F487366
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 980 | 378 | 1960 | 265 |
Family's Representative Sequence
| Representative Sequence | 3300042009|Ga0439451_010326|Ga0439451_010326_864_1742 |
| Length | 292 |
| Sequence | VYSASQTVSALSARKLLLLQSKVESPVGFSLLMKKASLAGAFFVSAIWLSGAQAFCPAPSGLTPVAVQRVVDGDTLRLSDGRSVRMIGLNTPELGKQGRSDEPFAVAARKRLEALVAASDGRVGLLPGKESRDHYGRTLAHVYSVDGANLEAQMLAEGLGFQVAVAPNVDLVACQQAAETSARRAGLGLWRQSPVLKAEQISASGFAMLSGRVSKVQRNRGGVWIELQDSVVLRVAPNLLGQFDVASLEKLKGKQIEARGWVVDRSRRGGLQPGQARWLLPLTDPAMLQAAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 20 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 23 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 24 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 25 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 26 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 27 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 28 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 29 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 37 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 45 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 46 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 47 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 49 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 54 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 70 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 72 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 73 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 75 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 76 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 77 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 78 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 79 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 80 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 81 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 82 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 83 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 84 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 85 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 86 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 87 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 88 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 89 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 90 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 91 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 92 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 93 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 94 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 95 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 96 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 97 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 98 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 99 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 100 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 101 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 102 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 103 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 104 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 105 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 106 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 107 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 108 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 109 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 110 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 111 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 112 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 113 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 114 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 115 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 116 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 117 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 118 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 119 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 120 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 121 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 122 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 123 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 124 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 125 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 126 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 127 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 208 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 209 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 210 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 211 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 212 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 213 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 214 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 215 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 216 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 217 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 218 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 219 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 220 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 221 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 222 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 223 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 224 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 225 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 228 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 229 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 230 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 231 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 232 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 233 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 234 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 235 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 236 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 237 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 238 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 239 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 240 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 241 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 242 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 243 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 244 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 245 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 246 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 247 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 248 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 249 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 250 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 251 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 252 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 253 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 254 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 255 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 256 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 257 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 258 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 259 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 260 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 261 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 262 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 263 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 264 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 265 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 266 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 267 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 268 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 269 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 270 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 271 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 272 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 273 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 274 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 275 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 276 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 277 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 278 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 279 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 280 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 281 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 282 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 283 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 284 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 285 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 286 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 287 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 288 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 289 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 290 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 291 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 292 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 293 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 294 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 295 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 296 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 297 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 298 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 299 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 300 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 301 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 302 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 303 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 304 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 305 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 306 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 307 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 308 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 309 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 310 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 311 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 312 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 313 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 314 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 315 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 316 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 317 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 318 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 319 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 320 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 321 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 322 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 323 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 324 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 325 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 326 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 327 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 328 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 329 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 330 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 331 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 332 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 333 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 334 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 335 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 336 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 337 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 338 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 339 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 340 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 341 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 342 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 343 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 344 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 345 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 346 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 347 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 348 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 349 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 350 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 351 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 352 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 353 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 354 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 355 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 356 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 357 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 358 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 359 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 360 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 361 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 362 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 363 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 364 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 365 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 366 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 367 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 368 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 369 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 370 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 371 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 372 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 373 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 374 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 375 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 376 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 377 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 378 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.51 |
