F487372
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 980 | 486 | 1960 | 288 |
Family's Representative Sequence
| Representative Sequence | 3300046559|Ga0495667_0213537|Ga0495667_0213537_216_1163 |
| Length | 315 |
| Sequence | MTETAPAATAFDLDAVSAIDMHVHIEQDSHGCFALDDELMDASAAYFKASDHRAPTLEHVAAYYRQQGMAAVVFTVDASTATGHPALSSEDIADRAAAHPDVLIPFGSVDPHAGPAAVQRARRLVTEHGVRGFKFHPSLQAFEPNDPAFYPLYEALTELGVVALFHTGQTGIGAGLPGGRGIKLRYSAPMLIDDVAADFPGLTIVMAHPSVPWQDEAISIATHKANVYIDLSGWSPKYFPPQLVRAANSMLKCKVLFGSDFPLLTPERWLRDFNDLDIKDDVRPLILKDNAARVLNLGQASRNDVAPGPSGTQAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 9 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 10 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 11 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 84 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 85 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 86 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 87 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 91 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 92 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 93 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 96 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 101 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 102 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 103 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Metagenome | Rhizosphere |
| 120 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 121 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 138 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 139 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 140 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 206 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 207 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 208 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 209 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 210 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 211 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 212 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 213 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 214 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 215 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 216 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 217 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 218 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 220 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 221 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 222 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 223 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 224 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 225 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 226 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 227 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 228 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 229 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 230 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 231 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 232 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 233 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 234 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 235 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 236 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 237 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 238 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 239 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 240 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 241 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 242 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 243 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 244 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 245 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 246 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 247 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 248 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 249 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 250 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 251 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 252 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 253 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 255 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 256 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 257 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 258 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 259 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 260 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 261 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 262 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 263 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 264 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 265 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 266 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 267 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 268 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 269 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 270 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 271 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 272 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 274 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 275 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 276 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 278 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 279 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 280 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 281 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 282 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 283 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 284 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 285 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 286 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 287 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 288 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 289 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 290 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 291 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 292 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 293 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 294 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 295 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 296 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 297 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 298 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 299 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 300 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 301 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 302 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 303 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 304 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 305 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 306 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 307 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 308 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 309 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 310 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 311 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 372 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 373 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 374 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 375 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 376 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 377 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 378 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 379 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 380 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 381 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 382 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 383 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 384 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 385 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 386 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 387 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 388 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 389 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 390 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 391 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 392 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 393 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 394 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 395 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 396 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 421 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 422 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 423 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 424 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 425 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 426 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 430 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 435 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 436 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 437 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 438 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 439 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 440 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 441 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 442 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 443 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 444 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 445 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 446 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 447 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 448 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 449 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 451 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 452 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 453 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 454 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 455 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 456 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 457 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 458 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 459 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 460 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 461 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 462 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 463 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 464 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 465 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 466 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 467 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 468 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 469 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 470 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 471 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 472 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 473 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 474 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 475 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 476 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 477 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 478 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 479 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 480 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 481 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 482 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 483 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 484 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 485 | 8055034563 | Leucobacter allii H21R-40 | Isolate | Rhizosphere |
| 486 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.51 |
| Metatranscriptomes | 0.71 |
| Isolates | 3.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.33 |
| Nodule | 0.2 |
| Rhizoplane | 6.33 |
| Rhizosphere | 78.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495667_0213537 | 3300046559 | Bacteria | 1233 |
| 2 | LJQas_1006464 | 3300000549 | Bacteria | 1458 |
| 3 | JGI24739J22299_10001011 | 3300001989 | Bacteria | 10438 |
| 4 | JGI24743J22301_10003850 | 3300001991 | Bacteria | 2402 |
| 5 | JGI24750J21931_1006679 | 3300002070 | Bacteria | 1440 |
| 6 | JGI24738J21930_10004652 | 3300002075 | Bacteria | 3346 |
| 7 | JGI24744J21845_10000914 | 3300002077 | Bacteria | 5589 |
| 8 | JGI24744J21845_10004456 | 3300002077 | Bacteria | 2894 |
| 9 | JGI24034J26672_10006466 | 3300002239 | Bacteria | 1690 |
| 10 | JGI25152J39213_1000223 | 3300002773 | Bacteria | 38521 |
| 11 | JGI25404J52841_10005017 | 3300003659 | Bacteria | 2719 |
| 12 | Ga0055542_1003653 | 3300003762 | Bacteria | 4050 |
| 13 | Ga0070658_10116132 | 3300005327 | Bacteria | 2220 |
| 14 | Ga0070658_10121123 | 3300005327 | Bacteria | 2174 |
| 15 | Ga0070658_10197972 | 3300005327 | Bacteria | 1694 |
| 16 | Ga0070658_10431126 | 3300005327 | Bacteria | 1135 |
| 17 | Ga0070676_10003893 | 3300005328 | Bacteria | 7833 |
| 18 | Ga0070676_10042782 | 3300005328 | Bacteria | 2632 |
| 19 | Ga0070683_100207208 | 3300005329 | Bacteria | 1862 |
| 20 | Ga0070690_100001751 | 3300005330 | Bacteria | 11475 |
| 21 | Ga0068869_100040836 | 3300005334 | Bacteria | 3319 |
| 22 | Ga0068869_100046758 | 3300005334 | Bacteria | 3121 |
| 23 | Ga0068869_100107815 | 3300005334 | Bacteria | 2115 |
| 24 | Ga0068869_100325362 | 3300005334 | Bacteria | 1248 |
| 25 | Ga0070666_10084631 | 3300005335 | Bacteria | 2171 |
| 26 | Ga0070680_100549544 | 3300005336 | Bacteria | 990 |
| 27 | Ga0070682_100002159 | 3300005337 | Bacteria | 10919 |
| 28 | Ga0070682_100004022 | 3300005337 | Bacteria | 8171 |
| 29 | Ga0068868_100001850 | 3300005338 | Bacteria | 14534 |
| 30 | Ga0068868_100043299 | 3300005338 | Bacteria | 3516 |
| 31 | Ga0068868_100195797 | 3300005338 | Bacteria | 1682 |
| 32 | Ga0070660_100223542 | 3300005339 | Bacteria | 1531 |
| 33 | Ga0070660_100303344 | 3300005339 | Bacteria | 1309 |
| 34 | Ga0070660_100328877 | 3300005339 | Bacteria | 1256 |
| 35 | Ga0070689_100015053 | 3300005340 | Bacteria | 5632 |
| 36 | Ga0070689_100044218 | 3300005340 | Bacteria | 3425 |
| 37 | Ga0070689_100094210 | 3300005340 | Bacteria | 2364 |
| 38 | Ga0070689_100165173 | 3300005340 | Bacteria | 1791 |
| 39 | Ga0070691_10031877 | 3300005341 | Bacteria | 2474 |
| 40 | Ga0070687_100100196 | 3300005343 | Bacteria | 1620 |
| 41 | Ga0070661_100030858 | 3300005344 | Bacteria | 3873 |
| 42 | Ga0070692_10016910 | 3300005345 | Bacteria | 3476 |
| 43 | Ga0070692_10062596 | 3300005345 | Bacteria | 1964 |
| 44 | Ga0070692_10076025 | 3300005345 | Bacteria | 1799 |
| 45 | Ga0070668_100000260 | 3300005347 | Bacteria | 35142 |
| 46 | Ga0070668_100003086 | 3300005347 | Bacteria | 12309 |
| 47 | Ga0070668_100008605 | 3300005347 | Bacteria | 7579 |
| 48 | Ga0070668_100042721 | 3300005347 | Bacteria | 3474 |
| 49 | Ga0070668_100096070 | 3300005347 | Bacteria | 2342 |
| 50 | Ga0070669_100394691 | 3300005353 | Bacteria | 1131 |
| 51 | Ga0070675_100182153 | 3300005354 | Bacteria | 1817 |
| 52 | Ga0070671_100181586 | 3300005355 | Bacteria | 1781 |
| 53 | Ga0070674_100015264 | 3300005356 | Bacteria | 4792 |
| 54 | Ga0070674_100032985 | 3300005356 | Bacteria | 3443 |
| 55 | Ga0070674_100272373 | 3300005356 | Bacteria | 1338 |
| 56 | Ga0070673_100017797 | 3300005364 | Bacteria | 5063 |
| 57 | Ga0070673_100035514 | 3300005364 | Bacteria | 3781 |
| 58 | Ga0070673_100042527 | 3300005364 | Bacteria | 3504 |
| 59 | Ga0070688_100060704 | 3300005365 | Bacteria | 2388 |
| 60 | Ga0070659_100007076 | 3300005366 | Bacteria | 8131 |
| 61 | Ga0070659_100031560 | 3300005366 | Bacteria | 4104 |
| 62 | Ga0070659_100038587 | 3300005366 | Bacteria | 3725 |
| 63 | Ga0070659_100107352 | 3300005366 | Bacteria | 2251 |
| 64 | Ga0070659_100187708 | 3300005366 | Bacteria | 1698 |
| 65 | Ga0070667_100003272 | 3300005367 | Bacteria | 13841 |
| 66 | Ga0070709_10054287 | 3300005434 | Bacteria | 2525 |
| 67 | Ga0070709_10458522 | 3300005434 | Bacteria | 961 |
| 68 | Ga0070714_100004406 | 3300005435 | Bacteria | 10595 |
| 69 | Ga0070714_100008761 | 3300005435 | Bacteria | 7911 |
| 70 | Ga0070714_100133967 | 3300005435 | Bacteria | 2216 |
| 71 | Ga0070713_100062002 | 3300005436 | Bacteria | 3130 |
| 72 | Ga0070710_10000303 | 3300005437 | Bacteria | 23421 |
| 73 | Ga0070701_10076508 | 3300005438 | Bacteria | 1802 |
| 74 | Ga0070711_100001503 | 3300005439 | Bacteria | 12819 |
| 75 | Ga0070711_100110898 | 3300005439 | Bacteria | 2014 |
| 76 | Ga0070705_100009744 | 3300005440 | Bacteria | 4786 |
| 77 | Ga0070705_100023877 | 3300005440 | Bacteria | 3291 |
| 78 | Ga0070694_100032942 | 3300005444 | Bacteria | 3405 |
| 79 | Ga0070694_100269260 | 3300005444 | Bacteria | 1295 |
| 80 | Ga0070708_100011818 | 3300005445 | Bacteria | 7105 |
| 81 | Ga0070708_100031194 | 3300005445 | Bacteria | 4611 |
| 82 | Ga0070708_100647180 | 3300005445 | Bacteria | 996 |
| 83 | Ga0070663_100018222 | 3300005455 | Bacteria | 4597 |
| 84 | Ga0070663_100086633 | 3300005455 | Bacteria | 2313 |
| 85 | Ga0070663_100146409 | 3300005455 | Bacteria | 1807 |
| 86 | Ga0070663_100168700 | 3300005455 | Bacteria | 1690 |
| 87 | Ga0070663_100242815 | 3300005455 | Bacteria | 1422 |
| 88 | Ga0070663_100382576 | 3300005455 | Bacteria | 1146 |
| 89 | Ga0070678_100005572 | 3300005456 | Bacteria | 7302 |
| 90 | Ga0070678_100034932 | 3300005456 | Bacteria | 3505 |
| 91 | Ga0070662_100002181 | 3300005457 | Bacteria | 12005 |
| 92 | Ga0070662_100026343 | 3300005457 | Bacteria | 4026 |
| 93 | Ga0070662_100210909 | 3300005457 | Bacteria | 1545 |
| 94 | Ga0070681_10119333 | 3300005458 | Bacteria | 2573 |
| 95 | Ga0068867_100002967 | 3300005459 | Bacteria | 11948 |
| 96 | Ga0070685_10034580 | 3300005466 | Bacteria | 2847 |
| 97 | Ga0070685_10059568 | 3300005466 | Bacteria | 2230 |
| 98 | Ga0070685_10103107 | 3300005466 | Bacteria | 1745 |
| 99 | Ga0070706_100000178 | 3300005467 | Bacteria | 80600 |
| 100 | Ga0070706_100049652 | 3300005467 | Bacteria | 3871 |
| 101 | Ga0070707_100159024 | 3300005468 | Bacteria | 2201 |
| 102 | Ga0070698_100004573 | 3300005471 | Bacteria | 15192 |
| 103 | Ga0070698_100016273 | 3300005471 | Bacteria | 7852 |
| 104 | Ga0070698_100205108 | 3300005471 | Unclassified | 1907 |
| 105 | Ga0070698_100277722 | 3300005471 | Bacteria | 1607 |
| 106 | Ga0070698_100339566 | 3300005471 | Bacteria | 1433 |
| 107 | Ga0070699_100147151 | 3300005518 | Bacteria | 2081 |
| 108 | Ga0070679_100016779 | 3300005530 | Bacteria | 7077 |
| 109 | Ga0070679_100046295 | 3300005530 | Bacteria | 4335 |
| 110 | Ga0070679_100303068 | 3300005530 | Bacteria | 1548 |
| 111 | Ga0070679_100310072 | 3300005530 | Bacteria | 1528 |
| 112 | Ga0070679_100404092 | 3300005530 | Bacteria | 1312 |
| 113 | Ga0070684_100013218 | 3300005535 | Bacteria | 6648 |
| 114 | Ga0070684_100065121 | 3300005535 | Bacteria | 3198 |
| 115 | Ga0070684_100068544 | 3300005535 | Bacteria | 3118 |
| 116 | Ga0070684_100114155 | 3300005535 | Bacteria | 2424 |
| 117 | Ga0070684_100187052 | 3300005535 | Bacteria | 1884 |
| 118 | Ga0070684_100311379 | 3300005535 | Bacteria | 1446 |
| 119 | Ga0070697_100010094 | 3300005536 | Bacteria | 7364 |
| 120 | Ga0068853_100000732 | 3300005539 | Bacteria | 22719 |
| 121 | Ga0068853_100001940 | 3300005539 | Bacteria | 15256 |
| 122 | Ga0070686_100018403 | 3300005544 | Bacteria | 4099 |
| 123 | Ga0070695_100023646 | 3300005545 | Bacteria | 3780 |
| 124 | Ga0070696_100002906 | 3300005546 | Bacteria | 11389 |
| 125 | Ga0070696_100109461 | 3300005546 | Bacteria | 1988 |
| 126 | Ga0070665_100010056 | 3300005548 | Bacteria | 9572 |
| 127 | Ga0070665_100117145 | 3300005548 | Bacteria | 2666 |
| 128 | Ga0070665_100158871 | 3300005548 | Bacteria | 2262 |
| 129 | Ga0070665_100420585 | 3300005548 | Bacteria | 1345 |
| 130 | Ga0070704_100000340 | 3300005549 | Bacteria | 21256 |
| 131 | Ga0070704_100357605 | 3300005549 | Bacteria | 1234 |
| 132 | Ga0068855_100215102 | 3300005563 | Bacteria | 2158 |
| 133 | Ga0068855_100287260 | 3300005563 | Bacteria | 1824 |
| 134 | Ga0070664_100098862 | 3300005564 | Bacteria | 2535 |
| 135 | Ga0070664_100314505 | 3300005564 | Bacteria | 1418 |
| 136 | Ga0068857_100121715 | 3300005577 | Bacteria | 2350 |
| 137 | Ga0068857_100146914 | 3300005577 | Bacteria | 2133 |
| 138 | Ga0068854_100008668 | 3300005578 | Bacteria | 6547 |
| 139 | Ga0068854_100009181 | 3300005578 | Bacteria | 6378 |
| 140 | Ga0068854_100031524 | 3300005578 | Bacteria | 3685 |
| 141 | Ga0068854_100108594 | 3300005578 | Bacteria | 2090 |
| 142 | Ga0068856_100168955 | 3300005614 | Bacteria | 2199 |
| 143 | Ga0068856_100217420 | 3300005614 | Bacteria | 1926 |
| 144 | Ga0068856_100314483 | 3300005614 | Bacteria | 1583 |
| 145 | Ga0068856_100389568 | 3300005614 | Bacteria | 1413 |
| 146 | Ga0070702_100000276 | 3300005615 | Bacteria | 17521 |
| 147 | Ga0070702_100051345 | 3300005615 | Bacteria | 2360 |
| 148 | Ga0070702_100131298 | 3300005615 | Bacteria | 1582 |
| 149 | Ga0068852_100231180 | 3300005616 | Bacteria | 1763 |
| 150 | Ga0068852_100237611 | 3300005616 | Bacteria | 1740 |
| 151 | Ga0068859_100002195 | 3300005617 | Bacteria | 19815 |
| 152 | Ga0068859_100079926 | 3300005617 | Bacteria | 3310 |
| 153 | Ga0068864_100006253 | 3300005618 | Bacteria | 9769 |
| 154 | Ga0068864_100096957 | 3300005618 | Bacteria | 2610 |
| 155 | Ga0068864_100139174 | 3300005618 | Bacteria | 2188 |
| 156 | Ga0068866_10000121 | 3300005718 | Bacteria | 34325 |
| 157 | Ga0068866_10004057 | 3300005718 | Bacteria | 6011 |
| 158 | Ga0068866_10117444 | 3300005718 | Bacteria | 1494 |
| 159 | Ga0068861_100000790 | 3300005719 | Bacteria | 19056 |
| 160 | Ga0068861_100375402 | 3300005719 | Bacteria | 1254 |
| 161 | Ga0068870_10141590 | 3300005840 | Bacteria | 1408 |
| 162 | Ga0068863_100007024 | 3300005841 | Bacteria | 11033 |
| 163 | Ga0068863_100075265 | 3300005841 | Bacteria | 3195 |
| 164 | Ga0068863_100372820 | 3300005841 | Bacteria | 1393 |
| 165 | Ga0068858_100002942 | 3300005842 | Bacteria | 17128 |
| 166 | Ga0068858_100031184 | 3300005842 | Bacteria | 4950 |
| 167 | Ga0068858_100095602 | 3300005842 | Bacteria | 2768 |
| 168 | Ga0068858_100121274 | 3300005842 | Bacteria | 2445 |
| 169 | Ga0068860_100000694 | 3300005843 | Bacteria | 38692 |
| 170 | Ga0068860_100383684 | 3300005843 | Bacteria | 1387 |
| 171 | Ga0068860_100393167 | 3300005843 | Bacteria | 1370 |
| 172 | Ga0068862_100073297 | 3300005844 | Bacteria | 2959 |
| 173 | Ga0068862_100094842 | 3300005844 | Bacteria | 2602 |
| 174 | Ga0068862_100584198 | 3300005844 | Bacteria | 1070 |
| 175 | Ga0081538_10091329 | 3300005981 | Bacteria | 1572 |
| 176 | Ga0081540_1002936 | 3300005983 | Bacteria | 13719 |
| 177 | Ga0081540_1037636 | 3300005983 | Bacteria | 2561 |
| 178 | Ga0070717_10242983 | 3300006028 | Bacteria | 1588 |
| 179 | Ga0075365_10000777 | 3300006038 | Bacteria | 13015 |
| 180 | Ga0075365_10011637 | 3300006038 | Bacteria | 5183 |
| 181 | Ga0075368_10033147 | 3300006042 | Bacteria | 2009 |
| 182 | Ga0075363_100002184 | 3300006048 | Bacteria | 7888 |
| 183 | Ga0075363_100005192 | 3300006048 | Bacteria | 5766 |
| 184 | Ga0075363_100013065 | 3300006048 | Bacteria | 4014 |
| 185 | Ga0075363_100016120 | 3300006048 | Bacteria | 3687 |
| 186 | Ga0075363_100051356 | 3300006048 | Bacteria | 2198 |
| 187 | Ga0075364_10001722 | 3300006051 | Bacteria | 12049 |
| 188 | Ga0075364_10002641 | 3300006051 | Bacteria | 10062 |
| 189 | Ga0075364_10006989 | 3300006051 | Bacteria | 6666 |
| 190 | Ga0075364_10246628 | 3300006051 | Bacteria | 1214 |
| 191 | Ga0075364_10320666 | 3300006051 | Bacteria | 1055 |
| 192 | Ga0070715_10079249 | 3300006163 | Bacteria | 1487 |
| 193 | Ga0070716_100000551 | 3300006173 | Bacteria | 15665 |
| 194 | Ga0070712_100004121 | 3300006175 | Bacteria | 8934 |
| 195 | Ga0070712_100047113 | 3300006175 | Bacteria | 2982 |
| 196 | Ga0070712_100071380 | 3300006175 | Bacteria | 2484 |
| 197 | Ga0070712_100210657 | 3300006175 | Bacteria | 1532 |
| 198 | Ga0070712_100281094 | 3300006175 | Bacteria | 1341 |
| 199 | Ga0075362_10008480 | 3300006177 | Bacteria | 3932 |
| 200 | Ga0075362_10032711 | 3300006177 | Bacteria | 2259 |
| 201 | Ga0075362_10067933 | 3300006177 | Bacteria | 1623 |
| 202 | Ga0075367_10055104 | 3300006178 | Bacteria | 2359 |
| 203 | Ga0075367_10083181 | 3300006178 | Bacteria | 1939 |
| 204 | Ga0075369_10000746 | 3300006186 | Bacteria | 10557 |
| 205 | Ga0075369_10058712 | 3300006186 | Bacteria | 1675 |
| 206 | Ga0075366_10083210 | 3300006195 | Bacteria | 1912 |
| 207 | Ga0097621_100014529 | 3300006237 | Bacteria | 5896 |
| 208 | Ga0097621_100034294 | 3300006237 | Bacteria | 4048 |
| 209 | Ga0097621_100109080 | 3300006237 | Bacteria | 2338 |
| 210 | Ga0075370_10000407 | 3300006353 | Bacteria | 15914 |
| 211 | Ga0075370_10022616 | 3300006353 | Bacteria | 3454 |
| 212 | Ga0075370_10024714 | 3300006353 | Bacteria | 3321 |
| 213 | Ga0075370_10037882 | 3300006353 | Bacteria | 2712 |
| 214 | Ga0075431_100028346 | 3300006847 | Bacteria | 5753 |
| 215 | Ga0068865_100003268 | 3300006881 | Bacteria | 9703 |
| 216 | Ga0068865_100264313 | 3300006881 | Bacteria | 1363 |
| 217 | Ga0075436_100218673 | 3300006914 | Bacteria | 1352 |
| 218 | Ga0097620_100002195 | 3300006931 | Bacteria | 19815 |
| 219 | Ga0097620_100079928 | 3300006931 | Bacteria | 3310 |
| 220 | Ga0075435_100055045 | 3300007076 | Unclassified | 3212 |
| 221 | Ga0099794_10223646 | 3300007265 | Bacteria | 967 |
| 222 | Ga0099795_10097355 | 3300007788 | Bacteria | 1149 |
| 223 | Ga0105244_10094693 | 3300009036 | Bacteria | 1466 |
| 224 | Ga0105250_10118259 | 3300009092 | Bacteria | 1088 |
| 225 | Ga0105240_10042940 | 3300009093 | Bacteria | 5759 |
| 226 | Ga0105240_10284090 | 3300009093 | Bacteria | 1900 |
| 227 | Ga0111539_10475281 | 3300009094 | Bacteria | 1455 |
| 228 | Ga0105245_10004378 | 3300009098 | Bacteria | 12498 |
| 229 | Ga0105245_10098839 | 3300009098 | Bacteria | 2697 |
| 230 | Ga0105245_10147197 | 3300009098 | Bacteria | 2223 |
| 231 | Ga0105245_10676667 | 3300009098 | Bacteria | 1064 |
| 232 | Ga0105247_10000541 | 3300009101 | Bacteria | 30700 |
| 233 | Ga0105247_10035331 | 3300009101 | Bacteria | 3046 |
| 234 | Ga0114129_10035682 | 3300009147 | Bacteria | 7024 |
| 235 | Ga0114129_10251320 | 3300009147 | Bacteria | 2373 |
| 236 | Ga0114129_10390013 | 3300009147 | Bacteria | 1837 |
| 237 | Ga0105243_10502066 | 3300009148 | Bacteria | 1150 |
| 238 | Ga0105243_10626304 | 3300009148 | Bacteria | 1039 |
| 239 | Ga0105241_10427162 | 3300009174 | Bacteria | 1167 |
| 240 | Ga0105242_10000572 | 3300009176 | Bacteria | 29126 |
| 241 | Ga0105242_10211617 | 3300009176 | Bacteria | 1728 |
| 242 | Ga0105248_10003762 | 3300009177 | Bacteria | 16802 |
| 243 | Ga0105248_10036204 | 3300009177 | Bacteria | 5519 |
| 244 | Ga0105248_10108657 | 3300009177 | Bacteria | 3127 |
| 245 | Ga0105248_10126994 | 3300009177 | Bacteria | 2877 |
| 246 | Ga0105248_10684684 | 3300009177 | Bacteria | 1157 |
| 247 | Ga0105237_10000989 | 3300009545 | Bacteria | 38202 |
| 248 | Ga0105237_10014908 | 3300009545 | Bacteria | 8105 |
| 249 | Ga0105237_10021850 | 3300009545 | Bacteria | 6573 |
| 250 | Ga0105237_10256787 | 3300009545 | Bacteria | 1750 |
| 251 | Ga0105237_10382287 | 3300009545 | Bacteria | 1413 |
| 252 | Ga0105238_10059610 | 3300009551 | Bacteria | 3823 |
| 253 | Ga0105238_10251768 | 3300009551 | Bacteria | 1745 |
| 254 | Ga0105238_10496081 | 3300009551 | Bacteria | 1221 |
| 255 | Ga0105249_10008808 | 3300009553 | Bacteria | 8809 |
| 256 | Ga0105249_10045535 | 3300009553 | Bacteria | 3991 |
| 257 | Ga0105249_10049659 | 3300009553 | Bacteria | 3825 |
| 258 | Ga0105249_10213490 | 3300009553 | Bacteria | 1895 |
| 259 | Ga0105239_10001012 | 3300010375 | Bacteria | 39279 |
| 260 | Ga0105239_10028063 | 3300010375 | Bacteria | 6193 |
| 261 | Ga0105239_10274345 | 3300010375 | Bacteria | 1897 |
| 262 | Ga0105239_10320968 | 3300010375 | Bacteria | 1746 |
| 263 | Ga0105239_10647579 | 3300010375 | Bacteria | 1207 |
| 264 | Ga0105246_10017527 | 3300011119 | Bacteria | 4553 |
| 265 | Ga0105246_10231586 | 3300011119 | Bacteria | 1455 |
| 266 | Ga0105246_10425834 | 3300011119 | Bacteria | 1109 |
| 267 | Ga0157340_1000155 | 3300012473 | Bacteria | 2324 |
| 268 | Ga0157342_1000664 | 3300012507 | Bacteria | 2228 |
| 269 | Ga0157373_10014861 | 3300013100 | Bacteria | 5701 |
| 270 | Ga0157373_10102813 | 3300013100 | Bacteria | 2010 |
| 271 | Ga0157373_10314979 | 3300013100 | Bacteria | 1112 |
| 272 | Ga0157370_10088666 | 3300013104 | Bacteria | 2905 |
| 273 | Ga0157370_10289568 | 3300013104 | Bacteria | 1513 |
| 274 | Ga0157369_10045076 | 3300013105 | Bacteria | 4798 |
| 275 | Ga0157369_10054299 | 3300013105 | Bacteria | 4327 |
| 276 | Ga0157369_10080939 | 3300013105 | Bacteria | 3476 |
| 277 | Ga0157369_10136810 | 3300013105 | Bacteria | 2593 |
| 278 | Ga0157369_10156235 | 3300013105 | Bacteria | 2409 |
| 279 | Ga0157369_10165211 | 3300013105 | Bacteria | 2335 |
| 280 | Ga0157369_10395391 | 3300013105 | Bacteria | 1434 |
| 281 | Ga0157374_10007319 | 3300013296 | Bacteria | 9410 |
| 282 | Ga0157374_10039682 | 3300013296 | Bacteria | 4333 |
| 283 | Ga0157374_10827013 | 3300013296 | Bacteria | 942 |
| 284 | Ga0157378_10027760 | 3300013297 | Bacteria | 4993 |
| 285 | Ga0157378_10088862 | 3300013297 | Bacteria | 2805 |
| 286 | Ga0157378_10516802 | 3300013297 | Bacteria | 1195 |
| 287 | Ga0163162_10018447 | 3300013306 | Bacteria | 6837 |
| 288 | Ga0157372_10216190 | 3300013307 | Bacteria | 2222 |
| 289 | Ga0157372_10250179 | 3300013307 | Bacteria | 2057 |
| 290 | Ga0157372_10336022 | 3300013307 | Bacteria | 1759 |
| 291 | Ga0157372_10429298 | 3300013307 | Bacteria | 1540 |
| 292 | Ga0157372_10476780 | 3300013307 | Bacteria | 1455 |
| 293 | Ga0157375_10047074 | 3300013308 | Bacteria | 4209 |
| 294 | Ga0157375_10168032 | 3300013308 | Bacteria | 2339 |
| 295 | Ga0157375_10777500 | 3300013308 | Bacteria | 1107 |
| 296 | Ga0163163_10060585 | 3300014325 | Bacteria | 3748 |
| 297 | Ga0163163_10397376 | 3300014325 | Bacteria | 1436 |
| 298 | Ga0163163_10668285 | 3300014325 | Bacteria | 1102 |
| 299 | Ga0157380_10004599 | 3300014326 | Bacteria | 9582 |
| 300 | Ga0157380_10126877 | 3300014326 | Bacteria | 2170 |
| 301 | Ga0157377_10010134 | 3300014745 | Bacteria | 4651 |
| 302 | Ga0157377_10015596 | 3300014745 | Bacteria | 3892 |
| 303 | Ga0157377_10031061 | 3300014745 | Bacteria | 2900 |
| 304 | Ga0157379_10026679 | 3300014968 | Bacteria | 5142 |
| 305 | Ga0157379_10073665 | 3300014968 | Bacteria | 3057 |
| 306 | Ga0157376_10117277 | 3300014969 | Bacteria | 2353 |
| 307 | Ga0163161_10001874 | 3300017792 | Bacteria | 15351 |
| 308 | Ga0163161_10038811 | 3300017792 | Bacteria | 3416 |
| 309 | Ga0163161_10079280 | 3300017792 | Bacteria | 2415 |
| 310 | Ga0163161_10405053 | 3300017792 | Bacteria | 1094 |
| 311 | Ga0206356_10161964 | 3300020070 | Bacteria | 4504 |
| 312 | Ga0206353_11031012 | 3300020082 | Bacteria | 6999 |
| 313 | Ga0206353_11285738 | 3300020082 | Bacteria | 4475 |
| 314 | Ga0213874_10057051 | 3300021377 | Bacteria | 1214 |
| 315 | Ga0213876_10013774 | 3300021384 | Bacteria | 4286 |
| 316 | Ga0213875_10000644 | 3300021388 | Bacteria | 27796 |
| 317 | Ga0213875_10019991 | 3300021388 | Bacteria | 3215 |
| 318 | Ga0213875_10022970 | 3300021388 | Bacteria | 2982 |
| 319 | Ga0213875_10039209 | 3300021388 | Bacteria | 2232 |
| 320 | Ga0224712_10146191 | 3300022467 | Bacteria | 1044 |
| 321 | Ga0209129_1000354 | 3300025258 | Bacteria | 38625 |
| 322 | Ga0209051_1022202 | 3300025303 | Bacteria | 2677 |
| 323 | Ga0207697_10000412 | 3300025315 | Bacteria | 24182 |
| 324 | Ga0207697_10000464 | 3300025315 | Bacteria | 22857 |
| 325 | Ga0207655_1011840 | 3300025728 | Bacteria | 5153 |
| 326 | Ga0207655_1013050 | 3300025728 | Bacteria | 4796 |
| 327 | Ga0207653_10007248 | 3300025885 | Bacteria | 3459 |
| 328 | Ga0207692_10003016 | 3300025898 | Bacteria | 6527 |
| 329 | Ga0207692_10069152 | 3300025898 | Bacteria | 1854 |
| 330 | Ga0207692_10221137 | 3300025898 | Bacteria | 1122 |
| 331 | Ga0207642_10001487 | 3300025899 | Bacteria | 7237 |
| 332 | Ga0207642_10093866 | 3300025899 | Bacteria | 1489 |
| 333 | Ga0207710_10011320 | 3300025900 | Bacteria | 3756 |
| 334 | Ga0207710_10012078 | 3300025900 | Bacteria | 3630 |
| 335 | Ga0207710_10167407 | 3300025900 | Bacteria | 1073 |
| 336 | Ga0207688_10000299 | 3300025901 | Bacteria | 22710 |
| 337 | Ga0207688_10007098 | 3300025901 | Bacteria | 6092 |
| 338 | Ga0207688_10008717 | 3300025901 | Bacteria | 5519 |
| 339 | Ga0207688_10150493 | 3300025901 | Bacteria | 1374 |
| 340 | Ga0207647_10008657 | 3300025904 | Bacteria | 7270 |
| 341 | Ga0207647_10022023 | 3300025904 | Bacteria | 4240 |
| 342 | Ga0207647_10072007 | 3300025904 | Bacteria | 2085 |
| 343 | Ga0207647_10130467 | 3300025904 | Bacteria | 1477 |
| 344 | Ga0207685_10133024 | 3300025905 | Bacteria | 1106 |
| 345 | Ga0207699_10008657 | 3300025906 | Bacteria | 5032 |
| 346 | Ga0207699_10014821 | 3300025906 | Bacteria | 4033 |
| 347 | Ga0207699_10107488 | 3300025906 | Bacteria | 1782 |
| 348 | Ga0207645_10005579 | 3300025907 | Bacteria | 9103 |
| 349 | Ga0207643_10002999 | 3300025908 | Bacteria | 9101 |
| 350 | Ga0207643_10037827 | 3300025908 | Bacteria | 2708 |
| 351 | Ga0207643_10203958 | 3300025908 | Bacteria | 1205 |
| 352 | Ga0207705_10246987 | 3300025909 | Bacteria | 1360 |
| 353 | Ga0207684_10000029 | 3300025910 | Bacteria | 305483 |
| 354 | Ga0207707_10031989 | 3300025912 | Bacteria | 4606 |
| 355 | Ga0207695_10084420 | 3300025913 | Bacteria | 3206 |
| 356 | Ga0207671_10006521 | 3300025914 | Bacteria | 10371 |
| 357 | Ga0207671_10016946 | 3300025914 | Bacteria | 5639 |
| 358 | Ga0207671_10139657 | 3300025914 | Bacteria | 1866 |
| 359 | Ga0207671_10251878 | 3300025914 | Bacteria | 1388 |
| 360 | Ga0207693_10000174 | 3300025915 | Bacteria | 58853 |
| 361 | Ga0207693_10003641 | 3300025915 | Bacteria | 13161 |
| 362 | Ga0207693_10035884 | 3300025915 | Bacteria | 3908 |
| 363 | Ga0207693_10145809 | 3300025915 | Bacteria | 1861 |
| 364 | Ga0207693_10184358 | 3300025915 | Bacteria | 1643 |
| 365 | Ga0207663_10000793 | 3300025916 | Bacteria | 14165 |
| 366 | Ga0207663_10015934 | 3300025916 | Bacteria | 4158 |
| 367 | Ga0207663_10062833 | 3300025916 | Bacteria | 2362 |
| 368 | Ga0207663_10277159 | 3300025916 | Bacteria | 1244 |
| 369 | Ga0207663_10299460 | 3300025916 | Bacteria | 1201 |
| 370 | Ga0207660_10047938 | 3300025917 | Bacteria | 3023 |
| 371 | Ga0207660_10114314 | 3300025917 | Unclassified | 2036 |
| 372 | Ga0207657_10051676 | 3300025919 | Bacteria | 3572 |
| 373 | Ga0207657_10121289 | 3300025919 | Bacteria | 2151 |
| 374 | Ga0207657_10140271 | 3300025919 | Bacteria | 1975 |
| 375 | Ga0207657_10146816 | 3300025919 | Bacteria | 1923 |
| 376 | Ga0207649_10067995 | 3300025920 | Bacteria | 2264 |
| 377 | Ga0207652_10029348 | 3300025921 | Bacteria | 4598 |
| 378 | Ga0207652_10077787 | 3300025921 | Bacteria | 2895 |
| 379 | Ga0207652_10111207 | 3300025921 | Bacteria | 2429 |
| 380 | Ga0207652_10188929 | 3300025921 | Bacteria | 1853 |
| 381 | Ga0207652_10238815 | 3300025921 | Bacteria | 1638 |
| 382 | Ga0207652_10285860 | 3300025921 | Bacteria | 1488 |
| 383 | Ga0207681_10151313 | 3300025923 | Bacteria | 1739 |
| 384 | Ga0207694_10348687 | 3300025924 | Bacteria | 1225 |
| 385 | Ga0207687_10001202 | 3300025927 | Bacteria | 17707 |
| 386 | Ga0207687_10018873 | 3300025927 | Bacteria | 4560 |
| 387 | Ga0207687_10071276 | 3300025927 | Bacteria | 2483 |
| 388 | Ga0207700_10018882 | 3300025928 | Bacteria | 4645 |
| 389 | Ga0207700_10105498 | 3300025928 | Bacteria | 2257 |
| 390 | Ga0207700_10136303 | 3300025928 | Bacteria | 2011 |
| 391 | Ga0207700_10177212 | 3300025928 | Bacteria | 1782 |
| 392 | Ga0207664_10005914 | 3300025929 | Bacteria | 8368 |
| 393 | Ga0207664_10008142 | 3300025929 | Bacteria | 7295 |
| 394 | Ga0207664_10039317 | 3300025929 | Bacteria | 3673 |
| 395 | Ga0207664_10310908 | 3300025929 | Bacteria | 1388 |
| 396 | Ga0207644_10205925 | 3300025931 | Bacteria | 1553 |
| 397 | Ga0207690_10080913 | 3300025932 | Bacteria | 2268 |
| 398 | Ga0207690_10094211 | 3300025932 | Bacteria | 2124 |
| 399 | Ga0207690_10178365 | 3300025932 | Bacteria | 1597 |
| 400 | Ga0207706_10005203 | 3300025933 | Bacteria | 12138 |
| 401 | Ga0207706_10019886 | 3300025933 | Bacteria | 6035 |
| 402 | Ga0207709_10006674 | 3300025935 | Bacteria | 6473 |
| 403 | Ga0207709_10024929 | 3300025935 | Bacteria | 3421 |
| 404 | Ga0207670_10076467 | 3300025936 | Bacteria | 2329 |
| 405 | Ga0207670_10313151 | 3300025936 | Bacteria | 1233 |
| 406 | Ga0207669_10005973 | 3300025937 | Bacteria | 5519 |
| 407 | Ga0207669_10013767 | 3300025937 | Bacteria | 4032 |
| 408 | Ga0207669_10351779 | 3300025937 | Bacteria | 1139 |
| 409 | Ga0207669_10387893 | 3300025937 | Bacteria | 1090 |
| 410 | Ga0207704_10000200 | 3300025938 | Bacteria | 30767 |
| 411 | Ga0207665_10007301 | 3300025939 | Bacteria | 7311 |
| 412 | Ga0207665_10009571 | 3300025939 | Bacteria | 6363 |
| 413 | Ga0207665_10095499 | 3300025939 | Bacteria | 2066 |
| 414 | Ga0207665_10126321 | 3300025939 | Bacteria | 1811 |
| 415 | Ga0207691_10020004 | 3300025940 | Bacteria | 6332 |
| 416 | Ga0207691_10047976 | 3300025940 | Bacteria | 3916 |
| 417 | Ga0207691_10258942 | 3300025940 | Bacteria | 1500 |
| 418 | Ga0207691_10366335 | 3300025940 | Bacteria | 1231 |
| 419 | Ga0207711_10051632 | 3300025941 | Bacteria | 3522 |
| 420 | Ga0207689_10005029 | 3300025942 | Bacteria | 11916 |
| 421 | Ga0207689_10022286 | 3300025942 | Bacteria | 5326 |
| 422 | Ga0207689_10054309 | 3300025942 | Bacteria | 3300 |
| 423 | Ga0207689_10210243 | 3300025942 | Bacteria | 1607 |
| 424 | Ga0207661_10003808 | 3300025944 | Bacteria | 10516 |
| 425 | Ga0207661_10004385 | 3300025944 | Bacteria | 9893 |
| 426 | Ga0207661_10105833 | 3300025944 | Bacteria | 2371 |
| 427 | Ga0207667_10108847 | 3300025949 | Bacteria | 2858 |
| 428 | Ga0207712_10020201 | 3300025961 | Bacteria | 4360 |
| 429 | Ga0207712_10086315 | 3300025961 | Bacteria | 2299 |
| 430 | Ga0207668_10103139 | 3300025972 | Bacteria | 2123 |
| 431 | Ga0207668_10119311 | 3300025972 | Bacteria | 1994 |
| 432 | Ga0207668_10312265 | 3300025972 | Bacteria | 1301 |
| 433 | Ga0207640_10008556 | 3300025981 | Bacteria | 5683 |
| 434 | Ga0207640_10076669 | 3300025981 | Bacteria | 2270 |
| 435 | Ga0207658_10020989 | 3300025986 | Bacteria | 4528 |
| 436 | Ga0207677_10019275 | 3300026023 | Bacteria | 4117 |
| 437 | Ga0207677_10080142 | 3300026023 | Bacteria | 2338 |
| 438 | Ga0207703_10003338 | 3300026035 | Bacteria | 13477 |
| 439 | Ga0207703_10045927 | 3300026035 | Bacteria | 3515 |
| 440 | Ga0207703_10053181 | 3300026035 | Bacteria | 3291 |
| 441 | Ga0207703_10120213 | 3300026035 | Bacteria | 2254 |
| 442 | Ga0207639_10020609 | 3300026041 | Bacteria | 4722 |
| 443 | Ga0207678_10008344 | 3300026067 | Bacteria | 9135 |
| 444 | Ga0207678_10064053 | 3300026067 | Bacteria | 3159 |
| 445 | Ga0207678_10068164 | 3300026067 | Bacteria | 3053 |
| 446 | Ga0207678_10080179 | 3300026067 | Bacteria | 2795 |
| 447 | Ga0207678_10101520 | 3300026067 | Bacteria | 2456 |
| 448 | Ga0207708_10000934 | 3300026075 | Bacteria | 21911 |
| 449 | Ga0207708_10025100 | 3300026075 | Bacteria | 4508 |
| 450 | Ga0207708_10047124 | 3300026075 | Bacteria | 3283 |
| 451 | Ga0207708_10049500 | 3300026075 | Bacteria | 3200 |
| 452 | Ga0207702_10095540 | 3300026078 | Bacteria | 2612 |
| 453 | Ga0207702_10219659 | 3300026078 | Bacteria | 1771 |
| 454 | Ga0207702_10237740 | 3300026078 | Bacteria | 1705 |
| 455 | Ga0207641_10026350 | 3300026088 | Bacteria | 4798 |
| 456 | Ga0207641_10212797 | 3300026088 | Bacteria | 1788 |
| 457 | Ga0207648_10000562 | 3300026089 | Bacteria | 41578 |
| 458 | Ga0207648_10034665 | 3300026089 | Bacteria | 4448 |
| 459 | Ga0207676_10051855 | 3300026095 | Bacteria | 3205 |
| 460 | Ga0207674_10006496 | 3300026116 | Bacteria | 13748 |
| 461 | Ga0207674_10021982 | 3300026116 | Bacteria | 6860 |
| 462 | Ga0207674_10095609 | 3300026116 | Bacteria | 2957 |
| 463 | Ga0207674_10173852 | 3300026116 | Bacteria | 2106 |
| 464 | Ga0207674_10405937 | 3300026116 | Bacteria | 1317 |
| 465 | Ga0207674_10438873 | 3300026116 | Bacteria | 1262 |
| 466 | Ga0207675_100000185 | 3300026118 | Bacteria | 56425 |
| 467 | Ga0207675_100034793 | 3300026118 | Bacteria | 4698 |
| 468 | Ga0207675_100051937 | 3300026118 | Bacteria | 3825 |
| 469 | Ga0207675_100075938 | 3300026118 | Bacteria | 3146 |
| 470 | Ga0207683_10000357 | 3300026121 | Bacteria | 41951 |
| 471 | Ga0207683_10009444 | 3300026121 | Bacteria | 8311 |
| 472 | Ga0207683_10011925 | 3300026121 | Bacteria | 7417 |
| 473 | Ga0207698_10072474 | 3300026142 | Bacteria | 2739 |
| 474 | Ga0207698_10331768 | 3300026142 | Bacteria | 1429 |
| 475 | Ga0209813_10016019 | 3300027866 | Bacteria | 2039 |
| 476 | Ga0268266_10016779 | 3300028379 | Bacteria | 6260 |
| 477 | Ga0268266_10083648 | 3300028379 | Bacteria | 2786 |
| 478 | Ga0268265_10007009 | 3300028380 | Bacteria | 7622 |
| 479 | Ga0268265_10422030 | 3300028380 | Bacteria | 1239 |
| 480 | Ga0268264_10001293 | 3300028381 | Bacteria | 23636 |
| 481 | Ga0265337_1000064 | 3300028556 | Bacteria | 48829 |
| 482 | Ga0265326_10001044 | 3300028558 | Bacteria | 9894 |
| 483 | Ga0265319_1000034 | 3300028563 | Bacteria | 117363 |
| 484 | Ga0265319_1001979 | 3300028563 | Bacteria | 11555 |
| 485 | Ga0265334_10000705 | 3300028573 | Bacteria | 16743 |
| 486 | Ga0265318_10014671 | 3300028577 | Bacteria | 3284 |
| 487 | Ga0265323_10011707 | 3300028653 | Bacteria | 3531 |
| 488 | Ga0265336_10001316 | 3300028666 | Bacteria | 11601 |
| 489 | Ga0307515_10001030 | 3300028794 | Bacteria | 63698 |
| 490 | Ga0307515_10054860 | 3300028794 | Bacteria | 5839 |
| 491 | Ga0307515_10249512 | 3300028794 | Bacteria | 1530 |
| 492 | Ga0307515_10273327 | 3300028794 | Bacteria | 1407 |
| 493 | Ga0307515_10412514 | 3300028794 | Bacteria | 973 |
| 494 | Ga0265338_10000565 | 3300028800 | Bacteria | 65112 |
| 495 | Ga0265338_10002634 | 3300028800 | Bacteria | 26472 |
| 496 | Ga0265324_10004404 | 3300029957 | Bacteria | 6384 |
| 497 | Ga0307512_10002715 | 3300030522 | Bacteria | 21708 |
| 498 | Ga0307512_10167676 | 3300030522 | Bacteria | 1267 |
| 499 | Ga0316176_1147110 | 3300030732 | Bacteria | 2009 |
| 500 | Ga0314311_1217690 | 3300030733 | Bacteria | 1984 |
| 501 | Ga0265332_10001004 | 3300031238 | Bacteria | 16641 |
| 502 | Ga0265320_10004097 | 3300031240 | Bacteria | 9576 |
| 503 | Ga0265320_10015076 | 3300031240 | Bacteria | 4377 |
| 504 | Ga0265340_10006980 | 3300031247 | Bacteria | 6165 |
| 505 | Ga0265339_10024325 | 3300031249 | Bacteria | 3491 |
| 506 | Ga0265316_10015192 | 3300031344 | Bacteria | 6742 |
| 507 | Ga0307513_10010160 | 3300031456 | Bacteria | 11836 |
| 508 | Ga0307513_10011034 | 3300031456 | Bacteria | 11270 |
| 509 | Ga0307509_10340914 | 3300031507 | Bacteria | 1226 |
| 510 | Ga0307408_100000205 | 3300031548 | Bacteria | 63434 |
| 511 | Ga0307408_100041587 | 3300031548 | Bacteria | 3258 |
| 512 | Ga0307408_100054172 | 3300031548 | Bacteria | 2900 |
| 513 | Ga0307408_100149258 | 3300031548 | Bacteria | 1844 |
| 514 | Ga0307408_100221176 | 3300031548 | Bacteria | 1545 |
| 515 | Ga0265313_10050036 | 3300031595 | Bacteria | 2007 |
| 516 | Ga0307508_10042391 | 3300031616 | Bacteria | 4083 |
| 517 | Ga0307508_10047877 | 3300031616 | Bacteria | 3810 |
| 518 | Ga0307508_10372780 | 3300031616 | Bacteria | 1018 |
| 519 | Ga0316575_10002381 | 3300031665 | Bacteria | 6301 |
| 520 | Ga0265314_10070799 | 3300031711 | Bacteria | 2335 |
| 521 | Ga0265342_10012544 | 3300031712 | Bacteria | 5736 |
| 522 | Ga0316576_10134679 | 3300031727 | Bacteria | 1859 |
| 523 | Ga0316576_10353739 | 3300031727 | Bacteria | 1093 |
| 524 | Ga0316578_10079246 | 3300031728 | Bacteria | 1952 |
| 525 | Ga0316578_10224106 | 3300031728 | Bacteria | 1130 |
| 526 | Ga0307516_10064138 | 3300031730 | Bacteria | 3554 |
| 527 | Ga0307405_10019015 | 3300031731 | Bacteria | 3805 |
| 528 | Ga0307413_10074370 | 3300031824 | Bacteria | 2152 |
| 529 | Ga0307410_10004832 | 3300031852 | Bacteria | 7039 |
| 530 | Ga0307410_10031823 | 3300031852 | Bacteria | 3389 |
| 531 | Ga0307406_10000260 | 3300031901 | Bacteria | 31960 |
| 532 | Ga0307406_10054506 | 3300031901 | Bacteria | 2552 |
| 533 | Ga0307406_10110756 | 3300031901 | Bacteria | 1890 |
| 534 | Ga0307407_10106660 | 3300031903 | Bacteria | 1751 |
| 535 | Ga0307412_10000876 | 3300031911 | Bacteria | 17305 |
| 536 | Ga0307412_10563151 | 3300031911 | Bacteria | 959 |
| 537 | Ga0307409_100049557 | 3300031995 | Bacteria | 3203 |
| 538 | Ga0307409_100148448 | 3300031995 | Bacteria | 2031 |
| 539 | Ga0307409_100158560 | 3300031995 | Bacteria | 1976 |
| 540 | Ga0307416_100032055 | 3300032002 | Bacteria | 3966 |
| 541 | Ga0307416_100085114 | 3300032002 | Bacteria | 2690 |
| 542 | Ga0307416_100383076 | 3300032002 | Bacteria | 1437 |
| 543 | Ga0307416_100643325 | 3300032002 | Bacteria | 1144 |
| 544 | Ga0307411_10050500 | 3300032005 | Bacteria | 2709 |
| 545 | Ga0307411_10308858 | 3300032005 | Bacteria | 1272 |
| 546 | Ga0307415_100142768 | 3300032126 | Bacteria | 1831 |
| 547 | Ga0307415_100177782 | 3300032126 | Bacteria | 1666 |
| 548 | Ga0316583_10004543 | 3300032133 | Bacteria | 4951 |
| 549 | Ga0316585_10006192 | 3300032137 | Bacteria | 3413 |
| 550 | Ga0316580_10024373 | 3300032139 | Bacteria | 1870 |
| 551 | Ga0316212_1004930 | 3300033547 | Bacteria | 1938 |
| 552 | Ga0373930_0017051 | 3300034816 | Bacteria | 1381 |
| 553 | Ga0373926_0002946 | 3300035083 | Bacteria | 5452 |
| 554 | Ga0373926_0007322 | 3300035083 | Bacteria | 3677 |
| 555 | Ga0373929_0019068 | 3300035085 | Bacteria | 1370 |
| 556 | Ga0373934_0010839 | 3300035086 | Bacteria | 3425 |
| 557 | Ga0373934_0021472 | 3300035086 | Bacteria | 2485 |
| 558 | Ga0373934_0028616 | 3300035086 | Bacteria | 2173 |
| 559 | Ga0373944_0001669 | 3300035089 | Bacteria | 5611 |
| 560 | Ga0373944_0044515 | 3300035089 | Bacteria | 1382 |
| 561 | Ga0373951_0008016 | 3300035091 | Bacteria | 2394 |
| 562 | Ga0373923_0028763 | 3300035111 | Bacteria | 2225 |
| 563 | Ga0373936_0000838 | 3300035113 | Bacteria | 10935 |
| 564 | Ga0373936_0001503 | 3300035113 | Bacteria | 8461 |
| 565 | Ga0373936_0016661 | 3300035113 | Bacteria | 2828 |
| 566 | Ga0373945_0002990 | 3300035116 | Bacteria | 5313 |
| 567 | Ga0373945_0005014 | 3300035116 | Bacteria | 4217 |
| 568 | Ga0373953_0004584 | 3300035117 | Bacteria | 4413 |
| 569 | Ga0373953_0011079 | 3300035117 | Bacteria | 3153 |
| 570 | Ga0373953_0030980 | 3300035117 | Bacteria | 2078 |
| 571 | Ga0373954_0164076 | 3300035118 | Bacteria | 1087 |
| 572 | Ga0373956_0022644 | 3300035119 | Bacteria | 2690 |
| 573 | Ga0373957_0003726 | 3300035120 | Bacteria | 4557 |
| 574 | Ga0373943_0002144 | 3300035170 | Bacteria | 8972 |
| 575 | Ga0373946_0000254 | 3300035171 | Bacteria | 16948 |
| 576 | Ga0373946_0001368 | 3300035171 | Bacteria | 8446 |
| 577 | Ga0373946_0088572 | 3300035171 | Bacteria | 1368 |
| 578 | Ga0373955_0008345 | 3300035172 | Bacteria | 4808 |
| 579 | Ga0373955_0009421 | 3300035172 | Bacteria | 4569 |
| 580 | Ga0373955_0240004 | 3300035172 | Bacteria | 1085 |
| 581 | Ga0373962_0015714 | 3300035242 | Bacteria | 1944 |
| 582 | Ga0316574_0094533 | 3300035398 | Bacteria | 1909 |
| 583 | Ga0373924_0006751 | 3300035410 | Bacteria | 4121 |
| 584 | Ga0373931_0012154 | 3300035691 | Bacteria | 4168 |
| 585 | Ga0373935_0012197 | 3300035692 | Bacteria | 5168 |
| 586 | Ga0373935_0015107 | 3300035692 | Bacteria | 4662 |
| 587 | Ga0373935_0027066 | 3300035692 | Bacteria | 3544 |
| 588 | Ga0373935_0089501 | 3300035692 | Bacteria | 2013 |
| 589 | Ga0373927_0002586 | 3300035695 | Bacteria | 13198 |
| 590 | Ga0373933_0016123 | 3300035724 | Bacteria | 4174 |
| 591 | Ga0373933_0145895 | 3300035724 | Bacteria | 1496 |
| 592 | Ga0373947_0035668 | 3300035725 | Bacteria | 2945 |
| 593 | Ga0373947_0173893 | 3300035725 | Bacteria | 1399 |
| 594 | Ga0373937_0052468 | 3300036401 | Bacteria | 3738 |
| 595 | Ga0373937_0076727 | 3300036401 | Unclassified | 3087 |
| 596 | Ga0373937_0217177 | 3300036401 | Bacteria | 1799 |
| 597 | Ga0372808_000293 | 3300036459 | Bacteria | 3504 |
| 598 | Ga0372808_005815 | 3300036459 | Bacteria | 1641 |
| 599 | Ga0316582_0017488 | 3300036647 | Bacteria | 4150 |
| 600 | Ga0316584_0015074 | 3300036712 | Bacteria | 5523 |
| 601 | Ga0316584_0036707 | 3300036712 | Bacteria | 3637 |
| 602 | Ga0316584_0230304 | 3300036712 | Bacteria | 1358 |
| 603 | Ga0373925_0000520 | 3300037068 | Bacteria | 38381 |
| 604 | Ga0373925_0006196 | 3300037068 | Bacteria | 8836 |
| 605 | Ga0373925_0042326 | 3300037068 | Bacteria | 3379 |
| 606 | Ga0395899_0006498 | 3300037312 | Bacteria | 9057 |
| 607 | Ga0395899_0173520 | 3300037312 | Bacteria | 1517 |
| 608 | Ga0395900_0021768 | 3300037418 | Bacteria | 6555 |
| 609 | Ga0395900_0060686 | 3300037418 | Bacteria | 3891 |
| 610 | Ga0395898_0005196 | 3300037466 | Bacteria | 14074 |
| 611 | Ga0395898_0051572 | 3300037466 | Bacteria | 4023 |
| 612 | Ga0395898_0100517 | 3300037466 | Bacteria | 2777 |
| 613 | Ga0395898_0125179 | 3300037466 | Bacteria | 2462 |
| 614 | Ga0395898_0293042 | 3300037466 | Bacteria | 1552 |
| 615 | Ga0395898_0412419 | 3300037466 | Bacteria | 1287 |
| 616 | Ga0395905_0350047 | 3300037471 | Bacteria | 1369 |
| 617 | Ga0436364_0060564 | 3300037853 | Bacteria | 1909 |
| 618 | Ga0436364_0330965 | 3300037853 | Bacteria | 247749 |
| 619 | Ga0436364_0520351 | 3300037853 | Bacteria | 12767 |
| 620 | Ga0436364_0815241 | 3300037853 | Bacteria | 2809 |
| 621 | Ga0436364_1204317 | 3300037853 | Bacteria | 2264 |
| 622 | Ga0436364_1390946 | 3300037853 | Bacteria | 2071 |
| 623 | Ga0436364_1473432 | 3300037853 | Bacteria | 3096 |
| 624 | Ga0395901_0004622 | 3300038443 | Bacteria | 13894 |
| 625 | Ga0395901_0004781 | 3300038443 | Bacteria | 13667 |
| 626 | Ga0400485_15239 | 3300038735 | Bacteria | 4327 |
| 627 | Ga0400483_015512 | 3300039062 | Bacteria | 2559 |
| 628 | Ga0400483_027222 | 3300039062 | Bacteria | 3990 |
| 629 | Ga0400483_054530 | 3300039062 | Bacteria | 6982 |
| 630 | Ga0400483_082538 | 3300039062 | Bacteria | 11182 |
| 631 | Ga0400483_166542 | 3300039062 | Bacteria | 1673 |
| 632 | Ga0400483_195596 | 3300039062 | Bacteria | 42851 |
| 633 | Ga0400483_237393 | 3300039062 | Bacteria | 3981 |
| 634 | Ga0400483_259886 | 3300039062 | Bacteria | 6528 |
| 635 | Ga0436365_0252452 | 3300039437 | Bacteria | 1292 |
| 636 | Ga0436365_1676582 | 3300039437 | Bacteria | 1647 |
| 637 | Ga0436363_1152983 | 3300039450 | Bacteria | 1660 |
| 638 | Ga0439461_0008116 | 3300041410 | Bacteria | 1875 |
| 639 | Ga0439466_0019531 | 3300041411 | Bacteria | 2425 |
| 640 | Ga0439466_0026588 | 3300041411 | Bacteria | 2011 |
| 641 | Ga0439465_0050098 | 3300041413 | Bacteria | 1365 |
| 642 | Ga0451797_0029876 | 3300041453 | Bacteria | 1581 |
| 643 | Ga0451797_0047916 | 3300041453 | Bacteria | 1038 |
| 644 | Ga0451795_0507694 | 3300041456 | Bacteria | 2686 |
| 645 | Ga0451841_0255082 | 3300041498 | Bacteria | 2216 |
| 646 | Ga0451853_0504170 | 3300041512 | Bacteria | 3951 |
| 647 | Ga0439448_0006405 | 3300042005 | Bacteria | 3384 |
| 648 | Ga0439448_0017671 | 3300042005 | Bacteria | 2179 |
| 649 | Ga0439455_0076553 | 3300042012 | Bacteria | 905 |
| 650 | Ga0450903_000239 | 3300042138 | Bacteria | 12251 |
| 651 | Ga0439458_0006273 | 3300042157 | Bacteria | 2651 |
| 652 | Ga0439464_0021459 | 3300042439 | Bacteria | 1773 |
| 653 | Ga0466972_0004889 | 3300044658 | Bacteria | 6720 |
| 654 | Ga0466972_0112940 | 3300044658 | Bacteria | 1283 |
| 655 | Ga0466972_0210887 | 3300044658 | Bacteria | 909 |
| 656 | Ga0466965_0000595 | 3300044683 | Bacteria | 13193 |
| 657 | Ga0466965_0006940 | 3300044683 | Bacteria | 5182 |
| 658 | Ga0466961_0104050 | 3300044693 | Bacteria | 1788 |
| 659 | Ga0466963_0121145 | 3300044694 | Bacteria | 1800 |
| 660 | Ga0466963_0138893 | 3300044694 | Bacteria | 1682 |
| 661 | Ga0466963_0145076 | 3300044694 | Bacteria | 1646 |
| 662 | Ga0466971_0096291 | 3300044719 | Bacteria | 1357 |
| 663 | Ga0466968_0095932 | 3300044735 | Bacteria | 1320 |
| 664 | Ga0466970_0024260 | 3300044765 | Bacteria | 3171 |
| 665 | Ga0466970_0030660 | 3300044765 | Bacteria | 2836 |
| 666 | Ga0466970_0039325 | 3300044765 | Bacteria | 2510 |
| 667 | Ga0466970_0054530 | 3300044765 | Bacteria | 2135 |
| 668 | Ga0466957_0134340 | 3300044842 | Bacteria | 1588 |
| 669 | Ga0466960_0018318 | 3300044901 | Bacteria | 3066 |
| 670 | Ga0466960_0029256 | 3300044901 | Bacteria | 2527 |
| 671 | Ga0466960_0093120 | 3300044901 | Bacteria | 1539 |
| 672 | Ga0466959_0010327 | 3300045049 | Bacteria | 6668 |
| 673 | Ga0466958_0185596 | 3300045836 | Bacteria | 1320 |
| 674 | Ga0466967_0003660 | 3300045976 | Bacteria | 10114 |
| 675 | Ga0466967_0056848 | 3300045976 | Bacteria | 3452 |
| 676 | Ga0466967_0095884 | 3300045976 | Bacteria | 2705 |
| 677 | Ga0466967_0102930 | 3300045976 | Bacteria | 2613 |
| 678 | Ga0466967_0140003 | 3300045976 | Bacteria | 2253 |
| 679 | Ga0466967_0147581 | 3300045976 | Bacteria | 2195 |
| 680 | Ga0466967_0154495 | 3300045976 | Bacteria | 2148 |
| 681 | Ga0466967_0304541 | 3300045976 | Bacteria | 1534 |
| 682 | Ga0466967_0490806 | 3300045976 | Bacteria | 1204 |
| 683 | Ga0495592_0008331 | 3300046454 | Bacteria | 7777 |
| 684 | Ga0495603_0029188 | 3300046455 | Bacteria | 3326 |
| 685 | Ga0495629_0005204 | 3300046459 | Bacteria | 9741 |
| 686 | Ga0495641_0001209 | 3300046461 | Bacteria | 22153 |
| 687 | Ga0495651_0007507 | 3300046462 | Bacteria | 8339 |
| 688 | Ga0495651_0012160 | 3300046462 | Bacteria | 6627 |
| 689 | Ga0495651_0024686 | 3300046462 | Bacteria | 4675 |
| 690 | Ga0495653_0003497 | 3300046463 | Bacteria | 12634 |
| 691 | Ga0495653_0015813 | 3300046463 | Bacteria | 6152 |
| 692 | Ga0495653_0059332 | 3300046463 | Bacteria | 2904 |
| 693 | Ga0495653_0070602 | 3300046463 | Bacteria | 2613 |
| 694 | Ga0495580_0026734 | 3300046472 | Bacteria | 4203 |
| 695 | Ga0495582_0001277 | 3300046473 | Bacteria | 14138 |
| 696 | Ga0495639_0012119 | 3300046475 | Bacteria | 3716 |
| 697 | Ga0495639_0126462 | 3300046475 | Bacteria | 1222 |
| 698 | Ga0495662_0000438 | 3300046476 | Bacteria | 18719 |
| 699 | Ga0495664_0002025 | 3300046477 | Bacteria | 10827 |
| 700 | Ga0495664_0275772 | 3300046477 | Bacteria | 1016 |
| 701 | Ga0495594_0296947 | 3300046499 | Bacteria | 920 |
| 702 | Ga0495606_0036389 | 3300046507 | Bacteria | 3353 |
| 703 | Ga0495608_0002688 | 3300046511 | Bacteria | 12772 |
| 704 | Ga0495608_0011474 | 3300046511 | Bacteria | 6167 |
| 705 | Ga0495608_0012319 | 3300046511 | Bacteria | 5940 |
| 706 | Ga0495618_0047110 | 3300046514 | Bacteria | 2721 |
| 707 | Ga0495628_0018242 | 3300046516 | Bacteria | 5817 |
| 708 | Ga0495628_0034343 | 3300046516 | Bacteria | 4079 |
| 709 | Ga0495628_0108400 | 3300046516 | Bacteria | 2138 |
| 710 | Ga0495630_0005067 | 3300046517 | Bacteria | 9266 |
| 711 | Ga0495630_0007080 | 3300046517 | Bacteria | 7990 |
| 712 | Ga0495632_0027616 | 3300046519 | Bacteria | 2971 |
| 713 | Ga0495648_0034453 | 3300046524 | Bacteria | 3294 |
| 714 | Ga0495666_0017251 | 3300046526 | Bacteria | 3596 |
| 715 | Ga0495652_0026075 | 3300046529 | Bacteria | 5165 |
| 716 | Ga0495652_0062155 | 3300046529 | Bacteria | 3149 |
| 717 | Ga0495652_0108206 | 3300046529 | Bacteria | 2241 |
| 718 | Ga0495665_0000615 | 3300046531 | Bacteria | 18098 |
| 719 | Ga0495665_0047701 | 3300046531 | Bacteria | 2272 |
| 720 | Ga0495640_0006440 | 3300046533 | Bacteria | 9280 |
| 721 | Ga0495640_0183364 | 3300046533 | Bacteria | 1333 |
| 722 | Ga0495586_0003867 | 3300046535 | Bacteria | 8026 |
| 723 | Ga0495586_0041107 | 3300046535 | Bacteria | 2490 |
| 724 | Ga0495586_0041560 | 3300046535 | Bacteria | 2476 |
| 725 | Ga0495587_0016061 | 3300046536 | Bacteria | 4660 |
| 726 | Ga0495587_0019313 | 3300046536 | Bacteria | 4220 |
| 727 | Ga0495645_0006820 | 3300046543 | Bacteria | 7933 |
| 728 | Ga0495633_0010590 | 3300046558 | Bacteria | 5025 |
| 729 | Ga0495667_0005694 | 3300046559 | Bacteria | 8436 |
| 730 | Ga0495667_0012212 | 3300046559 | Bacteria | 5818 |
| 731 | Ga0495667_0017386 | 3300046559 | Bacteria | 4856 |
| 732 | Ga0495667_0028080 | 3300046559 | Bacteria | 3788 |
| 733 | Ga0495656_0000824 | 3300046615 | Bacteria | 9975 |
| 734 | Ga0495668_0030235 | 3300046616 | Bacteria | 3059 |
| 735 | Ga0495634_0022882 | 3300046642 | Bacteria | 4399 |
| 736 | Ga0495611_0018202 | 3300046648 | Bacteria | 3011 |
| 737 | Ga0495635_0000969 | 3300046663 | Bacteria | 18900 |
| 738 | Ga0495635_0007463 | 3300046663 | Bacteria | 7633 |
| 739 | Ga0495635_0015652 | 3300046663 | Bacteria | 5297 |
| 740 | Ga0495635_0296108 | 3300046663 | Bacteria | 1085 |
| 741 | Ga0495588_0012962 | 3300046674 | Bacteria | 3958 |
| 742 | Ga0495657_0013369 | 3300046675 | Bacteria | 6060 |
| 743 | Ga0495657_0016451 | 3300046675 | Bacteria | 5389 |
| 744 | Ga0495657_0017706 | 3300046675 | Bacteria | 5168 |
| 745 | Ga0495623_0010837 | 3300046679 | Bacteria | 5901 |
| 746 | Ga0495623_0138650 | 3300046679 | Bacteria | 1449 |
| 747 | Ga0495646_0017692 | 3300046680 | Bacteria | 4518 |
| 748 | Ga0495647_0006996 | 3300046681 | Bacteria | 3759 |
| 749 | Ga0495658_0008689 | 3300046683 | Bacteria | 5044 |
| 750 | Ga0495613_0001172 | 3300046689 | Bacteria | 19992 |
| 751 | Ga0495624_0014416 | 3300046690 | Bacteria | 5364 |
| 752 | Ga0495670_0000592 | 3300046691 | Bacteria | 17270 |
| 753 | Ga0495671_0049402 | 3300046692 | Bacteria | 2097 |
| 754 | Ga0495649_0143711 | 3300046694 | Bacteria | 1255 |
| 755 | Ga0495600_0019880 | 3300046809 | Bacteria | 4292 |
| 756 | Ga0495581_0001358 | 3300047315 | Bacteria | 13543 |
| 757 | Ga0495581_0033931 | 3300047315 | Bacteria | 2953 |
| 758 | Ga0495604_0004541 | 3300047317 | Bacteria | 10993 |
| 759 | Ga0495604_0089973 | 3300047317 | Bacteria | 2280 |
| 760 | Ga0495604_0149931 | 3300047317 | Bacteria | 1658 |
| 761 | Ga0495636_0134946 | 3300047318 | Bacteria | 1099 |
| 762 | Ga0495674_0002882 | 3300047319 | Bacteria | 16731 |
| 763 | Ga0495674_0016835 | 3300047319 | Bacteria | 6817 |
| 764 | Ga0495674_0220174 | 3300047319 | Bacteria | 1569 |
| 765 | Ga0495672_0019952 | 3300047320 | Bacteria | 4405 |
| 766 | Ga0495676_0005426 | 3300047321 | Bacteria | 11697 |
| 767 | Ga0495676_0006517 | 3300047321 | Bacteria | 10758 |
| 768 | Ga0495676_0017360 | 3300047321 | Bacteria | 6364 |
| 769 | Ga0495680_0005478 | 3300047322 | Bacteria | 11932 |
| 770 | Ga0495680_0019108 | 3300047322 | Bacteria | 5798 |
| 771 | Ga0495680_0041822 | 3300047322 | Bacteria | 3640 |
| 772 | Ga0495680_0268681 | 3300047322 | Bacteria | 1204 |
| 773 | Ga0495675_0035481 | 3300047444 | Bacteria | 3185 |
| 774 | Ga0495685_013005 | 3300047447 | Bacteria | 2823 |
| 775 | Ga0495673_0002322 | 3300047469 | Bacteria | 13589 |
| 776 | Ga0495681_0012674 | 3300047470 | Bacteria | 4941 |
| 777 | Ga0495684_0011391 | 3300047471 | Bacteria | 6866 |
| 778 | Ga0495684_0020900 | 3300047471 | Bacteria | 5043 |
| 779 | Ga0495684_0058354 | 3300047471 | Bacteria | 2940 |
| 780 | Ga0495593_0000574 | 3300047673 | Bacteria | 20889 |
| 781 | Ga0495593_0042265 | 3300047673 | Bacteria | 2447 |
| 782 | Ga0495602_0048163 | 3300048088 | Bacteria | 3834 |
| 783 | Ga0495602_0100321 | 3300048088 | Bacteria | 2378 |
| 784 | Ga0495602_0139400 | 3300048088 | Bacteria | 1921 |
| 785 | Ga0495614_0002354 | 3300048089 | Bacteria | 8409 |
| 786 | Ga0496100_0000851 | 3300048903 | Bacteria | 14590 |
| 787 | Ga0496100_0004104 | 3300048903 | Bacteria | 7681 |
| 788 | Ga0496100_0082473 | 3300048903 | Bacteria | 2174 |
| 789 | Ga0496100_0157332 | 3300048903 | Bacteria | 1626 |
| 790 | Ga0496101_0000049 | 3300048904 | Bacteria | 146432 |
| 791 | Ga0496101_0028470 | 3300048904 | Bacteria | 3900 |
| 792 | Ga0496101_0210558 | 3300048904 | Bacteria | 1506 |
| 793 | Ga0496102_0000011 | 3300048905 | Bacteria | 321716 |
| 794 | Ga0496102_0059645 | 3300048905 | Bacteria | 3489 |
| 795 | Ga0496102_0270078 | 3300048905 | Bacteria | 1603 |
| 796 | Ga0496102_0338410 | 3300048905 | Bacteria | 1417 |
| 797 | Ga0496102_0360247 | 3300048905 | Bacteria | 1369 |
| 798 | Ga0496103_0000032 | 3300048906 | Bacteria | 201453 |
| 799 | Ga0496103_0000570 | 3300048906 | Bacteria | 29250 |
| 800 | Ga0496104_0018057 | 3300048907 | Bacteria | 6431 |
| 801 | Ga0496104_0278106 | 3300048907 | Bacteria | 1587 |
| 802 | Ga0496104_0344276 | 3300048907 | Bacteria | 1404 |
| 803 | Ga0496105_0077108 | 3300048908 | Bacteria | 2752 |
| 804 | Ga0496105_0140652 | 3300048908 | Bacteria | 1986 |
| 805 | Ga0496105_0246144 | 3300048908 | Bacteria | 1450 |
| 806 | Ga0496105_0302524 | 3300048908 | Bacteria | 1285 |
| 807 | Ga0496106_0000351 | 3300048909 | Bacteria | 32650 |
| 808 | Ga0496106_0043232 | 3300048909 | Bacteria | 3380 |
| 809 | Ga0496107_0000393 | 3300048910 | Bacteria | 23705 |
| 810 | Ga0496107_0094691 | 3300048910 | Bacteria | 2184 |
| 811 | Ga0496108_0017926 | 3300048911 | Bacteria | 5792 |
| 812 | Ga0496108_0108039 | 3300048911 | Bacteria | 2376 |
| 813 | Ga0496108_0149252 | 3300048911 | Bacteria | 2017 |
| 814 | Ga0496108_0236789 | 3300048911 | Bacteria | 1588 |
| 815 | Ga0496108_0240914 | 3300048911 | Bacteria | 1573 |
| 816 | Ga0496108_0297618 | 3300048911 | Bacteria | 1405 |
| 817 | Ga0496108_0302142 | 3300048911 | Bacteria | 1394 |
| 818 | Ga0496109_0006185 | 3300048912 | Bacteria | 10063 |
| 819 | Ga0496109_0062471 | 3300048912 | Bacteria | 3406 |
| 820 | Ga0496109_0079591 | 3300048912 | Bacteria | 3020 |
| 821 | Ga0496109_0088367 | 3300048912 | Bacteria | 2864 |
| 822 | Ga0496109_0100831 | 3300048912 | Bacteria | 2679 |
| 823 | Ga0496109_0107845 | 3300048912 | Bacteria | 2588 |
| 824 | Ga0496109_0180159 | 3300048912 | Bacteria | 1984 |
| 825 | Ga0496110_0005576 | 3300048913 | Bacteria | 9879 |
| 826 | Ga0496110_0114800 | 3300048913 | Bacteria | 2424 |
| 827 | Ga0496110_0278624 | 3300048913 | Bacteria | 1523 |
| 828 | Ga0496110_0515061 | 3300048913 | Bacteria | 1088 |
| 829 | Ga0496111_0107684 | 3300048914 | Bacteria | 2052 |
| 830 | Ga0496112_0003719 | 3300048915 | Bacteria | 12731 |
| 831 | Ga0496112_0031803 | 3300048915 | Bacteria | 5120 |
| 832 | Ga0496112_0042192 | 3300048915 | Bacteria | 4463 |
| 833 | Ga0496112_0165420 | 3300048915 | Bacteria | 2178 |
| 834 | Ga0496112_0485215 | 3300048915 | Bacteria | 1172 |
| 835 | Ga0496113_0001680 | 3300048916 | Bacteria | 12533 |
| 836 | Ga0496113_0046043 | 3300048916 | Bacteria | 3238 |
| 837 | Ga0496113_0060775 | 3300048916 | Bacteria | 2849 |
| 838 | Ga0496114_0012870 | 3300048917 | Bacteria | 6701 |
| 839 | Ga0496114_0017369 | 3300048917 | Bacteria | 5806 |
| 840 | Ga0496114_0243655 | 3300048917 | Bacteria | 1581 |
| 841 | Ga0496114_0375558 | 3300048917 | Bacteria | 1258 |
| 842 | Ga0496115_0016536 | 3300048918 | Bacteria | 5620 |
| 843 | Ga0496115_0092718 | 3300048918 | Bacteria | 2469 |
| 844 | Ga0496115_0234913 | 3300048918 | Bacteria | 1511 |
| 845 | Ga0496116_0000072 | 3300048919 | Bacteria | 238158 |
| 846 | Ga0496116_0094659 | 3300048919 | Bacteria | 1805 |
| 847 | Ga0496117_0000039 | 3300048920 | Bacteria | 322143 |
| 848 | Ga0496117_0030781 | 3300048920 | Bacteria | 4110 |
| 849 | Ga0496118_0000035 | 3300048921 | Bacteria | 322143 |
| 850 | Ga0496118_0063425 | 3300048921 | Bacteria | 2719 |
| 851 | Ga0496119_0001807 | 3300048922 | Bacteria | 24866 |
| 852 | Ga0496120_0000190 | 3300048923 | Bacteria | 105211 |
| 853 | Ga0496120_0049351 | 3300048923 | Bacteria | 2416 |
| 854 | Ga0496121_0000351 | 3300048924 | Bacteria | 95963 |
| 855 | Ga0496122_0019334 | 3300048925 | Bacteria | 6226 |
| 856 | Ga0496122_0052731 | 3300048925 | Bacteria | 3075 |
| 857 | Ga0496123_0019828 | 3300048926 | Bacteria | 5280 |
| 858 | Ga0496124_0021037 | 3300048927 | Bacteria | 6016 |
| 859 | Ga0496126_0004142 | 3300048929 | Bacteria | 17532 |
| 860 | Ga0496126_0005807 | 3300048929 | Bacteria | 13950 |
| 861 | Ga0496126_0008968 | 3300048929 | Bacteria | 10706 |
| 862 | Ga0496126_0037423 | 3300048929 | Bacteria | 4528 |
| 863 | Ga0496126_0071321 | 3300048929 | Bacteria | 3092 |
| 864 | Ga0496126_0323305 | 3300048929 | Bacteria | 1267 |
| 865 | Ga0501306_009305 | 3300049127 | Bacteria | 1217 |
| 866 | Ga0501033_0003027 | 3300049570 | Bacteria | 14002 |
| 867 | Ga0501034_0000488 | 3300049571 | Bacteria | 64385 |
| 868 | Ga0501034_0020532 | 3300049571 | Bacteria | 6746 |
| 869 | Ga0501036_0005155 | 3300049572 | Bacteria | 10563 |
| 870 | Ga0501036_0025516 | 3300049572 | Bacteria | 4987 |
| 871 | Ga0501037_0048457 | 3300049573 | Bacteria | 3113 |
| 872 | Ga0501038_0018506 | 3300049574 | Bacteria | 6290 |
| 873 | Ga0501039_0027961 | 3300049575 | Bacteria | 4338 |
| 874 | Ga0501039_0059130 | 3300049575 | Bacteria | 2969 |
| 875 | Ga0501040_0188924 | 3300049576 | Bacteria | 1461 |
| 876 | Ga0501040_0249525 | 3300049576 | Bacteria | 1266 |
| 877 | Ga0501041_0055807 | 3300049577 | Bacteria | 2412 |
| 878 | Ga0501041_0080966 | 3300049577 | Bacteria | 1999 |
| 879 | Ga0501042_0039401 | 3300049578 | Bacteria | 3357 |
| 880 | Ga0501042_0257911 | 3300049578 | Bacteria | 1258 |
| 881 | Ga0501043_0009206 | 3300049579 | Bacteria | 7761 |
| 882 | Ga0501046_0030006 | 3300049580 | Bacteria | 4417 |
| 883 | Ga0501046_0131295 | 3300049580 | Bacteria | 1900 |
| 884 | Ga0501047_0061332 | 3300049581 | Bacteria | 3628 |
| 885 | Ga0501069_0009508 | 3300049585 | Bacteria | 5131 |
| 886 | Ga0501070_0082207 | 3300049586 | Bacteria | 2666 |
| 887 | Ga0501070_0259890 | 3300049586 | Bacteria | 1419 |
| 888 | Ga0501070_0486278 | 3300049586 | Bacteria | 992 |
| 889 | Ga0501072_0147441 | 3300049588 | Bacteria | 1876 |
| 890 | Ga0501073_0093963 | 3300049589 | Bacteria | 2083 |
| 891 | Ga0501073_0318369 | 3300049589 | Bacteria | 1073 |
| 892 | Ga0501074_0062594 | 3300049590 | Bacteria | 2680 |
| 893 | Ga0501076_0137762 | 3300049592 | Bacteria | 1982 |
| 894 | Ga0501079_0124067 | 3300049741 | Bacteria | 2009 |
| 895 | Ga0501081_0213699 | 3300049743 | Bacteria | 1401 |
| 896 | Ga0501035_0018391 | 3300049822 | Bacteria | 6439 |
| 897 | Ga0501035_0191804 | 3300049822 | Bacteria | 1757 |
| 898 | Ga0501044_0007886 | 3300049823 | Bacteria | 11703 |
| 899 | Ga0501045_0049155 | 3300049824 | Bacteria | 3075 |
| 900 | Ga0501045_0089044 | 3300049824 | Bacteria | 2280 |
| 901 | nmdc:mga03n38_15161_c1 | 3300050490 | Bacteria | 2970 |
| 902 | nmdc:mga03n38_45330_c1 | 3300050490 | Bacteria | 1936 |
| 903 | nmdc:mga03n38_51777_c1 | 3300050490 | Bacteria | 1835 |
| 904 | nmdc:mga03n38_53321_c1 | 3300050490 | Bacteria | 1813 |
| 905 | nmdc:mga03n38_8103_c1 | 3300050490 | Bacteria | 3752 |
| 906 | nmdc:mga00v17_2925_c1 | 3300050491 | Bacteria | 8758 |
| 907 | nmdc:mga00v17_9318_c1 | 3300050491 | Bacteria | 5310 |
| 908 | nmdc:mga0k408_107198_c1 | 3300050493 | Bacteria | 1650 |
| 909 | nmdc:mga06z11_61383_c1 | 3300050494 | Bacteria | 1960 |
| 910 | nmdc:mga04h51_12549_c1 | 3300050495 | Bacteria | 2380 |
| 911 | nmdc:mga07m45_19707_c1 | 3300050496 | Bacteria | 3656 |
| 912 | nmdc:mga07m45_27300_c1 | 3300050496 | Bacteria | 3144 |
| 913 | nmdc:mga05p37_70519_c1 | 3300050507 | Bacteria | 4298 |
| 914 | nmdc:mga05p37_77715_c2 | 3300050507 | Bacteria | 3424 |
| 915 | nmdc:mga06r32_126560_c1 | 3300050510 | Bacteria | 2524 |
| 916 | nmdc:mga0rr50_194393_c1 | 3300050513 | Bacteria | 1664 |
| 917 | nmdc:mga0sz30_27116_c1 | 3300050516 | Bacteria | 2352 |
| 918 | nmdc:mga0sz30_46883_c1 | 3300050516 | Bacteria | 1825 |
| 919 | nmdc:mga0sz30_951_c1 | 3300050516 | Bacteria | 10377 |
| 920 | Ga0495601_0009930 | 3300053077 | Bacteria | 5641 |
| 921 | Ga0495612_0000809 | 3300053078 | Bacteria | 12742 |
| 922 | Ga0495595_0036357 | 3300053084 | Bacteria | 2235 |
| 923 | Ga0495619_0001138 | 3300053085 | Bacteria | 17467 |
| 924 | Ga0500643_005407 | 3300053087 | Bacteria | 5509 |
| 925 | Ga0500556_0000163 | 3300053104 | Bacteria | 54246 |
| 926 | Ga0500562_001298 | 3300053108 | Bacteria | 6165 |
| 927 | Ga0500593_005587 | 3300053117 | Bacteria | 4973 |
| 928 | Ga0500608_125976 | 3300053122 | Bacteria | 1155 |
| 929 | Ga0500642_0085005 | 3300053130 | Bacteria | 1458 |
| 930 | Ga0500652_014170 | 3300053131 | Bacteria | 2844 |
| 931 | Ga0500559_0000513 | 3300053136 | Bacteria | 27259 |
| 932 | Ga0500559_0004792 | 3300053136 | Bacteria | 6335 |
| 933 | Ga0500568_0052258 | 3300053139 | Bacteria | 1605 |
| 934 | Ga0500579_069132 | 3300053143 | Bacteria | 2048 |
| 935 | Ga0500600_0167553 | 3300053149 | Bacteria | 1072 |
| 936 | Ga0500616_0000060 | 3300053153 | Bacteria | 252252 |
| 937 | Ga0500616_0071982 | 3300053153 | Bacteria | 1758 |
| 938 | Ga0500627_0010274 | 3300053158 | Bacteria | 3408 |
| 939 | Ga0500645_000025 | 3300053730 | Bacteria | 125835 |
| 940 | Ga0500645_011725 | 3300053730 | Bacteria | 2852 |
| 941 | Ga0501084_0197057 | 3300054114 | Bacteria | 1699 |
| 942 | Ga0501082_0520272 | 3300060353 | Bacteria | 1040 |
| 943 | Ga0530510_0060449 | 3300061734 | Bacteria | 2742 |
| 944 | 2508673384 | 2508501039 | Bacteria | 9978592 |
| 945 | 2523384505 | 2523231044 | Bacteria | 6434991 |
| 946 | 2738707321 | 2738541274 | Bacteria | 6909446 |
| 947 | 2739328627 | 2738543028 | Bacteria | 6917070 |
| 948 | 2739363524 | 2738543034 | Bacteria | 6084756 |
| 949 | 2739365499 | 2738543034 | Bacteria | 6084756 |
| 950 | 2785369367 | 2784746768 | Bacteria | 10036182 |
| 951 | 2808850769 | 2808606360 | Bacteria | 4404006 |
| 952 | 2812318706 | 2811994871 | Bacteria | 4497550 |
| 953 | 2816503847 | 2816332139 | Bacteria | 9138787 |
| 954 | 2832007023 | 2832004796 | Bacteria | 6538017 |
| 955 | 2842139670 | 2842134933 | Bacteria | 5847019 |
| 956 | 2857740908 | 2857740372 | Bacteria | 4782044 |
| 957 | 2866070329 | 2866065130 | Bacteria | 6518152 |
| 958 | 2870790144 | 2870782633 | Bacteria | 9624083 |
| 959 | 2902797453 | 2902792274 | Bacteria | 7270173 |
| 960 | 2902799827 | 2902799365 | Bacteria | 5419524 |
| 961 | 2904501484 | 2904497146 | Bacteria | 4731781 |
| 962 | 2904766918 | 2904765812 | Bacteria | 5369154 |
| 963 | 2904775070 | 2904770941 | Bacteria | 5580202 |
| 964 | 2904778112 | 2904776348 | Bacteria | 4658726 |
| 965 | 2910811247 | 2910809715 | Bacteria | 4982797 |
| 966 | 2919035458 | 2919034639 | Bacteria | 4763403 |
| 967 | 2919055018 | 2919051321 | Bacteria | 4210889 |
| 968 | 2919420647 | 2919420072 | Bacteria | 5390363 |
| 969 | 2919433595 | 2919432681 | Bacteria | 5390474 |
| 970 | 2919539326 | 2919538618 | Bacteria | 4677069 |
| 971 | 2932427878 | 2932426870 | Bacteria | 4547726 |
| 972 | 2933422360 | 2933418574 | Bacteria | 4476724 |
| 973 | 2939601887 | 2939598168 | Bacteria | 4687164 |
| 974 | 2939677748 | 2939674588 | Bacteria | 4844420 |
| 975 | 2997605434 | 2997600082 | Bacteria | 9896405 |
| 976 | 3006430889 | 3006425503 | Bacteria | 6491253 |
| 977 | 8003317789 | 8003314358 | Bacteria | 10575343 |
| 978 | 8054476820 | 8054472261 | Bacteria | 7464355 |
| 979 | 8055034678 | 8055034563 | Bacteria | 3562128 |
| 980 | 8056064004 | 8056060235 | Bacteria | 7259403 |
| 981 | Ga0495667_0213537 | |||
| 982 | LJQas_1006464 | |||
| 983 | JGI24739J22299_10001011 | |||
| 984 | JGI24743J22301_10003850 | |||
| 985 | JGI24750J21931_1006679 | |||
| 986 | JGI24738J21930_10004652 | |||
| 987 | JGI24744J21845_10000914 | |||
| 988 | JGI24744J21845_10004456 | |||
| 989 | JGI24034J26672_10006466 | |||
| 990 | JGI25152J39213_1000223 | |||
| 991 | JGI25404J52841_10005017 | |||
| 992 | Ga0055542_1003653 | |||
| 993 | Ga0070658_10116132 | |||
| 994 | Ga0070658_10121123 | |||
| 995 | Ga0070658_10197972 | |||
| 996 | Ga0070658_10431126 | |||
| 997 | Ga0070676_10003893 | |||
| 998 | Ga0070676_10042782 | |||
| 999 | Ga0070683_100207208 | |||
| 1000 | Ga0070690_100001751 | |||
| 1001 | Ga0068869_100040836 | |||
| 1002 | Ga0068869_100046758 | |||
| 1003 | Ga0068869_100107815 | |||
| 1004 | Ga0068869_100325362 | |||
| 1005 | Ga0070666_10084631 | |||
| 1006 | Ga0070680_100549544 | |||
| 1007 | Ga0070682_100002159 | |||
| 1008 | Ga0070682_100004022 | |||
| 1009 | Ga0068868_100001850 | |||
| 1010 | Ga0068868_100043299 | |||
| 1011 | Ga0068868_100195797 | |||
| 1012 | Ga0070660_100223542 | |||
| 1013 | Ga0070660_100303344 | |||
| 1014 | Ga0070660_100328877 | |||
| 1015 | Ga0070689_100015053 | |||
| 1016 | Ga0070689_100044218 | |||
| 1017 | Ga0070689_100094210 | |||
| 1018 | Ga0070689_100165173 | |||
| 1019 | Ga0070691_10031877 | |||
| 1020 | Ga0070687_100100196 | |||
| 1021 | Ga0070661_100030858 | |||
| 1022 | Ga0070692_10016910 | |||
| 1023 | Ga0070692_10062596 | |||
| 1024 | Ga0070692_10076025 | |||
| 1025 | Ga0070668_100000260 | |||
| 1026 | Ga0070668_100003086 | |||
| 1027 | Ga0070668_100008605 | |||
| 1028 | Ga0070668_100042721 | |||
| 1029 | Ga0070668_100096070 | |||
| 1030 | Ga0070669_100394691 | |||
| 1031 | Ga0070675_100182153 | |||
| 1032 | Ga0070671_100181586 | |||
| 1033 | Ga0070674_100015264 | |||
| 1034 | Ga0070674_100032985 | |||
| 1035 | Ga0070674_100272373 | |||
| 1036 | Ga0070673_100017797 | |||
| 1037 | Ga0070673_100035514 | |||
| 1038 | Ga0070673_100042527 | |||
| 1039 | Ga0070688_100060704 | |||
| 1040 | Ga0070659_100007076 | |||
| 1041 | Ga0070659_100031560 | |||
| 1042 | Ga0070659_100038587 | |||
| 1043 | Ga0070659_100107352 | |||
| 1044 | Ga0070659_100187708 | |||
| 1045 | Ga0070667_100003272 | |||
| 1046 | Ga0070709_10054287 | |||
| 1047 | Ga0070709_10458522 | |||
| 1048 | Ga0070714_100004406 | |||
| 1049 | Ga0070714_100008761 | |||
| 1050 | Ga0070714_100133967 | |||
| 1051 | Ga0070713_100062002 | |||
| 1052 | Ga0070710_10000303 | |||
| 1053 | Ga0070701_10076508 | |||
| 1054 | Ga0070711_100001503 | |||
| 1055 | Ga0070711_100110898 | |||
| 1056 | Ga0070705_100009744 | |||
| 1057 | Ga0070705_100023877 | |||
| 1058 | Ga0070694_100032942 | |||
| 1059 | Ga0070694_100269260 | |||
| 1060 | Ga0070708_100011818 | |||
| 1061 | Ga0070708_100031194 | |||
| 1062 | Ga0070708_100647180 | |||
| 1063 | Ga0070663_100018222 | |||
| 1064 | Ga0070663_100086633 | |||
| 1065 | Ga0070663_100146409 | |||
| 1066 | Ga0070663_100168700 | |||
| 1067 | Ga0070663_100242815 | |||
| 1068 | Ga0070663_100382576 | |||
| 1069 | Ga0070678_100005572 | |||
| 1070 | Ga0070678_100034932 | |||
| 1071 | Ga0070662_100002181 | |||
| 1072 | Ga0070662_100026343 | |||
| 1073 | Ga0070662_100210909 | |||
| 1074 | Ga0070681_10119333 | |||
| 1075 | Ga0068867_100002967 | |||
| 1076 | Ga0070685_10034580 | |||
| 1077 | Ga0070685_10059568 | |||
| 1078 | Ga0070685_10103107 | |||
| 1079 | Ga0070706_100000178 | |||
| 1080 | Ga0070706_100049652 | |||
| 1081 | Ga0070707_100159024 | |||
| 1082 | Ga0070698_100004573 | |||
| 1083 | Ga0070698_100016273 | |||
| 1084 | Ga0070698_100205108 | |||
| 1085 | Ga0070698_100277722 | |||
| 1086 | Ga0070698_100339566 | |||
| 1087 | Ga0070699_100147151 | |||
| 1088 | Ga0070679_100016779 | |||
| 1089 | Ga0070679_100046295 | |||
| 1090 | Ga0070679_100303068 | |||
| 1091 | Ga0070679_100310072 | |||
| 1092 | Ga0070679_100404092 | |||
| 1093 | Ga0070684_100013218 | |||
| 1094 | Ga0070684_100065121 | |||
| 1095 | Ga0070684_100068544 | |||
| 1096 | Ga0070684_100114155 | |||
| 1097 | Ga0070684_100187052 | |||
| 1098 | Ga0070684_100311379 | |||
| 1099 | Ga0070697_100010094 | |||
| 1100 | Ga0068853_100000732 | |||
| 1101 | Ga0068853_100001940 | |||
| 1102 | Ga0070686_100018403 | |||
| 1103 | Ga0070695_100023646 | |||
| 1104 | Ga0070696_100002906 | |||
| 1105 | Ga0070696_100109461 | |||
| 1106 | Ga0070665_100010056 | |||
| 1107 | Ga0070665_100117145 | |||
| 1108 | Ga0070665_100158871 | |||
| 1109 | Ga0070665_100420585 | |||
| 1110 | Ga0070704_100000340 | |||
| 1111 | Ga0070704_100357605 | |||
| 1112 | Ga0068855_100215102 | |||
| 1113 | Ga0068855_100287260 | |||
| 1114 | Ga0070664_100098862 | |||
| 1115 | Ga0070664_100314505 | |||
| 1116 | Ga0068857_100121715 | |||
| 1117 | Ga0068857_100146914 | |||
| 1118 | Ga0068854_100008668 | |||
| 1119 | Ga0068854_100009181 | |||
| 1120 | Ga0068854_100031524 | |||
| 1121 | Ga0068854_100108594 | |||
| 1122 | Ga0068856_100168955 | |||
| 1123 | Ga0068856_100217420 | |||
| 1124 | Ga0068856_100314483 | |||
| 1125 | Ga0068856_100389568 | |||
| 1126 | Ga0070702_100000276 | |||
| 1127 | Ga0070702_100051345 | |||
| 1128 | Ga0070702_100131298 | |||
| 1129 | Ga0068852_100231180 | |||
| 1130 | Ga0068852_100237611 | |||
| 1131 | Ga0068859_100002195 | |||
| 1132 | Ga0068859_100079926 | |||
| 1133 | Ga0068864_100006253 | |||
| 1134 | Ga0068864_100096957 | |||
| 1135 | Ga0068864_100139174 | |||
| 1136 | Ga0068866_10000121 | |||
| 1137 | Ga0068866_10004057 | |||
| 1138 | Ga0068866_10117444 | |||
| 1139 | Ga0068861_100000790 | |||
| 1140 | Ga0068861_100375402 | |||
| 1141 | Ga0068870_10141590 | |||
| 1142 | Ga0068863_100007024 | |||
| 1143 | Ga0068863_100075265 | |||
| 1144 | Ga0068863_100372820 | |||
| 1145 | Ga0068858_100002942 | |||
| 1146 | Ga0068858_100031184 | |||
| 1147 | Ga0068858_100095602 | |||
| 1148 | Ga0068858_100121274 | |||
| 1149 | Ga0068860_100000694 | |||
| 1150 | Ga0068860_100383684 | |||
| 1151 | Ga0068860_100393167 | |||
| 1152 | Ga0068862_100073297 | |||
| 1153 | Ga0068862_100094842 | |||
| 1154 | Ga0068862_100584198 | |||
| 1155 | Ga0081538_10091329 | |||
| 1156 | Ga0081540_1002936 | |||
| 1157 | Ga0081540_1037636 | |||
| 1158 | Ga0070717_10242983 | |||
| 1159 | Ga0075365_10000777 | |||
| 1160 | Ga0075365_10011637 | |||
| 1161 | Ga0075368_10033147 | |||
| 1162 | Ga0075363_100002184 | |||
| 1163 | Ga0075363_100005192 | |||
| 1164 | Ga0075363_100013065 | |||
| 1165 | Ga0075363_100016120 | |||
| 1166 | Ga0075363_100051356 | |||
| 1167 | Ga0075364_10001722 | |||
| 1168 | Ga0075364_10002641 | |||
| 1169 | Ga0075364_10006989 | |||
| 1170 | Ga0075364_10246628 | |||
| 1171 | Ga0075364_10320666 | |||
| 1172 | Ga0070715_10079249 | |||
| 1173 | Ga0070716_100000551 | |||
| 1174 | Ga0070712_100004121 | |||
| 1175 | Ga0070712_100047113 | |||
| 1176 | Ga0070712_100071380 | |||
| 1177 | Ga0070712_100210657 | |||
| 1178 | Ga0070712_100281094 | |||
| 1179 | Ga0075362_10008480 | |||
| 1180 | Ga0075362_10032711 | |||
| 1181 | Ga0075362_10067933 | |||
| 1182 | Ga0075367_10055104 | |||
| 1183 | Ga0075367_10083181 | |||
| 1184 | Ga0075369_10000746 | |||
| 1185 | Ga0075369_10058712 | |||
| 1186 | Ga0075366_10083210 | |||
| 1187 | Ga0097621_100014529 | |||
| 1188 | Ga0097621_100034294 | |||
| 1189 | Ga0097621_100109080 | |||
| 1190 | Ga0075370_10000407 | |||
| 1191 | Ga0075370_10022616 | |||
| 1192 | Ga0075370_10024714 | |||
| 1193 | Ga0075370_10037882 | |||
| 1194 | Ga0075431_100028346 | |||
| 1195 | Ga0068865_100003268 | |||
| 1196 | Ga0068865_100264313 | |||
| 1197 | Ga0075436_100218673 | |||
| 1198 | Ga0097620_100002195 | |||
| 1199 | Ga0097620_100079928 | |||
| 1200 | Ga0075435_100055045 | |||
| 1201 | Ga0099794_10223646 | |||
| 1202 | Ga0099795_10097355 | |||
| 1203 | Ga0105244_10094693 | |||
| 1204 | Ga0105250_10118259 | |||
| 1205 | Ga0105240_10042940 | |||
| 1206 | Ga0105240_10284090 | |||
| 1207 | Ga0111539_10475281 | |||
| 1208 | Ga0105245_10004378 | |||
| 1209 | Ga0105245_10098839 | |||
| 1210 | Ga0105245_10147197 | |||
| 1211 | Ga0105245_10676667 | |||
| 1212 | Ga0105247_10000541 | |||
| 1213 | Ga0105247_10035331 | |||
| 1214 | Ga0114129_10035682 | |||
| 1215 | Ga0114129_10251320 | |||
| 1216 | Ga0114129_10390013 | |||
| 1217 | Ga0105243_10502066 | |||
| 1218 | Ga0105243_10626304 | |||
| 1219 | Ga0105241_10427162 | |||
| 1220 | Ga0105242_10000572 | |||
| 1221 | Ga0105242_10211617 | |||
| 1222 | Ga0105248_10003762 | |||
| 1223 | Ga0105248_10036204 | |||
| 1224 | Ga0105248_10108657 | |||
| 1225 | Ga0105248_10126994 | |||
| 1226 | Ga0105248_10684684 | |||
| 1227 | Ga0105237_10000989 | |||
| 1228 | Ga0105237_10014908 | |||
| 1229 | Ga0105237_10021850 | |||
| 1230 | Ga0105237_10256787 | |||
| 1231 | Ga0105237_10382287 | |||
| 1232 | Ga0105238_10059610 | |||
| 1233 | Ga0105238_10251768 | |||
| 1234 | Ga0105238_10496081 | |||
| 1235 | Ga0105249_10008808 | |||
| 1236 | Ga0105249_10045535 | |||
| 1237 | Ga0105249_10049659 | |||
| 1238 | Ga0105249_10213490 | |||
| 1239 | Ga0105239_10001012 | |||
| 1240 | Ga0105239_10028063 | |||
| 1241 | Ga0105239_10274345 | |||
| 1242 | Ga0105239_10320968 | |||
| 1243 | Ga0105239_10647579 | |||
| 1244 | Ga0105246_10017527 | |||
| 1245 | Ga0105246_10231586 | |||
| 1246 | Ga0105246_10425834 | |||
| 1247 | Ga0157340_1000155 | |||
| 1248 | Ga0157342_1000664 | |||
| 1249 | Ga0157373_10014861 | |||
| 1250 | Ga0157373_10102813 | |||
| 1251 | Ga0157373_10314979 | |||
| 1252 | Ga0157370_10088666 | |||
| 1253 | Ga0157370_10289568 | |||
| 1254 | Ga0157369_10045076 | |||
| 1255 | Ga0157369_10054299 | |||
| 1256 | Ga0157369_10080939 | |||
| 1257 | Ga0157369_10136810 | |||
| 1258 | Ga0157369_10156235 | |||
| 1259 | Ga0157369_10165211 | |||
| 1260 | Ga0157369_10395391 | |||
| 1261 | Ga0157374_10007319 | |||
| 1262 | Ga0157374_10039682 | |||
| 1263 | Ga0157374_10827013 | |||
| 1264 | Ga0157378_10027760 | |||
| 1265 | Ga0157378_10088862 | |||
| 1266 | Ga0157378_10516802 | |||
| 1267 | Ga0163162_10018447 | |||
| 1268 | Ga0157372_10216190 | |||
| 1269 | Ga0157372_10250179 | |||
| 1270 | Ga0157372_10336022 | |||
| 1271 | Ga0157372_10429298 | |||
| 1272 | Ga0157372_10476780 | |||
| 1273 | Ga0157375_10047074 | |||
| 1274 | Ga0157375_10168032 | |||
| 1275 | Ga0157375_10777500 | |||
| 1276 | Ga0163163_10060585 | |||
| 1277 | Ga0163163_10397376 | |||
| 1278 | Ga0163163_10668285 | |||
| 1279 | Ga0157380_10004599 | |||
| 1280 | Ga0157380_10126877 | |||
| 1281 | Ga0157377_10010134 | |||
| 1282 | Ga0157377_10015596 | |||
| 1283 | Ga0157377_10031061 | |||
| 1284 | Ga0157379_10026679 | |||
| 1285 | Ga0157379_10073665 | |||
| 1286 | Ga0157376_10117277 | |||
| 1287 | Ga0163161_10001874 | |||
| 1288 | Ga0163161_10038811 | |||
| 1289 | Ga0163161_10079280 | |||
| 1290 | Ga0163161_10405053 | |||
| 1291 | Ga0206356_10161964 | |||
| 1292 | Ga0206353_11031012 | |||
| 1293 | Ga0206353_11285738 | |||
| 1294 | Ga0213874_10057051 | |||
| 1295 | Ga0213876_10013774 | |||
| 1296 | Ga0213875_10000644 | |||
| 1297 | Ga0213875_10019991 | |||
| 1298 | Ga0213875_10022970 | |||
| 1299 | Ga0213875_10039209 | |||
| 1300 | Ga0224712_10146191 | |||
| 1301 | Ga0209129_1000354 | |||
| 1302 | Ga0209051_1022202 | |||
| 1303 | Ga0207697_10000412 | |||
| 1304 | Ga0207697_10000464 | |||
| 1305 | Ga0207655_1011840 | |||
| 1306 | Ga0207655_1013050 | |||
| 1307 | Ga0207653_10007248 | |||
| 1308 | Ga0207692_10003016 | |||
| 1309 | Ga0207692_10069152 | |||
| 1310 | Ga0207692_10221137 | |||
| 1311 | Ga0207642_10001487 | |||
| 1312 | Ga0207642_10093866 | |||
| 1313 | Ga0207710_10011320 | |||
| 1314 | Ga0207710_10012078 | |||
| 1315 | Ga0207710_10167407 | |||
| 1316 | Ga0207688_10000299 | |||
| 1317 | Ga0207688_10007098 | |||
| 1318 | Ga0207688_10008717 | |||
| 1319 | Ga0207688_10150493 | |||
| 1320 | Ga0207647_10008657 | |||
| 1321 | Ga0207647_10022023 | |||
| 1322 | Ga0207647_10072007 | |||
| 1323 | Ga0207647_10130467 | |||
| 1324 | Ga0207685_10133024 | |||
| 1325 | Ga0207699_10008657 | |||
| 1326 | Ga0207699_10014821 | |||
| 1327 | Ga0207699_10107488 | |||
| 1328 | Ga0207645_10005579 | |||
| 1329 | Ga0207643_10002999 | |||
| 1330 | Ga0207643_10037827 | |||
| 1331 | Ga0207643_10203958 | |||
| 1332 | Ga0207705_10246987 | |||
| 1333 | Ga0207684_10000029 | |||
| 1334 | Ga0207707_10031989 | |||
| 1335 | Ga0207695_10084420 | |||
| 1336 | Ga0207671_10006521 | |||
| 1337 | Ga0207671_10016946 | |||
| 1338 | Ga0207671_10139657 | |||
| 1339 | Ga0207671_10251878 | |||
| 1340 | Ga0207693_10000174 | |||
| 1341 | Ga0207693_10003641 | |||
| 1342 | Ga0207693_10035884 | |||
| 1343 | Ga0207693_10145809 | |||
| 1344 | Ga0207693_10184358 | |||
| 1345 | Ga0207663_10000793 | |||
| 1346 | Ga0207663_10015934 | |||
| 1347 | Ga0207663_10062833 | |||
| 1348 | Ga0207663_10277159 | |||
| 1349 | Ga0207663_10299460 | |||
| 1350 | Ga0207660_10047938 | |||
| 1351 | Ga0207660_10114314 | |||
| 1352 | Ga0207657_10051676 | |||
| 1353 | Ga0207657_10121289 | |||
| 1354 | Ga0207657_10140271 | |||
| 1355 | Ga0207657_10146816 | |||
| 1356 | Ga0207649_10067995 | |||
| 1357 | Ga0207652_10029348 | |||
| 1358 | Ga0207652_10077787 | |||
| 1359 | Ga0207652_10111207 | |||
| 1360 | Ga0207652_10188929 | |||
| 1361 | Ga0207652_10238815 | |||
| 1362 | Ga0207652_10285860 | |||
| 1363 | Ga0207681_10151313 | |||
| 1364 | Ga0207694_10348687 | |||
| 1365 | Ga0207687_10001202 | |||
| 1366 | Ga0207687_10018873 | |||
| 1367 | Ga0207687_10071276 | |||
| 1368 | Ga0207700_10018882 | |||
| 1369 | Ga0207700_10105498 | |||
| 1370 | Ga0207700_10136303 | |||
| 1371 | Ga0207700_10177212 | |||
| 1372 | Ga0207664_10005914 | |||
| 1373 | Ga0207664_10008142 | |||
| 1374 | Ga0207664_10039317 | |||
| 1375 | Ga0207664_10310908 | |||
| 1376 | Ga0207644_10205925 | |||
| 1377 | Ga0207690_10080913 | |||
| 1378 | Ga0207690_10094211 | |||
| 1379 | Ga0207690_10178365 | |||
| 1380 | Ga0207706_10005203 | |||
| 1381 | Ga0207706_10019886 | |||
| 1382 | Ga0207709_10006674 | |||
| 1383 | Ga0207709_10024929 | |||
| 1384 | Ga0207670_10076467 | |||
| 1385 | Ga0207670_10313151 | |||
| 1386 | Ga0207669_10005973 | |||
| 1387 | Ga0207669_10013767 | |||
| 1388 | Ga0207669_10351779 | |||
| 1389 | Ga0207669_10387893 | |||
| 1390 | Ga0207704_10000200 | |||
| 1391 | Ga0207665_10007301 | |||
| 1392 | Ga0207665_10009571 | |||
| 1393 | Ga0207665_10095499 | |||
| 1394 | Ga0207665_10126321 | |||
| 1395 | Ga0207691_10020004 | |||
| 1396 | Ga0207691_10047976 | |||
| 1397 | Ga0207691_10258942 | |||
| 1398 | Ga0207691_10366335 | |||
| 1399 | Ga0207711_10051632 | |||
| 1400 | Ga0207689_10005029 | |||
| 1401 | Ga0207689_10022286 | |||
| 1402 | Ga0207689_10054309 | |||
| 1403 | Ga0207689_10210243 | |||
| 1404 | Ga0207661_10003808 | |||
| 1405 | Ga0207661_10004385 | |||
| 1406 | Ga0207661_10105833 | |||
| 1407 | Ga0207667_10108847 | |||
| 1408 | Ga0207712_10020201 | |||
| 1409 | Ga0207712_10086315 | |||
| 1410 | Ga0207668_10103139 | |||
| 1411 | Ga0207668_10119311 | |||
| 1412 | Ga0207668_10312265 | |||
| 1413 | Ga0207640_10008556 | |||
| 1414 | Ga0207640_10076669 | |||
| 1415 | Ga0207658_10020989 | |||
| 1416 | Ga0207677_10019275 | |||
| 1417 | Ga0207677_10080142 | |||
| 1418 | Ga0207703_10003338 | |||
| 1419 | Ga0207703_10045927 | |||
| 1420 | Ga0207703_10053181 | |||
| 1421 | Ga0207703_10120213 | |||
| 1422 | Ga0207639_10020609 | |||
| 1423 | