F487366

General Info

Members Datasets Scaffolds Average Seq Length
980 378 1960 265

Family's Representative Sequence

Representative Sequence 3300042009|Ga0439451_010326|Ga0439451_010326_864_1742
Length 292
Sequence VYSASQTVSALSARKLLLLQSKVESPVGFSLLMKKASLAGAFFVSAIWLSGAQAFCPAPSGLTPVAVQRVVDGDTLRLSDGRSVRMIGLNTPELGKQGRSDEPFAVAARKRLEALVAASDGRVGLLPGKESRDHYGRTLAHVYSVDGANLEAQMLAEGLGFQVAVAPNVDLVACQQAAETSARRAGLGLWRQSPVLKAEQISASGFAMLSGRVSKVQRNRGGVWIELQDSVVLRVAPNLLGQFDVASLEKLKGKQIEARGWVVDRSRRGGLQPGQARWLLPLTDPAMLQAAP

Samples

Sample ID Description Type Environment
1 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
25 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
26 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
27 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
28 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
29 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
30 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
31 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
37 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
46 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
49 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
51 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
52 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
53 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
70 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
75 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
76 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
77 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
89 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
90 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
91 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
92 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
93 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
94 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
95 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
96 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
97 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
98 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
99 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
100 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
101 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
102 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
103 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
104 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
105 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
106 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
107 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
108 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
109 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
110 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
111 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
112 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
113 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
114 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
115 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
116 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
117 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
118 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
119 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
120 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
121 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
122 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
123 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
124 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
125 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
126 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
127 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
128 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
129 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
130 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
131 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
136 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
137 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
138 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
139 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
140 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
141 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
142 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
143 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
144 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
145 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
146 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
147 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
148 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
152 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
153 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
154 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
155 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
156 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
157 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
158 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
159 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
160 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
163 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
166 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
167 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
168 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
169 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
170 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
171 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
172 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
173 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
174 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
175 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
176 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
180 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
181 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
182 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
183 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
184 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
185 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
194 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
197 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
198 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
199 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
200 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
203 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
215 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
216 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
217 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
218 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
219 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
220 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
221 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
222 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
223 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
224 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
225 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
226 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
227 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
228 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
229 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
230 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
231 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
232 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
233 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
234 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
235 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
236 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
237 2511231004 Pseudomonas sp. GM102 Isolate Nodule
238 2511231006 Pseudomonas sp. GM17 Isolate Nodule
239 2511231007 Pseudomonas sp. GM18 Isolate Nodule
240 2511231008 Pseudomonas sp. GM21 Isolate Nodule
241 2511231011 Pseudomonas sp. GM30 Isolate Nodule
242 2511231012 Pseudomonas sp. GM33 Isolate Nodule
243 2511231014 Pseudomonas sp. GM48 Isolate Nodule
244 2511231015 Pseudomonas sp. GM49 Isolate Nodule
245 2511231016 Pseudomonas sp. GM50 Isolate Nodule
246 2511231017 Pseudomonas sp. GM55 Isolate Nodule
247 2511231018 Pseudomonas sp. GM60 Isolate Nodule
248 2511231019 Pseudomonas sp. GM67 Isolate Nodule
249 2511231020 Pseudomonas sp. GM74 Isolate Nodule
250 2511231022 Pseudomonas sp. GM79 Isolate Nodule
251 2511231023 Pseudomonas sp. GM80 Isolate Nodule
252 2511231031 Pseudomonas sp. GM16 Isolate Nodule
253 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
254 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
255 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
256 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
257 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
258 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
259 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
260 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
261 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
262 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
263 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
264 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
265 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
266 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
267 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
268 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
269 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
270 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
271 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
272 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
273 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
274 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
275 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
276 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
277 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
278 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
279 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
280 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
281 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
282 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
283 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
