Bacteria 1328
837 Ga0501311_065193 3300049527 Bacteria 595
838 Ga0501312_005276 3300049528 Bacteria 1563
839 Ga0501312_005882 3300049528 Bacteria 1510
840 Ga0501312_006751 3300049528 Bacteria 1444
841 Ga0501313_000012 3300049529 Bacteria 8507
842 Ga0501313_031750 3300049529 Bacteria 687
843 Ga0501314_002745 3300049530 Bacteria 1381
844 Ga0501314_003171 3300049530 Bacteria 1315
845 Ga0501314_004206 3300049530 Bacteria 1187
846 Ga0501314_030486 3300049530 Bacteria 598
847 Ga0501315_000004 3300049531 Bacteria 11326
848 Ga0501315_000082 3300049531 Bacteria 4574
849 Ga0501315_008575 3300049531 Bacteria 1192
850 Ga0501316_000002 3300049532 Bacteria 13278
851 Ga0501316_003898 3300049532 Bacteria 1476
852 Ga0501316_032611 3300049532 Bacteria 702
853 Ga0501317_026044 3300049533 Bacteria 823
854 Ga0501318_000040 3300049534 Bacteria 5307
855 Ga0501319_000218 3300049535 Bacteria 2405
856 Ga0501319_000527 3300049535 Bacteria 1869
857 Ga0501319_005104 3300049535 Bacteria 933
858 Ga0501319_007776 3300049535 Bacteria 815
859 Ga0501320_005730 3300049536 Bacteria 1142
860 Ga0501320_019720 3300049536 Bacteria 771
861 Ga0501320_021129 3300049536 Bacteria 754
862 Ga0501320_037531 3300049536 Bacteria 625
863 Ga0501320_039633 3300049536 Bacteria 613
864 Ga0501321_006362 3300049537 Bacteria 1198
865 Ga0501321_018009 3300049537 Bacteria 854
866 Ga0501322_000643 3300049538 Bacteria 1716
867 Ga0501322_001887 3300049538 Bacteria 1237
868 Ga0501323_000193 3300049539 Bacteria 3915
869 Ga0501323_002509 3300049539 Bacteria 1787
870 Ga0501323_006202 3300049539 Bacteria 1332
871 Ga0501323_023819 3300049539 Bacteria 824
872 Ga0501324_001950 3300049540 Bacteria 1448
873 Ga0501324_028532 3300049540 Bacteria 600
874 Ga0501325_010602 3300049541 Bacteria 838
875 Ga0501325_023963 3300049541 Bacteria 662
876 Ga0501326_04184 3300049542 Bacteria 759
877 Ga0501327_01907 3300049543 Bacteria 1044
878 Ga0501334_01100 3300049550 Bacteria 1430
879 Ga0501335_004710 3300049551 Bacteria 1202
880 Ga0501337_001443 3300049553 Bacteria 1361
881 Ga0501340_008756 3300049556 Bacteria 718
882 Ga0501036_0517648 3300049572 Bacteria 992
883 Ga0501040_0009838 3300049576 Bacteria 6243
884 Ga0501042_0231962 3300049578 Bacteria 1331
885 Ga0501070_0165024 3300049586 Bacteria 1825
886 Ga0501073_0193812 3300049589 Bacteria 1406
887 Ga0501074_0287578 3300049590 Bacteria 1168
888 Ga0501230_002593 3300049667 Bacteria 2321
889 Ga0501238_024207 3300049671 Bacteria 867
890 Ga0501249_052437 3300049679 Bacteria 937
891 Ga0501080_0143987 3300049742 Bacteria 2203
892 Ga0501083_0021465 3300049744 Bacteria 4488
893 Ga0501269_000003 3300049766 Bacteria 111299
894 Ga0501269_014902 3300049766 Bacteria 954
895 Ga0501279_007866 3300049775 Bacteria 1417
896 Ga0501035_0010452 3300049822 Bacteria 8602
897 nmdc:mga03683_14381_c1 3300050489 Bacteria 2927
898 nmdc:mga07m45_87196_c1 3300050496 Bacteria 1786
899 nmdc:mga08x19_381832_c1 3300050514 Bacteria 987
900 Ga0495619_0071086 3300053085 Bacteria 2328
901 Ga0500595_178790 3300053119 Bacteria 588
902 Ga0500586_012856 3300053145 Bacteria 2448
903 Ga0500619_059831 3300053154 Bacteria 1251
904 Ga0500636_0209054 3300053177 Bacteria 1026
905 Ga0587084_000213 3300059477 Bacteria 3885
906 Ga0587084_000401 3300059477 Bacteria 3315
907 Ga0587084_003559 3300059477 Bacteria 1720
908 Ga0587084_016243 3300059477 Bacteria 1061
909 Ga0587093_000380 3300059478 Bacteria 2980
910 Ga0587093_007958 3300059478 Bacteria 1195
911 Ga0587093_026028 3300059478 Bacteria 815
912 Ga0587066_000001 3300059490 Bacteria 11779
913 Ga0587070_000065 3300059491 Bacteria 5371
914 Ga0587077_108176 3300059493 Bacteria 677
915 Ga0587080_011343 3300059503 Bacteria 1329
916 Ga0587083_0000094 3300059505 Bacteria 5249
917 Ga0587085_017860 3300059506 Bacteria 1045
918 Ga0587088_000001 3300059508 Bacteria 14678
919 Ga0587089_000565 3300059509 Bacteria 2935