| Metatranscriptomes | 0 |
| Isolates | 14.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.18 |
| Nodule | 2.35 |
| Rhizoplane | 3.88 |
| Rhizosphere | 80.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0439451_010326 | 3300042009 | Bacteria | 1883 |
| 2 | MRS2a_Contig_841 | 2124908027 | Bacteria | 14575 |
| 3 | SwRhRL2b_contig_7644 | 2162886007 | Bacteria | 1814 |
| 4 | MBSR1b_contig_7640429 | 2162886012 | Bacteria | 886 |
| 5 | JGI25162J39368_1000098 | 3300002737 | Bacteria | 95821 |
| 6 | JGI25163J39215_1001163 | 3300002771 | Bacteria | 5119 |
| 7 | JGI25164J39214_1000076 | 3300002772 | Bacteria | 95821 |
| 8 | JGI25165J46597_1000180 | 3300003214 | Bacteria | 95821 |
| 9 | Ga0055536_1001506 | 3300003781 | Bacteria | 13995 |
| 10 | Ga0055536_1004111 | 3300003781 | Bacteria | 7557 |
| 11 | Ga0055536_1017763 | 3300003781 | Bacteria | 2312 |
| 12 | Ga0055530_10000677 | 3300003791 | Bacteria | 28934 |
| 13 | Ga0055530_10001490 | 3300003791 | Bacteria | 16999 |
| 14 | Ga0055540_1000217 | 3300003792 | Bacteria | 54396 |
| 15 | Ga0055540_1001429 | 3300003792 | Bacteria | 14239 |
| 16 | Ga0055531_10000238 | 3300003794 | Bacteria | 60414 |
| 17 | Ga0055531_10000275 | 3300003794 | Bacteria | 53122 |
| 18 | Ga0065714_10000623 | 3300005288 | Bacteria | 3828 |
| 19 | Ga0065714_10014927 | 3300005288 | Bacteria | 2217 |
| 20 | Ga0065714_10033938 | 3300005288 | Bacteria | 1155 |
| 21 | Ga0065714_10120319 | 3300005288 | Bacteria | 1352 |
| 22 | Ga0065714_10158496 | 3300005288 | Bacteria | 1053 |
| 23 | Ga0065704_10070786 | 3300005289 | Bacteria | 16102 |
| 24 | Ga0065704_10111549 | 3300005289 | Bacteria | 1954 |
| 25 | Ga0065712_10068398 | 3300005290 | Bacteria | 10913 |
| 26 | Ga0065715_10006941 | 3300005293 | Bacteria | 4482 |
| 27 | Ga0070669_100000221 | 3300005353 | Bacteria | 47408 |
| 28 | Ga0070669_100004459 | 3300005353 | Bacteria | 10085 |
| 29 | Ga0070669_100217126 | 3300005353 | Bacteria | 1511 |
| 30 | Ga0070662_100001883 | 3300005457 | Bacteria | 12866 |
| 31 | Ga0068853_100000089 | 3300005539 | Bacteria | 62291 |
| 32 | Ga0070665_100154401 | 3300005548 | Bacteria | 2297 |
| 33 | Ga0070664_100007327 | 3300005564 | Bacteria | 8894 |
| 34 | Ga0070664_100446119 | 3300005564 | Bacteria | 1187 |
| 35 | Ga0068851_10000024 | 3300005834 | Bacteria | 125917 |
| 36 | Ga0075364_10254605 | 3300006051 | Bacteria | 1193 |
| 37 | Ga0075364_10273311 | 3300006051 | Bacteria | 1149 |
| 38 | Ga0075432_10073565 | 3300006058 | Bacteria | 1230 |
| 39 | Ga0075432_10091394 | 3300006058 | Bacteria | 1114 |
| 40 | Ga0075432_10092135 | 3300006058 | Bacteria | 1110 |
| 41 | Ga0075362_10115415 | 3300006177 | Bacteria | 1267 |
| 42 | Ga0075362_10124473 | 3300006177 | Bacteria | 1222 |
| 43 | Ga0075436_100262996 | 3300006914 | Bacteria | 1230 |
| 44 | Ga0075436_100276046 | 3300006914 | Bacteria | 1201 |
| 45 | Ga0075436_100381306 | 3300006914 | Bacteria | 1019 |
| 46 | Ga0079104_1000508 | 3300006946 | Bacteria | 41889 |
| 47 | Ga0079104_1000732 | 3300006946 | Bacteria | 29101 |
| 48 | Ga0099826_10010490 | 3300006948 | Bacteria | 6944 |
| 49 | Ga0105251_10076327 | 3300009011 | Bacteria | 1555 |
| 50 | Ga0105251_10103057 | 3300009011 | Bacteria | 1304 |
| 51 | Ga0105251_10130791 | 3300009011 | Bacteria | 1137 |
| 52 | Ga0105244_10056276 | 3300009036 | Bacteria | 1991 |
| 53 | Ga0105244_10057561 | 3300009036 | Bacteria | 1964 |
| 54 | Ga0105244_10084700 | 3300009036 | Bacteria | 1565 |
| 55 | Ga0105244_10133019 | 3300009036 | Bacteria | 1200 |
| 56 | Ga0105244_10147702 | 3300009036 | Bacteria | 1127 |
| 57 | Ga0105244_10148770 | 3300009036 | Bacteria | 1123 |
| 58 | Ga0105250_10083280 | 3300009092 | Bacteria | 1298 |
| 59 | Ga0105250_10128568 | 3300009092 | Bacteria | 1045 |
| 60 | Ga0105243_10000930 | 3300009148 | Bacteria | 27440 |
| 61 | Ga0105243_10130877 | 3300009148 | Bacteria | 2128 |
| 62 | Ga0105242_10028253 | 3300009176 | Bacteria | 4464 |
| 63 | Ga0105248_10018503 | 3300009177 | Bacteria | 7699 |
| 64 | Ga0105246_10000305 | 3300011119 | Bacteria | 25977 |
| 65 | Ga0105246_10013235 | 3300011119 | Bacteria | 5166 |
| 66 | Ga0157345_1000263 | 3300012498 | Bacteria | 7319 |
| 67 | Ga0157373_10075583 | 3300013100 | Bacteria | 2377 |
| 68 | Ga0157373_10212130 | 3300013100 | Bacteria | 1365 |
| 69 | Ga0157373_10276354 | 3300013100 | Bacteria | 1190 |
| 70 | Ga0157373_10346967 | 3300013100 | Bacteria | 1059 |
| 71 | Ga0157371_10019663 | 3300013102 | Bacteria | 4976 |
| 72 | Ga0157371_10026569 | 3300013102 | Bacteria | 4206 |
| 73 | Ga0157371_10270950 | 3300013102 | Bacteria | 1225 |
| 74 | Ga0157370_10044961 | 3300013104 | Bacteria | 4240 |
| 75 | Ga0157370_10404382 | 3300013104 | Bacteria | 1256 |
| 76 | Ga0157370_10416931 | 3300013104 | Bacteria | 1235 |
| 77 | Ga0157370_10418905 | 3300013104 | Bacteria | 1232 |
| 78 | Ga0157370_10686947 | 3300013104 | Bacteria | 935 |
| 79 | Ga0157369_10043460 | 3300013105 | Bacteria | 4898 |
| 80 | Ga0157369_10064964 | 3300013105 | Bacteria | 3929 |
| 81 | Ga0163162_10002804 | 3300013306 | Bacteria | 16571 |
| 82 | Ga0163162_10146414 | 3300013306 | Bacteria | 2478 |
| 83 | Ga0163162_10660772 | 3300013306 | Bacteria | 1168 |
| 84 | Ga0157372_10077386 | 3300013307 | Bacteria | 3757 |
| 85 | Ga0157375_10695628 | 3300013308 | Bacteria | 1170 |
| 86 | Ga0157375_10709928 | 3300013308 | Bacteria | 1159 |
| 87 | Ga0157375_10763064 | 3300013308 | Bacteria | 1118 |
| 88 | Ga0157375_11124619 | 3300013308 | Bacteria | 920 |
| 89 | Ga0182008_10015018 | 3300014497 | Bacteria | 4049 |
| 90 | Ga0182008_10021981 | 3300014497 | Bacteria | 3269 |
| 91 | Ga0182008_10028041 | 3300014497 | Bacteria | 2849 |
| 92 | Ga0182008_10124813 | 3300014497 | Bacteria | 1281 |
| 93 | Ga0182008_10164042 | 3300014497 | Bacteria | 1119 |
| 94 | Ga0182008_10196968 | 3300014497 | Bacteria | 1024 |
| 95 | Ga0182008_10199696 | 3300014497 | Bacteria | 1017 |
| 96 | Ga0182006_1008138 | 3300015261 | Bacteria | 4757 |
| 97 | Ga0182006_1012068 | 3300015261 | Bacteria | 3784 |
| 98 | Ga0182006_1038238 | 3300015261 | Bacteria | 1898 |
| 99 | Ga0182006_1072633 | 3300015261 | Bacteria | 1272 |
| 100 | Ga0182006_1082877 | 3300015261 | Bacteria | 1167 |
| 101 | Ga0182006_1083870 | 3300015261 | Bacteria | 1158 |
| 102 | Ga0182005_1020208 | 3300015265 | Bacteria | 1834 |
| 103 | Ga0182005_1023545 | 3300015265 | Bacteria | 1682 |
| 104 | Ga0182005_1046868 | 3300015265 | Bacteria | 1174 |
| 105 | Ga0182005_1054986 | 3300015265 | Bacteria | 1084 |
| 106 | Ga0163161_10026663 | 3300017792 | Bacteria | 4094 |
| 107 | Ga0163161_10050945 | 3300017792 | Bacteria | 2997 |
| 108 | Ga0163161_10148210 | 3300017792 | Bacteria | 1782 |
| 109 | Ga0163161_10278217 | 3300017792 | Bacteria | 1312 |
| 110 | Ga0163161_10368722 | 3300017792 | Bacteria | 1145 |
| 111 | Ga0209760_100037 | 3300025207 | Bacteria | 129761 |
| 112 | Ga0209563_100703 | 3300025230 | Bacteria | 10476 |
| 113 | Ga0207427_100016 | 3300025231 | Bacteria | 538697 |
| 114 | Ga0209437_100011 | 3300025233 | Bacteria | 818520 |
| 115 | Ga0209233_1000019 | 3300025261 | Bacteria | 818520 |
| 116 | Ga0209675_1007380 | 3300025291 | Bacteria | 4223 |
| 117 | Ga0209676_1000025 | 3300025292 | Bacteria | 577569 |
| 118 | Ga0209676_1000032 | 3300025292 | Bacteria | 469558 |
| 119 | Ga0209676_1000318 | 3300025292 | Bacteria | 94045 |
| 120 | Ga0209050_1000025 | 3300025298 | Bacteria | 528225 |
| 121 | Ga0209050_1000381 | 3300025298 | Bacteria | 83623 |
| 122 | Ga0209050_1000981 | 3300025298 | Bacteria | 36358 |
| 123 | Ga0209051_1000026 | 3300025303 | Bacteria | 413311 |
| 124 | Ga0209051_1000299 | 3300025303 | Bacteria | 78310 |
| 125 | Ga0209257_1000034 | 3300025304 | Bacteria | 662719 |
| 126 | Ga0207656_10000008 | 3300025321 | Bacteria | 275365 |
| 127 | Ga0207696_1000057 | 3300025711 | Bacteria | 249404 |
| 128 | Ga0207696_1002043 | 3300025711 | Bacteria | 10201 |
| 129 | Ga0207696_1004054 | 3300025711 | Bacteria | 6418 |
| 130 | Ga0207655_1001265 | 3300025728 | Bacteria | 24120 |
| 131 | Ga0207655_1001320 | 3300025728 | Bacteria | 23413 |
| 132 | Ga0207655_1002555 | 3300025728 | Bacteria | 14564 |
| 133 | Ga0207655_1011490 | 3300025728 | Bacteria | 5267 |
| 134 | Ga0207655_1017780 | 3300025728 | Bacteria | 3817 |
| 135 | Ga0207655_1034389 | 3300025728 | Bacteria | 2280 |
| 136 | Ga0207655_1064697 | 3300025728 | Bacteria | 1393 |
| 137 | Ga0207713_1001759 | 3300025735 | Bacteria | 16630 |
| 138 | Ga0207713_1002871 | 3300025735 | Bacteria | 12096 |
| 139 | Ga0207713_1006851 | 3300025735 | Bacteria | 6861 |
| 140 | Ga0207713_1015274 | 3300025735 | Bacteria | 3949 |
| 141 | Ga0207713_1053449 | 3300025735 | Bacteria | 1591 |
| 142 | Ga0207649_10000001 | 3300025920 | Bacteria | 537851 |
| 143 | Ga0207681_10001569 | 3300025923 | Bacteria | 14689 |
| 144 | Ga0207706_10000069 | 3300025933 | Bacteria | 105541 |
| 145 | Ga0207706_10013390 | 3300025933 | Bacteria | 7459 |
| 146 | Ga0207709_10000022 | 3300025935 | Bacteria | 383573 |
| 147 | Ga0207709_10105049 | 3300025935 | Bacteria | 1876 |
| 148 | Ga0207711_10019450 | 3300025941 | Bacteria | 5653 |
| 149 | Ga0207679_10000011 | 3300025945 | Bacteria | 346112 |
| 150 | Ga0207639_10000099 | 3300026041 | Bacteria | 71467 |
| 151 | Ga0209281_1000026 | 3300027111 | Bacteria | 465877 |
| 152 | Ga0209281_1000033 | 3300027111 | Bacteria | 383539 |
| 153 | Ga0209281_1006372 | 3300027111 | Bacteria | 3093 |
| 154 | Ga0209983_1007167 | 3300027665 | Bacteria | 2289 |
| 155 | Ga0209282_1016451 | 3300027666 | Bacteria | 4705 |
| 156 | Ga0207428_10128566 | 3300027907 | Bacteria | 1940 |
| 157 | Ga0207428_10238065 | 3300027907 | Bacteria | 1361 |
| 158 | Ga0207428_10339048 | 3300027907 | Bacteria | 1107 |
| 159 | Ga0207428_10340626 | 3300027907 | Bacteria | 1105 |
| 160 | Ga0207428_10349722 | 3300027907 | Bacteria | 1087 |
| 161 | Ga0268266_10045723 | 3300028379 | Bacteria | 3745 |
| 162 | Ga0307517_10181803 | 3300028786 | Bacteria | 1356 |
| 163 | Ga0316178_1083481 | 3300030735 | Bacteria | 46215 |
| 164 | Ga0316183_1115597 | 3300030742 | Bacteria | 1094 |
| 165 | Ga0316181_1132780 | 3300030744 | Bacteria | 8983 |
| 166 | Ga0307408_100409023 | 3300031548 | Bacteria | 1167 |
| 167 | Ga0307408_100411689 | 3300031548 | Bacteria | 1163 |
| 168 | Ga0307516_10173178 | 3300031730 | Bacteria | 1897 |
| 169 | Ga0307516_10208998 | 3300031730 | Bacteria | 1667 |
| 170 | Ga0307405_10241772 | 3300031731 | Bacteria | 1337 |
| 171 | Ga0307405_10522412 | 3300031731 | Bacteria | 955 |
| 172 | Ga0307413_10039291 | 3300031824 | Bacteria | 2751 |
| 173 | Ga0307407_10042457 | 3300031903 | Bacteria | 2550 |
| 174 | Ga0307412_10228383 | 3300031911 | Bacteria | 1431 |
| 175 | Ga0307412_10496134 | 3300031911 | Bacteria | 1015 |
| 176 | Ga0307409_100699697 | 3300031995 | Bacteria | 1012 |
| 177 | Ga0307416_100700953 | 3300032002 | Bacteria | 1101 |
| 178 | Ga0307416_100726611 | 3300032002 | Bacteria | 1084 |
| 179 | Ga0307414_10002243 | 3300032004 | Bacteria | 10088 |
| 180 | Ga0307414_10550163 | 3300032004 | Bacteria | 1028 |
| 181 | Ga0307414_10574763 | 3300032004 | Bacteria | 1007 |
| 182 | Ga0307411_10397320 | 3300032005 | Bacteria | 1138 |
| 183 | Ga0307411_10444869 | 3300032005 | Bacteria | 1082 |
| 184 | Ga0307510_10047609 | 3300033180 | Bacteria | 4591 |
| 185 | Ga0237819_00952 | 3300038705 | Bacteria | 8820 |
| 186 | Ga0439438_000783 | 3300041405 | Bacteria | 14132 |
| 187 | Ga0439438_004585 | 3300041405 | Bacteria | 5256 |
| 188 | Ga0439438_006548 | 3300041405 | Bacteria | 4090 |
| 189 | Ga0439438_006674 | 3300041405 | Bacteria | 4036 |
| 190 | Ga0439438_009409 | 3300041405 | Bacteria | 3163 |
| 191 | Ga0439438_018774 | 3300041405 | Bacteria | 1963 |
| 192 | Ga0439447_012503 | 3300041407 | Bacteria | 2436 |
| 193 | Ga0439447_014518 | 3300041407 | Bacteria | 2207 |
| 194 | Ga0439447_020217 | 3300041407 | Bacteria | 1768 |
| 195 | Ga0439447_025907 | 3300041407 | Bacteria | 1507 |
| 196 | Ga0439447_046626 | 3300041407 | Bacteria | 1042 |
| 197 | Ga0439461_0019577 | 3300041410 | Bacteria | 1334 |
| 198 | Ga0439466_0001520 | 3300041411 | Bacteria | 9059 |
| 199 | Ga0439466_0007260 | 3300041411 | Bacteria | 4194 |
| 200 | Ga0439466_0009406 | 3300041411 | Bacteria | 3649 |
| 201 | Ga0439466_0026325 | 3300041411 | Bacteria | 2023 |
| 202 | Ga0439466_0051777 | 3300041411 | Bacteria | 1343 |
| 203 | Ga0439466_0076219 | 3300041411 | Bacteria | 1062 |
| 204 | Ga0439466_0085593 | 3300041411 | Bacteria | 991 |
| 205 | Ga0439466_0089199 | 3300041411 | Bacteria | 967 |
| 206 | Ga0439465_0024791 | 3300041413 | Bacteria | 1891 |
| 207 | Ga0439431_0002600 | 3300041997 | Bacteria | 3985 |
| 208 | Ga0439437_000241 | 3300042000 | Bacteria | 4916 |
| 209 | Ga0439445_0041553 | 3300042004 | Bacteria | 1223 |
| 210 | Ga0439432_001031 | 3300042006 | Bacteria | 10565 |
| 211 | Ga0439432_002040 | 3300042006 | Bacteria | 7641 |
| 212 | Ga0439432_007092 | 3300042006 | Bacteria | 3982 |
| 213 | Ga0439432_017191 | 3300042006 | Bacteria | 2429 |
| 214 | Ga0439432_024693 | 3300042006 | Bacteria | 1975 |
| 215 | Ga0439432_026722 | 3300042006 | Bacteria | 1888 |
| 216 | Ga0439432_066521 | 3300042006 | Bacteria | 1103 |
| 217 | Ga0439451_021169 | 3300042009 | Bacteria | 1311 |
| 218 | Ga0439451_026813 | 3300042009 | Bacteria | 1161 |
| 219 | Ga0439451_026863 | 3300042009 | Bacteria | 1160 |
| 220 | Ga0439451_028903 | 3300042009 | Bacteria | 1117 |
| 221 | Ga0439452_000670 | 3300042010 | Bacteria | 16851 |
| 222 | Ga0439452_000794 | 3300042010 | Bacteria | 14949 |
| 223 | Ga0439452_018520 | 3300042010 | Bacteria | 1853 |
| 224 | Ga0439452_026858 | 3300042010 | Bacteria | 1449 |
| 225 | Ga0439452_038575 | 3300042010 | Bacteria | 1133 |
| 226 | Ga0439452_039566 | 3300042010 | Bacteria | 1115 |
| 227 | Ga0439452_048166 | 3300042010 | Bacteria | 984 |
| 228 | Ga0439456_001644 | 3300042013 | Bacteria | 4511 |
| 229 | Ga0439456_009475 | 3300042013 | Bacteria | 2011 |
| 230 | Ga0439456_012208 | 3300042013 | Bacteria | 1780 |
| 231 | Ga0439456_015017 | 3300042013 | Bacteria | 1615 |
| 232 | Ga0439456_035375 | 3300042013 | Bacteria | 1076 |
| 233 | Ga0439456_035730 | 3300042013 | Bacteria | 1071 |
| 234 | Ga0439456_035998 | 3300042013 | Bacteria | 1067 |
| 235 | Ga0439456_058683 | 3300042013 | Bacteria | 844 |
| 236 | Ga0439463_008953 | 3300042016 | Bacteria | 2464 |
| 237 | Ga0439463_026487 | 3300042016 | Bacteria | 1456 |
| 238 | Ga0439463_043241 | 3300042016 | Bacteria | 1146 |
| 239 | Ga0439463_044840 | 3300042016 | Bacteria | 1126 |
| 240 | Ga0450911_000018 | 3300042115 | Bacteria | 104759 |
| 241 | Ga0450911_001188 | 3300042115 | Bacteria | 6352 |
| 242 | Ga0450911_005032 | 3300042115 | Bacteria | 2092 |
| 243 | Ga0450911_013451 | 3300042115 | Bacteria | 1094 |
| 244 | Ga0450919_003213 | 3300042121 | Bacteria | 2069 |
| 245 | Ga0450919_005273 | 3300042121 | Bacteria | 1558 |
| 246 | Ga0450920_001085 | 3300042122 | Bacteria | 4449 |
| 247 | Ga0450922_000453 | 3300042124 | Bacteria | 4404 |
| 248 | Ga0450922_001694 | 3300042124 | Bacteria | 2150 |
| 249 | Ga0450923_013176 | 3300042125 | Bacteria | 1516 |
| 250 | Ga0450890_001935 | 3300042127 | Bacteria | 2927 |
| 251 | Ga0450891_005895 | 3300042129 | Bacteria | 1130 |
| 252 | Ga0450900_003159 | 3300042136 | Bacteria | 1809 |
| 253 | Ga0450902_016068 | 3300042137 | Bacteria | 1218 |
| 254 | Ga0450902_022213 | 3300042137 | Bacteria | 1050 |
| 255 | Ga0450903_002260 | 3300042138 | Bacteria | 3438 |
| 256 | Ga0450903_003778 | 3300042138 | Bacteria | 2609 |
| 257 | Ga0450903_007597 | 3300042138 | Bacteria | 1780 |
| 258 | Ga0450903_015042 | 3300042138 | Bacteria | 1220 |
| 259 | Ga0450903_020841 | 3300042138 | Bacteria | 1013 |
| 260 | Ga0450903_023742 | 3300042138 | Bacteria | 942 |
| 261 | Ga0450904_000271 | 3300042139 | Bacteria | 11182 |
| 262 | Ga0450904_002407 | 3300042139 | Bacteria | 2235 |
| 263 | Ga0450904_002472 | 3300042139 | Bacteria | 2192 |
| 264 | Ga0450905_003582 | 3300042142 | Bacteria | 2042 |
| 265 | Ga0450905_012168 | 3300042142 | Bacteria | 1209 |
| 266 | Ga0450905_020674 | 3300042142 | Bacteria | 970 |
| 267 | Ga0450906_002239 | 3300042145 | Bacteria | 4230 |
| 268 | Ga0450906_003997 | 3300042145 | Bacteria | 3119 |
| 269 | Ga0450906_024040 | 3300042145 | Bacteria | 1083 |
| 270 | Ga0450907_000319 | 3300042146 | Bacteria | 15627 |
| 271 | Ga0450907_001968 | 3300042146 | Bacteria | 4141 |
| 272 | Ga0450907_006117 | 3300042146 | Bacteria | 2016 |
| 273 | Ga0450910_007754 | 3300042147 | Bacteria | 1501 |
| 274 | Ga0450910_013873 | 3300042147 | Bacteria | 1175 |
| 275 | Ga0439446_0096769 | 3300042156 | Bacteria | 929 |
| 276 | Ga0450908_012070 | 3300042184 | Bacteria | 1572 |
| 277 | Ga0450909_001587 | 3300042185 | Bacteria | 3174 |
| 278 | Ga0450909_005000 | 3300042185 | Bacteria | 1904 |
| 279 | Ga0450909_005594 | 3300042185 | Bacteria | 1807 |
| 280 | Ga0439434_0016587 | 3300042435 | Bacteria | 2201 |
| 281 | Ga0439434_0082787 | 3300042435 | Bacteria | 1019 |
| 282 | Ga0439464_0013879 | 3300042439 | Bacteria | 2162 |
| 283 | Ga0439460_0015656 | 3300042461 | Bacteria | 2010 |
| 284 | Ga0450918_016905 | 3300042531 | Bacteria | 1269 |
| 285 | Ga0450893_0014394 | 3300042532 | Bacteria | 1326 |
| 286 | Ga0450893_0021451 | 3300042532 | Bacteria | 1115 |
| 287 | Ga0450893_0025382 | 3300042532 | Bacteria | 1038 |
| 288 | Ga0450901_001597 | 3300042533 | Bacteria | 2567 |
| 289 | Ga0439440_0010764 | 3300042993 | Bacteria | 1919 |
| 290 | Ga0439440_0011030 | 3300042993 | Bacteria | 1900 |
| 291 | Ga0439440_0040886 | 3300042993 | Bacteria | 1129 |
| 292 | Ga0439440_0043431 | 3300042993 | Bacteria | 1102 |
| 293 | Ga0495617_037768 | 3300046452 | Bacteria | 1616 |
| 294 | Ga0495617_067088 | 3300046452 | Bacteria | 1182 |
| 295 | Ga0495617_079378 | 3300046452 | Bacteria | 1075 |
| 296 | Ga0495617_080486 | 3300046452 | Bacteria | 1067 |
| 297 | Ga0495617_088085 | 3300046452 | Bacteria | 1014 |
| 298 | Ga0495617_096817 | 3300046452 | Bacteria | 960 |
| 299 | Ga0495627_001267 | 3300046453 | Bacteria | 15562 |
| 300 | Ga0495627_019354 | 3300046453 | Bacteria | 2283 |
| 301 | Ga0495627_040808 | 3300046453 | Bacteria | 1428 |
| 302 | Ga0495627_050121 | 3300046453 | Bacteria | 1258 |
| 303 | Ga0495627_054570 | 3300046453 | Bacteria | 1194 |
| 304 | Ga0495627_064345 | 3300046453 | Bacteria | 1079 |
| 305 | Ga0495627_095294 | 3300046453 | Bacteria | 853 |
| 306 | Ga0495603_0023732 | 3300046455 | Bacteria | 3710 |
| 307 | Ga0495603_0100921 | 3300046455 | Bacteria | 1684 |
| 308 | Ga0495603_0224826 | 3300046455 | Bacteria | 1082 |
| 309 | Ga0495603_0298979 | 3300046455 | Bacteria | 924 |
| 310 | Ga0495590_0005691 | 3300046457 | Bacteria | 4900 |
| 311 | Ga0495590_0031965 | 3300046457 | Bacteria | 1841 |
| 312 | Ga0495590_0035559 | 3300046457 | Bacteria | 1738 |
| 313 | Ga0495590_0054910 | 3300046457 | Bacteria | 1392 |
| 314 | Ga0495591_006008 | 3300046458 | Bacteria | 5475 |
| 315 | Ga0495591_009188 | 3300046458 | Bacteria | 3951 |
| 316 | Ga0495591_009335 | 3300046458 | Bacteria | 3908 |
| 317 | Ga0495591_009346 | 3300046458 | Bacteria | 3905 |
| 318 | Ga0495591_009402 | 3300046458 | Bacteria | 3891 |
| 319 | Ga0495591_026051 | 3300046458 | Bacteria | 1824 |
| 320 | Ga0495591_037190 | 3300046458 | Bacteria | 1410 |
| 321 | Ga0495591_038474 | 3300046458 | Bacteria | 1376 |
| 322 | Ga0495591_054000 | 3300046458 | Bacteria | 1087 |
| 323 | Ga0495591_056944 | 3300046458 | Bacteria | 1049 |
| 324 | Ga0495591_058404 | 3300046458 | Bacteria | 1031 |
| 325 | Ga0495591_062234 | 3300046458 | Bacteria | 988 |
| 326 | Ga0495591_063243 | 3300046458 | Bacteria | 977 |
| 327 | Ga0495591_063459 | 3300046458 | Bacteria | 975 |
| 328 | Ga0495629_0029737 | 3300046459 | Bacteria | 3873 |
| 329 | Ga0495638_0021353 | 3300046460 | Bacteria | 4270 |
| 330 | Ga0495638_0024729 | 3300046460 | Bacteria | 3910 |
| 331 | Ga0495638_0026393 | 3300046460 | Bacteria | 3763 |
| 332 | Ga0495638_0041024 | 3300046460 | Bacteria | 2930 |
| 333 | Ga0495638_0141218 | 3300046460 | Bacteria | 1405 |
| 334 | Ga0495638_0147467 | 3300046460 | Bacteria | 1367 |
| 335 | Ga0495638_0161865 | 3300046460 | Bacteria | 1290 |
| 336 | Ga0495638_0192264 | 3300046460 | Bacteria | 1157 |
| 337 | Ga0495638_0195943 | 3300046460 | Bacteria | 1143 |
| 338 | Ga0495638_0204215 | 3300046460 | Bacteria | 1113 |
| 339 | Ga0495638_0220444 | 3300046460 | Bacteria | 1060 |
| 340 | Ga0495638_0245803 | 3300046460 | Bacteria | 988 |
| 341 | Ga0495653_0008133 | 3300046463 | Bacteria | 8589 |
| 342 | Ga0495653_0015309 | 3300046463 | Bacteria | 6252 |
| 343 | Ga0495653_0029993 | 3300046463 | Bacteria | 4335 |
| 344 | Ga0495650_0015737 | 3300046471 | Bacteria | 3867 |
| 345 | Ga0495650_0015746 | 3300046471 | Bacteria | 3866 |
| 346 | Ga0495650_0018288 | 3300046471 | Bacteria | 3486 |
| 347 | Ga0495650_0037443 | 3300046471 | Bacteria | 2112 |
| 348 | Ga0495650_0052349 | 3300046471 | Bacteria | 1676 |
| 349 | Ga0495650_0069489 | 3300046471 | Bacteria | 1385 |
| 350 | Ga0495650_0074150 | 3300046471 | Bacteria | 1327 |
| 351 | Ga0495650_0098122 | 3300046471 | Bacteria | 1103 |
| 352 | Ga0495582_0071158 | 3300046473 | Bacteria | 1924 |
| 353 | Ga0495605_0000246 | 3300046474 | Bacteria | 64351 |
| 354 | Ga0495605_0014541 | 3300046474 | Bacteria | 4305 |
| 355 | Ga0495605_0015560 | 3300046474 | Bacteria | 4133 |
| 356 | Ga0495605_0075866 | 3300046474 | Bacteria | 1580 |
| 357 | Ga0495605_0117801 | 3300046474 | Bacteria | 1206 |
| 358 | Ga0495605_0132288 | 3300046474 | Bacteria | 1124 |
| 359 | Ga0495605_0147348 | 3300046474 | Bacteria | 1052 |
| 360 | Ga0495639_0001551 | 3300046475 | Bacteria | 10257 |
| 361 | Ga0495639_0010965 | 3300046475 | Bacteria | 3902 |
| 362 | Ga0495584_0005435 | 3300046491 | Bacteria | 6751 |
| 363 | Ga0495584_0013994 | 3300046491 | Bacteria | 4086 |
| 364 | Ga0495584_0016523 | 3300046491 | Bacteria | 3762 |
| 365 | Ga0495584_0024887 | 3300046491 | Bacteria | 3035 |
| 366 | Ga0495584_0031735 | 3300046491 | Bacteria | 2673 |
| 367 | Ga0495584_0070437 | 3300046491 | Bacteria | 1757 |
| 368 | Ga0495584_0088226 | 3300046491 | Bacteria | 1563 |
| 369 | Ga0495584_0171829 | 3300046491 | Bacteria | 1101 |
| 370 | Ga0495584_0172727 | 3300046491 | Bacteria | 1098 |
| 371 | Ga0495584_0198015 | 3300046491 | Bacteria | 1021 |
| 372 | Ga0495584_0204514 | 3300046491 | Bacteria | 1003 |
| 373 | Ga0495585_0013551 | 3300046492 | Bacteria | 4764 |
| 374 | Ga0495585_0014847 | 3300046492 | Bacteria | 4531 |
| 375 | Ga0495585_0017937 | 3300046492 | Bacteria | 4084 |
| 376 | Ga0495585_0056686 | 3300046492 | Bacteria | 2163 |
| 377 | Ga0495585_0068394 | 3300046492 | Bacteria | 1940 |
| 378 | Ga0495585_0099401 | 3300046492 | Bacteria | 1557 |
| 379 | Ga0495585_0147731 | 3300046492 | Bacteria | 1227 |
| 380 | Ga0495585_0165454 | 3300046492 | Bacteria | 1145 |
| 381 | Ga0495585_0172481 | 3300046492 | Bacteria | 1116 |
| 382 | Ga0495585_0186085 | 3300046492 | Bacteria | 1065 |
| 383 | Ga0495594_0084849 | 3300046499 | Bacteria | 1771 |
| 384 | Ga0495594_0103538 | 3300046499 | Bacteria | 1602 |
| 385 | Ga0495594_0213815 | 3300046499 | Bacteria | 1099 |
| 386 | Ga0495596_0118221 | 3300046500 | Bacteria | 1029 |
| 387 | Ga0495607_0001148 | 3300046501 | Bacteria | 23968 |
| 388 | Ga0495607_0002250 | 3300046501 | Bacteria | 15942 |
| 389 | Ga0495607_0002707 | 3300046501 | Bacteria | 14140 |
| 390 | Ga0495607_0018812 | 3300046501 | Bacteria | 4393 |
| 391 | Ga0495607_0023114 | 3300046501 | Bacteria | 3895 |
| 392 | Ga0495607_0024514 | 3300046501 | Bacteria | 3760 |
| 393 | Ga0495607_0034140 | 3300046501 | Bacteria | 3088 |
| 394 | Ga0495607_0058730 | 3300046501 | Bacteria | 2197 |
| 395 | Ga0495607_0087203 | 3300046501 | Bacteria | 1699 |
| 396 | Ga0495607_0144511 | 3300046501 | Bacteria | 1223 |
| 397 | Ga0495607_0150143 | 3300046501 | Bacteria | 1193 |
| 398 | Ga0495607_0164504 | 3300046501 | Bacteria | 1124 |
| 399 | Ga0495607_0186317 | 3300046501 | Bacteria | 1037 |
| 400 | Ga0495607_0214016 | 3300046501 | Bacteria | 946 |
| 401 | Ga0495583_0005604 | 3300046506 | Bacteria | 8462 |
| 402 | Ga0495583_0012755 | 3300046506 | Bacteria | 4732 |
| 403 | Ga0495583_0071296 | 3300046506 | Bacteria | 1526 |
| 404 | Ga0495583_0076303 | 3300046506 | Bacteria | 1464 |
| 405 | Ga0495583_0100564 | 3300046506 | Bacteria | 1234 |
| 406 | Ga0495583_0137828 | 3300046506 | Bacteria | 1017 |
| 407 | Ga0495583_0138733 | 3300046506 | Bacteria | 1013 |
| 408 | Ga0495606_0016977 | 3300046507 | Bacteria | 5523 |
| 409 | Ga0495606_0024248 | 3300046507 | Bacteria | 4376 |
| 410 | Ga0495606_0024630 | 3300046507 | Bacteria | 4330 |
| 411 | Ga0495606_0028702 | 3300046507 | Bacteria | 3919 |
| 412 | Ga0495606_0065393 | 3300046507 | Bacteria | 2310 |
| 413 | Ga0495606_0200002 | 3300046507 | Bacteria | 1139 |
| 414 | Ga0495606_0258256 | 3300046507 | Bacteria | 963 |
| 415 | Ga0495606_0276861 | 3300046507 | Bacteria | 919 |
| 416 | Ga0495610_0009319 | 3300046512 | Bacteria | 6219 |
| 417 | Ga0495610_0015655 | 3300046512 | Bacteria | 4397 |
| 418 | Ga0495610_0046117 | 3300046512 | Bacteria | 2152 |
| 419 | Ga0495610_0057601 | 3300046512 | Bacteria | 1862 |
| 420 | Ga0495610_0087194 | 3300046512 | Bacteria | 1420 |
| 421 | Ga0495610_0098834 | 3300046512 | Bacteria | 1310 |
| 422 | Ga0495610_0113724 | 3300046512 | Bacteria | 1195 |
| 423 | Ga0495610_0124704 | 3300046512 | Bacteria | 1124 |
| 424 | Ga0495610_0145373 | 3300046512 | Bacteria | 1016 |
| 425 | Ga0495610_0149386 | 3300046512 | Bacteria | 998 |
| 426 | Ga0495610_0150900 | 3300046512 | Bacteria | 991 |
| 427 | Ga0495616_0014268 | 3300046513 | Bacteria | 4454 |
| 428 | Ga0495616_0016705 | 3300046513 | Bacteria | 4055 |
| 429 | Ga0495616_0018207 | 3300046513 | Bacteria | 3860 |
| 430 | Ga0495616_0037480 | 3300046513 | Bacteria | 2494 |
| 431 | Ga0495616_0058584 | 3300046513 | Bacteria | 1896 |
| 432 | Ga0495616_0099988 | 3300046513 | Bacteria | 1361 |
| 433 | Ga0495616_0102115 | 3300046513 | Bacteria | 1343 |
| 434 | Ga0495616_0102695 | 3300046513 | Bacteria | 1339 |
| 435 | Ga0495616_0148608 | 3300046513 | Bacteria | 1061 |
| 436 | Ga0495620_0010398 | 3300046515 | Bacteria | 4911 |
| 437 | Ga0495620_0020263 | 3300046515 | Bacteria | 3250 |
| 438 | Ga0495620_0036836 | 3300046515 | Bacteria | 2184 |
| 439 | Ga0495620_0079953 | 3300046515 | Bacteria | 1323 |
| 440 | Ga0495620_0079968 | 3300046515 | Bacteria | 1323 |
| 441 | Ga0495620_0087576 | 3300046515 | Bacteria | 1252 |
| 442 | Ga0495620_0108494 | 3300046515 | Bacteria | 1101 |
| 443 | Ga0495620_0112559 | 3300046515 | Bacteria | 1077 |
| 444 | Ga0495620_0145495 | 3300046515 | Bacteria | 925 |
| 445 | Ga0495628_0173838 | 3300046516 | Bacteria | 1632 |
| 446 | Ga0495628_0419688 | 3300046516 | Bacteria | 975 |
| 447 | Ga0495630_0143480 | 3300046517 | Bacteria | 1815 |
| 448 | Ga0495630_0387427 | 3300046517 | Bacteria | 1070 |
| 449 | Ga0495631_0009778 | 3300046518 | Bacteria | 4776 |
| 450 | Ga0495631_0010807 | 3300046518 | Bacteria | 4509 |
| 451 | Ga0495631_0025448 | 3300046518 | Bacteria | 2725 |
| 452 | Ga0495631_0093758 | 3300046518 | Bacteria | 1292 |
| 453 | Ga0495631_0185301 | 3300046518 | Bacteria | 891 |
| 454 | Ga0495631_0193072 | 3300046518 | Bacteria | 871 |
| 455 | Ga0495632_0013983 | 3300046519 | Bacteria | 4557 |
| 456 | Ga0495632_0016110 | 3300046519 | Bacteria | 4168 |
| 457 | Ga0495632_0016947 | 3300046519 | Bacteria | 4036 |
| 458 | Ga0495632_0017184 | 3300046519 | Bacteria | 4000 |
| 459 | Ga0495632_0019197 | 3300046519 | Bacteria | 3730 |
| 460 | Ga0495632_0055128 | 3300046519 | Bacteria | 1946 |
| 461 | Ga0495632_0093099 | 3300046519 | Bacteria | 1426 |
| 462 | Ga0495632_0122253 | 3300046519 | Bacteria | 1216 |
| 463 | Ga0495632_0130945 | 3300046519 | Bacteria | 1167 |
| 464 | Ga0495632_0140071 | 3300046519 | Bacteria | 1122 |
| 465 | Ga0495632_0141151 | 3300046519 | Bacteria | 1117 |
| 466 | Ga0495632_0160846 | 3300046519 | Bacteria | 1034 |
| 467 | Ga0495632_0162183 | 3300046519 | Bacteria | 1029 |
| 468 | Ga0495637_0011881 | 3300046520 | Bacteria | 4173 |
| 469 | Ga0495637_0012319 | 3300046520 | Bacteria | 4094 |
| 470 | Ga0495637_0013369 | 3300046520 | Bacteria | 3895 |
| 471 | Ga0495637_0039623 | 3300046520 | Bacteria | 2032 |
| 472 | Ga0495637_0055274 | 3300046520 | Bacteria | 1646 |
| 473 | Ga0495637_0059527 | 3300046520 | Bacteria | 1571 |
| 474 | Ga0495637_0063802 | 3300046520 | Bacteria | 1504 |
| 475 | Ga0495637_0066387 | 3300046520 | Bacteria | 1466 |
| 476 | Ga0495637_0072596 | 3300046520 | Bacteria | 1385 |
| 477 | Ga0495637_0077275 | 3300046520 | Bacteria | 1332 |
| 478 | Ga0495637_0077636 | 3300046520 | Bacteria | 1328 |
| 479 | Ga0495637_0079422 | 3300046520 | Bacteria | 1310 |
| 480 | Ga0495637_0121861 | 3300046520 | Bacteria | 1002 |
| 481 | Ga0495637_0123024 | 3300046520 | Bacteria | 996 |
| 482 | Ga0495643_0001071 | 3300046522 | Bacteria | 27279 |
| 483 | Ga0495643_0003165 | 3300046522 | Bacteria | 12249 |
| 484 | Ga0495643_0004059 | 3300046522 | Bacteria | 10429 |
| 485 | Ga0495643_0018955 | 3300046522 | Bacteria | 3985 |
| 486 | Ga0495643_0026264 | 3300046522 | Bacteria | 3287 |
| 487 | Ga0495643_0122639 | 3300046522 | Bacteria | 1311 |
| 488 | Ga0495643_0168018 | 3300046522 | Bacteria | 1074 |
| 489 | Ga0495643_0168071 | 3300046522 | Bacteria | 1074 |
| 490 | Ga0495643_0172045 | 3300046522 | Bacteria | 1058 |
| 491 | Ga0495643_0243502 | 3300046522 | Bacteria | 842 |
| 492 | Ga0495644_0025574 | 3300046523 | Bacteria | 2240 |
| 493 | Ga0495644_0104367 | 3300046523 | Bacteria | 1073 |
| 494 | Ga0495644_0149879 | 3300046523 | Bacteria | 892 |
| 495 | Ga0495648_0021054 | 3300046524 | Bacteria | 4528 |
| 496 | Ga0495648_0050577 | 3300046524 | Bacteria | 2537 |
| 497 | Ga0495648_0069543 | 3300046524 | Bacteria | 2048 |
| 498 | Ga0495648_0087169 | 3300046524 | Bacteria | 1759 |
| 499 | Ga0495648_0119070 | 3300046524 | Bacteria | 1422 |
| 500 | Ga0495648_0147189 | 3300046524 | Bacteria | 1232 |
| 501 | Ga0495648_0151066 | 3300046524 | Bacteria | 1211 |
| 502 | Ga0495648_0178258 | 3300046524 | Bacteria | 1082 |
| 503 | Ga0495648_0189569 | 3300046524 | Bacteria | 1038 |
| 504 | Ga0495648_0191441 | 3300046524 | Bacteria | 1031 |
| 505 | Ga0495648_0197884 | 3300046524 | Bacteria | 1008 |
| 506 | Ga0495648_0200989 | 3300046524 | Bacteria | 997 |
| 507 | Ga0495648_0214973 | 3300046524 | Bacteria | 952 |
| 508 | Ga0495648_0241568 | 3300046524 | Bacteria | 877 |
| 509 | Ga0495666_0136343 | 3300046526 | Bacteria | 1145 |
| 510 | Ga0495666_0149988 | 3300046526 | Bacteria | 1084 |
| 511 | Ga0495666_0179354 | 3300046526 | Bacteria | 978 |
| 512 | Ga0495642_0003636 | 3300046528 | Bacteria | 6054 |
| 513 | Ga0495642_0006288 | 3300046528 | Bacteria | 4555 |
| 514 | Ga0495642_0008389 | 3300046528 | Bacteria | 3954 |
| 515 | Ga0495654_0004916 | 3300046530 | Bacteria | 7864 |
| 516 | Ga0495654_0012182 | 3300046530 | Bacteria | 4626 |
| 517 | Ga0495654_0077006 | 3300046530 | Bacteria | 1571 |
| 518 | Ga0495654_0098154 | 3300046530 | Bacteria | 1351 |
| 519 | Ga0495654_0104627 | 3300046530 | Bacteria | 1298 |
| 520 | Ga0495654_0105894 | 3300046530 | Bacteria | 1288 |
| 521 | Ga0495654_0114884 | 3300046530 | Bacteria | 1224 |
| 522 | Ga0495654_0130326 | 3300046530 | Bacteria | 1129 |
| 523 | Ga0495654_0135131 | 3300046530 | Bacteria | 1103 |
| 524 | Ga0495654_0140510 | 3300046530 | Bacteria | 1076 |
| 525 | Ga0495654_0143779 | 3300046530 | Bacteria | 1060 |
| 526 | Ga0495654_0148523 | 3300046530 | Bacteria | 1038 |
| 527 | Ga0495654_0150003 | 3300046530 | Bacteria | 1032 |
| 528 | Ga0495586_0145562 | 3300046535 | Bacteria | 1331 |
| 529 | Ga0495587_0018577 | 3300046536 | Bacteria | 4312 |
| 530 | Ga0495587_0018895 | 3300046536 | Bacteria | 4273 |
| 531 | Ga0495609_0000053 | 3300046538 | Bacteria | 149126 |
| 532 | Ga0495609_0010982 | 3300046538 | Bacteria | 4325 |
| 533 | Ga0495609_0011202 | 3300046538 | Bacteria | 4277 |
| 534 | Ga0495609_0013138 | 3300046538 | Bacteria | 3915 |
| 535 | Ga0495609_0077668 | 3300046538 | Bacteria | 1453 |
| 536 | Ga0495609_0088429 | 3300046538 | Bacteria | 1348 |
| 537 | Ga0495609_0099681 | 3300046538 | Bacteria | 1259 |
| 538 | Ga0495609_0115656 | 3300046538 | Bacteria | 1155 |
| 539 | Ga0495597_0011071 | 3300046542 | Bacteria | 4381 |
| 540 | Ga0495597_0011559 | 3300046542 | Bacteria | 4277 |
| 541 | Ga0495597_0047670 | 3300046542 | Bacteria | 1896 |
| 542 | Ga0495597_0093658 | 3300046542 | Bacteria | 1272 |
| 543 | Ga0495597_0096652 | 3300046542 | Bacteria | 1248 |
| 544 | Ga0495597_0098131 | 3300046542 | Bacteria | 1237 |
| 545 | Ga0495645_0139967 | 3300046543 | Bacteria | 1689 |
| 546 | Ga0495622_0000977 | 3300046557 | Bacteria | 15320 |
| 547 | Ga0495622_0012542 | 3300046557 | Bacteria | 3925 |
| 548 | Ga0495622_0028785 | 3300046557 | Bacteria | 2595 |
| 549 | Ga0495622_0094875 | 3300046557 | Bacteria | 1369 |
| 550 | Ga0495622_0096499 | 3300046557 | Bacteria | 1356 |
| 551 | Ga0495622_0149481 | 3300046557 | Bacteria | 1057 |
| 552 | Ga0495633_0001685 | 3300046558 | Bacteria | 16613 |
| 553 | Ga0495633_0013531 | 3300046558 | Bacteria | 4294 |
| 554 | Ga0495633_0105035 | 3300046558 | Bacteria | 1310 |
| 555 | Ga0495633_0105468 | 3300046558 | Bacteria | 1307 |
| 556 | Ga0495668_0016301 | 3300046616 | Bacteria | 4318 |
| 557 | Ga0495668_0203994 | 3300046616 | Bacteria | 1082 |
| 558 | Ga0495668_0251774 | 3300046616 | Bacteria | 967 |
| 559 | Ga0495634_0018644 | 3300046642 | Bacteria | 4936 |
| 560 | Ga0495634_0081021 | 3300046642 | Bacteria | 2123 |
| 561 | Ga0495634_0158158 | 3300046642 | Bacteria | 1430 |
| 562 | Ga0495611_0003180 | 3300046648 | Bacteria | 7271 |
| 563 | Ga0495611_0077708 | 3300046648 | Bacteria | 1522 |
| 564 | Ga0495611_0149241 | 3300046648 | Bacteria | 1091 |
| 565 | Ga0495611_0177873 | 3300046648 | Bacteria | 994 |
| 566 | Ga0495625_0012751 | 3300046660 | Bacteria | 6798 |
| 567 | Ga0495625_0068167 | 3300046660 | Bacteria | 2502 |
| 568 | Ga0495625_0076099 | 3300046660 | Bacteria | 2347 |
| 569 | Ga0495625_0098151 | 3300046660 | Bacteria | 2015 |
| 570 | Ga0495625_0103402 | 3300046660 | Bacteria | 1953 |
| 571 | Ga0495625_0140824 | 3300046660 | Bacteria | 1627 |
| 572 | Ga0495625_0267849 | 3300046660 | Bacteria | 1103 |
| 573 | Ga0495625_0295753 | 3300046660 | Bacteria | 1037 |
| 574 | Ga0495635_0147707 | 3300046663 | Bacteria | 1600 |
| 575 | Ga0495659_0004187 | 3300046664 | Bacteria | 4552 |
| 576 | Ga0495659_0026539 | 3300046664 | Bacteria | 1991 |
| 577 | Ga0495659_0058797 | 3300046664 | Bacteria | 1415 |
| 578 | Ga0495661_0019957 | 3300046665 | Bacteria | 4383 |
| 579 | Ga0495661_0059952 | 3300046665 | Bacteria | 2262 |
| 580 | Ga0495661_0085515 | 3300046665 | Bacteria | 1807 |
| 581 | Ga0495661_0144513 | 3300046665 | Bacteria | 1290 |
| 582 | Ga0495661_0205535 | 3300046665 | Bacteria | 1028 |
| 583 | Ga0495661_0225918 | 3300046665 | Bacteria | 967 |
| 584 | Ga0495588_0103922 | 3300046674 | Bacteria | 1494 |
| 585 | Ga0495588_0137420 | 3300046674 | Bacteria | 1290 |
| 586 | Ga0495588_0155397 | 3300046674 | Bacteria | 1209 |
| 587 | Ga0495588_0242557 | 3300046674 | Bacteria | 950 |
| 588 | Ga0495623_0016822 | 3300046679 | Bacteria | 4725 |
| 589 | Ga0495623_0116888 | 3300046679 | Bacteria | 1610 |
| 590 | Ga0495646_0014967 | 3300046680 | Bacteria | 4927 |
| 591 | Ga0495646_0039664 | 3300046680 | Bacteria | 2902 |
| 592 | Ga0495646_0067887 | 3300046680 | Bacteria | 2106 |
| 593 | Ga0495669_0001474 | 3300046684 | Bacteria | 9705 |
| 594 | Ga0495669_0091690 | 3300046684 | Bacteria | 1403 |
| 595 | Ga0495613_0137037 | 3300046689 | Bacteria | 1751 |
| 596 | Ga0495624_0006449 | 3300046690 | Bacteria | 8326 |
| 597 | Ga0495670_0011499 | 3300046691 | Bacteria | 4353 |
| 598 | Ga0495670_0050885 | 3300046691 | Bacteria | 2073 |
| 599 | Ga0495670_0059553 | 3300046691 | Bacteria | 1917 |
| 600 | Ga0495670_0106777 | 3300046691 | Bacteria | 1446 |
| 601 | Ga0495670_0127440 | 3300046691 | Bacteria | 1325 |
| 602 | Ga0495670_0143561 | 3300046691 | Bacteria | 1249 |
| 603 | Ga0495670_0153629 | 3300046691 | Bacteria | 1207 |
| 604 | Ga0495670_0173076 | 3300046691 | Bacteria | 1137 |
| 605 | Ga0495670_0233474 | 3300046691 | Bacteria | 978 |
| 606 | Ga0495671_0006003 | 3300046692 | Bacteria | 7059 |
| 607 | Ga0495671_0007411 | 3300046692 | Bacteria | 6258 |
| 608 | Ga0495671_0014510 | 3300046692 | Bacteria | 4238 |
| 609 | Ga0495671_0017911 | 3300046692 | Bacteria | 3766 |
| 610 | Ga0495671_0036791 | 3300046692 | Bacteria | 2478 |
| 611 | Ga0495671_0038097 | 3300046692 | Bacteria | 2431 |
| 612 | Ga0495671_0045950 | 3300046692 | Bacteria | 2184 |
| 613 | Ga0495671_0046769 | 3300046692 | Bacteria | 2163 |
| 614 | Ga0495671_0142367 | 3300046692 | Bacteria | 1168 |
| 615 | Ga0495671_0142590 | 3300046692 | Bacteria | 1167 |
| 616 | Ga0495671_0188700 | 3300046692 | Bacteria | 1001 |
| 617 | Ga0495649_0009233 | 3300046694 | Bacteria | 5875 |
| 618 | Ga0495649_0014456 | 3300046694 | Bacteria | 4522 |
| 619 | Ga0495649_0017231 | 3300046694 | Bacteria | 4079 |
| 620 | Ga0495649_0043916 | 3300046694 | Bacteria | 2439 |
| 621 | Ga0495649_0047213 | 3300046694 | Bacteria | 2342 |
| 622 | Ga0495649_0123088 | 3300046694 | Bacteria | 1370 |
| 623 | Ga0495649_0130573 | 3300046694 | Bacteria | 1325 |
| 624 | Ga0495649_0130575 | 3300046694 | Bacteria | 1325 |
| 625 | Ga0495649_0131104 | 3300046694 | Bacteria | 1322 |
| 626 | Ga0495649_0170365 | 3300046694 | Bacteria | 1139 |
| 627 | Ga0495649_0194323 | 3300046694 | Bacteria | 1055 |
| 628 | Ga0495649_0216614 | 3300046694 | Bacteria | 991 |
| 629 | Ga0495589_0000587 | 3300046794 | Bacteria | 24915 |
| 630 | Ga0495589_0012704 | 3300046794 | Bacteria | 4353 |
| 631 | Ga0495589_0016991 | 3300046794 | Bacteria | 3735 |
| 632 | Ga0495589_0029116 | 3300046794 | Bacteria | 2783 |
| 633 | Ga0495589_0062447 | 3300046794 | Bacteria | 1827 |
| 634 | Ga0495589_0078803 | 3300046794 | Bacteria | 1603 |
| 635 | Ga0495589_0125288 | 3300046794 | Bacteria | 1235 |
| 636 | Ga0495589_0145028 | 3300046794 | Bacteria | 1135 |
| 637 | Ga0495589_0198867 | 3300046794 | Bacteria | 946 |
| 638 | Ga0495589_0206208 | 3300046794 | Bacteria | 926 |
| 639 | Ga0495600_0040402 | 3300046809 | Bacteria | 3037 |
| 640 | Ga0495600_0159448 | 3300046809 | Bacteria | 1458 |
| 641 | Ga0495660_0015934 | 3300046810 | Bacteria | 4337 |
| 642 | Ga0495660_0019503 | 3300046810 | Bacteria | 3894 |
| 643 | Ga0495660_0027716 | 3300046810 | Bacteria | 3203 |
| 644 | Ga0495660_0034452 | 3300046810 | Bacteria | 2833 |
| 645 | Ga0495660_0046194 | 3300046810 | Bacteria | 2388 |
| 646 | Ga0495660_0050642 | 3300046810 | Bacteria | 2261 |
| 647 | Ga0495660_0051793 | 3300046810 | Bacteria | 2232 |
| 648 | Ga0495660_0058464 | 3300046810 | Bacteria | 2076 |
| 649 | Ga0495660_0062284 | 3300046810 | Bacteria | 2000 |
| 650 | Ga0495660_0087943 | 3300046810 | Bacteria | 1619 |
| 651 | Ga0495660_0098062 | 3300046810 | Bacteria | 1512 |
| 652 | Ga0495660_0120408 | 3300046810 | Bacteria | 1328 |
| 653 | Ga0495660_0147017 | 3300046810 | Bacteria | 1167 |
| 654 | Ga0495660_0228420 | 3300046810 | Bacteria | 873 |
| 655 | Ga0495581_0065187 | 3300047315 | Bacteria | 2105 |
| 656 | Ga0495581_0077586 | 3300047315 | Bacteria | 1922 |
| 657 | Ga0495604_0094943 | 3300047317 | Bacteria | 2203 |
| 658 | Ga0495604_0145477 | 3300047317 | Bacteria | 1689 |
| 659 | Ga0495604_0204040 | 3300047317 | Bacteria | 1369 |
| 660 | Ga0495636_0020095 | 3300047318 | Bacteria | 2689 |
| 661 | Ga0495674_0180437 | 3300047319 | Bacteria | 1758 |
| 662 | Ga0495674_0687037 | 3300047319 | Bacteria | 804 |
| 663 | Ga0495672_0002026 | 3300047320 | Bacteria | 19104 |
| 664 | Ga0495672_0007781 | 3300047320 | Bacteria | 8013 |
| 665 | Ga0495672_0023132 | 3300047320 | Bacteria | 4028 |
| 666 | Ga0495672_0023554 | 3300047320 | Bacteria | 3983 |
| 667 | Ga0495672_0148568 | 3300047320 | Bacteria | 1217 |
| 668 | Ga0495672_0155120 | 3300047320 | Bacteria | 1183 |
| 669 | Ga0495672_0158645 | 3300047320 | Bacteria | 1165 |
| 670 | Ga0495672_0161335 | 3300047320 | Bacteria | 1152 |
| 671 | Ga0495672_0178683 | 3300047320 | Bacteria | 1076 |
| 672 | Ga0495672_0194273 | 3300047320 | Bacteria | 1018 |
| 673 | Ga0495672_0201399 | 3300047320 | Bacteria | 995 |
| 674 | Ga0495676_0066839 | 3300047321 | Bacteria | 2783 |
| 675 | Ga0495676_0083234 | 3300047321 | Bacteria | 2418 |
| 676 | Ga0495680_0032796 | 3300047322 | Bacteria | 4211 |
| 677 | Ga0495680_0073016 | 3300047322 | Bacteria | 2608 |
| 678 | Ga0495680_0194825 | 3300047322 | Bacteria | 1456 |
| 679 | Ga0495680_0330804 | 3300047322 | Bacteria | 1064 |
| 680 | Ga0495683_0010503 | 3300047323 | Bacteria | 4889 |
| 681 | Ga0495683_0012509 | 3300047323 | Bacteria | 4453 |
| 682 | Ga0495683_0054876 | 3300047323 | Bacteria | 1984 |
| 683 | Ga0495683_0100097 | 3300047323 | Bacteria | 1394 |
| 684 | Ga0495683_0119608 | 3300047323 | Bacteria | 1251 |
| 685 | Ga0495683_0124530 | 3300047323 | Bacteria | 1220 |
| 686 | Ga0495683_0129457 | 3300047323 | Bacteria | 1191 |
| 687 | Ga0495683_0137290 | 3300047323 | Bacteria | 1148 |
| 688 | Ga0495683_0162163 | 3300047323 | Bacteria | 1033 |
| 689 | Ga0495683_0191192 | 3300047323 | Bacteria | 928 |
| 690 | Ga0495687_013599 | 3300047443 | Bacteria | 4235 |
| 691 | Ga0495687_081413 | 3300047443 | Bacteria | 1266 |
| 692 | Ga0495675_0064234 | 3300047444 | Bacteria | 2322 |
| 693 | Ga0495677_0028720 | 3300047445 | Bacteria | 2021 |
| 694 | Ga0495679_009646 | 3300047446 | Bacteria | 3846 |
| 695 | Ga0495679_017816 | 3300047446 | Bacteria | 2535 |
| 696 | Ga0495679_019986 | 3300047446 | Bacteria | 2341 |
| 697 | Ga0495679_054116 | 3300047446 | Bacteria | 1196 |
| 698 | Ga0495679_057625 | 3300047446 | Bacteria | 1148 |
| 699 | Ga0495679_063285 | 3300047446 | Bacteria | 1080 |
| 700 | Ga0495679_083136 | 3300047446 | Bacteria | 906 |
| 701 | Ga0495685_022846 | 3300047447 | Bacteria | 2152 |
| 702 | Ga0495685_026608 | 3300047447 | Bacteria | 1990 |
| 703 | Ga0495673_0005030 | 3300047469 | Bacteria | 8098 |
| 704 | Ga0495673_0009780 | 3300047469 | Bacteria | 5272 |
| 705 | Ga0495673_0012319 | 3300047469 | Bacteria | 4546 |
| 706 | Ga0495673_0013582 | 3300047469 | Bacteria | 4270 |
| 707 | Ga0495673_0027680 | 3300047469 | Bacteria | 2693 |
| 708 | Ga0495673_0065791 | 3300047469 | Bacteria | 1539 |
| 709 | Ga0495673_0075075 | 3300047469 | Bacteria | 1413 |
| 710 | Ga0495673_0077049 | 3300047469 | Bacteria | 1389 |
| 711 | Ga0495673_0079534 | 3300047469 | Bacteria | 1360 |
| 712 | Ga0495673_0088677 | 3300047469 | Bacteria | 1267 |
| 713 | Ga0495673_0105068 | 3300047469 | Bacteria | 1136 |
| 714 | Ga0495673_0111898 | 3300047469 | Bacteria | 1090 |
| 715 | Ga0495673_0114218 | 3300047469 | Bacteria | 1076 |
| 716 | Ga0495673_0119922 | 3300047469 | Bacteria | 1042 |
| 717 | Ga0495673_0119949 | 3300047469 | Bacteria | 1042 |
| 718 | Ga0495673_0129550 | 3300047469 | Bacteria | 992 |
| 719 | Ga0495673_0174086 | 3300047469 | Bacteria | 818 |
| 720 | Ga0495681_0007814 | 3300047470 | Bacteria | 6772 |
| 721 | Ga0495681_0013783 | 3300047470 | Bacteria | 4674 |
| 722 | Ga0495681_0016258 | 3300047470 | Bacteria | 4178 |
| 723 | Ga0495681_0017009 | 3300047470 | Bacteria | 4053 |
| 724 | Ga0495681_0018090 | 3300047470 | Bacteria | 3891 |
| 725 | Ga0495681_0059413 | 3300047470 | Bacteria | 1768 |
| 726 | Ga0495681_0084372 | 3300047470 | Bacteria | 1412 |
| 727 | Ga0495681_0091558 | 3300047470 | Bacteria | 1342 |
| 728 | Ga0495681_0130960 | 3300047470 | Bacteria | 1067 |
| 729 | Ga0495681_0136506 | 3300047470 | Bacteria | 1039 |
| 730 | Ga0495684_0063092 | 3300047471 | Bacteria | 2817 |
| 731 | Ga0495684_0100174 | 3300047471 | Bacteria | 2190 |
| 732 | Ga0495686_0011348 | 3300047472 | Bacteria | 6280 |
| 733 | Ga0495686_0025100 | 3300047472 | Bacteria | 3908 |
| 734 | Ga0495686_0089889 | 3300047472 | Bacteria | 1865 |
| 735 | Ga0495686_0211311 | 3300047472 | Bacteria | 1108 |
| 736 | Ga0495593_0059867 | 3300047673 | Bacteria | 1994 |
| 737 | Ga0495593_0077007 | 3300047673 | Bacteria | 1727 |
| 738 | Ga0495593_0124863 | 3300047673 | Bacteria | 1308 |
| 739 | Ga0495593_0165503 | 3300047673 | Bacteria | 1115 |
| 740 | Ga0495602_0074105 | 3300048088 | Bacteria | 2894 |
| 741 | Ga0495626_0001849 | 3300048091 | Bacteria | 15889 |
| 742 | Ga0495626_0002063 | 3300048091 | Bacteria | 14667 |
| 743 | Ga0495626_0012097 | 3300048091 | Bacteria | 4539 |
| 744 | Ga0495626_0013302 | 3300048091 | Bacteria | 4277 |
| 745 | Ga0495626_0028334 | 3300048091 | Bacteria | 2716 |
| 746 | Ga0495626_0081221 | 3300048091 | Bacteria | 1439 |
| 747 | Ga0495626_0109319 | 3300048091 | Bacteria | 1198 |
| 748 | Ga0495626_0113131 | 3300048091 | Bacteria | 1173 |
| 749 | Ga0495626_0118812 | 3300048091 | Bacteria | 1138 |
| 750 | Ga0495626_0122448 | 3300048091 | Bacteria | 1116 |
| 751 | Ga0495626_0129512 | 3300048091 | Bacteria | 1078 |
| 752 | Ga0495626_0163068 | 3300048091 | Bacteria | 933 |
| 753 | Ga0496101_0472887 | 3300048904 | Bacteria | 989 |
| 754 | Ga0496102_0029602 | 3300048905 | Bacteria | 4900 |
| 755 | Ga0496103_0283973 | 3300048906 | Bacteria | 1064 |
| 756 | Ga0496104_0536594 | 3300048907 | Bacteria | 1081 |
| 757 | Ga0496105_0401947 | 3300048908 | Bacteria | 1087 |
| 758 | Ga0496107_0386880 | 3300048910 | Bacteria | 1040 |
| 759 | Ga0496110_0254188 | 3300048913 | Bacteria | 1599 |
| 760 | Ga0496114_0284253 | 3300048917 | Bacteria | 1459 |
| 761 | Ga0496116_0004746 | 3300048919 | Bacteria | 12836 |
| 762 | Ga0496116_0016123 | 3300048919 | Bacteria | 5866 |
| 763 | Ga0496116_0087859 | 3300048919 | Bacteria | 1901 |
| 764 | Ga0496116_0134950 | 3300048919 | Bacteria | 1399 |
| 765 | Ga0496116_0202202 | 3300048919 | Bacteria | 1038 |
| 766 | Ga0496117_0033142 | 3300048920 | Bacteria | 3910 |
| 767 | Ga0496117_0078731 | 3300048920 | Bacteria | 2174 |
| 768 | Ga0496117_0095080 | 3300048920 | Bacteria | 1905 |
| 769 | Ga0496117_0101411 | 3300048920 | Bacteria | 1820 |
| 770 | Ga0496117_0235647 | 3300048920 | Bacteria | 1008 |
| 771 | Ga0496117_0244619 | 3300048920 | Bacteria | 982 |
| 772 | Ga0496118_0037568 | 3300048921 | Bacteria | 3895 |
| 773 | Ga0496118_0087797 | 3300048921 | Bacteria | 2155 |
| 774 | Ga0496118_0107116 | 3300048921 | Bacteria | 1867 |
| 775 | Ga0496118_0205148 | 3300048921 | Bacteria | 1163 |
| 776 | Ga0496119_0065278 | 3300048922 | Bacteria | 2156 |
| 777 | Ga0496119_0138328 | 3300048922 | Bacteria | 1318 |
| 778 | Ga0496119_0235092 | 3300048922 | Bacteria | 930 |
| 779 | Ga0496120_0103528 | 3300048923 | Bacteria | 1499 |
| 780 | Ga0496120_0210348 | 3300048923 | Bacteria | 935 |
| 781 | Ga0496121_0047275 | 3300048924 | Bacteria | 3673 |
| 782 | Ga0496121_0109908 | 3300048924 | Bacteria | 2104 |
| 783 | Ga0496121_0232656 | 3300048924 | Bacteria | 1289 |
| 784 | Ga0496121_0288765 | 3300048924 | Bacteria | 1118 |
| 785 | Ga0496122_0102453 | 3300048925 | Bacteria | 1908 |
| 786 | Ga0496122_0212581 | 3300048925 | Bacteria | 1118 |
| 787 | Ga0496122_0216223 | 3300048925 | Bacteria | 1104 |
| 788 | Ga0496123_0175852 | 3300048926 | Bacteria | 1123 |
| 789 | Ga0496123_0182240 | 3300048926 | Bacteria | 1095 |
| 790 | Ga0496123_0240857 | 3300048926 | Bacteria | 898 |
| 791 | Ga0496124_0000120 | 3300048927 | Bacteria | 163899 |
| 792 | Ga0496124_0089046 | 3300048927 | Bacteria | 2521 |
| 793 | Ga0496124_0158040 | 3300048927 | Bacteria | 1770 |
| 794 | Ga0496124_0213028 | 3300048927 | Bacteria | 1460 |
| 795 | Ga0496124_0338096 | 3300048927 | Bacteria | 1070 |
| 796 | Ga0496124_0509605 | 3300048927 | Bacteria | 804 |
| 797 | Ga0496125_0052982 | 3300048928 | Bacteria | 3331 |
| 798 | Ga0496125_0063050 | 3300048928 | Bacteria | 2958 |
| 799 | Ga0496125_0301350 | 3300048928 | Bacteria | 981 |
| 800 | Ga0496125_0304538 | 3300048928 | Bacteria | 974 |
| 801 | Ga0496125_0309874 | 3300048928 | Bacteria | 962 |
| 802 | Ga0496126_0212624 | 3300048929 | Bacteria | 1627 |
| 803 | Ga0495678_012258 | 3300049459 | Bacteria | 4068 |
| 804 | Ga0495678_030258 | 3300049459 | Bacteria | 2266 |
| 805 | Ga0495678_036418 | 3300049459 | Bacteria | 2007 |
| 806 | Ga0495678_056602 | 3300049459 | Bacteria | 1489 |
| 807 | Ga0495678_059030 | 3300049459 | Bacteria | 1447 |
| 808 | Ga0495678_062139 | 3300049459 | Bacteria | 1399 |
| 809 | Ga0495678_070782 | 3300049459 | Bacteria | 1279 |
| 810 | Ga0495678_089560 | 3300049459 | Bacteria | 1086 |
| 811 | Ga0495678_091613 | 3300049459 | Bacteria | 1069 |
| 812 | Ga0495678_093561 | 3300049459 | Bacteria | 1053 |
| 813 | Ga0495678_100429 | 3300049459 | Bacteria | 1003 |
| 814 | Ga0495678_100504 | 3300049459 | Bacteria | 1002 |
| 815 | Ga0495678_102294 | 3300049459 | Bacteria | 990 |
| 816 | Ga0495678_103272 | 3300049459 | Bacteria | 984 |
| 817 | Ga0495678_108119 | 3300049459 | Bacteria | 952 |
| 818 | Ga0495682_0007794 | 3300049460 | Bacteria | 4241 |
| 819 | Ga0495682_0020205 | 3300049460 | Bacteria | 2500 |
| 820 | Ga0495682_0025638 | 3300049460 | Bacteria | 2193 |
| 821 | Ga0495682_0081420 | 3300049460 | Bacteria | 1164 |
| 822 | Ga0495682_0098053 | 3300049460 | Bacteria | 1052 |
| 823 | Ga0495682_0103060 | 3300049460 | Bacteria | 1023 |
| 824 | Ga0495682_0145320 | 3300049460 | Bacteria | 846 |
| 825 | Ga0501222_009583 | 3300049662 | Bacteria | 1281 |
| 826 | Ga0501227_025523 | 3300049665 | Bacteria | 1386 |
| 827 | Ga0501241_005307 | 3300049758 | Bacteria | 2406 |
| 828 | Ga0501226_000002 | 3300049853 | Bacteria | 426935 |
| 829 | Ga0501226_006651 | 3300049853 | Bacteria | 1308 |
| 830 | nmdc:mga03683_146217_c1 | 3300050489 | Bacteria | 1065 |
| 831 | nmdc:mga03683_208505_c1 | 3300050489 | Bacteria | 898 |
| 832 | nmdc:mga03683_9895_c1 | 3300050489 | Bacteria | 3405 |
| 833 | nmdc:mga03n38_248732_c1 | 3300050490 | Bacteria | 938 |
| 834 | nmdc:mga00v17_361873_c1 | 3300050491 | Bacteria | 943 |
| 835 | nmdc:mga00v17_90411_c1 | 3300050491 | Bacteria | 1922 |
| 836 | Ga0500572_011163 | 3300053111 | Bacteria | 2164 |
| 837 | Ga0500577_0101793 | 3300053142 | Bacteria | 1175 |
| 838 | Ga0500586_038340 | 3300053145 | Bacteria | 1614 |
| 839 | 2511254751 | 2511231004 | Bacteria | 6669789 |
| 840 | 2511265563 | 2511231006 | Bacteria | 6794709 |
| 841 | 2511271108 | 2511231007 | Bacteria | 6306603 |
| 842 | 2511280547 | 2511231008 | Bacteria | 6624100 |
| 843 | 2511297953 | 2511231011 | Bacteria | 6149768 |
| 844 | 2511302376 | 2511231012 | Bacteria | 6738011 |
| 845 | 2511315226 | 2511231014 | Bacteria | 6462302 |
| 846 | 2511320784 | 2511231015 | Bacteria | 6598026 |
| 847 | 2511326061 | 2511231016 | Bacteria | 6704427 |
| 848 | 2511331017 | 2511231017 | Bacteria | 6503007 |
| 849 | 2511336365 | 2511231018 | Bacteria | 6436256 |
| 850 | 2511345729 | 2511231019 | Bacteria | 6520662 |
| 851 | 2511349073 | 2511231020 | Bacteria | 6115223 |
| 852 | 2511360686 | 2511231022 | Bacteria | 6719296 |
| 853 | 2511368597 | 2511231023 | Bacteria | 6808468 |
| 854 | 2511411285 | 2511231031 | Bacteria | 6558529 |
| 855 | 2512325925 | 2512047018 | Bacteria | 6663241 |
| 856 | 2554818093 | 2554235132 | Bacteria | 6772433 |
| 857 | 2583789834 | 2582580891 | Bacteria | 6800976 |
| 858 | 2597855632 | 2597489887 | Bacteria | 6666321 |
| 859 | 2599398877 | 2599185167 | Bacteria | 6353609 |
| 860 | 2599450932 | 2599185179 | Bacteria | 6611171 |
| 861 | 2599485534 | 2599185185 | Bacteria | 6652270 |
| 862 | 2599514122 | 2599185190 | Bacteria | 6285678 |
| 863 | 2599518723 | 2599185191 | Bacteria | 6297582 |
| 864 | 2599806663 | 2599185257 | Bacteria | 6492581 |
| 865 | 2599893543 | 2599185290 | Bacteria | 6289611 |
| 866 | 2599943629 | 2599185302 | Bacteria | 5954930 |
| 867 | 2599955939 | 2599185304 | Bacteria | 5951361 |
| 868 | 2599984633 | 2599185309 | Bacteria | 5969593 |
| 869 | 2599991214 | 2599185310 | Bacteria | 6014457 |
| 870 | 2599994894 | 2599185311 | Bacteria | 6354990 |
| 871 | 2600002255 | 2599185312 | Bacteria | 5912071 |
| 872 | 2600023924 | 2599185316 | Bacteria | 6320029 |
| 873 | 2600032667 | 2599185317 | Bacteria | 6435722 |
| 874 | 2600034717 | 2599185318 | Bacteria | 6961590 |
| 875 | 2600044888 | 2599185319 | Bacteria | 6637840 |
| 876 | 2600048025 | 2599185320 | Bacteria | 5963263 |
| 877 | 2600061274 | 2599185322 | Bacteria | 6763055 |
| 878 | 2600068165 | 2599185323 | Bacteria | 6688755 |
| 879 | 2600077617 | 2599185325 | Bacteria | 6324919 |
| 880 | 2600362192 | 2600254930 | Bacteria | 6431253 |
| 881 | 2600364912 | 2600254931 | Bacteria | 6734225 |
| 882 | 2601627217 | 2600255283 | Bacteria | 6061572 |
| 883 | 2601797803 | 2600255318 | Bacteria | 6383414 |
| 884 | 2606076714 | 2603880185 | Bacteria | 6379190 |
| 885 | 2606128872 | 2603880199 | Bacteria | 6377649 |
| 886 | 2608380605 | 2606217733 | Bacteria | 6360972 |
| 887 | 2624478191 | 2623620443 | Bacteria | 6427864 |
| 888 | 2624489734 | 2623620446 | Bacteria | 6500345 |
| 889 | 2643840950 | 2643221565 | Bacteria | 6216018 |
| 890 | 2643954942 | 2643221589 | Bacteria | 6250934 |
| 891 | 2644024582 | 2643221602 | Bacteria | 6249926 |
| 892 | 2644186092 | 2643221633 | Bacteria | 6733554 |
| 893 | 2652547308 | 2651869719 | Bacteria | 6047974 |
| 894 | 2671127293 | 2667528176 | Bacteria | 6724917 |
| 895 | 2671772314 | 2671180172 | Bacteria | 6495783 |
| 896 | 2678260946 | 2675903515 | Bacteria | 6580491 |
| 897 | 2715749178 | 2713897148 | Bacteria | 5883533 |
| 898 | 2715759529 | 2713897149 | Bacteria | 6506249 |
| 899 | 2718632131 | 2718217725 | Bacteria | 5758958 |
| 900 | 2729146476 | 2728369097 | Bacteria | 4333476 |
| 901 | 2739197998 | 2738543004 | Bacteria | 6381073 |
| 902 | 2739260339 | 2738543015 | Bacteria | 6750701 |
| 903 | 2739286974 | 2738543020 | Bacteria | 5718238 |
| 904 | 2739292287 | 2738543021 | Bacteria | 5718241 |
| 905 | 2739311251 | 2738543025 | Bacteria | 6600348 |
| 906 | 2743735049 | 2740892503 | Bacteria | 6855563 |
| 907 | 2745006258 | 2744054620 | Bacteria | 6551379 |
| 908 | 2774119589 | 2773857670 | Bacteria | 6407454 |
| 909 | 2774134708 | 2773857673 | Bacteria | 6513460 |
| 910 | 2784261077 | 2784132063 | Bacteria | 6262788 |
| 911 | 2784316336 | 2784132072 | Bacteria | 6596533 |
| 912 | 2808855899 | 2808606361 | Bacteria | 6136259 |
| 913 | 2808905464 | 2808606373 | Bacteria | 4423627 |
| 914 | 2808922786 | 2808606376 | Bacteria | 6248667 |
| 915 | 2808932150 | 2808606377 | Bacteria | 6646337 |
| 916 | 2808935979 | 2808606378 | Bacteria | 6177535 |
| 917 | 2808939714 | 2808606379 | Bacteria | 5022697 |
| 918 | 2808944473 | 2808606380 | Bacteria | 6248705 |
| 919 | 2808954249 | 2808606381 | Bacteria | 6646461 |
| 920 | 2808955829 | 2808606382 | Bacteria | 6841132 |
| 921 | 2808964524 | 2808606383 | Bacteria | 6138645 |
| 922 | 2808999412 | 2808606389 | Bacteria | 6138126 |
| 923 | 2809217949 | 2808606445 | Bacteria | 6057339 |
| 924 | 2819657199 | 2818991456 | Bacteria | 6123676 |
| 925 | 2825654297 | 2825651385 | Bacteria | 6715909 |
| 926 | 2826582476 | 2826581358 | Bacteria | 5963467 |
| 927 | 2842817682 | 2842815866 | Bacteria | 5947510 |
| 928 | 2842832339 | 2842826826 | Bacteria | 5974129 |
| 929 | 2842834132 | 2842832357 | Bacteria | 5959113 |
| 930 | 2842838596 | 2842837860 | Bacteria | 6066181 |
| 931 | 2842846393 | 2842843487 | Bacteria | 6004777 |
| 932 | 2842851636 | 2842849001 | Bacteria | 5924277 |
| 933 | 2842858765 | 2842854478 | Bacteria | 6143501 |
| 934 | 2844667869 | 2844665904 | Bacteria | 6817974 |
| 935 | 2852660482 | 2852657418 | Bacteria | 6472974 |
| 936 | 2860343669 | 2860339153 | Bacteria | 6846989 |
| 937 | 2878030135 | 2878029506 | Bacteria | 6418441 |
| 938 | 2880231082 | 2880230671 | Bacteria | 6140320 |
| 939 | 2904519541 | 2904518522 | Bacteria | 6068986 |
| 940 | 2904552274 | 2904550169 | Bacteria | 6221258 |
| 941 | 2919066183 | 2919063839 | Bacteria | 6302690 |
| 942 | 2919389805 | 2919385768 | Bacteria | 5897293 |
| 943 | 2919459957 | 2919456309 | Bacteria | 6586567 |
| 944 | 2919486847 | 2919481497 | Bacteria | 6907839 |
| 945 | 2919488737 | 2919487758 | Bacteria | 5929766 |
| 946 | 2919698988 | 2919697872 | Bacteria | 6553725 |
| 947 | 2923154043 | 2923153595 | Bacteria | 6870622 |
| 948 | 2929144774 | 2929144301 | Bacteria | 6622272 |
| 949 | 2931391353 | 2931390751 | Bacteria | 6273349 |
| 950 | 2931398807 | 2931396565 | Bacteria | 7251677 |
| 951 | 2939641069 | 2939636861 | Bacteria | 6297853 |
| 952 | 2946028616 | 2946027586 | Bacteria | 6049274 |
| 953 | 2969304930 | 2969304461 | Bacteria | 6601805 |
| 954 | 2974293377 | 2974289157 | Bacteria | 6080362 |
| 955 | 2984292016 | 2984286254 | Bacteria | 6702062 |
| 956 | 2988732166 | 2988728565 | Bacteria | 6124362 |
| 957 | 2998140426 | 2998139840 | Bacteria | 6073514 |
| 958 | 3007398056 | 3007395558 | Bacteria | 6755444 |
| 959 | 3007517865 | 3007511990 | Bacteria | 6481491 |
| 960 | 3007615200 | 3007614139 | Bacteria | 6053559 |
| 961 | 3007625017 | 3007619802 | Bacteria | 6411688 |
| 962 | 3007721193 | 3007718800 | Bacteria | 5971527 |
| 963 | 3007859671 | 3007855910 | Bacteria | 5637581 |
| 964 | 3007864361 | 3007861166 | Bacteria | 6045338 |
| 965 | 3007872069 | 3007866637 | Bacteria | 5899198 |
| 966 | 8011352517 | 8011350971 | Bacteria | 6158957 |
| 967 | 8015688292 | 8015687852 | Bacteria | 6613826 |
| 968 | 8019770279 | 8019769354 | Bacteria | 6924660 |
| 969 | 8019777308 | 8019775933 | Bacteria | 6858656 |
| 970 | 8054503929 | 8054503363 | Bacteria | 6101651 |
| 971 | 8055771390 | 8055770955 | Bacteria | 6827675 |
| 972 | 8056126434 | 8056125926 | Bacteria | 6228218 |
| 973 | 8056142679 | 8056137416 | Bacteria | 6147080 |
| 974 | 8056143700 | 8056143049 | Bacteria | 6307666 |
| 975 | 8056158484 | 8056155041 | Bacteria | 6486948 |
| 976 | 8056170619 | 8056166840 | Bacteria | 5820959 |
| 977 | 8056176732 | 8056172158 | Bacteria | 6133900 |
| 978 | 8056183081 | 8056177738 | Bacteria | 6748268 |
| 979 | 8056572292 | 8056569372 | Bacteria | 5997322 |
| 980 | 8057802681 | 8057798959 | Bacteria | 6713499 |
| 981 | Ga0439451_010326 | |||
| 982 | MRS2a_Contig_841 | |||
| 983 | SwRhRL2b_contig_7644 | |||
| 984 | MBSR1b_contig_7640429 | |||
| 985 | JGI25162J39368_1000098 | |||
| 986 | JGI25163J39215_1001163 | |||
| 987 | JGI25164J39214_1000076 | |||
| 988 | JGI25165J46597_1000180 | |||
| 989 | Ga0055536_1001506 | |||
| 990 | Ga0055536_1004111 | |||
| 991 | Ga0055536_1017763 | |||
| 992 | Ga0055530_10000677 | |||
| 993 | Ga0055530_10001490 | |||
| 994 | Ga0055540_1000217 | |||
| 995 | Ga0055540_1001429 | |||
| 996 | Ga0055531_10000238 | |||
| 997 | Ga0055531_10000275 | |||
| 998 | Ga0065714_10000623 | |||
| 999 | Ga0065714_10014927 | |||
| 1000 | Ga0065714_10033938 | |||
| 1001 | Ga0065714_10120319 | |||
| 1002 | Ga0065714_10158496 | |||
| 1003 | Ga0065704_10070786 | |||
| 1004 | Ga0065704_10111549 | |||
| 1005 | Ga0065712_10068398 | |||
| 1006 | Ga0065715_10006941 | |||
| 1007 | Ga0070669_100000221 | |||
| 1008 | Ga0070669_100004459 | |||
| 1009 | Ga0070669_100217126 | |||
| 1010 | Ga0070662_100001883 | |||
| 1011 | Ga0068853_100000089 | |||
| 1012 | Ga0070665_100154401 | |||
| 1013 | Ga0070664_100007327 | |||
| 1014 | Ga0070664_100446119 | |||
| 1015 | Ga0068851_10000024 | |||
| 1016 | Ga0075364_10254605 | |||
| 1017 | Ga0075364_10273311 | |||
| 1018 | Ga0075432_10073565 | |||
| 1019 | Ga0075432_10091394 | |||
| 1020 | Ga0075432_10092135 | |||
| 1021 | Ga0075362_10115415 | |||
| 1022 | Ga0075362_10124473 | |||
| 1023 | Ga0075436_100262996 | |||
| 1024 | Ga0075436_100276046 | |||
| 1025 | Ga0075436_100381306 | |||
| 1026 | Ga0079104_1000508 | |||
| 1027 | Ga0079104_1000732 | |||
| 1028 | Ga0099826_10010490 | |||
| 1029 | Ga0105251_10076327 | |||
| 1030 | Ga0105251_10103057 | |||
| 1031 | Ga0105251_10130791 | |||
| 1032 | Ga0105244_10056276 | |||
| 1033 | Ga0105244_10057561 | |||
| 1034 | Ga0105244_10084700 | |||
| 1035 | Ga0105244_10133019 | |||
| 1036 | Ga0105244_10147702 | |||
| 1037 | Ga0105244_10148770 | |||
| 1038 | Ga0105250_10083280 | |||
| 1039 | Ga0105250_10128568 | |||
| 1040 | Ga0105243_10000930 | |||
| 1041 | Ga0105243_10130877 | |||
| 1042 | Ga0105242_10028253 | |||
| 1043 | Ga0105248_10018503 | |||
| 1044 | Ga0105246_10000305 | |||
| 1045 | Ga0105246_10013235 | |||
| 1046 | Ga0157345_1000263 | |||
| 1047 | Ga0157373_10075583 | |||
| 1048 | Ga0157373_10212130 | |||
| 1049 | Ga0157373_10276354 | |||
| 1050 | Ga0157373_10346967 | |||
| 1051 | Ga0157371_10019663 | |||
| 1052 | Ga0157371_10026569 | |||
| 1053 | Ga0157371_10270950 | |||
| 1054 | Ga0157370_10044961 | |||
| 1055 | Ga0157370_10404382 | |||
| 1056 | Ga0157370_10416931 | |||
| 1057 | Ga0157370_10418905 | |||
| 1058 | Ga0157370_10686947 | |||
| 1059 | Ga0157369_10043460 | |||
| 1060 | Ga0157369_10064964 | |||
| 1061 | Ga0163162_10002804 | |||
| 1062 | Ga0163162_10146414 | |||
| 1063 | Ga0163162_10660772 | |||
| 1064 | Ga0157372_10077386 | |||
| 1065 | Ga0157375_10695628 | |||
| 1066 | Ga0157375_10709928 | |||
| 1067 | Ga0157375_10763064 | |||
| 1068 | Ga0157375_11124619 | |||
| 1069 | Ga0182008_10015018 | |||
| 1070 | Ga0182008_10021981 | |||
| 1071 | Ga0182008_10028041 | |||
| 1072 | Ga0182008_10124813 | |||
| 1073 | Ga0182008_10164042 | |||
| 1074 | Ga0182008_10196968 | |||
| 1075 | Ga0182008_10199696 | |||
| 1076 | Ga0182006_1008138 | |||
| 1077 | Ga0182006_1012068 | |||
| 1078 | Ga0182006_1038238 | |||
| 1079 | Ga0182006_1072633 | |||
| 1080 | Ga0182006_1082877 | |||
| 1081 | Ga0182006_1083870 | |||
| 1082 | Ga0182005_1020208 | |||
| 1083 | Ga0182005_1023545 | |||
| 1084 | Ga0182005_1046868 | |||
| 1085 | Ga0182005_1054986 | |||
| 1086 | Ga0163161_10026663 | |||
| 1087 | Ga0163161_10050945 | |||
| 1088 | Ga0163161_10148210 | |||
| 1089 | Ga0163161_10278217 | |||
| 1090 | Ga0163161_10368722 | |||
| 1091 | Ga0209760_100037 | |||
| 1092 | Ga0209563_100703 | |||
| 1093 | Ga0207427_100016 | |||
| 1094 | Ga0209437_100011 | |||
| 1095 | Ga0209233_1000019 | |||
| 1096 | Ga0209675_1007380 | |||
| 1097 | Ga0209676_1000025 | |||
| 1098 | Ga0209676_1000032 | |||
| 1099 | Ga0209676_1000318 | |||
| 1100 | Ga0209050_1000025 | |||
| 1101 | Ga0209050_1000381 | |||
| 1102 | Ga0209050_1000981 | |||
| 1103 | Ga0209051_1000026 | |||
| 1104 | Ga0209051_1000299 | |||
| 1105 | Ga0209257_1000034 | |||
| 1106 | Ga0207656_10000008 | |||
| 1107 | Ga0207696_1000057 | |||
| 1108 | Ga0207696_1002043 | |||
| 1109 | Ga0207696_1004054 | |||
| 1110 | Ga0207655_1001265 | |||
| 1111 | Ga0207655_1001320 | |||
| 1112 | Ga0207655_1002555 | |||
| 1113 | Ga0207655_1011490 | |||
| 1114 | Ga0207655_1017780 | |||
| 1115 | Ga0207655_1034389 | |||
| 1116 | Ga0207655_1064697 | |||
| 1117 | Ga0207713_1001759 | |||
| 1118 | Ga0207713_1002871 | |||
| 1119 | Ga0207713_1006851 | |||
| 1120 | Ga0207713_1015274 | |||
| 1121 | Ga0207713_1053449 | |||
| 1122 | Ga0207649_10000001 | |||
| 1123 | Ga0207681_10001569 | |||
| 1124 | Ga0207706_10000069 | |||
| 1125 | Ga0207706_10013390 | |||
| 1126 | Ga0207709_10000022 | |||
| 1127 | Ga0207709_10105049 | |||
| 1128 | Ga0207711_10019450 | |||
| 1129 | Ga0207679_10000011 | |||
| 1130 | Ga0207639_10000099 | |||
| 1131 | Ga0209281_1000026 | |||
| 1132 | Ga0209281_1000033 | |||
| 1133 | Ga0209281_1006372 | |||
| 1134 | Ga0209983_1007167 | |||
| 1135 | Ga0209282_1016451 | |||
| 1136 | Ga0207428_10128566 | |||
| 1137 | Ga0207428_10238065 | |||
| 1138 | Ga0207428_10339048 | |||
| 1139 | Ga0207428_10340626 | |||
| 1140 | Ga0207428_10349722 | |||
| 1141 | Ga0268266_10045723 | |||
| 1142 | Ga0307517_10181803 | |||
| 1143 | Ga0316178_1083481 | |||
| 1144 | Ga0316183_1115597 | |||
| 1145 | Ga0316181_1132780 | |||
| 1146 | Ga0307408_100409023 | |||
| 1147 | Ga0307408_100411689 | |||
| 1148 | Ga0307516_10173178 | |||
| 1149 | Ga0307516_10208998 | |||
| 1150 | Ga0307405_10241772 | |||
| 1151 | Ga0307405_10522412 | |||
| 1152 | Ga0307413_10039291 | |||
| 1153 | Ga0307407_10042457 | |||
| 1154 | Ga0307412_10228383 | |||
| 1155 | Ga0307412_10496134 | |||
| 1156 | Ga0307409_100699697 | |||
| 1157 | Ga0307416_100700953 | |||
| 1158 | Ga0307416_100726611 | |||
| 1159 | Ga0307414_10002243 | |||
| 1160 | Ga0307414_10550163 | |||
| 1161 | Ga0307414_10574763 | |||
| 1162 | Ga0307411_10397320 | |||
| 1163 | Ga0307411_10444869 | |||
| 1164 | Ga0307510_10047609 | |||
| 1165 | Ga0237819_00952 | |||
| 1166 | Ga0439438_000783 | |||
| 1167 | Ga0439438_004585 | |||
| 1168 | Ga0439438_006548 | |||
| 1169 | Ga0439438_006674 | |||
| 1170 | Ga0439438_009409 | |||
| 1171 | Ga0439438_018774 | |||
| 1172 | Ga0439447_012503 | |||
| 1173 | Ga0439447_014518 | |||
| 1174 | Ga0439447_020217 | |||
| 1175 | Ga0439447_025907 | |||
| 1176 | Ga0439447_046626 | |||
| 1177 | Ga0439461_0019577 | |||
| 1178 | Ga0439466_0001520 | |||
| 1179 | Ga0439466_0007260 | |||
| 1180 | Ga0439466_0009406 | |||
| 1181 | Ga0439466_0026325 | |||
| 1182 | Ga0439466_0051777 | |||
| 1183 | Ga0439466_0076219 | |||
| 1184 | Ga0439466_0085593 | |||
| 1185 | Ga0439466_0089199 | |||