284 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
285 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
286 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
287 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
288 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
289 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
290 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
291 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
292 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
293 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
294 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
295 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
296 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
297 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
298 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
299 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
300 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
301 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
302 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
303 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
304 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
305 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
306 2773857670 Pseudomonas sp. 478 Isolate Unclassified
307 2773857673 Pseudomonas sp. 443 Isolate Unclassified
308 2784132063 Pseudomonas sp. 424 Isolate Unclassified
309 2784132072 Pseudomonas sp. 460 Isolate Unclassified
310 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
311 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
312 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
313 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
314 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
315 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
316 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
317 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
318 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
319 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
320 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
321 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
322 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
323 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
324 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
325 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
326 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
327 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
328 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
329 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
330 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
331 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
332 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
333 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
334 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
335 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
336 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
337 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
338 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
339 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
340 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
341 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
342 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
343 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
344 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
345 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
346 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
347 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
348 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
349 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
350 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
351 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
352 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
353 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
354 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
355 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
356 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
357 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
358 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
359 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
360 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
361 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
362 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
363 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
364 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
365 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
366 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
367 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
368 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
369 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
370 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
371 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
372 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
373 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
374 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
375 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
376 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
377 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
378 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.51
Metatranscriptomes 0
Isolates 14.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.18
Nodule 2.35
Rhizoplane 3.88
Rhizosphere 80.51
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439451_010326 3300042009 Bacteria 1883
2 MRS2a_Contig_841 2124908027 Bacteria 14575
3 SwRhRL2b_contig_7644 2162886007 Bacteria 1814
4 MBSR1b_contig_7640429 2162886012 Bacteria 886
5 JGI25162J39368_1000098 3300002737 Bacteria 95821
6 JGI25163J39215_1001163 3300002771 Bacteria 5119
7 JGI25164J39214_1000076 3300002772 Bacteria 95821
8 JGI25165J46597_1000180 3300003214 Bacteria 95821
9 Ga0055536_1001506 3300003781 Bacteria 13995
10 Ga0055536_1004111 3300003781 Bacteria 7557
11 Ga0055536_1017763 3300003781 Bacteria 2312
12 Ga0055530_10000677 3300003791 Bacteria 28934
13 Ga0055530_10001490 3300003791 Bacteria 16999
14 Ga0055540_1000217 3300003792 Bacteria 54396
15 Ga0055540_1001429 3300003792 Bacteria 14239
16 Ga0055531_10000238 3300003794 Bacteria 60414
17 Ga0055531_10000275 3300003794 Bacteria 53122
18 Ga0065714_10000623 3300005288 Bacteria 3828
19 Ga0065714_10014927 3300005288 Bacteria 2217
20 Ga0065714_10033938 3300005288 Bacteria 1155
21 Ga0065714_10120319 3300005288 Bacteria 1352
22 Ga0065714_10158496 3300005288 Bacteria 1053
23 Ga0065704_10070786 3300005289 Bacteria 16102
24 Ga0065704_10111549 3300005289 Bacteria 1954
25 Ga0065712_10068398 3300005290 Bacteria 10913
26 Ga0065715_10006941 3300005293 Bacteria 4482
27 Ga0070669_100000221 3300005353 Bacteria 47408
28 Ga0070669_100004459 3300005353 Bacteria 10085
29 Ga0070669_100217126 3300005353 Bacteria 1511
30 Ga0070662_100001883 3300005457 Bacteria 12866
31 Ga0068853_100000089 3300005539 Bacteria 62291
32 Ga0070665_100154401 3300005548 Bacteria 2297
33 Ga0070664_100007327 3300005564 Bacteria 8894
34 Ga0070664_100446119 3300005564 Bacteria 1187
35 Ga0068851_10000024 3300005834 Bacteria 125917
36 Ga0075364_10254605 3300006051 Bacteria 1193
37 Ga0075364_10273311 3300006051 Bacteria 1149
38 Ga0075432_10073565 3300006058 Bacteria 1230
39 Ga0075432_10091394 3300006058 Bacteria 1114
40 Ga0075432_10092135 3300006058 Bacteria 1110
41 Ga0075362_10115415 3300006177 Bacteria 1267
42 Ga0075362_10124473 3300006177 Bacteria 1222
43 Ga0075436_100262996 3300006914 Bacteria 1230
44 Ga0075436_100276046 3300006914 Bacteria 1201
45 Ga0075436_100381306 3300006914 Bacteria 1019
46 Ga0079104_1000508 3300006946 Bacteria 41889
47 Ga0079104_1000732 3300006946 Bacteria 29101
48 Ga0099826_10010490 3300006948 Bacteria 6944
49 Ga0105251_10076327 3300009011 Bacteria 1555
50 Ga0105251_10103057 3300009011 Bacteria 1304
51 Ga0105251_10130791 3300009011 Bacteria 1137
52 Ga0105244_10056276 3300009036 Bacteria 1991
53 Ga0105244_10057561 3300009036 Bacteria 1964
54 Ga0105244_10084700 3300009036 Bacteria 1565
55 Ga0105244_10133019 3300009036 Bacteria 1200
56 Ga0105244_10147702 3300009036 Bacteria 1127
57 Ga0105244_10148770 3300009036 Bacteria 1123
58 Ga0105250_10083280 3300009092 Bacteria 1298
59 Ga0105250_10128568 3300009092 Bacteria 1045
60 Ga0105243_10000930 3300009148 Bacteria 27440
61 Ga0105243_10130877 3300009148 Bacteria 2128
62 Ga0105242_10028253 3300009176 Bacteria 4464
63 Ga0105248_10018503 3300009177 Bacteria 7699
64 Ga0105246_10000305 3300011119 Bacteria 25977
65 Ga0105246_10013235 3300011119 Bacteria 5166
66 Ga0157345_1000263 3300012498 Bacteria 7319
67 Ga0157373_10075583 3300013100 Bacteria 2377
68 Ga0157373_10212130 3300013100 Bacteria 1365
69 Ga0157373_10276354 3300013100 Bacteria 1190
70 Ga0157373_10346967 3300013100 Bacteria 1059
71 Ga0157371_10019663 3300013102 Bacteria 4976
72 Ga0157371_10026569 3300013102 Bacteria 4206
73 Ga0157371_10270950 3300013102 Bacteria 1225
74 Ga0157370_10044961 3300013104 Bacteria 4240
75 Ga0157370_10404382 3300013104 Bacteria 1256
76 Ga0157370_10416931 3300013104 Bacteria 1235
77 Ga0157370_10418905 3300013104 Bacteria 1232
78 Ga0157370_10686947 3300013104 Bacteria 935
79 Ga0157369_10043460 3300013105 Bacteria 4898
80 Ga0157369_10064964 3300013105 Bacteria 3929
81 Ga0163162_10002804 3300013306 Bacteria 16571
82 Ga0163162_10146414 3300013306 Bacteria 2478
83 Ga0163162_10660772 3300013306 Bacteria 1168
84 Ga0157372_10077386 3300013307 Bacteria 3757
85 Ga0157375_10695628 3300013308 Bacteria 1170
86 Ga0157375_10709928 3300013308 Bacteria 1159
87 Ga0157375_10763064 3300013308 Bacteria 1118
88 Ga0157375_11124619 3300013308 Bacteria 920
89 Ga0182008_10015018 3300014497 Bacteria 4049
90 Ga0182008_10021981 3300014497 Bacteria 3269
91 Ga0182008_10028041 3300014497 Bacteria 2849
92 Ga0182008_10124813 3300014497 Bacteria 1281
93 Ga0182008_10164042 3300014497 Bacteria 1119
94 Ga0182008_10196968 3300014497 Bacteria 1024
95 Ga0182008_10199696 3300014497 Bacteria 1017
96 Ga0182006_1008138 3300015261 Bacteria 4757
97 Ga0182006_1012068 3300015261 Bacteria 3784
98 Ga0182006_1038238 3300015261 Bacteria 1898
99 Ga0182006_1072633 3300015261 Bacteria 1272
100 Ga0182006_1082877 3300015261 Bacteria 1167
101 Ga0182006_1083870 3300015261 Bacteria 1158
102 Ga0182005_1020208 3300015265 Bacteria 1834
103 Ga0182005_1023545 3300015265 Bacteria 1682
104 Ga0182005_1046868 3300015265 Bacteria 1174
105 Ga0182005_1054986 3300015265 Bacteria 1084
106 Ga0163161_10026663 3300017792 Bacteria 4094
107 Ga0163161_10050945 3300017792 Bacteria 2997
108 Ga0163161_10148210 3300017792 Bacteria 1782
109 Ga0163161_10278217 3300017792 Bacteria 1312
110 Ga0163161_10368722 3300017792 Bacteria 1145
111 Ga0209760_100037 3300025207 Bacteria 129761
112 Ga0209563_100703 3300025230 Bacteria 10476
113 Ga0207427_100016 3300025231 Bacteria 538697
114 Ga0209437_100011 3300025233 Bacteria 818520
115 Ga0209233_1000019 3300025261 Bacteria 818520
116 Ga0209675_1007380 3300025291 Bacteria 4223
117 Ga0209676_1000025 3300025292 Bacteria 577569
118 Ga0209676_1000032 3300025292 Bacteria 469558
119 Ga0209676_1000318 3300025292 Bacteria 94045
120 Ga0209050_1000025 3300025298 Bacteria 528225
121 Ga0209050_1000381 3300025298 Bacteria 83623
122 Ga0209050_1000981 3300025298 Bacteria 36358
123 Ga0209051_1000026 3300025303 Bacteria 413311
124 Ga0209051_1000299 3300025303 Bacteria 78310
125 Ga0209257_1000034 3300025304 Bacteria 662719
126 Ga0207656_10000008 3300025321 Bacteria 275365
127 Ga0207696_1000057 3300025711 Bacteria 249404
128 Ga0207696_1002043 3300025711 Bacteria 10201
129 Ga0207696_1004054 3300025711 Bacteria 6418
130 Ga0207655_1001265 3300025728 Bacteria 24120
131 Ga0207655_1001320 3300025728 Bacteria 23413
132 Ga0207655_1002555 3300025728 Bacteria 14564
133 Ga0207655_1011490 3300025728 Bacteria 5267
134 Ga0207655_1017780 3300025728 Bacteria 3817
135 Ga0207655_1034389 3300025728 Bacteria 2280
136 Ga0207655_1064697 3300025728 Bacteria 1393
137 Ga0207713_1001759 3300025735 Bacteria 16630
138 Ga0207713_1002871 3300025735 Bacteria 12096
139 Ga0207713_1006851 3300025735 Bacteria 6861
140 Ga0207713_1015274 3300025735 Bacteria 3949
141 Ga0207713_1053449 3300025735 Bacteria 1591
142 Ga0207649_10000001 3300025920 Bacteria 537851
143 Ga0207681_10001569 3300025923 Bacteria 14689
144 Ga0207706_10000069 3300025933 Bacteria 105541
145 Ga0207706_10013390 3300025933 Bacteria 7459
146 Ga0207709_10000022 3300025935 Bacteria 383573
147 Ga0207709_10105049 3300025935 Bacteria 1876
148 Ga0207711_10019450 3300025941 Bacteria 5653
149 Ga0207679_10000011 3300025945 Bacteria 346112
150 Ga0207639_10000099 3300026041 Bacteria 71467
151 Ga0209281_1000026 3300027111 Bacteria 465877
152 Ga0209281_1000033 3300027111 Bacteria 383539
153 Ga0209281_1006372 3300027111 Bacteria 3093
154 Ga0209983_1007167 3300027665 Bacteria 2289
155 Ga0209282_1016451 3300027666 Bacteria 4705
156 Ga0207428_10128566 3300027907 Bacteria 1940
157 Ga0207428_10238065 3300027907 Bacteria 1361
158 Ga0207428_10339048 3300027907 Bacteria 1107
159 Ga0207428_10340626 3300027907 Bacteria 1105
160 Ga0207428_10349722 3300027907 Bacteria 1087
161 Ga0268266_10045723 3300028379 Bacteria 3745
162 Ga0307517_10181803 3300028786 Bacteria 1356
163 Ga0316178_1083481 3300030735 Bacteria 46215
164 Ga0316183_1115597 3300030742 Bacteria 1094
165 Ga0316181_1132780 3300030744 Bacteria 8983
166 Ga0307408_100409023 3300031548 Bacteria 1167
167 Ga0307408_100411689 3300031548 Bacteria 1163
168 Ga0307516_10173178 3300031730 Bacteria 1897
169 Ga0307516_10208998 3300031730 Bacteria 1667
170 Ga0307405_10241772 3300031731 Bacteria 1337
171 Ga0307405_10522412 3300031731 Bacteria 955
172 Ga0307413_10039291 3300031824 Bacteria 2751
173 Ga0307407_10042457 3300031903 Bacteria 2550
174 Ga0307412_10228383 3300031911 Bacteria 1431
175 Ga0307412_10496134 3300031911 Bacteria 1015
176 Ga0307409_100699697 3300031995 Bacteria 1012
177 Ga0307416_100700953 3300032002 Bacteria 1101
178 Ga0307416_100726611 3300032002 Bacteria 1084
179 Ga0307414_10002243 3300032004 Bacteria 10088
180 Ga0307414_10550163 3300032004 Bacteria 1028
181 Ga0307414_10574763 3300032004 Bacteria 1007
182 Ga0307411_10397320 3300032005 Bacteria 1138
183 Ga0307411_10444869 3300032005 Bacteria 1082
184 Ga0307510_10047609 3300033180 Bacteria 4591
185 Ga0237819_00952 3300038705 Bacteria 8820
186 Ga0439438_000783 3300041405 Bacteria 14132
187 Ga0439438_004585 3300041405 Bacteria 5256
188 Ga0439438_006548 3300041405 Bacteria 4090
189 Ga0439438_006674 3300041405 Bacteria 4036
190 Ga0439438_009409 3300041405 Bacteria 3163
191 Ga0439438_018774 3300041405 Bacteria 1963
192 Ga0439447_012503 3300041407 Bacteria 2436
193 Ga0439447_014518 3300041407 Bacteria 2207
194 Ga0439447_020217 3300041407 Bacteria 1768
195 Ga0439447_025907 3300041407 Bacteria 1507
196 Ga0439447_046626 3300041407 Bacteria 1042
197 Ga0439461_0019577 3300041410 Bacteria 1334
198 Ga0439466_0001520 3300041411 Bacteria 9059
199 Ga0439466_0007260 3300041411 Bacteria 4194
200 Ga0439466_0009406 3300041411 Bacteria 3649
201 Ga0439466_0026325 3300041411 Bacteria 2023
202 Ga0439466_0051777 3300041411 Bacteria 1343
203 Ga0439466_0076219 3300041411 Bacteria 1062
204 Ga0439466_0085593 3300041411 Bacteria 991
205 Ga0439466_0089199 3300041411 Bacteria 967
206 Ga0439465_0024791 3300041413 Bacteria 1891
207 Ga0439431_0002600 3300041997 Bacteria 3985
208 Ga0439437_000241 3300042000 Bacteria 4916
209 Ga0439445_0041553 3300042004 Bacteria 1223
210 Ga0439432_001031 3300042006 Bacteria 10565
211 Ga0439432_002040 3300042006 Bacteria 7641
212 Ga0439432_007092 3300042006 Bacteria 3982
213 Ga0439432_017191 3300042006 Bacteria 2429
214 Ga0439432_024693 3300042006 Bacteria 1975
215 Ga0439432_026722 3300042006 Bacteria 1888
216 Ga0439432_066521 3300042006 Bacteria 1103
217 Ga0439451_021169 3300042009 Bacteria 1311
218 Ga0439451_026813 3300042009 Bacteria 1161
219 Ga0439451_026863 3300042009 Bacteria 1160
220 Ga0439451_028903 3300042009 Bacteria 1117
221 Ga0439452_000670 3300042010 Bacteria 16851
222 Ga0439452_000794 3300042010 Bacteria 14949
223 Ga0439452_018520 3300042010 Bacteria 1853
224 Ga0439452_026858 3300042010 Bacteria 1449
225 Ga0439452_038575 3300042010 Bacteria 1133
226 Ga0439452_039566 3300042010 Bacteria 1115
227 Ga0439452_048166 3300042010 Bacteria 984
228 Ga0439456_001644 3300042013 Bacteria 4511
229 Ga0439456_009475 3300042013 Bacteria 2011
230 Ga0439456_012208 3300042013 Bacteria 1780
231 Ga0439456_015017 3300042013 Bacteria 1615
232 Ga0439456_035375 3300042013 Bacteria 1076
233 Ga0439456_035730 3300042013 Bacteria 1071
234 Ga0439456_035998 3300042013 Bacteria 1067
235 Ga0439456_058683 3300042013 Bacteria 844
236 Ga0439463_008953 3300042016 Bacteria 2464
237 Ga0439463_026487 3300042016 Bacteria 1456
238 Ga0439463_043241 3300042016 Bacteria 1146
239 Ga0439463_044840 3300042016 Bacteria 1126
240 Ga0450911_000018 3300042115 Bacteria 104759
241 Ga0450911_001188 3300042115 Bacteria 6352
242 Ga0450911_005032 3300042115 Bacteria 2092
243 Ga0450911_013451 3300042115 Bacteria 1094
244 Ga0450919_003213 3300042121 Bacteria 2069
245 Ga0450919_005273 3300042121 Bacteria 1558
246 Ga0450920_001085 3300042122 Bacteria 4449
247 Ga0450922_000453 3300042124 Bacteria 4404
248 Ga0450922_001694 3300042124 Bacteria 2150
249 Ga0450923_013176 3300042125 Bacteria 1516
250 Ga0450890_001935 3300042127 Bacteria 2927
251 Ga0450891_005895 3300042129 Bacteria 1130
252 Ga0450900_003159 3300042136 Bacteria 1809
253 Ga0450902_016068 3300042137 Bacteria 1218
254 Ga0450902_022213 3300042137 Bacteria 1050
255 Ga0450903_002260 3300042138 Bacteria 3438
256 Ga0450903_003778 3300042138 Bacteria 2609
257 Ga0450903_007597 3300042138 Bacteria 1780
258 Ga0450903_015042 3300042138 Bacteria 1220
259 Ga0450903_020841 3300042138 Bacteria 1013
260 Ga0450903_023742 3300042138 Bacteria 942
261 Ga0450904_000271 3300042139 Bacteria 11182
262 Ga0450904_002407 3300042139 Bacteria 2235
263 Ga0450904_002472 3300042139 Bacteria 2192
264 Ga0450905_003582 3300042142 Bacteria 2042
265 Ga0450905_012168 3300042142 Bacteria 1209
266 Ga0450905_020674 3300042142 Bacteria 970
267 Ga0450906_002239 3300042145 Bacteria 4230
268 Ga0450906_003997 3300042145 Bacteria 3119
269 Ga0450906_024040 3300042145 Bacteria 1083
270 Ga0450907_000319 3300042146 Bacteria 15627
271 Ga0450907_001968 3300042146 Bacteria 4141
272 Ga0450907_006117 3300042146 Bacteria 2016
273 Ga0450910_007754 3300042147 Bacteria 1501
274 Ga0450910_013873 3300042147 Bacteria 1175
275 Ga0439446_0096769 3300042156 Bacteria 929
276 Ga0450908_012070 3300042184 Bacteria 1572
277 Ga0450909_001587 3300042185 Bacteria 3174
278 Ga0450909_005000 3300042185 Bacteria 1904
279 Ga0450909_005594 3300042185 Bacteria 1807
280 Ga0439434_0016587 3300042435 Bacteria 2201
281 Ga0439434_0082787 3300042435 Bacteria 1019
282 Ga0439464_0013879 3300042439 Bacteria 2162
283 Ga0439460_0015656 3300042461 Bacteria 2010
284 Ga0450918_016905 3300042531 Bacteria 1269
285 Ga0450893_0014394 3300042532 Bacteria 1326
286 Ga0450893_0021451 3300042532 Bacteria 1115
287 Ga0450893_0025382 3300042532 Bacteria 1038
288 Ga0450901_001597 3300042533 Bacteria 2567
289 Ga0439440_0010764 3300042993 Bacteria 1919
290 Ga0439440_0011030 3300042993 Bacteria 1900
291 Ga0439440_0040886 3300042993 Bacteria 1129
292 Ga0439440_0043431 3300042993 Bacteria 1102
293 Ga0495617_037768 3300046452 Bacteria 1616
294 Ga0495617_067088 3300046452 Bacteria 1182
295 Ga0495617_079378 3300046452 Bacteria 1075
296 Ga0495617_080486 3300046452 Bacteria 1067
297 Ga0495617_088085 3300046452 Bacteria 1014
298 Ga0495617_096817 3300046452 Bacteria 960
299 Ga0495627_001267 3300046453 Bacteria 15562
300 Ga0495627_019354 3300046453 Bacteria 2283
301 Ga0495627_040808 3300046453 Bacteria 1428
302 Ga0495627_050121 3300046453 Bacteria 1258
303 Ga0495627_054570 3300046453 Bacteria 1194
304 Ga0495627_064345 3300046453 Bacteria 1079
305 Ga0495627_095294 3300046453 Bacteria 853
306 Ga0495603_0023732 3300046455 Bacteria 3710
307 Ga0495603_0100921 3300046455 Bacteria 1684
308 Ga0495603_0224826 3300046455 Bacteria 1082
309 Ga0495603_0298979 3300046455 Bacteria 924
310 Ga0495590_0005691 3300046457 Bacteria 4900
311 Ga0495590_0031965 3300046457 Bacteria 1841
312 Ga0495590_0035559 3300046457 Bacteria 1738
313 Ga0495590_0054910 3300046457 Bacteria 1392
314 Ga0495591_006008 3300046458 Bacteria 5475
315 Ga0495591_009188 3300046458 Bacteria 3951
316 Ga0495591_009335 3300046458 Bacteria 3908
317 Ga0495591_009346 3300046458 Bacteria 3905
318 Ga0495591_009402 3300046458 Bacteria 3891
319 Ga0495591_026051 3300046458 Bacteria 1824
320 Ga0495591_037190 3300046458 Bacteria 1410
321 Ga0495591_038474 3300046458 Bacteria 1376
322 Ga0495591_054000 3300046458 Bacteria 1087
323 Ga0495591_056944 3300046458 Bacteria 1049
324 Ga0495591_058404 3300046458 Bacteria 1031
325 Ga0495591_062234 3300046458 Bacteria 988
326 Ga0495591_063243 3300046458 Bacteria 977
327 Ga0495591_063459 3300046458 Bacteria 975
328 Ga0495629_0029737 3300046459 Bacteria 3873
329 Ga0495638_0021353 3300046460 Bacteria 4270
330 Ga0495638_0024729 3300046460 Bacteria 3910
331 Ga0495638_0026393 3300046460 Bacteria 3763
332 Ga0495638_0041024 3300046460 Bacteria 2930
333 Ga0495638_0141218 3300046460 Bacteria 1405
334 Ga0495638_0147467 3300046460 Bacteria 1367
335 Ga0495638_0161865 3300046460 Bacteria 1290
336 Ga0495638_0192264 3300046460 Bacteria 1157
337 Ga0495638_0195943 3300046460 Bacteria 1143
338 Ga0495638_0204215 3300046460 Bacteria 1113
339 Ga0495638_0220444 3300046460 Bacteria 1060
340 Ga0495638_0245803 3300046460 Bacteria 988
341 Ga0495653_0008133 3300046463 Bacteria 8589
342 Ga0495653_0015309 3300046463 Bacteria 6252
343 Ga0495653_0029993 3300046463 Bacteria 4335
344 Ga0495650_0015737 3300046471 Bacteria 3867
345 Ga0495650_0015746 3300046471 Bacteria 3866
346 Ga0495650_0018288 3300046471 Bacteria 3486
347 Ga0495650_0037443 3300046471 Bacteria 2112
348 Ga0495650_0052349 3300046471 Bacteria 1676
349 Ga0495650_0069489 3300046471 Bacteria 1385
350 Ga0495650_0074150 3300046471 Bacteria 1327
351 Ga0495650_0098122 3300046471 Bacteria 1103
352 Ga0495582_0071158 3300046473 Bacteria 1924
353 Ga0495605_0000246 3300046474 Bacteria 64351
354 Ga0495605_0014541 3300046474 Bacteria 4305
355 Ga0495605_0015560 3300046474 Bacteria 4133
356 Ga0495605_0075866 3300046474 Bacteria 1580
357 Ga0495605_0117801 3300046474 Bacteria 1206
358 Ga0495605_0132288 3300046474 Bacteria 1124
359 Ga0495605_0147348 3300046474 Bacteria 1052
360 Ga0495639_0001551 3300046475 Bacteria 10257
361 Ga0495639_0010965 3300046475 Bacteria 3902
362 Ga0495584_0005435 3300046491 Bacteria 6751
363 Ga0495584_0013994 3300046491 Bacteria 4086
364 Ga0495584_0016523 3300046491 Bacteria 3762
365 Ga0495584_0024887 3300046491 Bacteria 3035
366 Ga0495584_0031735 3300046491 Bacteria 2673
367 Ga0495584_0070437 3300046491 Bacteria 1757
368 Ga0495584_0088226 3300046491 Bacteria 1563
369 Ga0495584_0171829 3300046491 Bacteria 1101
370 Ga0495584_0172727 3300046491 Bacteria 1098
371 Ga0495584_0198015 3300046491 Bacteria 1021
372 Ga0495584_0204514 3300046491 Bacteria 1003
373 Ga0495585_0013551 3300046492 Bacteria 4764
374 Ga0495585_0014847 3300046492 Bacteria 4531
375 Ga0495585_0017937 3300046492 Bacteria 4084
376 Ga0495585_0056686 3300046492 Bacteria 2163
377 Ga0495585_0068394 3300046492 Bacteria 1940
378 Ga0495585_0099401 3300046492 Bacteria 1557
379 Ga0495585_0147731 3300046492 Bacteria 1227
380 Ga0495585_0165454 3300046492 Bacteria 1145
381 Ga0495585_0172481 3300046492 Bacteria 1116
382 Ga0495585_0186085 3300046492 Bacteria 1065
383 Ga0495594_0084849 3300046499 Bacteria 1771
384 Ga0495594_0103538 3300046499 Bacteria 1602
385 Ga0495594_0213815 3300046499 Bacteria 1099
386 Ga0495596_0118221 3300046500 Bacteria 1029
387 Ga0495607_0001148 3300046501 Bacteria 23968
388 Ga0495607_0002250 3300046501 Bacteria 15942
389 Ga0495607_0002707 3300046501 Bacteria 14140
390 Ga0495607_0018812 3300046501 Bacteria 4393
391 Ga0495607_0023114 3300046501 Bacteria 3895
392 Ga0495607_0024514 3300046501 Bacteria 3760
393 Ga0495607_0034140 3300046501 Bacteria 3088
394 Ga0495607_0058730 3300046501 Bacteria 2197
395 Ga0495607_0087203 3300046501 Bacteria 1699
396 Ga0495607_0144511 3300046501 Bacteria 1223
397 Ga0495607_0150143 3300046501 Bacteria 1193
398 Ga0495607_0164504 3300046501 Bacteria 1124
399 Ga0495607_0186317 3300046501 Bacteria 1037
400 Ga0495607_0214016 3300046501 Bacteria 946
401 Ga0495583_0005604 3300046506 Bacteria 8462
402 Ga0495583_0012755 3300046506 Bacteria 4732
403 Ga0495583_0071296 3300046506 Bacteria 1526
404 Ga0495583_0076303 3300046506 Bacteria 1464
405 Ga0495583_0100564 3300046506 Bacteria 1234
406 Ga0495583_0137828 3300046506 Bacteria 1017
407 Ga0495583_0138733 3300046506 Bacteria 1013
408 Ga0495606_0016977 3300046507 Bacteria 5523
409 Ga0495606_0024248 3300046507 Bacteria 4376
410 Ga0495606_0024630 3300046507 Bacteria 4330
411 Ga0495606_0028702 3300046507 Bacteria 3919
412 Ga0495606_0065393 3300046507 Bacteria 2310
413 Ga0495606_0200002 3300046507 Bacteria 1139
414 Ga0495606_0258256 3300046507 Bacteria 963
415 Ga0495606_0276861 3300046507 Bacteria 919
416 Ga0495610_0009319 3300046512 Bacteria 6219
417 Ga0495610_0015655 3300046512 Bacteria 4397
418 Ga0495610_0046117 3300046512 Bacteria 2152
419 Ga0495610_0057601 3300046512 Bacteria 1862
420 Ga0495610_0087194 3300046512 Bacteria 1420
421 Ga0495610_0098834 3300046512 Bacteria 1310
422 Ga0495610_0113724 3300046512 Bacteria 1195
423 Ga0495610_0124704 3300046512 Bacteria 1124
424 Ga0495610_0145373 3300046512 Bacteria 1016
425 Ga0495610_0149386 3300046512 Bacteria 998
426 Ga0495610_0150900 3300046512 Bacteria 991
427 Ga0495616_0014268 3300046513 Bacteria 4454
428 Ga0495616_0016705 3300046513 Bacteria 4055
429 Ga0495616_0018207 3300046513 Bacteria 3860
430 Ga0495616_0037480 3300046513 Bacteria 2494
431 Ga0495616_0058584 3300046513 Bacteria 1896
432 Ga0495616_0099988 3300046513 Bacteria 1361
433 Ga0495616_0102115 3300046513 Bacteria 1343
434 Ga0495616_0102695 3300046513 Bacteria 1339
435 Ga0495616_0148608 3300046513 Bacteria 1061
436 Ga0495620_0010398 3300046515 Bacteria 4911
437 Ga0495620_0020263 3300046515 Bacteria 3250
438 Ga0495620_0036836 3300046515 Bacteria 2184
439 Ga0495620_0079953 3300046515 Bacteria 1323
440 Ga0495620_0079968 3300046515 Bacteria 1323
441 Ga0495620_0087576 3300046515 Bacteria 1252
442 Ga0495620_0108494 3300046515 Bacteria 1101
443 Ga0495620_0112559 3300046515 Bacteria 1077
444 Ga0495620_0145495 3300046515 Bacteria 925
445 Ga0495628_0173838 3300046516 Bacteria 1632
446 Ga0495628_0419688 3300046516 Bacteria 975
447 Ga0495630_0143480 3300046517 Bacteria 1815
448 Ga0495630_0387427 3300046517 Bacteria 1070
449 Ga0495631_0009778 3300046518 Bacteria 4776
450 Ga0495631_0010807 3300046518 Bacteria 4509
451 Ga0495631_0025448 3300046518 Bacteria 2725
452 Ga0495631_0093758 3300046518 Bacteria 1292
453 Ga0495631_0185301 3300046518 Bacteria 891
454 Ga0495631_0193072 3300046518 Bacteria 871
455 Ga0495632_0013983 3300046519 Bacteria 4557
456 Ga0495632_0016110 3300046519 Bacteria 4168
457 Ga0495632_0016947 3300046519 Bacteria 4036
458 Ga0495632_0017184 3300046519 Bacteria 4000
459 Ga0495632_0019197 3300046519 Bacteria 3730
460 Ga0495632_0055128 3300046519 Bacteria 1946
461 Ga0495632_0093099 3300046519 Bacteria 1426
462 Ga0495632_0122253 3300046519 Bacteria 1216
463 Ga0495632_0130945 3300046519 Bacteria 1167
464 Ga0495632_0140071 3300046519 Bacteria 1122
465 Ga0495632_0141151 3300046519 Bacteria 1117
466 Ga0495632_0160846 3300046519 Bacteria 1034
467 Ga0495632_0162183 3300046519 Bacteria 1029
468 Ga0495637_0011881 3300046520 Bacteria 4173
469 Ga0495637_0012319 3300046520 Bacteria 4094
470 Ga0495637_0013369 3300046520 Bacteria 3895
471 Ga0495637_0039623 3300046520 Bacteria 2032
472 Ga0495637_0055274 3300046520 Bacteria 1646
473 Ga0495637_0059527 3300046520 Bacteria 1571
474 Ga0495637_0063802 3300046520 Bacteria 1504
475 Ga0495637_0066387 3300046520 Bacteria 1466
476 Ga0495637_0072596 3300046520 Bacteria 1385
477 Ga0495637_0077275 3300046520 Bacteria 1332
478 Ga0495637_0077636 3300046520 Bacteria 1328
479 Ga0495637_0079422 3300046520 Bacteria 1310
480 Ga0495637_0121861 3300046520 Bacteria 1002
481 Ga0495637_0123024 3300046520 Bacteria 996
482 Ga0495643_0001071 3300046522 Bacteria 27279
483 Ga0495643_0003165 3300046522 Bacteria 12249
484 Ga0495643_0004059 3300046522 Bacteria 10429
485 Ga0495643_0018955 3300046522 Bacteria 3985
486 Ga0495643_0026264 3300046522 Bacteria 3287
487 Ga0495643_0122639 3300046522 Bacteria 1311
488 Ga0495643_0168018 3300046522 Bacteria 1074
489 Ga0495643_0168071 3300046522 Bacteria 1074
490 Ga0495643_0172045 3300046522 Bacteria 1058
491 Ga0495643_0243502 3300046522 Bacteria 842
492 Ga0495644_0025574 3300046523 Bacteria 2240
493 Ga0495644_0104367 3300046523 Bacteria 1073
494 Ga0495644_0149879 3300046523 Bacteria 892
495 Ga0495648_0021054 3300046524 Bacteria 4528
496 Ga0495648_0050577 3300046524 Bacteria 2537
497 Ga0495648_0069543 3300046524 Bacteria 2048
498 Ga0495648_0087169 3300046524 Bacteria 1759
499 Ga0495648_0119070 3300046524 Bacteria 1422
500 Ga0495648_0147189 3300046524 Bacteria 1232
501 Ga0495648_0151066 3300046524 Bacteria 1211
502 Ga0495648_0178258 3300046524 Bacteria 1082
503 Ga0495648_0189569 3300046524 Bacteria 1038
504 Ga0495648_0191441 3300046524 Bacteria 1031
505 Ga0495648_0197884 3300046524 Bacteria 1008
506 Ga0495648_0200989 3300046524 Bacteria 997
507 Ga0495648_0214973 3300046524 Bacteria 952
508 Ga0495648_0241568 3300046524 Bacteria 877
509 Ga0495666_0136343 3300046526 Bacteria 1145
510 Ga0495666_0149988 3300046526 Bacteria 1084
511 Ga0495666_0179354 3300046526 Bacteria 978
512 Ga0495642_0003636 3300046528 Bacteria 6054
513 Ga0495642_0006288 3300046528 Bacteria 4555
514 Ga0495642_0008389 3300046528 Bacteria 3954
515 Ga0495654_0004916 3300046530 Bacteria 7864
516 Ga0495654_0012182 3300046530 Bacteria 4626
517 Ga0495654_0077006 3300046530 Bacteria 1571
518 Ga0495654_0098154 3300046530 Bacteria 1351
519 Ga0495654_0104627 3300046530 Bacteria 1298
520 Ga0495654_0105894 3300046530 Bacteria 1288
521 Ga0495654_0114884 3300046530 Bacteria 1224
522 Ga0495654_0130326 3300046530 Bacteria 1129
523 Ga0495654_0135131 3300046530 Bacteria 1103
524 Ga0495654_0140510 3300046530 Bacteria 1076
525 Ga0495654_0143779 3300046530 Bacteria 1060
526 Ga0495654_0148523 3300046530 Bacteria 1038
527 Ga0495654_0150003 3300046530 Bacteria 1032
528 Ga0495586_0145562 3300046535 Bacteria 1331
529 Ga0495587_0018577 3300046536 Bacteria 4312
530 Ga0495587_0018895 3300046536 Bacteria 4273
531 Ga0495609_0000053 3300046538 Bacteria 149126
532 Ga0495609_0010982 3300046538 Bacteria 4325
533 Ga0495609_0011202 3300046538 Bacteria 4277
534 Ga0495609_0013138 3300046538 Bacteria 3915
535 Ga0495609_0077668 3300046538 Bacteria 1453
536 Ga0495609_0088429 3300046538 Bacteria 1348
537 Ga0495609_0099681 3300046538 Bacteria 1259
538 Ga0495609_0115656 3300046538 Bacteria 1155
539 Ga0495597_0011071 3300046542 Bacteria 4381
540 Ga0495597_0011559 3300046542 Bacteria 4277
541 Ga0495597_0047670 3300046542 Bacteria 1896
542 Ga0495597_0093658 3300046542 Bacteria 1272
543 Ga0495597_0096652 3300046542 Bacteria 1248
544 Ga0495597_0098131 3300046542 Bacteria 1237
545 Ga0495645_0139967 3300046543 Bacteria 1689
546 Ga0495622_0000977 3300046557 Bacteria 15320
547 Ga0495622_0012542 3300046557 Bacteria 3925
548 Ga0495622_0028785 3300046557 Bacteria 2595
549 Ga0495622_0094875 3300046557 Bacteria 1369
550 Ga0495622_0096499 3300046557 Bacteria 1356
551 Ga0495622_0149481 3300046557 Bacteria 1057
552 Ga0495633_0001685 3300046558 Bacteria 16613
553 Ga0495633_0013531 3300046558 Bacteria 4294
554 Ga0495633_0105035 3300046558 Bacteria 1310
555 Ga0495633_0105468 3300046558 Bacteria 1307
556 Ga0495668_0016301 3300046616 Bacteria 4318
557 Ga0495668_0203994 3300046616 Bacteria 1082