920 Ga0587092_000969 3300059512 Bacteria 2624
921 Ga0587092_056408 3300059512 Bacteria 725
922 Ga0587094_006756 3300059513 Bacteria 1386
923 Ga0587098_017985 3300059604 Bacteria 871
924 Ga0587125_002919 3300059607 Bacteria 1413
925 Ga0587129_000838 3300059608 Bacteria 1514
926 Ga0587099_000239 3300059622 Bacteria 2770
927 Ga0587101_000023 3300059623 Bacteria 7377
928 Ga0587109_003197 3300059624 Bacteria 2163
929 Ga0587109_081541 3300059624 Bacteria 716
930 Ga0587113_000311 3300059625 Bacteria 2411
931 Ga0587115_010663 3300059626 Bacteria 1148
932 Ga0587117_041262 3300059627 Bacteria 736
933 Ga0587128_000098 3300059630 Bacteria 4404
934 Ga0587062_000153 3300059639 Bacteria 3794
935 Ga0587062_002195 3300059639 Bacteria 1823
936 Ga0587068_000002 3300059641 Bacteria 13671
937 Ga0587068_000350 3300059641 Bacteria 3976
938 Ga0587068_002203 3300059641 Bacteria 2337
939 Ga0587069_000016 3300059642 Bacteria 8774
940 Ga0587072_003430 3300059643 Bacteria 2226
941 Ga0587072_128677 3300059643 Bacteria 594
942 Ga0587075_000434 3300059644 Bacteria 3285
943 Ga0587076_000914 3300059645 Bacteria 2766
944 Ga0587079_000584 3300059647 Bacteria 3398
945 Ga0587079_145788 3300059647 Bacteria 608
946 Ga0587102_011513 3300059649 Bacteria 890
947 Ga0587102_043001 3300059649 Bacteria 588
948 Ga0587102_043002 3300059649 Bacteria 588
949 Ga0587104_000049 3300059650 Bacteria 3143
950 Ga0587108_000210 3300059653 Bacteria 2694
951 Ga0587110_007725 3300059654 Bacteria 1023
952 Ga0587114_007269 3300059655 Bacteria 1266
953 Ga0587118_11441 3300059657 Bacteria 684
954 Ga0587096_00279 3300060247 Bacteria 1279
955 Ga0587071_024403 3300060344 Bacteria 1129
956 Ga0587111_0000229 3300060346 Bacteria 4601
957 Ga0466962_0094696 3300061719 Bacteria 1431
958 2601667017 2600255292 Bacteria 6300551
959 2643799425 2643221556 Bacteria 7251154
960 2644254811 2643221645 Bacteria 7207331
961 2644360372 2643221664 Bacteria 7272945
962 2644471518 2643221684 Bacteria 7145183
963 2738738120 2738541280 Bacteria 6630198
964 2738826785 2738541297 Bacteria 6549566
965 2738843082 2738541300 Bacteria 6675882
966 2739150582 2738541357 Bacteria 6549408
967 2739192501 2738543003 Bacteria 6549560
968 2739273833 2738543018 Bacteria 6718814
969 2739318978 2738543026 Bacteria 6549408
970 2739337219 2738543029 Bacteria 6549249
971 2739342877 2738543030 Bacteria 6719714
972 2809145896 2808606418 Bacteria 6724496
973 2819543889 2818991436 Bacteria 5376622
974 2842712341 2842711865 Bacteria 7155354
975 2857556285 2857553236 Bacteria 6166726
976 2857560798 2857558681 Bacteria 6617694
977 2857567997 2857564685 Bacteria 6290584
978 2904428887 2904424332 Bacteria 7633521
979 2919476953 2919476304 Bacteria 5888696
980 8047676081 8047673197 Bacteria 7395230
981 Ga0207664_10333073
982 JGI24739J22299_10081927
983 JGI24737J22298_10004492
984 JGI24735J21928_10116714
985 JGI25162J39368_1000154
986 JGI25154J39366_1001042
987 JGI25158J39367_1000542
988 Ga0006763J43179_104166
989 Ga0006765J45826_105454
990 Ga0006778J45830_1013714
991 Ga0006759J45824_1007037
992 Ga0006759J45824_1018706
993 Ga0006759J45824_1019946
994 JGI25165J46597_1000239
995 JGI25153J46596_10024994
996 Ga0007428J48920_101526
997 Ga0006758J48902_1003545
998 Ga0006758J48902_1003546
999 Ga0006758J48902_1008911
1000 Ga0006758J48902_1015405
1001 Ga0006770J48903_1019658
1002 Ga0006777J48905_1009816
1003 rootH2_10116476
1004 Ga0007417J51691_1002612
1005 Ga0007417J51691_1011781
1006 Ga0007417J51691_1016345
1007 Ga0007427J51700_104411
1008 Ga0007427J51700_113492
1009 Ga0006781J51513_1010997
1010 Ga0007410J51695_1004597
1011 Ga0007410J51695_1012689
1012 Ga0007410J51695_1025455
1013 Ga0007410J51695_1058196
1014 Ga0007409J51694_1000685
1015 Ga0007409J51694_1029110
1016 Ga0007409J51694_1070581
1017 Ga0007416J51690_1005292
1018 Ga0007416J51690_1032863
1019 Ga0007429J51699_1013730
1020 Ga0007411J51799_103551
1021 Ga0007411J51799_109076
1022 Ga0007415J51800_102854
1023 Ga0007415J51800_105493
1024 Ga0007415J51800_109761
1025 Ga0032354_1003171
1026 Ga0006780_1003428
1027 Ga0055538_1000094
1028 Ga0055539_1000136
1029 Ga0055533_1000143
1030 Ga0055525_1000018
1031 Ga0055525_1000188
1032 Ga0055542_1007983
1033 Ga0055529_1000079
1034 Ga0055526_1008246
1035 Ga0055526_1008253
1036 Ga0055524_1000024
1037 Ga0055541_1000092
1038 Ga0058861_10170907
1039 Ga0065165_1006561
1040 Ga0065714_10022125
1041 Ga0065714_10153472
1042 Ga0070658_10375676
1043 Ga0070658_11193996
1044 Ga0070676_10039416
1045 Ga0070683_101033281
1046 Ga0068869_100134135
1047 Ga0070680_100002604
1048 Ga0070680_100028265
1049 Ga0070680_100046385
1050 Ga0070680_101014747
1051 Ga0070660_100133103
1052 Ga0070660_100689087
1053 Ga0070661_100605006
1054 Ga0070692_10189273
1055 Ga0070675_100276851
1056 Ga0070671_100026292
1057 Ga0070674_100370014
1058 Ga0070673_100529641
1059 Ga0070659_100293652
1060 Ga0070659_100341638
1061 Ga0070667_100412882
1062 Ga0070667_100542226
1063 Ga0070709_10045049
1064 Ga0070714_100458199
1065 Ga0070714_101141093
1066 Ga0070713_100322951
1067 Ga0070713_100459605
1068 Ga0070711_100043033
1069 Ga0070663_100255852
1070 Ga0070681_10001062
1071 Ga0070681_10009391
1072 Ga0070681_10035879
1073 Ga0070681_10520790
1074 Ga0068867_100076663
1075 Ga0070706_100446918
1076 Ga0070707_100321013
1077 Ga0070679_100007538
1078 Ga0070679_100043950
1079 Ga0070679_100372080
1080 Ga0070684_100098831
1081 Ga0068853_100029320
1082 Ga0070672_100442341
1083 Ga0070693_100614552
1084 Ga0068855_101539437
1085 Ga0068857_100148498
1086 Ga0068857_100999740
1087 Ga0068854_100069183
1088 Ga0068856_100054238
1089 Ga0068852_100141024
1090 Ga0068866_10380290
1091 Ga0070717_10514606
1092 Ga0070717_10803096
1093 Ga0075363_100057573
1094 Ga0070716_100069058
1095 Ga0070712_100418037
1096 Ga0075362_10000565
1097 Ga0068871_100015656
1098 Ga0075434_100292233
1099 Ga0075436_100027159
1100 Ga0075436_100053121
1101 Ga0079104_1004078
1102 Ga0099826_10000010
1103 Ga0105244_10028871
1104 Ga0105244_10093441
1105 Ga0105240_10108670
1106 Ga0105240_10183485
1107 Ga0105240_10302490
1108 Ga0105245_10023078
1109 Ga0105243_10006860
1110 Ga0105241_10057980
1111 Ga0105242_10007953
1112 Ga0105237_10056847
1113 Ga0105238_10181832
1114 Ga0105239_10159405
1115 Ga0105246_10631108
1116 Ga0157373_10015732
1117 Ga0157371_10001564
1118 Ga0157371_10061649
1119 Ga0157370_10001390
1120 Ga0157370_10062522
1121 Ga0157370_10159747
1122 Ga0157370_10383313
1123 Ga0157369_10022775
1124 Ga0157369_10093282
1125 Ga0157374_11284784
1126 Ga0157378_10027087
1127 Ga0157372_10466393
1128 Ga0182008_10003186
1129 Ga0182008_10014196
1130 Ga0182008_10062305
1131 Ga0182008_10140209
1132 Ga0157376_10177756
1133 Ga0182006_1000240
1134 Ga0182006_1009882
1135 Ga0182007_10055314
1136 Ga0182005_1000016
1137 Ga0182005_1000370
1138 Ga0163161_10136578
1139 Ga0197907_11499114
1140 Ga0206356_10461406
1141 Ga0206355_1124031
1142 Ga0206355_1623195
1143 Ga0206351_10065238
1144 Ga0206352_10851379
1145 Ga0206350_10425581
1146 Ga0206353_10343767
1147 Ga0154015_1130987
1148 Ga0154015_1240091
1149 Ga0213873_10016116
1150 Ga0213872_10010693
1151 Ga0213872_10095672
1152 Ga0213872_10120400
1153 Ga0213872_10157466
1154 Ga0213876_10029406
1155 Ga0213876_10470897
1156 Ga0213875_10051551
1157 Ga0213875_10309564
1158 Ga0224712_10010495
1159 Ga0224712_10108908
1160 Ga0209784_100010
1161 Ga0209566_100008
1162 Ga0209674_100019
1163 Ga0209672_107144
1164 Ga0209563_100011
1165 Ga0209563_100021
1166 Ga0207427_100342
1167 Ga0209437_100019
1168 Ga0209437_111736
1169 Ga0207425_1000845
1170 Ga0209646_1000068
1171 Ga0209677_100011
1172 Ga0209677_107757
1173 Ga0209148_1000444
1174 Ga0209233_1000025
1175 Ga0209565_1003095
1176 Ga0209455_1000070
1177 Ga0209564_1000027
1178 Ga0209564_1000047
1179 Ga0209758_1000322
1180 Ga0209256_1000054
1181 Ga0207655_1000499
1182 Ga0207692_10024037
1183 Ga0207642_10237198
1184 Ga0207647_10029480
1185 Ga0207699_10053227
1186 Ga0207699_10165237
1187 Ga0207645_10052858
1188 Ga0207645_10908634
1189 Ga0207643_10227447
1190 Ga0207705_10061747
1191 Ga0207654_10002111
1192 Ga0207707_10000624
1193 Ga0207707_10072148
1194 Ga0207707_10560144
1195 Ga0207695_10286070
1196 Ga0207695_10518252
1197 Ga0207671_10322971
1198 Ga0207660_10003099
1199 Ga0207660_10028410
1200 Ga0207660_10035902
1201 Ga0207660_10596541
1202 Ga0207657_10030110
1203 Ga0207657_10117719
1204 Ga0207649_10023804
1205 Ga0207652_10002587
1206 Ga0207652_10016091
1207 Ga0207652_10047542
1208 Ga0207652_10297798
1209 Ga0207652_10574032
1210 Ga0207694_10049485
1211 Ga0207659_10041435
1212 Ga0207659_10265034
1213 Ga0207687_10038586
1214 Ga0207700_10270259
1215 Ga0207700_10379394
1216 Ga0207700_11037856
1217 Ga0207664_10013077
1218 Ga0207664_10117307
1219 Ga0207664_11090312
1220 Ga0207644_10018270
1221 Ga0207644_10070425
1222 Ga0207690_10048382
1223 Ga0207690_10086879
1224 Ga0207706_10008025
1225 Ga0207665_10007579
1226 Ga0207665_10183966
1227 Ga0207691_10384377
1228 Ga0207667_10730553
1229 Ga0207667_11030979
1230 Ga0207640_10022226
1231 Ga0207640_10409513
1232 Ga0207658_10463889
1233 Ga0207639_10120679
1234 Ga0207678_10003236
1235 Ga0207708_10317470
1236 Ga0207702_10128885
1237 Ga0207702_10269242
1238 Ga0207648_10088414
1239 Ga0207674_10033169
1240 Ga0207674_10265308
1241 Ga0207698_10059102
1242 Ga0209281_1002282
1243 Ga0209282_1000072
1244 Ga0307517_10185945
1245 Ga0307515_10301373
1246 Ga0316177_1129821
1247 Ga0314311_1250163
1248 Ga0316179_1096110
1249 Ga0316178_1118368
1250 Ga0316180_1056555
1251 Ga0316183_1076598
1252 Ga0316181_1197761
1253 Ga0316182_1166049
1254 Ga0316182_1185148
1255 Ga0307513_10124367
1256 Ga0307408_100067624
1257 Ga0307408_100876168
1258 Ga0265314_10280692
1259 Ga0307518_10004256
1260 Ga0307410_11091250
1261 Ga0307414_10232447
1262 Ga0307414_11194441
1263 Ga0316593_10000028
1264 Ga0316593_10001205
1265 Ga0316593_10010927
1266 Ga0316593_10054650
1267 Ga0316592_1000008
1268 Ga0316588_1000407
1269 Ga0316588_1078285
1270 Ga0316587_1006317
1271 Ga0316596_1000064
1272 Ga0316596_1000066
1273 Ga0316596_1002127
1274 Ga0316596_1007429
1275 Ga0373940_0077156
1276 Ga0373932_0023950
1277 Ga0373932_0030521
1278 Ga0373945_0257013
1279 Ga0373954_0018067
1280 Ga0373956_0026542
1281 Ga0373924_0058992
1282 Ga0373927_0257353
1283 Ga0373933_0098957
1284 Ga0373937_0010933
1285 Ga0373937_0021961
1286 Ga0316584_0005838
1287 Ga0316584_0201759
1288 Ga0395899_0000218
1289 Ga0395900_0138621
1290 Ga0395900_0330458
1291 Ga0395905_0043124
1292 Ga0395905_0255533
1293 Ga0395905_0545515
1294 Ga0436364_0616684
1295 Ga0436364_0714149
1296 Ga0436364_0834204
1297 Ga0436364_1028033
1298 Ga0400484_27221
1299 Ga0400484_30405
1300 Ga0400490_00204
1301 Ga0400490_19939
1302 Ga0400491_28158
1303 Ga0400488_49716
1304 Ga0436365_0441459
1305 Ga0436365_0616754
1306 Ga0436365_1763289
1307 Ga0436360_0935816
1308 Ga0436361_0097588
1309 Ga0436361_0378504
1310 Ga0436361_0819770
1311 Ga0436361_1134854
1312 Ga0436361_1164878
1313 Ga0436363_0600038
1314 Ga0436362_0456417
1315 Ga0436362_0534119
1316 Ga0439466_0092749
1317 Ga0451797_0130278
1318 Ga0451805_007804
1319 Ga0451833_1345593
1320 Ga0439442_067695
1321 Ga0439448_0045174
1322 Ga0439448_0081728
1323 Ga0439449_0003878
1324 Ga0439449_0036247
1325 Ga0439450_002944
1326 Ga0450911_004506
1327 Ga0450911_013578
1328 Ga0450920_033325
1329 Ga0450890_005814
1330 Ga0450895_002778
1331 Ga0450898_005215
1332 Ga0450898_022107
1333 Ga0450904_000961
1334 Ga0450906_012608
1335 Ga0439458_0059447
1336 Ga0450893_0005540
1337 Ga0466972_0130107
1338 Ga0466972_0148097
1339 Ga0466965_0093975
1340 Ga0466965_0214040
1341 Ga0466963_0313069
1342 Ga0466964_0020973
1343 Ga0453684_0035225
1344 Ga0466968_0037110
1345 Ga0466957_0508805
1346 Ga0466960_0348048
1347 Ga0466959_0891169
1348 Ga0466958_0126968
1349 Ga0466967_0113077
1350 Ga0466967_0166281
1351 Ga0495617_000397
1352 Ga0495617_000636
1353 Ga0495617_000830
1354 Ga0495627_000011
1355 Ga0495627_008059
1356 Ga0495627_026596
1357 Ga0495592_0237935
1358 Ga0495603_0001612
1359 Ga0495603_0009392
1360 Ga0495590_0000020
1361 Ga0495590_0000632
1362 Ga0495590_0001551
1363 Ga0495590_0006208
1364 Ga0495590_0113871
1365 Ga0495591_029494
1366 Ga0495591_042271
1367 Ga0495629_0007936
1368 Ga0495629_0021816
1369 Ga0495638_0000235
1370 Ga0495638_0077642
1371 Ga0495638_0426504
1372 Ga0495638_0470404
1373 Ga0495651_0138175
1374 Ga0495653_0004702
1375 Ga0495653_0102956
1376 Ga0495650_0000200
1377 Ga0495650_0002469
1378 Ga0495650_0007290
1379 Ga0495650_0109119
1380 Ga0495580_0009003
1381 Ga0495580_0184657
1382 Ga0495580_0772514
1383 Ga0495582_0005108
1384 Ga0495582_0116114
1385 Ga0495582_0228048
1386 Ga0495605_0005449
1387 Ga0495605_0010393
1388 Ga0495605_0013819
1389 Ga0495605_0044149
1390 Ga0495605_0070705
1391 Ga0495605_0074651
1392 Ga0495605_0282203
1393 Ga0495639_0106666
1394 Ga0495639_0372301
1395 Ga0495584_0000636
1396 Ga0495584_0011799
1397 Ga0495584_0012155
1398 Ga0495584_0036677
1399 Ga0495584_0046813
1400 Ga0495584_0070356
1401 Ga0495584_0155594
1402 Ga0495584_0372300
1403 Ga0495584_0436883
1404 Ga0495585_0006666
1405 Ga0495585_0022456
1406 Ga0495585_0041550
1407 Ga0495585_0068953
1408 Ga0495585_0094118
1409 Ga0495585_0113007
1410 Ga0495585_0125485
1411 Ga0495585_0135390
1412 Ga0495585_0176714
1413 Ga0495585_0270387
1414 Ga0495594_0034748
1415 Ga0495594_0044356
1416 Ga0495594_0049733
1417 Ga0495594_0050249
1418 Ga0495594_0105645
1419 Ga0495596_0001745
1420 Ga0495596_0001963
1421 Ga0495596_0044469
1422 Ga0495596_0045347
1423 Ga0495596_0070273
1424 Ga0495596_0086780
1425 Ga0495596_0235705
1426 Ga0495596_0325819
1427 Ga0495607_0019187
1428 Ga0495607_0021914
1429 Ga0495607_0042980
1430 Ga0495607_0070470
1431 Ga0495607_0093106
1432 Ga0495607_0099229
1433 Ga0495607_0163586
1434 Ga0495583_0003152
1435 Ga0495583_0004594
1436 Ga0495583_0019465
1437 Ga0495583_0024275
1438 Ga0495583_0056580
1439 Ga0495583_0063582
1440 Ga0495583_0072580
1441 Ga0495583_0125428
1442 Ga0495583_0224861
1443 Ga0495583_0243926
1444 Ga0495606_0000433
1445 Ga0495606_0032750
1446 Ga0495606_0035831
1447 Ga0495606_0038679
1448 Ga0495606_0048233
1449 Ga0495606_0073479
1450 Ga0495606_0188818
1451 Ga0495606_0240234
1452 Ga0495606_0261711
1453 Ga0495606_0358617
1454 Ga0495610_0004520
1455 Ga0495610_0035533
1456 Ga0495616_0018110
1457 Ga0495616_0028095
1458 Ga0495616_0042318
1459 Ga0495616_0091183
1460 Ga0495616_0152195
1461 Ga0495616_0241174
1462 Ga0495620_0001543
1463 Ga0495628_0107716
1464 Ga0495628_0325059
1465 Ga0495630_0261706
1466 Ga0495631_0019480
1467 Ga0495631_0026488
1468 Ga0495631_0040478
1469 Ga0495631_0059518
1470 Ga0495631_0106636
1471 Ga0495631_0121050
1472 Ga0495631_0241364
1473 Ga0495632_0018868
1474 Ga0495632_0083186
1475 Ga0495632_0162453
1476 Ga0495632_0221455
1477 Ga0495637_0000053
1478 Ga0495637_0001780
1479 Ga0495637_0002190
1480 Ga0495637_0094170
1481 Ga0495637_0109064
1482 Ga0495637_0109372
1483 Ga0495643_0002891
1484 Ga0495643_0014375
1485 Ga0495643_0016892
1486 Ga0495643_0040909
1487 Ga0495643_0055349
1488 Ga0495643_0060952
1489 Ga0495643_0173422
1490 Ga0495644_0003110
1491 Ga0495644_0047750
1492 Ga0495644_0056888
1493 Ga0495644_0099407
1494 Ga0495644_0128679
1495 Ga0495644_0266720
1496 Ga0495648_0056197
1497 Ga0495648_0072602
1498 Ga0495648_0205591
1499 Ga0495648_0238369
1500 Ga0495648_0243890
1501 Ga0495648_0287948
1502 Ga0495663_0028845
1503 Ga0495663_0062920
1504 Ga0495663_0125037
1505 Ga0495663_0230973
1506 Ga0495666_0009599
1507 Ga0495666_0102712
1508 Ga0495666_0211919
1509 Ga0495666_0238353
1510 Ga0495642_0005824
1511 Ga0495642_0007577
1512 Ga0495642_0008349
1513 Ga0495642_0033338
1514 Ga0495642_0037203
1515 Ga0495642_0082123
1516 Ga0495642_0273037
1517 Ga0495642_0293861
1518 Ga0495642_0318284
1519 Ga0495642_0326058
1520 Ga0495642_0456784
1521 Ga0495652_0019185
1522 Ga0495652_0142778
1523 Ga0495652_0260810
1524 Ga0495654_0018887
1525 Ga0495654_0192855
1526 Ga0495665_0008466
1527 Ga0495665_0018585
1528 Ga0495665_0099716
1529 Ga0495640_0041811
1530 Ga0495586_0070286
1531 Ga0495586_0155133
1532 Ga0495586_0155850
1533 Ga0495586_0756939
1534 Ga0495587_0007790
1535 Ga0495587_0028480
1536 Ga0495609_0000007
1537 Ga0495609_0018793
1538 Ga0495609_0026889
1539 Ga0495609_0046136
1540 Ga0495609_0167336
1541 Ga0495597_0004273
1542 Ga0495597_0007533
1543 Ga0495597_0007961
1544 Ga0495597_0022360
1545 Ga0495597_0050127
1546 Ga0495597_0123403
1547 Ga0495597_0148630
1548 Ga0495597_0198440
1549 Ga0495597_0233802
1550 Ga0495645_0153398
1551 Ga0495622_0012942
1552 Ga0495622_0014615
1553 Ga0495622_0033375
1554 Ga0495622_0041061
1555 Ga0495622_0086811
1556 Ga0495633_0006566
1557 Ga0495633_0017696
1558 Ga0495633_0102739
1559 Ga0495633_0103686
1560 Ga0495633_0180912
1561 Ga0495633_0232073
1562 Ga0495633_0263396
1563 Ga0495633_0283515
1564 Ga0495633_0361734
1565 Ga0495633_0365351
1566 Ga0495656_0036295
1567 Ga0495656_0077654
1568 Ga0495656_0121688
1569 Ga0495668_0002640
1570 Ga0495668_0011342
1571 Ga0495668_0018916
1572 Ga0495668_0034324
1573 Ga0495668_0134102
1574 Ga0495668_0151367
1575 Ga0495668_0223246
1576 Ga0495668_0230437
1577 Ga0495668_0590187
1578 Ga0495634_0014598
1579 Ga0495634_0234705
1580 Ga0495634_0587085
1581 Ga0495611_0001662
1582 Ga0495611_0002069
1583 Ga0495611_0005909
1584 Ga0495611_0011467
1585 Ga0495611_0031470
1586 Ga0495611_0232931
1587 Ga0495611_0371160
1588 Ga0495625_0042626
1589 Ga0495625_0176951
1590 Ga0495625_0311060
1591 Ga0495625_0371459
1592 Ga0495625_0411023
1593 Ga0495635_0008977
1594 Ga0495635_0074819
1595 Ga0495659_0007839
1596 Ga0495659_0175125
1597 Ga0495659_0243115
1598 Ga0495661_0048413
1599 Ga0495661_0141952
1600 Ga0495661_0152056
1601 Ga0495661_0173828
1602 Ga0495661_0178330
1603 Ga0495661_0196882
1604 Ga0495661_0203066
1605 Ga0495588_0009027
1606 Ga0495588_0017870
1607 Ga0495588_0022754
1608 Ga0495588_0046528
1609 Ga0495588_0067691
1610 Ga0495588_0094469
1611 Ga0495588_0121691
1612 Ga0495588_0143878
1613 Ga0495588_0232532
1614 Ga0495588_0272713
1615 Ga0495588_0310631
1616 Ga0495657_0173947
1617 Ga0495657_0199806
1618 Ga0495599_0001590
1619 Ga0495599_0247626
1620 Ga0495623_0008893
1621 Ga0495623_0182525
1622 Ga0495623_0379440
1623 Ga0495646_0043675
1624 Ga0495646_0059870
1625 Ga0495646_0168697
1626 Ga0495669_0002717
1627 Ga0495613_0106108
1628 Ga0495624_0133574
1629 Ga0495624_0792004
1630 Ga0495670_0031340
1631 Ga0495670_0051413
1632 Ga0495670_0055789
1633 Ga0495670_0170012
1634 Ga0495670_0205591
1635 Ga0495670_0232931
1636 Ga0495670_0246090
1637 Ga0495671_0005005
1638 Ga0495671_0291497
1639 Ga0495671_0294721
1640 Ga0495671_0315099
1641 Ga0495649_0012662
1642 Ga0495649_0066300
1643 Ga0495649_0101900
1644 Ga0495649_0141389
1645 Ga0495649_0186833
1646 Ga0495649_0193639
1647 Ga0495649_0259803
1648 Ga0495649_0266824
1649 Ga0495589_0030733
1650 Ga0495589_0037560
1651 Ga0495589_0053829
1652 Ga0495589_0114942
1653 Ga0495589_0141655
1654 Ga0495589_0147423
1655 Ga0495589_0207683
1656 Ga0495589_0279380
1657 Ga0495600_0004009
1658 Ga0495600_0112057
1659 Ga0495600_0132309
1660 Ga0495660_0007547
1661 Ga0495660_0011018
1662 Ga0495660_0030532
1663 Ga0495660_0034825
1664 Ga0495660_0116918
1665 Ga0495660_0153779
1666 Ga0495660_0285950
1667 Ga0495581_0101745
1668 Ga0495581_0114908
1669 Ga0495581_0527910
1670 Ga0495581_0750282
1671 Ga0495604_0003421
1672 Ga0495604_0010804
1673 Ga0495604_0037248
1674 Ga0495604_0311423
1675 Ga0495636_0001434
1676 Ga0495636_0006316
1677 Ga0495674_0009303
1678 Ga0495672_0000013
1679 Ga0495672_0000157
1680 Ga0495672_0007686
1681 Ga0495672_0021784
1682 Ga0495672_0084969
1683 Ga0495676_0004545