| 1186 | Ga0439465_0024791 | |||
| 1187 | Ga0439431_0002600 | |||
| 1188 | Ga0439437_000241 | |||
| 1189 | Ga0439445_0041553 | |||
| 1190 | Ga0439432_001031 | |||
| 1191 | Ga0439432_002040 | |||
| 1192 | Ga0439432_007092 | |||
| 1193 | Ga0439432_017191 | |||
| 1194 | Ga0439432_024693 | |||
| 1195 | Ga0439432_026722 | |||
| 1196 | Ga0439432_066521 | |||
| 1197 | Ga0439451_021169 | |||
| 1198 | Ga0439451_026813 | |||
| 1199 | Ga0439451_026863 | |||
| 1200 | Ga0439451_028903 | |||
| 1201 | Ga0439452_000670 | |||
| 1202 | Ga0439452_000794 | |||
| 1203 | Ga0439452_018520 | |||
| 1204 | Ga0439452_026858 | |||
| 1205 | Ga0439452_038575 | |||
| 1206 | Ga0439452_039566 | |||
| 1207 | Ga0439452_048166 | |||
| 1208 | Ga0439456_001644 | |||
| 1209 | Ga0439456_009475 | |||
| 1210 | Ga0439456_012208 | |||
| 1211 | Ga0439456_015017 | |||
| 1212 | Ga0439456_035375 | |||
| 1213 | Ga0439456_035730 | |||
| 1214 | Ga0439456_035998 | |||
| 1215 | Ga0439456_058683 | |||
| 1216 | Ga0439463_008953 | |||
| 1217 | Ga0439463_026487 | |||
| 1218 | Ga0439463_043241 | |||
| 1219 | Ga0439463_044840 | |||
| 1220 | Ga0450911_000018 | |||
| 1221 | Ga0450911_001188 | |||
| 1222 | Ga0450911_005032 | |||
| 1223 | Ga0450911_013451 | |||
| 1224 | Ga0450919_003213 | |||
| 1225 | Ga0450919_005273 | |||
| 1226 | Ga0450920_001085 | |||
| 1227 | Ga0450922_000453 | |||
| 1228 | Ga0450922_001694 | |||
| 1229 | Ga0450923_013176 | |||
| 1230 | Ga0450890_001935 | |||
| 1231 | Ga0450891_005895 | |||
| 1232 | Ga0450900_003159 | |||
| 1233 | Ga0450902_016068 | |||
| 1234 | Ga0450902_022213 | |||
| 1235 | Ga0450903_002260 | |||
| 1236 | Ga0450903_003778 | |||
| 1237 | Ga0450903_007597 | |||
| 1238 | Ga0450903_015042 | |||
| 1239 | Ga0450903_020841 | |||
| 1240 | Ga0450903_023742 | |||
| 1241 | Ga0450904_000271 | |||
| 1242 | Ga0450904_002407 | |||
| 1243 | Ga0450904_002472 | |||
| 1244 | Ga0450905_003582 | |||
| 1245 | Ga0450905_012168 | |||
| 1246 | Ga0450905_020674 | |||
| 1247 | Ga0450906_002239 | |||
| 1248 | Ga0450906_003997 | |||
| 1249 | Ga0450906_024040 | |||
| 1250 | Ga0450907_000319 | |||
| 1251 | Ga0450907_001968 | |||
| 1252 | Ga0450907_006117 | |||
| 1253 | Ga0450910_007754 | |||
| 1254 | Ga0450910_013873 | |||
| 1255 | Ga0439446_0096769 | |||
| 1256 | Ga0450908_012070 | |||
| 1257 | Ga0450909_001587 | |||
| 1258 | Ga0450909_005000 | |||
| 1259 | Ga0450909_005594 | |||
| 1260 | Ga0439434_0016587 | |||
| 1261 | Ga0439434_0082787 | |||
| 1262 | Ga0439464_0013879 | |||
| 1263 | Ga0439460_0015656 | |||
| 1264 | Ga0450918_016905 | |||
| 1265 | Ga0450893_0014394 | |||
| 1266 | Ga0450893_0021451 | |||
| 1267 | Ga0450893_0025382 | |||
| 1268 | Ga0450901_001597 | |||
| 1269 | Ga0439440_0010764 | |||
| 1270 | Ga0439440_0011030 | |||
| 1271 | Ga0439440_0040886 | |||
| 1272 | Ga0439440_0043431 | |||
| 1273 | Ga0495617_037768 | |||
| 1274 | Ga0495617_067088 | |||
| 1275 | Ga0495617_079378 | |||
| 1276 | Ga0495617_080486 | |||
| 1277 | Ga0495617_088085 | |||
| 1278 | Ga0495617_096817 | |||
| 1279 | Ga0495627_001267 | |||
| 1280 | Ga0495627_019354 | |||
| 1281 | Ga0495627_040808 | |||
| 1282 | Ga0495627_050121 | |||
| 1283 | Ga0495627_054570 | |||
| 1284 | Ga0495627_064345 | |||
| 1285 | Ga0495627_095294 | |||
| 1286 | Ga0495603_0023732 | |||
| 1287 | Ga0495603_0100921 | |||
| 1288 | Ga0495603_0224826 | |||
| 1289 | Ga0495603_0298979 | |||
| 1290 | Ga0495590_0005691 | |||
| 1291 | Ga0495590_0031965 | |||
| 1292 | Ga0495590_0035559 | |||
| 1293 | Ga0495590_0054910 | |||
| 1294 | Ga0495591_006008 | |||
| 1295 | Ga0495591_009188 | |||
| 1296 | Ga0495591_009335 | |||
| 1297 | Ga0495591_009346 | |||
| 1298 | Ga0495591_009402 | |||
| 1299 | Ga0495591_026051 | |||
| 1300 | Ga0495591_037190 | |||
| 1301 | Ga0495591_038474 | |||
| 1302 | Ga0495591_054000 | |||
| 1303 | Ga0495591_056944 | |||
| 1304 | Ga0495591_058404 | |||
| 1305 | Ga0495591_062234 | |||
| 1306 | Ga0495591_063243 | |||
| 1307 | Ga0495591_063459 | |||
| 1308 | Ga0495629_0029737 | |||
| 1309 | Ga0495638_0021353 | |||
| 1310 | Ga0495638_0024729 | |||
| 1311 | Ga0495638_0026393 | |||
| 1312 | Ga0495638_0041024 | |||
| 1313 | Ga0495638_0141218 | |||
| 1314 | Ga0495638_0147467 | |||
| 1315 | Ga0495638_0161865 | |||
| 1316 | Ga0495638_0192264 | |||
| 1317 | Ga0495638_0195943 | |||
| 1318 | Ga0495638_0204215 | |||
| 1319 | Ga0495638_0220444 | |||
| 1320 | Ga0495638_0245803 | |||
| 1321 | Ga0495653_0008133 | |||
| 1322 | Ga0495653_0015309 | |||
| 1323 | Ga0495653_0029993 | |||
| 1324 | Ga0495650_0015737 | |||
| 1325 | Ga0495650_0015746 | |||
| 1326 | Ga0495650_0018288 | |||
| 1327 | Ga0495650_0037443 | |||
| 1328 | Ga0495650_0052349 | |||
| 1329 | Ga0495650_0069489 | |||
| 1330 | Ga0495650_0074150 | |||
| 1331 | Ga0495650_0098122 | |||
| 1332 | Ga0495582_0071158 | |||
| 1333 | Ga0495605_0000246 | |||
| 1334 | Ga0495605_0014541 | |||
| 1335 | Ga0495605_0015560 | |||
| 1336 | Ga0495605_0075866 | |||
| 1337 | Ga0495605_0117801 | |||
| 1338 | Ga0495605_0132288 | |||
| 1339 | Ga0495605_0147348 | |||
| 1340 | Ga0495639_0001551 | |||
| 1341 | Ga0495639_0010965 | |||
| 1342 | Ga0495584_0005435 | |||
| 1343 | Ga0495584_0013994 | |||
| 1344 | Ga0495584_0016523 | |||
| 1345 | Ga0495584_0024887 | |||
| 1346 | Ga0495584_0031735 | |||
| 1347 | Ga0495584_0070437 | |||
| 1348 | Ga0495584_0088226 | |||
| 1349 | Ga0495584_0171829 | |||
| 1350 | Ga0495584_0172727 | |||
| 1351 | Ga0495584_0198015 | |||
| 1352 | Ga0495584_0204514 | |||
| 1353 | Ga0495585_0013551 | |||
| 1354 | Ga0495585_0014847 | |||
| 1355 | Ga0495585_0017937 | |||
| 1356 | Ga0495585_0056686 | |||
| 1357 | Ga0495585_0068394 | |||
| 1358 | Ga0495585_0099401 | |||
| 1359 | Ga0495585_0147731 | |||
| 1360 | Ga0495585_0165454 | |||
| 1361 | Ga0495585_0172481 | |||
| 1362 | Ga0495585_0186085 | |||
| 1363 | Ga0495594_0084849 | |||
| 1364 | Ga0495594_0103538 | |||
| 1365 | Ga0495594_0213815 | |||
| 1366 | Ga0495596_0118221 | |||
| 1367 | Ga0495607_0001148 | |||
| 1368 | Ga0495607_0002250 | |||
| 1369 | Ga0495607_0002707 | |||
| 1370 | Ga0495607_0018812 | |||
| 1371 | Ga0495607_0023114 | |||
| 1372 | Ga0495607_0024514 | |||
| 1373 | Ga0495607_0034140 | |||
| 1374 | Ga0495607_0058730 | |||
| 1375 | Ga0495607_0087203 | |||
| 1376 | Ga0495607_0144511 | |||
| 1377 | Ga0495607_0150143 | |||
| 1378 | Ga0495607_0164504 | |||
| 1379 | Ga0495607_0186317 | |||
| 1380 | Ga0495607_0214016 | |||
| 1381 | Ga0495583_0005604 | |||
| 1382 | Ga0495583_0012755 | |||
| 1383 | Ga0495583_0071296 | |||
| 1384 | Ga0495583_0076303 | |||
| 1385 | Ga0495583_0100564 | |||
| 1386 | Ga0495583_0137828 | |||
| 1387 | Ga0495583_0138733 | |||
| 1388 | Ga0495606_0016977 | |||
| 1389 | Ga0495606_0024248 | |||
| 1390 | Ga0495606_0024630 | |||
| 1391 | Ga0495606_0028702 | |||
| 1392 | Ga0495606_0065393 | |||
| 1393 | Ga0495606_0200002 | |||
| 1394 | Ga0495606_0258256 | |||
| 1395 | Ga0495606_0276861 | |||
| 1396 | Ga0495610_0009319 | |||
| 1397 | Ga0495610_0015655 | |||
| 1398 | Ga0495610_0046117 | |||
| 1399 | Ga0495610_0057601 | |||
| 1400 | Ga0495610_0087194 | |||
| 1401 | Ga0495610_0098834 | |||
| 1402 | Ga0495610_0113724 | |||
| 1403 | Ga0495610_0124704 | |||
| 1404 | Ga0495610_0145373 | |||
| 1405 | Ga0495610_0149386 | |||
| 1406 | Ga0495610_0150900 | |||
| 1407 | Ga0495616_0014268 | |||
| 1408 | Ga0495616_0016705 | |||
| 1409 | Ga0495616_0018207 | |||
| 1410 | Ga0495616_0037480 | |||
| 1411 | Ga0495616_0058584 | |||
| 1412 | Ga0495616_0099988 | |||
| 1413 | Ga0495616_0102115 | |||
| 1414 | Ga0495616_0102695 | |||
| 1415 | Ga0495616_0148608 | |||
| 1416 | Ga0495620_0010398 | |||
| 1417 | Ga0495620_0020263 | |||
| 1418 | Ga0495620_0036836 | |||
| 1419 | Ga0495620_0079953 | |||
| 1420 | Ga0495620_0079968 | |||
| 1421 | Ga0495620_0087576 | |||
| 1422 | Ga0495620_0108494 | |||
| 1423 | Ga0495620_0112559 | |||
| 1424 | Ga0495620_0145495 | |||
| 1425 | Ga0495628_0173838 | |||
| 1426 | Ga0495628_0419688 | |||
| 1427 | Ga0495630_0143480 | |||
| 1428 | Ga0495630_0387427 | |||
| 1429 | Ga0495631_0009778 | |||
| 1430 | Ga0495631_0010807 | |||
| 1431 | Ga0495631_0025448 | |||
| 1432 | Ga0495631_0093758 | |||
| 1433 | Ga0495631_0185301 | |||
| 1434 | Ga0495631_0193072 | |||
| 1435 | Ga0495632_0013983 | |||
| 1436 | Ga0495632_0016110 | |||
| 1437 | Ga0495632_0016947 | |||
| 1438 | Ga0495632_0017184 | |||
| 1439 | Ga0495632_0019197 | |||
| 1440 | Ga0495632_0055128 | |||
| 1441 | Ga0495632_0093099 | |||
| 1442 | Ga0495632_0122253 | |||
| 1443 | Ga0495632_0130945 | |||
| 1444 | Ga0495632_0140071 | |||
| 1445 | Ga0495632_0141151 | |||
| 1446 | Ga0495632_0160846 | |||
| 1447 | Ga0495632_0162183 | |||
| 1448 | Ga0495637_0011881 | |||
| 1449 | Ga0495637_0012319 | |||
| 1450 | Ga0495637_0013369 | |||
| 1451 | Ga0495637_0039623 | |||
| 1452 | Ga0495637_0055274 | |||
| 1453 | Ga0495637_0059527 | |||
| 1454 | Ga0495637_0063802 | |||
| 1455 | Ga0495637_0066387 | |||
| 1456 | Ga0495637_0072596 | |||
| 1457 | Ga0495637_0077275 | |||
| 1458 | Ga0495637_0077636 | |||
| 1459 | Ga0495637_0079422 | |||
| 1460 | Ga0495637_0121861 | |||
| 1461 | Ga0495637_0123024 | |||
| 1462 | Ga0495643_0001071 | |||
| 1463 | Ga0495643_0003165 | |||
| 1464 | Ga0495643_0004059 | |||
| 1465 | Ga0495643_0018955 | |||
| 1466 | Ga0495643_0026264 | |||
| 1467 | Ga0495643_0122639 | |||
| 1468 | Ga0495643_0168018 | |||
| 1469 | Ga0495643_0168071 | |||
| 1470 | Ga0495643_0172045 | |||
| 1471 | Ga0495643_0243502 | |||
| 1472 | Ga0495644_0025574 | |||
| 1473 | Ga0495644_0104367 | |||
| 1474 | Ga0495644_0149879 | |||
| 1475 | Ga0495648_0021054 | |||
| 1476 | Ga0495648_0050577 | |||
| 1477 | Ga0495648_0069543 | |||
| 1478 | Ga0495648_0087169 | |||
| 1479 | Ga0495648_0119070 | |||
| 1480 | Ga0495648_0147189 | |||
| 1481 | Ga0495648_0151066 | |||
| 1482 | Ga0495648_0178258 | |||
| 1483 | Ga0495648_0189569 | |||
| 1484 | Ga0495648_0191441 | |||
| 1485 | Ga0495648_0197884 | |||
| 1486 | Ga0495648_0200989 | |||
| 1487 | Ga0495648_0214973 | |||
| 1488 | Ga0495648_0241568 | |||
| 1489 | Ga0495666_0136343 | |||
| 1490 | Ga0495666_0149988 | |||
| 1491 | Ga0495666_0179354 | |||
| 1492 | Ga0495642_0003636 | |||
| 1493 | Ga0495642_0006288 | |||
| 1494 | Ga0495642_0008389 | |||
| 1495 | Ga0495654_0004916 | |||
| 1496 | Ga0495654_0012182 | |||
| 1497 | Ga0495654_0077006 | |||
| 1498 | Ga0495654_0098154 | |||
| 1499 | Ga0495654_0104627 | |||
| 1500 | Ga0495654_0105894 | |||
| 1501 | Ga0495654_0114884 | |||
| 1502 | Ga0495654_0130326 | |||
| 1503 | Ga0495654_0135131 | |||
| 1504 | Ga0495654_0140510 | |||
| 1505 | Ga0495654_0143779 | |||
| 1506 | Ga0495654_0148523 | |||
| 1507 | Ga0495654_0150003 | |||
| 1508 | Ga0495586_0145562 | |||
| 1509 | Ga0495587_0018577 | |||
| 1510 | Ga0495587_0018895 | |||
| 1511 | Ga0495609_0000053 | |||
| 1512 | Ga0495609_0010982 | |||
| 1513 | Ga0495609_0011202 | |||
| 1514 | Ga0495609_0013138 | |||
| 1515 | Ga0495609_0077668 | |||
| 1516 | Ga0495609_0088429 | |||
| 1517 | Ga0495609_0099681 | |||
| 1518 | Ga0495609_0115656 | |||
| 1519 | Ga0495597_0011071 | |||
| 1520 | Ga0495597_0011559 | |||
| 1521 | Ga0495597_0047670 | |||
| 1522 | Ga0495597_0093658 | |||
| 1523 | Ga0495597_0096652 | |||
| 1524 | Ga0495597_0098131 | |||
| 1525 | Ga0495645_0139967 | |||
| 1526 | Ga0495622_0000977 | |||
| 1527 | Ga0495622_0012542 | |||
| 1528 | Ga0495622_0028785 | |||
| 1529 | Ga0495622_0094875 | |||
| 1530 | Ga0495622_0096499 | |||
| 1531 | Ga0495622_0149481 | |||
| 1532 | Ga0495633_0001685 | |||
| 1533 | Ga0495633_0013531 | |||
| 1534 | Ga0495633_0105035 | |||
| 1535 | Ga0495633_0105468 | |||
| 1536 | Ga0495668_0016301 | |||
| 1537 | Ga0495668_0203994 | |||
| 1538 | Ga0495668_0251774 | |||
| 1539 | Ga0495634_0018644 | |||
| 1540 | Ga0495634_0081021 | |||
| 1541 | Ga0495634_0158158 | |||
| 1542 | Ga0495611_0003180 | |||
| 1543 | Ga0495611_0077708 | |||
| 1544 | Ga0495611_0149241 | |||
| 1545 | Ga0495611_0177873 | |||
| 1546 | Ga0495625_0012751 | |||
| 1547 | Ga0495625_0068167 | |||
| 1548 | Ga0495625_0076099 | |||
| 1549 | Ga0495625_0098151 | |||
| 1550 | Ga0495625_0103402 | |||
| 1551 | Ga0495625_0140824 | |||
| 1552 | Ga0495625_0267849 | |||
| 1553 | Ga0495625_0295753 | |||
| 1554 | Ga0495635_0147707 | |||
| 1555 | Ga0495659_0004187 | |||
| 1556 | Ga0495659_0026539 | |||
| 1557 | Ga0495659_0058797 | |||
| 1558 | Ga0495661_0019957 | |||
| 1559 | Ga0495661_0059952 | |||
| 1560 | Ga0495661_0085515 | |||
| 1561 | Ga0495661_0144513 | |||
| 1562 | Ga0495661_0205535 | |||
| 1563 | Ga0495661_0225918 | |||
| 1564 | Ga0495588_0103922 | |||
| 1565 | Ga0495588_0137420 | |||
| 1566 | Ga0495588_0155397 | |||
| 1567 | Ga0495588_0242557 | |||
| 1568 | Ga0495623_0016822 | |||
| 1569 | Ga0495623_0116888 | |||
| 1570 | Ga0495646_0014967 | |||
| 1571 | Ga0495646_0039664 | |||
| 1572 | Ga0495646_0067887 | |||
| 1573 | Ga0495669_0001474 | |||
| 1574 | Ga0495669_0091690 | |||
| 1575 | Ga0495613_0137037 | |||
| 1576 | Ga0495624_0006449 | |||
| 1577 | Ga0495670_0011499 | |||
| 1578 | Ga0495670_0050885 | |||
| 1579 | Ga0495670_0059553 | |||
| 1580 | Ga0495670_0106777 | |||
| 1581 | Ga0495670_0127440 | |||
| 1582 | Ga0495670_0143561 | |||
| 1583 | Ga0495670_0153629 | |||
| 1584 | Ga0495670_0173076 | |||
| 1585 | Ga0495670_0233474 | |||
| 1586 | Ga0495671_0006003 | |||
| 1587 | Ga0495671_0007411 | |||
| 1588 | Ga0495671_0014510 | |||
| 1589 | Ga0495671_0017911 | |||
| 1590 | Ga0495671_0036791 | |||
| 1591 | Ga0495671_0038097 | |||
| 1592 | Ga0495671_0045950 | |||
| 1593 | Ga0495671_0046769 | |||
| 1594 | Ga0495671_0142367 | |||
| 1595 | Ga0495671_0142590 | |||
| 1596 | Ga0495671_0188700 | |||
| 1597 | Ga0495649_0009233 | |||
| 1598 | Ga0495649_0014456 | |||
| 1599 | Ga0495649_0017231 | |||
| 1600 | Ga0495649_0043916 | |||
| 1601 | Ga0495649_0047213 | |||
| 1602 | Ga0495649_0123088 | |||
| 1603 | Ga0495649_0130573 | |||
| 1604 | Ga0495649_0130575 | |||
| 1605 | Ga0495649_0131104 | |||
| 1606 | Ga0495649_0170365 | |||
| 1607 | Ga0495649_0194323 | |||
| 1608 | Ga0495649_0216614 | |||
| 1609 | Ga0495589_0000587 | |||
| 1610 | Ga0495589_0012704 | |||
| 1611 | Ga0495589_0016991 | |||
| 1612 | Ga0495589_0029116 | |||
| 1613 | Ga0495589_0062447 | |||
| 1614 | Ga0495589_0078803 | |||
| 1615 | Ga0495589_0125288 | |||
| 1616 | Ga0495589_0145028 | |||
| 1617 | Ga0495589_0198867 | |||
| 1618 | Ga0495589_0206208 | |||
| 1619 | Ga0495600_0040402 | |||
| 1620 | Ga0495600_0159448 | |||
| 1621 | Ga0495660_0015934 | |||
| 1622 | Ga0495660_0019503 | |||
| 1623 | Ga0495660_0027716 | |||
| 1624 | Ga0495660_0034452 | |||
| 1625 | Ga0495660_0046194 | |||
| 1626 | Ga0495660_0050642 | |||
| 1627 | Ga0495660_0051793 | |||
| 1628 | Ga0495660_0058464 | |||
| 1629 | Ga0495660_0062284 | |||
| 1630 | Ga0495660_0087943 | |||
| 1631 | Ga0495660_0098062 | |||
| 1632 | Ga0495660_0120408 | |||
| 1633 | Ga0495660_0147017 | |||
| 1634 | Ga0495660_0228420 | |||
| 1635 | Ga0495581_0065187 | |||
| 1636 | Ga0495581_0077586 | |||
| 1637 | Ga0495604_0094943 | |||
| 1638 | Ga0495604_0145477 | |||
| 1639 | Ga0495604_0204040 | |||
| 1640 | Ga0495636_0020095 | |||
| 1641 | Ga0495674_0180437 | |||
| 1642 | Ga0495674_0687037 | |||
| 1643 | Ga0495672_0002026 | |||
| 1644 | Ga0495672_0007781 | |||
| 1645 | Ga0495672_0023132 | |||
| 1646 | Ga0495672_0023554 | |||
| 1647 | Ga0495672_0148568 | |||
| 1648 | Ga0495672_0155120 | |||
| 1649 | Ga0495672_0158645 | |||
| 1650 | Ga0495672_0161335 | |||
| 1651 | Ga0495672_0178683 | |||
| 1652 | Ga0495672_0194273 | |||
| 1653 | Ga0495672_0201399 | |||
| 1654 | Ga0495676_0066839 | |||
| 1655 | Ga0495676_0083234 | |||
| 1656 | Ga0495680_0032796 | |||
| 1657 | Ga0495680_0073016 | |||
| 1658 | Ga0495680_0194825 | |||
| 1659 | Ga0495680_0330804 | |||
| 1660 | Ga0495683_0010503 | |||
| 1661 | Ga0495683_0012509 | |||
| 1662 | Ga0495683_0054876 | |||
| 1663 | Ga0495683_0100097 | |||
| 1664 | Ga0495683_0119608 | |||
| 1665 | Ga0495683_0124530 | |||
| 1666 | Ga0495683_0129457 | |||
| 1667 | Ga0495683_0137290 | |||
| 1668 | Ga0495683_0162163 | |||
| 1669 | Ga0495683_0191192 | |||
| 1670 | Ga0495687_013599 | |||
| 1671 | Ga0495687_081413 | |||
| 1672 | Ga0495675_0064234 | |||
| 1673 | Ga0495677_0028720 | |||
| 1674 | Ga0495679_009646 | |||
| 1675 | Ga0495679_017816 | |||
| 1676 | Ga0495679_019986 | |||
| 1677 | Ga0495679_054116 | |||
| 1678 | Ga0495679_057625 | |||
| 1679 | Ga0495679_063285 | |||
| 1680 | Ga0495679_083136 | |||
| 1681 | Ga0495685_022846 | |||
| 1682 | Ga0495685_026608 | |||
| 1683 | Ga0495673_0005030 | |||
| 1684 | Ga0495673_0009780 | |||
| 1685 | Ga0495673_0012319 | |||
| 1686 | Ga0495673_0013582 | |||
| 1687 | Ga0495673_0027680 | |||
| 1688 | Ga0495673_0065791 | |||
| 1689 | Ga0495673_0075075 | |||
| 1690 | Ga0495673_0077049 | |||
| 1691 | Ga0495673_0079534 | |||
| 1692 | Ga0495673_0088677 | |||
| 1693 | Ga0495673_0105068 | |||
| 1694 | Ga0495673_0111898 | |||
| 1695 | Ga0495673_0114218 | |||
| 1696 | Ga0495673_0119922 | |||
| 1697 | Ga0495673_0119949 | |||
| 1698 | Ga0495673_0129550 | |||
| 1699 | Ga0495673_0174086 | |||
| 1700 | Ga0495681_0007814 | |||
| 1701 | Ga0495681_0013783 | |||
| 1702 | Ga0495681_0016258 | |||
| 1703 | Ga0495681_0017009 | |||
| 1704 | Ga0495681_0018090 | |||
| 1705 | Ga0495681_0059413 | |||
| 1706 | Ga0495681_0084372 | |||
| 1707 | Ga0495681_0091558 | |||
| 1708 | Ga0495681_0130960 | |||
| 1709 | Ga0495681_0136506 | |||
| 1710 | Ga0495684_0063092 | |||
| 1711 | Ga0495684_0100174 | |||
| 1712 | Ga0495686_0011348 | |||
| 1713 | Ga0495686_0025100 | |||
| 1714 | Ga0495686_0089889 | |||
| 1715 | Ga0495686_0211311 | |||
| 1716 | Ga0495593_0059867 | |||
| 1717 | Ga0495593_0077007 | |||
| 1718 | Ga0495593_0124863 | |||
| 1719 | Ga0495593_0165503 | |||
| 1720 | Ga0495602_0074105 | |||
| 1721 | Ga0495626_0001849 | |||
| 1722 | Ga0495626_0002063 | |||
| 1723 | Ga0495626_0012097 | |||
| 1724 | Ga0495626_0013302 | |||
| 1725 | Ga0495626_0028334 | |||
| 1726 | Ga0495626_0081221 | |||
| 1727 | Ga0495626_0109319 | |||
| 1728 | Ga0495626_0113131 | |||
| 1729 | Ga0495626_0118812 | |||
| 1730 | Ga0495626_0122448 | |||
| 1731 | Ga0495626_0129512 | |||
| 1732 | Ga0495626_0163068 | |||
| 1733 | Ga0496101_0472887 | |||
| 1734 | Ga0496102_0029602 | |||
| 1735 | Ga0496103_0283973 | |||
| 1736 | Ga0496104_0536594 | |||
| 1737 | Ga0496105_0401947 | |||
| 1738 | Ga0496107_0386880 | |||
| 1739 | Ga0496110_0254188 | |||
| 1740 | Ga0496114_0284253 | |||
| 1741 | Ga0496116_0004746 | |||
| 1742 | Ga0496116_0016123 | |||
| 1743 | Ga0496116_0087859 | |||
| 1744 | Ga0496116_0134950 | |||
| 1745 | Ga0496116_0202202 | |||
| 1746 | Ga0496117_0033142 | |||
| 1747 | Ga0496117_0078731 | |||
| 1748 | Ga0496117_0095080 | |||
| 1749 | Ga0496117_0101411 | |||
| 1750 | Ga0496117_0235647 | |||
| 1751 | Ga0496117_0244619 | |||
| 1752 | Ga0496118_0037568 | |||
| 1753 | Ga0496118_0087797 | |||
| 1754 | Ga0496118_0107116 | |||
| 1755 | Ga0496118_0205148 | |||
| 1756 | Ga0496119_0065278 | |||
| 1757 | Ga0496119_0138328 | |||
| 1758 | Ga0496119_0235092 | |||
| 1759 | Ga0496120_0103528 | |||
| 1760 | Ga0496120_0210348 | |||
| 1761 | Ga0496121_0047275 | |||
| 1762 | Ga0496121_0109908 | |||
| 1763 | Ga0496121_0232656 | |||
| 1764 | Ga0496121_0288765 | |||
| 1765 | Ga0496122_0102453 | |||
| 1766 | Ga0496122_0212581 | |||
| 1767 | Ga0496122_0216223 | |||
| 1768 | Ga0496123_0175852 | |||
| 1769 | Ga0496123_0182240 | |||
| 1770 | Ga0496123_0240857 | |||
| 1771 | Ga0496124_0000120 | |||
| 1772 | Ga0496124_0089046 | |||
| 1773 | Ga0496124_0158040 | |||
| 1774 | Ga0496124_0213028 | |||
| 1775 | Ga0496124_0338096 | |||
| 1776 | Ga0496124_0509605 | |||
| 1777 | Ga0496125_0052982 | |||
| 1778 | Ga0496125_0063050 | |||
| 1779 | Ga0496125_0301350 | |||
| 1780 | Ga0496125_0304538 | |||
| 1781 | Ga0496125_0309874 | |||
| 1782 | Ga0496126_0212624 | |||
| 1783 | Ga0495678_012258 | |||
| 1784 | Ga0495678_030258 | |||
| 1785 | Ga0495678_036418 | |||
| 1786 | Ga0495678_056602 | |||
| 1787 | Ga0495678_059030 | |||
| 1788 | Ga0495678_062139 | |||
| 1789 | Ga0495678_070782 | |||
| 1790 | Ga0495678_089560 | |||
| 1791 | Ga0495678_091613 | |||
| 1792 | Ga0495678_093561 | |||
| 1793 | Ga0495678_100429 | |||
| 1794 | Ga0495678_100504 | |||
| 1795 | Ga0495678_102294 | |||
| 1796 | Ga0495678_103272 | |||
| 1797 | Ga0495678_108119 | |||
| 1798 | Ga0495682_0007794 | |||
| 1799 | Ga0495682_0020205 | |||
| 1800 | Ga0495682_0025638 | |||
| 1801 | Ga0495682_0081420 | |||
| 1802 | Ga0495682_0098053 | |||
| 1803 | Ga0495682_0103060 | |||
| 1804 | Ga0495682_0145320 | |||
| 1805 | Ga0501222_009583 | |||
| 1806 | Ga0501227_025523 | |||
| 1807 | Ga0501241_005307 | |||
| 1808 | Ga0501226_000002 | |||
| 1809 | Ga0501226_006651 | |||
| 1810 | nmdc:mga03683_146217_c1 | |||
| 1811 | nmdc:mga03683_208505_c1 | |||
| 1812 | nmdc:mga03683_9895_c1 | |||
| 1813 | nmdc:mga03n38_248732_c1 | |||
| 1814 | nmdc:mga00v17_361873_c1 | |||
| 1815 | nmdc:mga00v17_90411_c1 | |||
| 1816 | Ga0500572_011163 | |||
| 1817 | Ga0500577_0101793 | |||
| 1818 | Ga0500586_038340 | |||
| 1819 | 2511254751 | |||
| 1820 | 2511265563 | |||
| 1821 | 2511271108 | |||
| 1822 | 2511280547 | |||
| 1823 | 2511297953 | |||
| 1824 | 2511302376 | |||
| 1825 | 2511315226 | |||
| 1826 | 2511320784 | |||
| 1827 | 2511326061 | |||
| 1828 | 2511331017 | |||
| 1829 | 2511336365 | |||
| 1830 | 2511345729 | |||
| 1831 | 2511349073 | |||
| 1832 | 2511360686 | |||
| 1833 | 2511368597 | |||
| 1834 | 2511411285 | |||
| 1835 | 2512325925 | |||
| 1836 | 2554818093 | |||
| 1837 | 2583789834 | |||
| 1838 | 2597855632 | |||
| 1839 | 2599398877 | |||
| 1840 | 2599450932 | |||
| 1841 | 2599485534 | |||
| 1842 | 2599514122 | |||
| 1843 | 2599518723 | |||
| 1844 | 2599806663 | |||
| 1845 | 2599893543 | |||
| 1846 | 2599943629 | |||
| 1847 | 2599955939 | |||
| 1848 | 2599984633 | |||
| 1849 | 2599991214 | |||
| 1850 | 2599994894 | |||
| 1851 | 2600002255 | |||
| 1852 | 2600023924 | |||
| 1853 | 2600032667 | |||
| 1854 | 2600034717 | |||
| 1855 | 2600044888 | |||
| 1856 | 2600048025 | |||
| 1857 | 2600061274 | |||
| 1858 | 2600068165 | |||
| 1859 | 2600077617 | |||
| 1860 | 2600362192 | |||
| 1861 | 2600364912 | |||
| 1862 | 2601627217 | |||
| 1863 | 2601797803 | |||
| 1864 | 2606076714 | |||
| 1865 | 2606128872 | |||
| 1866 | 2608380605 | |||
| 1867 | 2624478191 | |||
| 1868 | 2624489734 | |||
| 1869 | 2643840950 | |||
| 1870 | 2643954942 | |||
| 1871 | 2644024582 | |||
| 1872 | 2644186092 | |||
| 1873 | 2652547308 | |||
| 1874 | 2671127293 | |||
| 1875 | 2671772314 | |||
| 1876 | 2678260946 | |||
| 1877 | 2715749178 | |||
| 1878 | 2715759529 | |||
| 1879 | 2718632131 | |||
| 1880 | 2729146476 | |||
| 1881 | 2739197998 | |||
| 1882 | 2739260339 | |||
| 1883 | 2739286974 | |||
| 1884 | 2739292287 | |||
| 1885 | 2739311251 | |||
| 1886 | 2743735049 | |||
| 1887 | 2745006258 | |||
| 1888 | 2774119589 | |||
| 1889 | 2774134708 | |||
| 1890 | 2784261077 | |||
| 1891 | 2784316336 | |||
| 1892 | 2808855899 | |||
| 1893 | 2808905464 | |||
| 1894 | 2808922786 | |||
| 1895 | 2808932150 | |||
| 1896 | 2808935979 | |||
| 1897 | 2808939714 | |||
| 1898 | 2808944473 | |||
| 1899 | 2808954249 | |||
| 1900 | 2808955829 | |||
| 1901 | 2808964524 | |||
| 1902 | 2808999412 | |||
| 1903 | 2809217949 | |||
| 1904 | 2819657199 | |||
| 1905 | 2825654297 | |||
| 1906 | 2826582476 | |||
| 1907 | 2842817682 | |||
| 1908 | 2842832339 | |||
| 1909 | 2842834132 | |||
| 1910 | 2842838596 | |||
| 1911 | 2842846393 | |||
| 1912 | 2842851636 | |||
| 1913 | 2842858765 | |||
| 1914 | 2844667869 | |||
| 1915 | 2852660482 | |||
| 1916 | 2860343669 | |||
| 1917 | 2878030135 | |||
| 1918 | 2880231082 | |||
| 1919 | 2904519541 | |||
| 1920 | 2904552274 | |||
| 1921 | 2919066183 | |||
| 1922 | 2919389805 | |||
| 1923 | 2919459957 | |||
| 1924 | 2919486847 | |||
| 1925 | 2919488737 | |||
| 1926 | 2919698988 | |||
| 1927 | 2923154043 | |||
| 1928 | 2929144774 | |||
| 1929 | 2931391353 | |||
| 1930 | 2931398807 | |||
| 1931 | 2939641069 | |||
| 1932 | 2946028616 | |||
| 1933 | 2969304930 | |||
| 1934 | 2974293377 | |||
| 1935 | 2984292016 | |||
| 1936 | 2988732166 | |||
| 1937 | 2998140426 | |||
| 1938 | 3007398056 | |||
| 1939 | 3007517865 | |||
| 1940 | 3007615200 | |||
| 1941 | 3007625017 | |||
| 1942 | 3007721193 | |||
| 1943 | 3007859671 | |||
| 1944 | 3007864361 | |||
| 1945 | 3007872069 | |||
| 1946 | 8011352517 | |||
| 1947 | 8015688292 | |||
| 1948 | 8019770279 | |||
| 1949 | 8019777308 | |||
| 1950 | 8054503929 | |||
| 1951 | 8055771390 | |||
| 1952 | 8056126434 | |||
| 1953 | 8056142679 | |||
| 1954 | 8056143700 | |||
| 1955 | 8056158484 | |||
| 1956 | 8056170619 | |||
| 1957 | 8056176732 | |||
| 1958 | 8056183081 | |||
| 1959 | 8056572292 | |||
| 1960 | 8057802681 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1snm-assembly1.cif.gz_A | active site mutant glu-43 (right arrow) asp in staphylococcal nuclease displays nonlocal structural changes | 0.9279 | 35 | 164 |
| 6eek-assembly1.cif.gz_A | crystal structure of apo staphylcoccal nuclease variant delta+phs t62e/v66k, ph 7 at cryogenic temperature | 0.9248 | 58 | 164 |
| 2f0q-assembly1.cif.gz_A | crystal structure of staphylococcal nuclease mutant v66l/i92l | 0.9216 | 35 | 164 |
| 1ey9-assembly1.cif.gz_A | structure of s. nuclease stabilizing quadruple mutant t41i/p117g/h124l/s128a | 0.9207 | 35 | 164 |
| 4k8i-assembly1.cif.gz_A | crystal structure of staphylococcal nuclease mutant i92v/v99l | 0.9197 | 35 | 164 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6eekA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.9248 | 58 | 164 | 2.40.50.90 |
| af_Q2FYV8_40_177_2.40.50.90 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.9069 | 34 | 166 | 2.40.50.90 |
| af_Q2RBJ2_237_347_2.40.50.90 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.8749 | 58 | 166 | 2.40.50.90 |
| af_Q2FYV8_40_177_2.40.50.90 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.8693 | 34 | 166 | 2.40.50.90 |
| af_Q7XV85_13_156_2.40.50.90 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.8565 | 38 | 168 | 2.40.50.90 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-J8V517-F1-model_v4 | deleted | 0.9768 | 40 | 123 |
|
| AF-A0A3M5AD78-F1-model_v4 | deleted | 0.976 | 77 | 262 |
|
| AF-A0A2A2M5E2-F1-model_v4 | TNase-like domain-containing protein | 0.9722 | 33 | 168 |
GO:0003676
GO:0004518 |
| AF-A0A831XV62-F1-model_v4 | TNase-like domain-containing protein | 0.9716 | 39 | 167 |
|
| AF-A0A836ZNZ3-F1-model_v4 | deleted | 0.9676 | 106 | 262 |
|