558 Ga0495668_0251774 3300046616 Bacteria 967
559 Ga0495634_0018644 3300046642 Bacteria 4936
560 Ga0495634_0081021 3300046642 Bacteria 2123
561 Ga0495634_0158158 3300046642 Bacteria 1430
562 Ga0495611_0003180 3300046648 Bacteria 7271
563 Ga0495611_0077708 3300046648 Bacteria 1522
564 Ga0495611_0149241 3300046648 Bacteria 1091
565 Ga0495611_0177873 3300046648 Bacteria 994
566 Ga0495625_0012751 3300046660 Bacteria 6798
567 Ga0495625_0068167 3300046660 Bacteria 2502
568 Ga0495625_0076099 3300046660 Bacteria 2347
569 Ga0495625_0098151 3300046660 Bacteria 2015
570 Ga0495625_0103402 3300046660 Bacteria 1953
571 Ga0495625_0140824 3300046660 Bacteria 1627
572 Ga0495625_0267849 3300046660 Bacteria 1103
573 Ga0495625_0295753 3300046660 Bacteria 1037
574 Ga0495635_0147707 3300046663 Bacteria 1600
575 Ga0495659_0004187 3300046664 Bacteria 4552
576 Ga0495659_0026539 3300046664 Bacteria 1991
577 Ga0495659_0058797 3300046664 Bacteria 1415
578 Ga0495661_0019957 3300046665 Bacteria 4383
579 Ga0495661_0059952 3300046665 Bacteria 2262
580 Ga0495661_0085515 3300046665 Bacteria 1807
581 Ga0495661_0144513 3300046665 Bacteria 1290
582 Ga0495661_0205535 3300046665 Bacteria 1028
583 Ga0495661_0225918 3300046665 Bacteria 967
584 Ga0495588_0103922 3300046674 Bacteria 1494
585 Ga0495588_0137420 3300046674 Bacteria 1290
586 Ga0495588_0155397 3300046674 Bacteria 1209
587 Ga0495588_0242557 3300046674 Bacteria 950
588 Ga0495623_0016822 3300046679 Bacteria 4725
589 Ga0495623_0116888 3300046679 Bacteria 1610
590 Ga0495646_0014967 3300046680 Bacteria 4927
591 Ga0495646_0039664 3300046680 Bacteria 2902
592 Ga0495646_0067887 3300046680 Bacteria 2106
593 Ga0495669_0001474 3300046684 Bacteria 9705
594 Ga0495669_0091690 3300046684 Bacteria 1403
595 Ga0495613_0137037 3300046689 Bacteria 1751
596 Ga0495624_0006449 3300046690 Bacteria 8326
597 Ga0495670_0011499 3300046691 Bacteria 4353
598 Ga0495670_0050885 3300046691 Bacteria 2073
599 Ga0495670_0059553 3300046691 Bacteria 1917
600 Ga0495670_0106777 3300046691 Bacteria 1446
601 Ga0495670_0127440 3300046691 Bacteria 1325
602 Ga0495670_0143561 3300046691 Bacteria 1249
603 Ga0495670_0153629 3300046691 Bacteria 1207
604 Ga0495670_0173076 3300046691 Bacteria 1137
605 Ga0495670_0233474 3300046691 Bacteria 978
606 Ga0495671_0006003 3300046692 Bacteria 7059
607 Ga0495671_0007411 3300046692 Bacteria 6258
608 Ga0495671_0014510 3300046692 Bacteria 4238
609 Ga0495671_0017911 3300046692 Bacteria 3766
610 Ga0495671_0036791 3300046692 Bacteria 2478
611 Ga0495671_0038097 3300046692 Bacteria 2431
612 Ga0495671_0045950 3300046692 Bacteria 2184
613 Ga0495671_0046769 3300046692 Bacteria 2163
614 Ga0495671_0142367 3300046692 Bacteria 1168
615 Ga0495671_0142590 3300046692 Bacteria 1167
616 Ga0495671_0188700 3300046692 Bacteria 1001
617 Ga0495649_0009233 3300046694 Bacteria 5875
618 Ga0495649_0014456 3300046694 Bacteria 4522
619 Ga0495649_0017231 3300046694 Bacteria 4079
620 Ga0495649_0043916 3300046694 Bacteria 2439
621 Ga0495649_0047213 3300046694 Bacteria 2342
622 Ga0495649_0123088 3300046694 Bacteria 1370
623 Ga0495649_0130573 3300046694 Bacteria 1325
624 Ga0495649_0130575 3300046694 Bacteria 1325
625 Ga0495649_0131104 3300046694 Bacteria 1322
626 Ga0495649_0170365 3300046694 Bacteria 1139
627 Ga0495649_0194323 3300046694 Bacteria 1055
628 Ga0495649_0216614 3300046694 Bacteria 991
629 Ga0495589_0000587 3300046794 Bacteria 24915
630 Ga0495589_0012704 3300046794 Bacteria 4353
631 Ga0495589_0016991 3300046794 Bacteria 3735
632 Ga0495589_0029116 3300046794 Bacteria 2783
633 Ga0495589_0062447 3300046794 Bacteria 1827
634 Ga0495589_0078803 3300046794 Bacteria 1603
635 Ga0495589_0125288 3300046794 Bacteria 1235
636 Ga0495589_0145028 3300046794 Bacteria 1135
637 Ga0495589_0198867 3300046794 Bacteria 946
638 Ga0495589_0206208 3300046794 Bacteria 926
639 Ga0495600_0040402 3300046809 Bacteria 3037
640 Ga0495600_0159448 3300046809 Bacteria 1458
641 Ga0495660_0015934 3300046810 Bacteria 4337
642 Ga0495660_0019503 3300046810 Bacteria 3894
643 Ga0495660_0027716 3300046810 Bacteria 3203
644 Ga0495660_0034452 3300046810 Bacteria 2833
645 Ga0495660_0046194 3300046810 Bacteria 2388
646 Ga0495660_0050642 3300046810 Bacteria 2261
647 Ga0495660_0051793 3300046810 Bacteria 2232
648 Ga0495660_0058464 3300046810 Bacteria 2076
649 Ga0495660_0062284 3300046810 Bacteria 2000
650 Ga0495660_0087943 3300046810 Bacteria 1619
651 Ga0495660_0098062 3300046810 Bacteria 1512
652 Ga0495660_0120408 3300046810 Bacteria 1328
653 Ga0495660_0147017 3300046810 Bacteria 1167
654 Ga0495660_0228420 3300046810 Bacteria 873
655 Ga0495581_0065187 3300047315 Bacteria 2105
656 Ga0495581_0077586 3300047315 Bacteria 1922
657 Ga0495604_0094943 3300047317 Bacteria 2203
658 Ga0495604_0145477 3300047317 Bacteria 1689
659 Ga0495604_0204040 3300047317 Bacteria 1369
660 Ga0495636_0020095 3300047318 Bacteria 2689
661 Ga0495674_0180437 3300047319 Bacteria 1758
662 Ga0495674_0687037 3300047319 Bacteria 804
663 Ga0495672_0002026 3300047320 Bacteria 19104
664 Ga0495672_0007781 3300047320 Bacteria 8013
665 Ga0495672_0023132 3300047320 Bacteria 4028
666 Ga0495672_0023554 3300047320 Bacteria 3983
667 Ga0495672_0148568 3300047320 Bacteria 1217
668 Ga0495672_0155120 3300047320 Bacteria 1183
669 Ga0495672_0158645 3300047320 Bacteria 1165
670 Ga0495672_0161335 3300047320 Bacteria 1152
671 Ga0495672_0178683 3300047320 Bacteria 1076
672 Ga0495672_0194273 3300047320 Bacteria 1018
673 Ga0495672_0201399 3300047320 Bacteria 995
674 Ga0495676_0066839 3300047321 Bacteria 2783
675 Ga0495676_0083234 3300047321 Bacteria 2418
676 Ga0495680_0032796 3300047322 Bacteria 4211
677 Ga0495680_0073016 3300047322 Bacteria 2608
678 Ga0495680_0194825 3300047322 Bacteria 1456
679 Ga0495680_0330804 3300047322 Bacteria 1064
680 Ga0495683_0010503 3300047323 Bacteria 4889
681 Ga0495683_0012509 3300047323 Bacteria 4453
682 Ga0495683_0054876 3300047323 Bacteria 1984
683 Ga0495683_0100097 3300047323 Bacteria 1394
684 Ga0495683_0119608 3300047323 Bacteria 1251
685 Ga0495683_0124530 3300047323 Bacteria 1220
686 Ga0495683_0129457 3300047323 Bacteria 1191
687 Ga0495683_0137290 3300047323 Bacteria 1148
688 Ga0495683_0162163 3300047323 Bacteria 1033
689 Ga0495683_0191192 3300047323 Bacteria 928
690 Ga0495687_013599 3300047443 Bacteria 4235
691 Ga0495687_081413 3300047443 Bacteria 1266
692 Ga0495675_0064234 3300047444 Bacteria 2322
693 Ga0495677_0028720 3300047445 Bacteria 2021
694 Ga0495679_009646 3300047446 Bacteria 3846
695 Ga0495679_017816 3300047446 Bacteria 2535
696 Ga0495679_019986 3300047446 Bacteria 2341
697 Ga0495679_054116 3300047446 Bacteria 1196
698 Ga0495679_057625 3300047446 Bacteria 1148
699 Ga0495679_063285 3300047446 Bacteria 1080
700 Ga0495679_083136 3300047446 Bacteria 906
701 Ga0495685_022846 3300047447 Bacteria 2152
702 Ga0495685_026608 3300047447 Bacteria 1990
703 Ga0495673_0005030 3300047469 Bacteria 8098
704 Ga0495673_0009780 3300047469 Bacteria 5272
705 Ga0495673_0012319 3300047469 Bacteria 4546
706 Ga0495673_0013582 3300047469 Bacteria 4270
707 Ga0495673_0027680 3300047469 Bacteria 2693
708 Ga0495673_0065791 3300047469 Bacteria 1539
709 Ga0495673_0075075 3300047469 Bacteria 1413
710 Ga0495673_0077049 3300047469 Bacteria 1389
711 Ga0495673_0079534 3300047469 Bacteria 1360
712 Ga0495673_0088677 3300047469 Bacteria 1267
713 Ga0495673_0105068 3300047469 Bacteria 1136
714 Ga0495673_0111898 3300047469 Bacteria 1090
715 Ga0495673_0114218 3300047469 Bacteria 1076
716 Ga0495673_0119922 3300047469 Bacteria 1042
717 Ga0495673_0119949 3300047469 Bacteria 1042
718 Ga0495673_0129550 3300047469 Bacteria 992
719 Ga0495673_0174086 3300047469 Bacteria 818
720 Ga0495681_0007814 3300047470 Bacteria 6772
721 Ga0495681_0013783 3300047470 Bacteria 4674
722 Ga0495681_0016258 3300047470 Bacteria 4178
723 Ga0495681_0017009 3300047470 Bacteria 4053
724 Ga0495681_0018090 3300047470 Bacteria 3891
725 Ga0495681_0059413 3300047470 Bacteria 1768
726 Ga0495681_0084372 3300047470 Bacteria 1412
727 Ga0495681_0091558 3300047470 Bacteria 1342
728 Ga0495681_0130960 3300047470 Bacteria 1067
729 Ga0495681_0136506 3300047470 Bacteria 1039
730 Ga0495684_0063092 3300047471 Bacteria 2817
731 Ga0495684_0100174 3300047471 Bacteria 2190
732 Ga0495686_0011348 3300047472 Bacteria 6280
733 Ga0495686_0025100 3300047472 Bacteria 3908
734 Ga0495686_0089889 3300047472 Bacteria 1865
735 Ga0495686_0211311 3300047472 Bacteria 1108
736 Ga0495593_0059867 3300047673 Bacteria 1994
737 Ga0495593_0077007 3300047673 Bacteria 1727
738 Ga0495593_0124863 3300047673 Bacteria 1308
739 Ga0495593_0165503 3300047673 Bacteria 1115
740 Ga0495602_0074105 3300048088 Bacteria 2894
741 Ga0495626_0001849 3300048091 Bacteria 15889
742 Ga0495626_0002063 3300048091 Bacteria 14667
743 Ga0495626_0012097 3300048091 Bacteria 4539
744 Ga0495626_0013302 3300048091 Bacteria 4277
745 Ga0495626_0028334 3300048091 Bacteria 2716
746 Ga0495626_0081221 3300048091 Bacteria 1439
747 Ga0495626_0109319 3300048091 Bacteria 1198
748 Ga0495626_0113131 3300048091 Bacteria 1173
749 Ga0495626_0118812 3300048091 Bacteria 1138
750 Ga0495626_0122448 3300048091 Bacteria 1116
751 Ga0495626_0129512 3300048091 Bacteria 1078
752 Ga0495626_0163068 3300048091 Bacteria 933
753 Ga0496101_0472887 3300048904 Bacteria 989
754 Ga0496102_0029602 3300048905 Bacteria 4900
755 Ga0496103_0283973 3300048906 Bacteria 1064
756 Ga0496104_0536594 3300048907 Bacteria 1081
757 Ga0496105_0401947 3300048908 Bacteria 1087
758 Ga0496107_0386880 3300048910 Bacteria 1040
759 Ga0496110_0254188 3300048913 Bacteria 1599
760 Ga0496114_0284253 3300048917 Bacteria 1459
761 Ga0496116_0004746 3300048919 Bacteria 12836
762 Ga0496116_0016123 3300048919 Bacteria 5866
763 Ga0496116_0087859 3300048919 Bacteria 1901
764 Ga0496116_0134950 3300048919 Bacteria 1399
765 Ga0496116_0202202 3300048919 Bacteria 1038
766 Ga0496117_0033142 3300048920 Bacteria 3910
767 Ga0496117_0078731 3300048920 Bacteria 2174
768 Ga0496117_0095080 3300048920 Bacteria 1905
769 Ga0496117_0101411 3300048920 Bacteria 1820
770 Ga0496117_0235647 3300048920 Bacteria 1008
771 Ga0496117_0244619 3300048920 Bacteria 982
772 Ga0496118_0037568 3300048921 Bacteria 3895
773 Ga0496118_0087797 3300048921 Bacteria 2155
774 Ga0496118_0107116 3300048921 Bacteria 1867
775 Ga0496118_0205148 3300048921 Bacteria 1163
776 Ga0496119_0065278 3300048922 Bacteria 2156
777 Ga0496119_0138328 3300048922 Bacteria 1318
778 Ga0496119_0235092 3300048922 Bacteria 930
779 Ga0496120_0103528 3300048923 Bacteria 1499
780 Ga0496120_0210348 3300048923 Bacteria 935
781 Ga0496121_0047275 3300048924 Bacteria 3673
782 Ga0496121_0109908 3300048924 Bacteria 2104
783 Ga0496121_0232656 3300048924 Bacteria 1289
784 Ga0496121_0288765 3300048924 Bacteria 1118
785 Ga0496122_0102453 3300048925 Bacteria 1908
786 Ga0496122_0212581 3300048925 Bacteria 1118
787 Ga0496122_0216223 3300048925 Bacteria 1104
788 Ga0496123_0175852 3300048926 Bacteria 1123
789 Ga0496123_0182240 3300048926 Bacteria 1095
790 Ga0496123_0240857 3300048926 Bacteria 898
791 Ga0496124_0000120 3300048927 Bacteria 163899
792 Ga0496124_0089046 3300048927 Bacteria 2521
793 Ga0496124_0158040 3300048927 Bacteria 1770
794 Ga0496124_0213028 3300048927 Bacteria 1460
795 Ga0496124_0338096 3300048927 Bacteria 1070
796 Ga0496124_0509605 3300048927 Bacteria 804
797 Ga0496125_0052982 3300048928 Bacteria 3331
798 Ga0496125_0063050 3300048928 Bacteria 2958
799 Ga0496125_0301350 3300048928 Bacteria 981
800 Ga0496125_0304538 3300048928 Bacteria 974
801 Ga0496125_0309874 3300048928 Bacteria 962
802 Ga0496126_0212624 3300048929 Bacteria 1627
803 Ga0495678_012258 3300049459 Bacteria 4068
804 Ga0495678_030258 3300049459 Bacteria 2266
805 Ga0495678_036418 3300049459 Bacteria 2007
806 Ga0495678_056602 3300049459 Bacteria 1489
807 Ga0495678_059030 3300049459 Bacteria 1447
808 Ga0495678_062139 3300049459 Bacteria 1399
809 Ga0495678_070782 3300049459 Bacteria 1279
810 Ga0495678_089560 3300049459 Bacteria 1086
811 Ga0495678_091613 3300049459 Bacteria 1069
812 Ga0495678_093561 3300049459 Bacteria 1053
813 Ga0495678_100429 3300049459 Bacteria 1003
814 Ga0495678_100504 3300049459 Bacteria 1002
815 Ga0495678_102294 3300049459 Bacteria 990
816 Ga0495678_103272 3300049459 Bacteria 984
817 Ga0495678_108119 3300049459 Bacteria 952
818 Ga0495682_0007794 3300049460 Bacteria 4241
819 Ga0495682_0020205 3300049460 Bacteria 2500
820 Ga0495682_0025638 3300049460 Bacteria 2193
821 Ga0495682_0081420 3300049460 Bacteria 1164
822 Ga0495682_0098053 3300049460 Bacteria 1052
823 Ga0495682_0103060 3300049460 Bacteria 1023
824 Ga0495682_0145320 3300049460 Bacteria 846
825 Ga0501222_009583 3300049662 Bacteria 1281
826 Ga0501227_025523 3300049665 Bacteria 1386
827 Ga0501241_005307 3300049758 Bacteria 2406
828 Ga0501226_000002 3300049853 Bacteria 426935
829 Ga0501226_006651 3300049853 Bacteria 1308
830 nmdc:mga03683_146217_c1 3300050489 Bacteria 1065
831 nmdc:mga03683_208505_c1 3300050489 Bacteria 898
832 nmdc:mga03683_9895_c1 3300050489 Bacteria 3405
833 nmdc:mga03n38_248732_c1 3300050490 Bacteria 938
834 nmdc:mga00v17_361873_c1 3300050491 Bacteria 943
835 nmdc:mga00v17_90411_c1 3300050491 Bacteria 1922
836 Ga0500572_011163 3300053111 Bacteria 2164
837 Ga0500577_0101793 3300053142 Bacteria 1175
838 Ga0500586_038340 3300053145 Bacteria 1614
839 2511254751 2511231004 Bacteria 6669789
840 2511265563 2511231006 Bacteria 6794709
841 2511271108 2511231007 Bacteria 6306603
842 2511280547 2511231008 Bacteria 6624100
843 2511297953 2511231011 Bacteria 6149768
844 2511302376 2511231012 Bacteria 6738011
845 2511315226 2511231014 Bacteria 6462302
846 2511320784 2511231015 Bacteria 6598026
847 2511326061 2511231016 Bacteria 6704427
848 2511331017 2511231017 Bacteria 6503007
849 2511336365 2511231018 Bacteria 6436256
850 2511345729 2511231019 Bacteria 6520662
851 2511349073 2511231020 Bacteria 6115223
852 2511360686 2511231022 Bacteria 6719296
853 2511368597 2511231023 Bacteria 6808468
854 2511411285 2511231031 Bacteria 6558529
855 2512325925 2512047018 Bacteria 6663241
856 2554818093 2554235132 Bacteria 6772433
857 2583789834 2582580891 Bacteria 6800976
858 2597855632 2597489887 Bacteria 6666321
859 2599398877 2599185167 Bacteria 6353609
860 2599450932 2599185179 Bacteria 6611171
861 2599485534 2599185185 Bacteria 6652270
862 2599514122 2599185190 Bacteria 6285678
863 2599518723 2599185191 Bacteria 6297582
864 2599806663 2599185257 Bacteria 6492581
865 2599893543 2599185290 Bacteria 6289611
866 2599943629 2599185302 Bacteria 5954930
867 2599955939 2599185304 Bacteria 5951361
868 2599984633 2599185309 Bacteria 5969593
869 2599991214 2599185310 Bacteria 6014457
870 2599994894 2599185311 Bacteria 6354990
871 2600002255 2599185312 Bacteria 5912071
872 2600023924 2599185316 Bacteria 6320029
873 2600032667 2599185317 Bacteria 6435722
874 2600034717 2599185318 Bacteria 6961590
875 2600044888 2599185319 Bacteria 6637840
876 2600048025 2599185320 Bacteria 5963263
877 2600061274 2599185322 Bacteria 6763055
878 2600068165 2599185323 Bacteria 6688755
879 2600077617 2599185325 Bacteria 6324919
880 2600362192 2600254930 Bacteria 6431253
881 2600364912 2600254931 Bacteria 6734225
882 2601627217 2600255283 Bacteria 6061572
883 2601797803 2600255318 Bacteria 6383414
884 2606076714 2603880185 Bacteria 6379190
885 2606128872 2603880199 Bacteria 6377649
886 2608380605 2606217733 Bacteria 6360972
887 2624478191 2623620443 Bacteria 6427864
888 2624489734 2623620446 Bacteria 6500345
889 2643840950 2643221565 Bacteria 6216018
890 2643954942 2643221589 Bacteria 6250934
891 2644024582 2643221602 Bacteria 6249926
892 2644186092 2643221633 Bacteria 6733554
893 2652547308 2651869719 Bacteria 6047974
894 2671127293 2667528176 Bacteria 6724917
895 2671772314 2671180172 Bacteria 6495783
896 2678260946 2675903515 Bacteria 6580491
897 2715749178 2713897148 Bacteria 5883533
898 2715759529 2713897149 Bacteria 6506249
899 2718632131 2718217725 Bacteria 5758958
900 2729146476 2728369097 Bacteria 4333476
901 2739197998 2738543004 Bacteria 6381073
902 2739260339 2738543015 Bacteria 6750701
903 2739286974 2738543020 Bacteria 5718238
904 2739292287 2738543021 Bacteria 5718241
905 2739311251 2738543025 Bacteria 6600348
906 2743735049 2740892503 Bacteria 6855563
907 2745006258 2744054620 Bacteria 6551379
908 2774119589 2773857670 Bacteria 6407454
909 2774134708 2773857673 Bacteria 6513460
910 2784261077 2784132063 Bacteria 6262788
911 2784316336 2784132072 Bacteria 6596533
912 2808855899 2808606361 Bacteria 6136259
913 2808905464 2808606373 Bacteria 4423627
914 2808922786 2808606376 Bacteria 6248667
915 2808932150 2808606377 Bacteria 6646337
916 2808935979 2808606378 Bacteria 6177535
917 2808939714 2808606379 Bacteria 5022697
918 2808944473 2808606380 Bacteria 6248705
919 2808954249 2808606381 Bacteria 6646461
920 2808955829 2808606382 Bacteria 6841132
921 2808964524 2808606383 Bacteria 6138645
922 2808999412 2808606389 Bacteria 6138126
923 2809217949 2808606445 Bacteria 6057339
924 2819657199 2818991456 Bacteria 6123676
925 2825654297 2825651385 Bacteria 6715909
926 2826582476 2826581358 Bacteria 5963467
927 2842817682 2842815866 Bacteria 5947510
928 2842832339 2842826826 Bacteria 5974129
929 2842834132 2842832357 Bacteria 5959113
930 2842838596 2842837860 Bacteria 6066181
931 2842846393 2842843487 Bacteria 6004777
932 2842851636 2842849001 Bacteria 5924277
933 2842858765 2842854478 Bacteria 6143501
934 2844667869 2844665904 Bacteria 6817974
935 2852660482 2852657418 Bacteria 6472974
936 2860343669 2860339153 Bacteria 6846989
937 2878030135 2878029506 Bacteria 6418441
938 2880231082 2880230671 Bacteria 6140320
939 2904519541 2904518522 Bacteria 6068986
940 2904552274 2904550169 Bacteria 6221258
941 2919066183 2919063839 Bacteria 6302690
942 2919389805 2919385768 Bacteria 5897293
943 2919459957 2919456309 Bacteria 6586567
944 2919486847 2919481497 Bacteria 6907839
945 2919488737 2919487758 Bacteria 5929766
946 2919698988 2919697872 Bacteria 6553725
947 2923154043 2923153595 Bacteria 6870622
948 2929144774 2929144301 Bacteria 6622272
949 2931391353 2931390751 Bacteria 6273349
950 2931398807 2931396565 Bacteria 7251677
951 2939641069 2939636861 Bacteria 6297853
952 2946028616 2946027586 Bacteria 6049274
953 2969304930 2969304461 Bacteria 6601805
954 2974293377 2974289157 Bacteria 6080362
955 2984292016 2984286254 Bacteria 6702062
956 2988732166 2988728565 Bacteria 6124362
957 2998140426 2998139840 Bacteria 6073514
958 3007398056 3007395558 Bacteria 6755444
959 3007517865 3007511990 Bacteria 6481491
960 3007615200 3007614139 Bacteria 6053559
961 3007625017 3007619802 Bacteria 6411688
962 3007721193 3007718800 Bacteria 5971527
963 3007859671 3007855910 Bacteria 5637581
964 3007864361 3007861166 Bacteria 6045338
965 3007872069 3007866637 Bacteria 5899198
966 8011352517 8011350971 Bacteria 6158957
967 8015688292 8015687852 Bacteria 6613826
968 8019770279 8019769354 Bacteria 6924660
969 8019777308 8019775933 Bacteria 6858656
970 8054503929 8054503363 Bacteria 6101651
971 8055771390 8055770955 Bacteria 6827675
972 8056126434 8056125926 Bacteria 6228218
973 8056142679 8056137416 Bacteria 6147080
974 8056143700 8056143049 Bacteria 6307666
975 8056158484 8056155041 Bacteria 6486948
976 8056170619 8056166840 Bacteria 5820959
977 8056176732 8056172158 Bacteria 6133900
978 8056183081 8056177738 Bacteria 6748268
979 8056572292 8056569372 Bacteria 5997322
980 8057802681 8057798959 Bacteria 6713499
981 Ga0439451_010326
982 MRS2a_Contig_841
983 SwRhRL2b_contig_7644
984 MBSR1b_contig_7640429
985 JGI25162J39368_1000098
986 JGI25163J39215_1001163
987 JGI25164J39214_1000076
988 JGI25165J46597_1000180
989 Ga0055536_1001506
990 Ga0055536_1004111
991 Ga0055536_1017763
992 Ga0055530_10000677
993 Ga0055530_10001490
994 Ga0055540_1000217
995 Ga0055540_1001429
996 Ga0055531_10000238
997 Ga0055531_10000275
998 Ga0065714_10000623
999 Ga0065714_10014927
1000 Ga0065714_10033938
1001 Ga0065714_10120319
1002 Ga0065714_10158496
1003 Ga0065704_10070786
1004 Ga0065704_10111549
1005 Ga0065712_10068398
1006 Ga0065715_10006941
1007 Ga0070669_100000221
1008 Ga0070669_100004459
1009 Ga0070669_100217126
1010 Ga0070662_100001883
1011 Ga0068853_100000089
1012 Ga0070665_100154401
1013 Ga0070664_100007327
1014 Ga0070664_100446119
1015 Ga0068851_10000024
1016 Ga0075364_10254605
1017 Ga0075364_10273311
1018 Ga0075432_10073565
1019 Ga0075432_10091394
1020 Ga0075432_10092135
1021 Ga0075362_10115415
1022 Ga0075362_10124473
1023 Ga0075436_100262996
1024 Ga0075436_100276046
1025 Ga0075436_100381306
1026 Ga0079104_1000508
1027 Ga0079104_1000732
1028 Ga0099826_10010490
1029 Ga0105251_10076327
1030 Ga0105251_10103057
1031 Ga0105251_10130791
1032 Ga0105244_10056276
1033 Ga0105244_10057561
1034 Ga0105244_10084700
1035 Ga0105244_10133019
1036 Ga0105244_10147702
1037 Ga0105244_10148770
1038 Ga0105250_10083280
1039 Ga0105250_10128568
1040 Ga0105243_10000930
1041 Ga0105243_10130877
1042 Ga0105242_10028253
1043 Ga0105248_10018503
1044 Ga0105246_10000305
1045 Ga0105246_10013235
1046 Ga0157345_1000263
1047 Ga0157373_10075583
1048 Ga0157373_10212130
1049 Ga0157373_10276354
1050 Ga0157373_10346967
1051 Ga0157371_10019663
1052 Ga0157371_10026569
1053 Ga0157371_10270950
1054 Ga0157370_10044961
1055 Ga0157370_10404382
1056 Ga0157370_10416931
1057 Ga0157370_10418905
1058 Ga0157370_10686947
1059 Ga0157369_10043460
1060 Ga0157369_10064964
1061 Ga0163162_10002804
1062 Ga0163162_10146414
1063 Ga0163162_10660772
1064 Ga0157372_10077386
1065 Ga0157375_10695628
1066 Ga0157375_10709928
1067 Ga0157375_10763064
1068 Ga0157375_11124619
1069 Ga0182008_10015018
1070 Ga0182008_10021981
1071 Ga0182008_10028041
1072 Ga0182008_10124813
1073 Ga0182008_10164042
1074 Ga0182008_10196968
1075 Ga0182008_10199696
1076 Ga0182006_1008138
1077 Ga0182006_1012068
1078 Ga0182006_1038238
1079 Ga0182006_1072633
1080 Ga0182006_1082877
1081 Ga0182006_1083870
1082 Ga0182005_1020208
1083 Ga0182005_1023545
1084 Ga0182005_1046868
1085 Ga0182005_1054986
1086 Ga0163161_10026663
1087 Ga0163161_10050945
1088 Ga0163161_10148210
1089 Ga0163161_10278217
1090 Ga0163161_10368722
1091 Ga0209760_100037
1092 Ga0209563_100703
1093 Ga0207427_100016
1094 Ga0209437_100011
1095 Ga0209233_1000019
1096 Ga0209675_1007380
1097 Ga0209676_1000025
1098 Ga0209676_1000032
1099 Ga0209676_1000318
1100 Ga0209050_1000025
1101 Ga0209050_1000381
1102 Ga0209050_1000981
1103 Ga0209051_1000026
1104 Ga0209051_1000299
1105 Ga0209257_1000034
1106 Ga0207656_10000008
1107 Ga0207696_1000057
1108 Ga0207696_1002043
1109 Ga0207696_1004054
1110 Ga0207655_1001265
1111 Ga0207655_1001320
1112 Ga0207655_1002555
1113 Ga0207655_1011490
1114 Ga0207655_1017780
1115 Ga0207655_1034389
1116 Ga0207655_1064697
1117 Ga0207713_1001759
1118 Ga0207713_1002871
1119 Ga0207713_1006851
1120 Ga0207713_1015274
1121 Ga0207713_1053449
1122 Ga0207649_10000001
1123 Ga0207681_10001569
1124 Ga0207706_10000069
1125 Ga0207706_10013390
1126 Ga0207709_10000022
1127 Ga0207709_10105049
1128 Ga0207711_10019450
1129 Ga0207679_10000011
1130 Ga0207639_10000099
1131 Ga0209281_1000026
1132 Ga0209281_1000033
1133 Ga0209281_1006372
1134 Ga0209983_1007167
1135 Ga0209282_1016451
1136 Ga0207428_10128566
1137 Ga0207428_10238065
1138 Ga0207428_10339048
1139 Ga0207428_10340626
1140 Ga0207428_10349722
1141 Ga0268266_10045723
1142 Ga0307517_10181803
1143 Ga0316178_1083481
1144 Ga0316183_1115597
1145 Ga0316181_1132780
1146 Ga0307408_100409023
1147 Ga0307408_100411689
1148 Ga0307516_10173178
1149 Ga0307516_10208998
1150 Ga0307405_10241772
1151 Ga0307405_10522412
1152 Ga0307413_10039291
1153 Ga0307407_10042457
1154 Ga0307412_10228383
1155 Ga0307412_10496134
1156 Ga0307409_100699697
1157 Ga0307416_100700953
1158 Ga0307416_100726611
1159 Ga0307414_10002243
1160 Ga0307414_10550163
1161 Ga0307414_10574763
1162 Ga0307411_10397320
1163 Ga0307411_10444869
1164 Ga0307510_10047609
1165 Ga0237819_00952
1166 Ga0439438_000783
1167 Ga0439438_004585
1168 Ga0439438_006548
1169 Ga0439438_006674
1170 Ga0439438_009409
1171 Ga0439438_018774
1172 Ga0439447_012503
1173 Ga0439447_014518
1174 Ga0439447_020217
1175 Ga0439447_025907
1176 Ga0439447_046626
1177 Ga0439461_0019577
1178 Ga0439466_0001520
1179 Ga0439466_0007260
1180 Ga0439466_0009406
1181 Ga0439466_0026325
1182 Ga0439466_0051777
1183 Ga0439466_0076219
1184 Ga0439466_0085593
1185 Ga0439466_0089199
1186 Ga0439465_0024791
1187 Ga0439431_0002600
1188 Ga0439437_000241
1189 Ga0439445_0041553
1190 Ga0439432_001031
1191 Ga0439432_002040
1192 Ga0439432_007092
1193 Ga0439432_017191
1194 Ga0439432_024693
1195 Ga0439432_026722
1196 Ga0439432_066521
1197 Ga0439451_021169
1198 Ga0439451_026813
1199 Ga0439451_026863
1200 Ga0439451_028903
1201 Ga0439452_000670
1202 Ga0439452_000794
1203 Ga0439452_018520
1204 Ga0439452_026858
1205 Ga0439452_038575
1206 Ga0439452_039566
1207 Ga0439452_048166
1208 Ga0439456_001644
1209 Ga0439456_009475
1210 Ga0439456_012208
1211 Ga0439456_015017
1212 Ga0439456_035375
1213 Ga0439456_035730
1214 Ga0439456_035998
1215 Ga0439456_058683
1216 Ga0439463_008953
1217 Ga0439463_026487
1218 Ga0439463_043241
1219 Ga0439463_044840
1220 Ga0450911_000018
1221 Ga0450911_001188
1222 Ga0450911_005032
1223 Ga0450911_013451
1224 Ga0450919_003213
1225 Ga0450919_005273
1226 Ga0450920_001085
1227 Ga0450922_000453
1228 Ga0450922_001694
1229 Ga0450923_013176
1230 Ga0450890_001935
1231 Ga0450891_005895
1232 Ga0450900_003159
1233 Ga0450902_016068
1234 Ga0450902_022213
1235 Ga0450903_002260
1236 Ga0450903_003778
1237 Ga0450903_007597
1238 Ga0450903_015042
1239 Ga0450903_020841
1240 Ga0450903_023742
1241 Ga0450904_000271
1242 Ga0450904_002407
1243 Ga0450904_002472
1244 Ga0450905_003582
1245 Ga0450905_012168
1246 Ga0450905_020674
1247 Ga0450906_002239
1248 Ga0450906_003997
1249 Ga0450906_024040
1250 Ga0450907_000319
1251 Ga0450907_001968
1252 Ga0450907_006117
1253 Ga0450910_007754
1254 Ga0450910_013873
1255 Ga0439446_0096769
1256 Ga0450908_012070
1257 Ga0450909_001587
1258 Ga0450909_005000
1259 Ga0450909_005594
1260 Ga0439434_0016587
1261 Ga0439434_0082787
1262 Ga0439464_0013879
1263 Ga0439460_0015656
1264 Ga0450918_016905
1265 Ga0450893_0014394
1266 Ga0450893_0021451
1267 Ga0450893_0025382
1268 Ga0450901_001597
1269 Ga0439440_0010764
1270 Ga0439440_0011030
1271 Ga0439440_0040886
1272 Ga0439440_0043431
1273 Ga0495617_037768
1274 Ga0495617_067088
1275 Ga0495617_079378
1276 Ga0495617_080486
1277 Ga0495617_088085
1278 Ga0495617_096817
1279 Ga0495627_001267
1280 Ga0495627_019354
1281 Ga0495627_040808
1282 Ga0495627_050121
1283 Ga0495627_054570
1284 Ga0495627_064345
1285 Ga0495627_095294
1286 Ga0495603_0023732
1287 Ga0495603_0100921
1288 Ga0495603_0224826
1289 Ga0495603_0298979
1290 Ga0495590_0005691
1291 Ga0495590_0031965
1292 Ga0495590_0035559
1293 Ga0495590_0054910
1294 Ga0495591_006008
1295 Ga0495591_009188
1296 Ga0495591_009335
1297 Ga0495591_009346
1298 Ga0495591_009402
1299 Ga0495591_026051
1300 Ga0495591_037190
1301 Ga0495591_038474
1302 Ga0495591_054000
1303 Ga0495591_056944
1304 Ga0495591_058404
1305 Ga0495591_062234
1306 Ga0495591_063243
1307 Ga0495591_063459
1308 Ga0495629_0029737
1309 Ga0495638_0021353
1310 Ga0495638_0024729
1311 Ga0495638_0026393
1312 Ga0495638_0041024
1313 Ga0495638_0141218
1314 Ga0495638_0147467
1315 Ga0495638_0161865
1316 Ga0495638_0192264
1317 Ga0495638_0195943
1318 Ga0495638_0204215
1319 Ga0495638_0220444
1320 Ga0495638_0245803
1321 Ga0495653_0008133
1322 Ga0495653_0015309
1323 Ga0495653_0029993
1324 Ga0495650_0015737
1325 Ga0495650_0015746
1326 Ga0495650_0018288
1327 Ga0495650_0037443
1328 Ga0495650_0052349
1329 Ga0495650_0069489
1330 Ga0495650_0074150
1331 Ga0495650_0098122
1332 Ga0495582_0071158
1333 Ga0495605_0000246
1334 Ga0495605_0014541
1335 Ga0495605_0015560
1336 Ga0495605_0075866
1337 Ga0495605_0117801
1338 Ga0495605_0132288
1339 Ga0495605_0147348
1340 Ga0495639_0001551
1341 Ga0495639_0010965
1342 Ga0495584_0005435
1343 Ga0495584_0013994
1344 Ga0495584_0016523
1345 Ga0495584_0024887
1346 Ga0495584_0031735
1347 Ga0495584_0070437
1348 Ga0495584_0088226
1349 Ga0495584_0171829
1350 Ga0495584_0172727
1351 Ga0495584_0198015
1352 Ga0495584_0204514
1353 Ga0495585_0013551
1354 Ga0495585_0014847
1355 Ga0495585_0017937
1356 Ga0495585_0056686
1357 Ga0495585_0068394
1358 Ga0495585_0099401
1359 Ga0495585_0147731
1360 Ga0495585_0165454
1361 Ga0495585_0172481
1362 Ga0495585_0186085
1363 Ga0495594_0084849
1364 Ga0495594_0103538
1365 Ga0495594_0213815
1366 Ga0495596_0118221
1367 Ga0495607_0001148
1368 Ga0495607_0002250
1369 Ga0495607_0002707
1370 Ga0495607_0018812
1371 Ga0495607_0023114
1372 Ga0495607_0024514
1373 Ga0495607_0034140
1374 Ga0495607_0058730
1375 Ga0495607_0087203
1376 Ga0495607_0144511
1377 Ga0495607_0150143
1378 Ga0495607_0164504
1379 Ga0495607_0186317
1380 Ga0495607_0214016
1381 Ga0495583_0005604
1382 Ga0495583_0012755
1383 Ga0495583_0071296
1384 Ga0495583_0076303
1385 Ga0495583_0100564
1386 Ga0495583_0137828
1387 Ga0495583_0138733
1388 Ga0495606_0016977
1389 Ga0495606_0024248
1390 Ga0495606_0024630
1391 Ga0495606_0028702
1392 Ga0495606_0065393
1393 Ga0495606_0200002
1394 Ga0495606_0258256
1395 Ga0495606_0276861
1396 Ga0495610_0009319
1397 Ga0495610_0015655
1398 Ga0495610_0046117
1399 Ga0495610_0057601
1400 Ga0495610_0087194
1401 Ga0495610_0098834
1402 Ga0495610_0113724
1403 Ga0495610_0124704
1404 Ga0495610_0145373
1405 Ga0495610_0149386
1406 Ga0495610_0150900
1407 Ga0495616_0014268
1408 Ga0495616_0016705
1409 Ga0495616_0018207
1410 Ga0495616_0037480
1411 Ga0495616_0058584
1412 Ga0495616_0099988
1413 Ga0495616_0102115
1414 Ga0495616_0102695
1415 Ga0495616_0148608
1416 Ga0495620_0010398
1417 Ga0495620_0020263
1418 Ga0495620_0036836
1419 Ga0495620_0079953
1420 Ga0495620_0079968
1421 Ga0495620_0087576
1422 Ga0495620_0108494
1423 Ga0495620_0112559
1424 Ga0495620_0145495
1425 Ga0495628_0173838
1426 Ga0495628_0419688
1427 Ga0495630_0143480
1428 Ga0495630_0387427
1429 Ga0495631_0009778
1430 Ga0495631_0010807
1431 Ga0495631_0025448
1432 Ga0495631_0093758
1433 Ga0495631_0185301
1434 Ga0495631_0193072
1435 Ga0495632_0013983
1436 Ga0495632_0016110
1437 Ga0495632_0016947
1438 Ga0495632_0017184
1439 Ga0495632_0019197
1440 Ga0495632_0055128
1441 Ga0495632_0093099
1442 Ga0495632_0122253
1443 Ga0495632_0130945
1444 Ga0495632_0140071
1445 Ga0495632_0141151
1446 Ga0495632_0160846
1447 Ga0495632_0162183
1448 Ga0495637_0011881
1449 Ga0495637_0012319
1450 Ga0495637_0013369
1451 Ga0495637_0039623
1452 Ga0495637_0055274
1453 Ga0495637_0059527
1454 Ga0495637_0063802
1455 Ga0495637_0066387
1456 Ga0495637_0072596
1457 Ga0495637_0077275
1458 Ga0495637_0077636
1459 Ga0495637_0079422
1460 Ga0495637_0121861
1461 Ga0495637_0123024
1462 Ga0495643_0001071
1463 Ga0495643_0003165
1464 Ga0495643_0004059
1465 Ga0495643_0018955
1466 Ga0495643_0026264
1467 Ga0495643_0122639
1468 Ga0495643_0168018
1469 Ga0495643_0168071
1470 Ga0495643_0172045
1471 Ga0495643_0243502
1472 Ga0495644_0025574
1473 Ga0495644_0104367
1474 Ga0495644_0149879
1475 Ga0495648_0021054
1476 Ga0495648_0050577
1477 Ga0495648_0069543
1478 Ga0495648_0087169
1479 Ga0495648_0119070
1480 Ga0495648_0147189
1481 Ga0495648_0151066
1482 Ga0495648_0178258
1483 Ga0495648_0189569
1484 Ga0495648_0191441
1485 Ga0495648_0197884
1486 Ga0495648_0200989
1487 Ga0495648_0214973
1488 Ga0495648_0241568
1489 Ga0495666_0136343
1490 Ga0495666_0149988
1491 Ga0495666_0179354
1492 Ga0495642_0003636
1493 Ga0495642_0006288
1494 Ga0495642_0008389
1495 Ga0495654_0004916
1496 Ga0495654_0012182
1497 Ga0495654_0077006
1498 Ga0495654_0098154
1499 Ga0495654_0104627
1500 Ga0495654_0105894
1501 Ga0495654_0114884
1502 Ga0495654_0130326
1503 Ga0495654_0135131
1504 Ga0495654_0140510
1505 Ga0495654_0143779
1506 Ga0495654_0148523
1507 Ga0495654_0150003
1508 Ga0495586_0145562
1509 Ga0495587_0018577
1510 Ga0495587_0018895
1511 Ga0495609_0000053
1512 Ga0495609_0010982
1513 Ga0495609_0011202
1514 Ga0495609_0013138
1515 Ga0495609_0077668
1516 Ga0495609_0088429
1517 Ga0495609_0099681
1518 Ga0495609_0115656
1519 Ga0495597_0011071
1520 Ga0495597_0011559
1521 Ga0495597_0047670
1522 Ga0495597_0093658
1523 Ga0495597_0096652
1524 Ga0495597_0098131
1525 Ga0495645_0139967
1526 Ga0495622_0000977
1527 Ga0495622_0012542
1528 Ga0495622_0028785
1529 Ga0495622_0094875
1530 Ga0495622_0096499
1531 Ga0495622_0149481
1532 Ga0495633_0001685
1533 Ga0495633_0013531
1534 Ga0495633_0105035
1535 Ga0495633_0105468
1536 Ga0495668_0016301
1537 Ga0495668_0203994
1538 Ga0495668_0251774
1539 Ga0495634_0018644
1540 Ga0495634_0081021
1541 Ga0495634_0158158
1542 Ga0495611_0003180
1543 Ga0495611_0077708
1544 Ga0495611_0149241
1545 Ga0495611_0177873
1546 Ga0495625_0012751
1547 Ga0495625_0068167
1548 Ga0495625_0076099
1549 Ga0495625_0098151
1550 Ga0495625_0103402
1551 Ga0495625_0140824
1552 Ga0495625_0267849
1553 Ga0495625_0295753
1554 Ga0495635_0147707
1555 Ga0495659_0004187
1556 Ga0495659_0026539
1557 Ga0495659_0058797
1558 Ga0495661_0019957
1559 Ga0495661_0059952
1560 Ga0495661_0085515
1561 Ga0495661_0144513
1562 Ga0495661_0205535
1563 Ga0495661_0225918
1564 Ga0495588_0103922
1565 Ga0495588_0137420
1566 Ga0495588_0155397
1567 Ga0495588_0242557
1568 Ga0495623_0016822
1569 Ga0495623_0116888
1570 Ga0495646_0014967
1571 Ga0495646_0039664
1572 Ga0495646_0067887
1573 Ga0495669_0001474
1574 Ga0495669_0091690
1575 Ga0495613_0137037
1576 Ga0495624_0006449
1577 Ga0495670_0011499
1578 Ga0495670_0050885
1579 Ga0495670_0059553
1580 Ga0495670_0106777
1581 Ga0495670_0127440
1582 Ga0495670_0143561
1583 Ga0495670_0153629
1584 Ga0495670_0173076
1585 Ga0495670_0233474
1586 Ga0495671_0006003
1587 Ga0495671_0007411
1588 Ga0495671_0014510
1589 Ga0495671_0017911
1590 Ga0495671_0036791
1591 Ga0495671_0038097
1592 Ga0495671_0045950
1593 Ga0495671_0046769
1594 Ga0495671_0142367
1595 Ga0495671_0142590
1596 Ga0495671_0188700
1597 Ga0495649_0009233
1598 Ga0495649_0014456
1599 Ga0495649_0017231
1600 Ga0495649_0043916
1601 Ga0495649_0047213
1602 Ga0495649_0123088
1603 Ga0495649_0130573
1604 Ga0495649_0130575
1605 Ga0495649_0131104
1606 Ga0495649_0170365
1607 Ga0495649_0194323
1608 Ga0495649_0216614
1609 Ga0495589_0000587
1610 Ga0495589_0012704
1611 Ga0495589_0016991
1612 Ga0495589_0029116
1613 Ga0495589_0062447
1614 Ga0495589_0078803
1615 Ga0495589_0125288
1616 Ga0495589_0145028
1617 Ga0495589_0198867
1618 Ga0495589_0206208
1619 Ga0495600_0040402
1620 Ga0495600_0159448
1621 Ga0495660_0015934
1622 Ga0495660_0019503
1623 Ga0495660_0027716
1624 Ga0495660_0034452
1625 Ga0495660_0046194
1626 Ga0495660_0050642
1627 Ga0495660_0051793
1628 Ga0495660_0058464
1629 Ga0495660_0062284
1630 Ga0495660_0087943
1631 Ga0495660_0098062
1632 Ga0495660_0120408
1633 Ga0495660_0147017
1634 Ga0495660_0228420
1635 Ga0495581_0065187
1636 Ga0495581_0077586
1637 Ga0495604_0094943
1638 Ga0495604_0145477
1639 Ga0495604_0204040
1640 Ga0495636_0020095
1641 Ga0495674_0180437
1642 Ga0495674_0687037
1643 Ga0495672_0002026
1644 Ga0495672_0007781
1645 Ga0495672_0023132
1646 Ga0495672_0023554
1647 Ga0495672_0148568
1648 Ga0495672_0155120
1649 Ga0495672_0158645
1650 Ga0495672_0161335
1651 Ga0495672_0178683
1652 Ga0495672_0194273
1653 Ga0495672_0201399
1654 Ga0495676_0066839
1655 Ga0495676_0083234
1656 Ga0495680_0032796
1657 Ga0495680_0073016
1658 Ga0495680_0194825
1659 Ga0495680_0330804
1660 Ga0495683_0010503
1661 Ga0495683_0012509
1662 Ga0495683_0054876
1663 Ga0495683_0100097
1664 Ga0495683_0119608
1665 Ga0495683_0124530
1666 Ga0495683_0129457
1667 Ga0495683_0137290
1668 Ga0495683_0162163
1669 Ga0495683_0191192
1670 Ga0495687_013599
1671 Ga0495687_081413
1672 Ga0495675_0064234
1673 Ga0495677_0028720
1674 Ga0495679_009646
1675 Ga0495679_017816
1676 Ga0495679_019986
1677 Ga0495679_054116
1678 Ga0495679_057625
1679 Ga0495679_063285
1680 Ga0495679_083136
1681 Ga0495685_022846
1682 Ga0495685_026608
1683 Ga0495673_0005030
1684 Ga0495673_0009780
1685 Ga0495673_0012319
1686 Ga0495673_0013582
1687 Ga0495673_0027680
1688 Ga0495673_0065791
1689 Ga0495673_0075075
1690 Ga0495673_0077049
1691 Ga0495673_0079534
1692 Ga0495673_0088677
1693 Ga0495673_0105068
1694 Ga0495673_0111898
1695 Ga0495673_0114218
1696 Ga0495673_0119922
1697 Ga0495673_0119949
1698 Ga0495673_0129550
1699 Ga0495673_0174086
1700 Ga0495681_0007814
1701 Ga0495681_0013783
1702 Ga0495681_0016258
1703 Ga0495681_0017009
1704 Ga0495681_0018090
1705 Ga0495681_0059413
1706 Ga0495681_0084372
1707 Ga0495681_0091558
1708 Ga0495681_0130960
1709 Ga0495681_0136506
1710 Ga0495684_0063092
1711 Ga0495684_0100174
1712 Ga0495686_0011348
1713 Ga0495686_0025100
1714 Ga0495686_0089889
1715 Ga0495686_0211311
1716 Ga0495593_0059867
1717 Ga0495593_0077007
1718 Ga0495593_0124863
1719 Ga0495593_0165503
1720 Ga0495602_0074105
1721 Ga0495626_0001849
1722 Ga0495626_0002063
1723 Ga0495626_0012097
1724 Ga0495626_0013302
1725 Ga0495626_0028334
1726 Ga0495626_0081221
1727 Ga0495626_0109319
1728 Ga0495626_0113131
1729 Ga0495626_0118812
1730 Ga0495626_0122448
1731 Ga0495626_0129512
1732 Ga0495626_0163068
1733 Ga0496101_0472887
1734 Ga0496102_0029602
1735 Ga0496103_0283973
1736 Ga0496104_0536594
1737 Ga0496105_0401947
1738 Ga0496107_0386880
1739 Ga0496110_0254188
1740 Ga0496114_0284253
1741 Ga0496116_0004746
1742 Ga0496116_0016123
1743 Ga0496116_0087859
1744 Ga0496116_0134950
1745 Ga0496116_0202202
1746 Ga0496117_0033142
1747 Ga0496117_0078731
1748 Ga0496117_0095080
1749 Ga0496117_0101411
1750 Ga0496117_0235647
1751 Ga0496117_0244619
1752 Ga0496118_0037568
1753 Ga0496118_0087797
1754 Ga0496118_0107116
1755 Ga0496118_0205148
1756 Ga0496119_0065278
1757 Ga0496119_0138328
1758 Ga0496119_0235092
1759 Ga0496120_0103528
1760 Ga0496120_0210348
1761 Ga0496121_0047275
1762 Ga0496121_0109908
1763 Ga0496121_0232656
1764 Ga0496121_0288765
1765 Ga0496122_0102453
1766 Ga0496122_0212581
1767 Ga0496122_0216223
1768 Ga0496123_0175852
1769 Ga0496123_0182240
1770 Ga0496123_0240857
1771 Ga0496124_0000120
1772 Ga0496124_0089046
1773 Ga0496124_0158040
1774 Ga0496124_0213028
1775 Ga0496124_0338096
1776 Ga0496124_0509605
1777 Ga0496125_0052982
1778 Ga0496125_0063050
1779 Ga0496125_0301350
1780 Ga0496125_0304538
1781 Ga0496125_0309874
1782 Ga0496126_0212624
1783 Ga0495678_012258
1784 Ga0495678_030258
1785 Ga0495678_036418
1786 Ga0495678_056602
1787 Ga0495678_059030
1788 Ga0495678_062139
1789 Ga0495678_070782
1790 Ga0495678_089560
1791 Ga0495678_091613
1792 Ga0495678_093561
1793 Ga0495678_100429
1794 Ga0495678_100504
1795 Ga0495678_102294
1796 Ga0495678_103272
1797 Ga0495678_108119
1798 Ga0495682_0007794
1799 Ga0495682_0020205
1800 Ga0495682_0025638
1801 Ga0495682_0081420
1802 Ga0495682_0098053
1803 Ga0495682_0103060
1804 Ga0495682_0145320
1805 Ga0501222_009583
1806 Ga0501227_025523
1807 Ga0501241_005307
1808 Ga0501226_000002
1809 Ga0501226_006651
1810 nmdc:mga03683_146217_c1
1811 nmdc:mga03683_208505_c1
1812 nmdc:mga03683_9895_c1
1813 nmdc:mga03n38_248732_c1
1814 nmdc:mga00v17_361873_c1
1815 nmdc:mga00v17_90411_c1
1816 Ga0500572_011163
1817 Ga0500577_0101793
1818 Ga0500586_038340
1819 2511254751
1820 2511265563
1821 2511271108
1822 2511280547
1823 2511297953
1824 2511302376
1825 2511315226
1826 2511320784
1827 2511326061
1828 2511331017
1829 2511336365
1830 2511345729
1831 2511349073
1832 2511360686
1833 2511368597
1834 2511411285
1835 2512325925
1836 2554818093
1837 2583789834
1838 2597855632
1839 2599398877
1840 2599450932
1841 2599485534
1842 2599514122
1843 2599518723
1844 2599806663
1845 2599893543
1846 2599943629
1847 2599955939
1848 2599984633
1849 2599991214
1850 2599994894
1851 2600002255
1852 2600023924
1853 2600032667
1854 2600034717
1855 2600044888
1856 2600048025
1857 2600061274
1858 2600068165
1859 2600077617
1860 2600362192
1861 2600364912
1862 2601627217
1863 2601797803
1864 2606076714
1865 2606128872
1866 2608380605
1867 2624478191
1868 2624489734
1869 2643840950
1870 2643954942
1871 2644024582
1872 2644186092
1873 2652547308
1874 2671127293
1875 2671772314
1876 2678260946
1877 2715749178
1878 2715759529
1879 2718632131
1880 2729146476
1881 2739197998
1882 2739260339
1883 2739286974
1884 2739292287
1885 2739311251
1886 2743735049
1887 2745006258
1888 2774119589
1889 2774134708
1890 2784261077
1891 2784316336
1892 2808855899
1893 2808905464
1894 2808922786
1895 2808932150
1896 2808935979
1897 2808939714
1898 2808944473
1899 2808954249
1900 2808955829
1901 2808964524
1902 2808999412
1903 2809217949
1904 2819657199
1905 2825654297
1906 2826582476
1907 2842817682
1908 2842832339
1909 2842834132
1910 2842838596
1911 2842846393
1912 2842851636
1913 2842858765
1914 2844667869
1915 2852660482
1916 2860343669
1917 2878030135
1918 2880231082
1919 2904519541
1920 2904552274
1921 2919066183
1922 2919389805
1923 2919459957
1924 2919486847
1925 2919488737
1926 2919698988
1927 2923154043
1928 2929144774
1929 2931391353
1930 2931398807
1931 2939641069
1932 2946028616
1933 2969304930
1934 2974293377
1935 2984292016
1936 2988732166
1937 2998140426
1938 3007398056
1939 3007517865
1940 3007615200
1941 3007625017
1942 3007721193
1943 3007859671
1944 3007864361
1945 3007872069
1946 8011352517
1947 8015688292
1948 8019770279
1949 8019777308
1950 8054503929
1951 8055771390
1952 8056126434
1953 8056142679
1954 8056143700
1955 8056158484
1956 8056170619
1957 8056176732
1958 8056183081
1959 8056572292
1960 8057802681

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00565

SNase

Staphylococcal nuclease homologue

83

192

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1snm-assembly1.cif.gz_A active site mutant glu-43 (right arrow) asp in staphylococcal nuclease displays nonlocal structural changes 0.9279 35 164
6eek-assembly1.cif.gz_A crystal structure of apo staphylcoccal nuclease variant delta+phs t62e/v66k, ph 7 at cryogenic temperature 0.9248 58 164
2f0q-assembly1.cif.gz_A crystal structure of staphylococcal nuclease mutant v66l/i92l 0.9216 35 164
1ey9-assembly1.cif.gz_A structure of s. nuclease stabilizing quadruple mutant t41i/p117g/h124l/s128a 0.9207 35 164
4k8i-assembly1.cif.gz_A crystal structure of staphylococcal nuclease mutant i92v/v99l 0.9197 35 164
ID Description Score Start End Superfamily
6eekA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.9248 58 164 2.40.50.90
af_Q2FYV8_40_177_2.40.50.90 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.9069 34 166 2.40.50.90
af_Q2RBJ2_237_347_2.40.50.90 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.8749 58 166 2.40.50.90
af_Q2FYV8_40_177_2.40.50.90 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.8693 34 166 2.40.50.90
af_Q7XV85_13_156_2.40.50.90 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.8565 38 168 2.40.50.90
ID Description Score Start End GO Terms
AF-J8V517-F1-model_v4 deleted 0.9768 40 123
AF-A0A3M5AD78-F1-model_v4 deleted 0.976 77 262
AF-A0A2A2M5E2-F1-model_v4 TNase-like domain-containing protein 0.9722 33 168 GO:0003676
GO:0004518
AF-A0A831XV62-F1-model_v4 TNase-like domain-containing protein 0.9716 39 167
AF-A0A836ZNZ3-F1-model_v4 deleted 0.9676 106 262

Map