1684 Ga0495676_0024323
1685 Ga0495676_0226652
1686 Ga0495676_0253927
1687 Ga0495676_0278351
1688 Ga0495680_0213721
1689 Ga0495680_0776926
1690 Ga0495683_0014031
1691 Ga0495683_0057199
1692 Ga0495683_0070987
1693 Ga0495683_0128679
1694 Ga0495683_0155573
1695 Ga0495683_0238734
1696 Ga0495683_0239204
1697 Ga0495683_0241935
1698 Ga0495683_0263294
1699 Ga0495683_0446597
1700 Ga0495687_002781
1701 Ga0495687_002921
1702 Ga0495687_007470
1703 Ga0495687_133110
1704 Ga0495675_0021158
1705 Ga0495675_0072153
1706 Ga0495675_0130020
1707 Ga0495675_0288300
1708 Ga0495677_0037415
1709 Ga0495677_0037798
1710 Ga0495677_0123448
1711 Ga0495677_0131948
1712 Ga0495677_0332952
1713 Ga0495679_008349
1714 Ga0495679_034795
1715 Ga0495685_014389
1716 Ga0495685_036127
1717 Ga0495685_082500
1718 Ga0495685_102862
1719 Ga0495673_0017349
1720 Ga0495681_0011744
1721 Ga0495681_0021475
1722 Ga0495681_0047436
1723 Ga0495681_0112030
1724 Ga0495681_0131935
1725 Ga0495681_0135941
1726 Ga0495681_0154727
1727 Ga0495684_0135318
1728 Ga0495686_0021073
1729 Ga0495686_0061812
1730 Ga0495686_0088035
1731 Ga0495593_0002955
1732 Ga0495593_0073060
1733 Ga0495602_0044651
1734 Ga0495602_0051607
1735 Ga0495602_0205899
1736 Ga0495614_0054920
1737 Ga0495614_0111517
1738 Ga0495615_0009239
1739 Ga0495615_0009700
1740 Ga0495615_0043836
1741 Ga0495615_0050859
1742 Ga0495626_0000227
1743 Ga0495626_0002147
1744 Ga0495626_0014493
1745 Ga0495626_0081138
1746 Ga0495626_0092701
1747 Ga0495626_0185379
1748 Ga0495626_0227992
1749 Ga0495626_0242327
1750 Ga0495626_0285631
1751 Ga0495626_0312925
1752 Ga0495626_0327976
1753 Ga0496100_0014114
1754 Ga0496100_0561774
1755 Ga0496101_0009727
1756 Ga0496101_0160023
1757 Ga0496102_0219122
1758 Ga0496102_0222236
1759 Ga0496102_0240111
1760 Ga0496102_0608728
1761 Ga0496102_1337507
1762 Ga0496103_0017021
1763 Ga0496103_0020711
1764 Ga0496103_0061076
1765 Ga0496103_0135193
1766 Ga0496103_0428895
1767 Ga0496104_1126081
1768 Ga0496105_0594350
1769 Ga0496106_0265208
1770 Ga0496107_0210280
1771 Ga0496107_0273009
1772 Ga0496108_0116425
1773 Ga0496109_1574807
1774 Ga0496110_0062981
1775 Ga0496111_0101527
1776 Ga0496111_0866486
1777 Ga0496112_0040118
1778 Ga0496113_0180677
1779 Ga0496114_0041004
1780 Ga0496114_0208036
1781 Ga0496114_0288875
1782 Ga0496115_0050480
1783 Ga0496115_0495924
1784 Ga0496115_0622063
1785 Ga0496120_0289890
1786 Ga0496121_0274189
1787 Ga0496122_0158956
1788 Ga0496123_0076261
1789 Ga0496124_0052609
1790 Ga0496125_0128609
1791 Ga0496125_0249965
1792 Ga0501306_000907
1793 Ga0501308_000002
1794 Ga0501308_000177
1795 Ga0501309_000053
1796 Ga0501310_003240
1797 Ga0501310_006490
1798 Ga0501310_007550
1799 Ga0501310_023183
1800 Ga0501304_000001
1801 Ga0501304_000110
1802 Ga0501305_004893
1803 Ga0501305_009203
1804 Ga0501307_000295
1805 Ga0501307_002501
1806 Ga0501307_012966
1807 Ga0495678_000010
1808 Ga0495678_006909
1809 Ga0495678_016621
1810 Ga0495678_016940
1811 Ga0495678_040403
1812 Ga0495682_0035772
1813 Ga0495682_0049156
1814 Ga0495682_0141958
1815 Ga0501311_002363
1816 Ga0501311_006367
1817 Ga0501311_065193
1818 Ga0501312_005276
1819 Ga0501312_005882
1820 Ga0501312_006751
1821 Ga0501313_000012
1822 Ga0501313_031750
1823 Ga0501314_002745
1824 Ga0501314_003171
1825 Ga0501314_004206
1826 Ga0501314_030486
1827 Ga0501315_000004
1828 Ga0501315_000082
1829 Ga0501315_008575
1830 Ga0501316_000002
1831 Ga0501316_003898
1832 Ga0501316_032611
1833 Ga0501317_026044
1834 Ga0501318_000040
1835 Ga0501319_000218
1836 Ga0501319_000527
1837 Ga0501319_005104
1838 Ga0501319_007776
1839 Ga0501320_005730
1840 Ga0501320_019720
1841 Ga0501320_021129
1842 Ga0501320_037531
1843 Ga0501320_039633
1844 Ga0501321_006362
1845 Ga0501321_018009
1846 Ga0501322_000643
1847 Ga0501322_001887
1848 Ga0501323_000193
1849 Ga0501323_002509
1850 Ga0501323_006202
1851 Ga0501323_023819
1852 Ga0501324_001950
1853 Ga0501324_028532
1854 Ga0501325_010602
1855 Ga0501325_023963
1856 Ga0501326_04184
1857 Ga0501327_01907
1858 Ga0501334_01100
1859 Ga0501335_004710
1860 Ga0501337_001443
1861 Ga0501340_008756
1862 Ga0501036_0517648
1863 Ga0501040_0009838
1864 Ga0501042_0231962
1865 Ga0501070_0165024
1866 Ga0501073_0193812
1867 Ga0501074_0287578
1868 Ga0501230_002593
1869 Ga0501238_024207
1870 Ga0501249_052437
1871 Ga0501080_0143987
1872 Ga0501083_0021465
1873 Ga0501269_000003
1874 Ga0501269_014902
1875 Ga0501279_007866
1876 Ga0501035_0010452
1877 nmdc:mga03683_14381_c1
1878 nmdc:mga07m45_87196_c1
1879 nmdc:mga08x19_381832_c1
1880 Ga0495619_0071086
1881 Ga0500595_178790
1882 Ga0500586_012856
1883 Ga0500619_059831
1884 Ga0500636_0209054
1885 Ga0587084_000213
1886 Ga0587084_000401
1887 Ga0587084_003559
1888 Ga0587084_016243
1889 Ga0587093_000380
1890 Ga0587093_007958
1891 Ga0587093_026028
1892 Ga0587066_000001
1893 Ga0587070_000065
1894 Ga0587077_108176
1895 Ga0587080_011343
1896 Ga0587083_0000094
1897 Ga0587085_017860
1898 Ga0587088_000001
1899 Ga0587089_000565
1900 Ga0587092_000969
1901 Ga0587092_056408
1902 Ga0587094_006756
1903 Ga0587098_017985
1904 Ga0587125_002919
1905 Ga0587129_000838
1906 Ga0587099_000239
1907 Ga0587101_000023
1908 Ga0587109_003197
1909 Ga0587109_081541
1910 Ga0587113_000311
1911 Ga0587115_010663
1912 Ga0587117_041262
1913 Ga0587128_000098
1914 Ga0587062_000153
1915 Ga0587062_002195
1916 Ga0587068_000002
1917 Ga0587068_000350
1918 Ga0587068_002203
1919 Ga0587069_000016
1920 Ga0587072_003430
1921 Ga0587072_128677
1922 Ga0587075_000434
1923 Ga0587076_000914
1924 Ga0587079_000584
1925 Ga0587079_145788
1926 Ga0587102_011513
1927 Ga0587102_043001
1928 Ga0587102_043002
1929 Ga0587104_000049
1930 Ga0587108_000210
1931 Ga0587110_007725
1932 Ga0587114_007269
1933 Ga0587118_11441
1934 Ga0587096_00279
1935 Ga0587071_024403
1936 Ga0587111_0000229
1937 Ga0466962_0094696
1938 2601667017
1939 2643799425
1940 2644254811
1941 2644360372
1942 2644471518
1943 2738738120
1944 2738826785
1945 2738843082
1946 2739150582
1947 2739192501
1948 2739273833
1949 2739318978
1950 2739337219
1951 2739342877
1952 2809145896
1953 2819543889
1954 2842712341
1955 2857556285
1956 2857560798
1957 2857567997
1958 2904428887
1959 2919476953
1960 8047676081

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00347

Ribosomal_L6

Ribosomal protein L6

105

180

0.99

PF00347

Ribosomal_L6

Ribosomal protein L6

26

97

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fn2-assembly1.cif.gz_H the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.9739 1 172
6v3b-assembly1.cif.gz_G cryo-em structure of the acinetobacter baumannii ribosome: 70s in empty state 0.973 2 175
5mmi-assembly1.cif.gz_G structure of the large subunit of the chloroplast ribosome 0.9708 2 175
8cgk-assembly1.cif.gz_g lincomycin and avilamycin bound to the 50s subunit 0.9705 2 174
5x8t-assembly1.cif.gz_G structure of the 50s large subunit of chloroplast ribosome from spinach 0.9704 3 174
ID Description Score Start End Superfamily
af_Q09865_118_210_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9726 83 175 3.90.930.12
af_Q6AU10_7_103_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9687 85 177 3.90.930.12
af_Q09865_118_210_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9625 83 175 3.90.930.12
5x8tG01 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9553 3 82 3.90.930.12
af_O21037_77_170_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9534 83 177 3.90.930.12
ID Description Score Start End GO Terms
AF-A0A2J1D431-F1-model_v4 deleted 0.9985 74 168
AF-A0A358FVP3-F1-model_v4 50S ribosomal protein L6 0.9963 81 161 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A6A5L2Q1-F1-model_v4 deleted 0.995 7 169
AF-A0A6J7NFJ6-F1-model_v4 Unannotated protein 0.9942 76 172 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A2M8V9T2-F1-model_v4 deleted 0.9916 1 71

Map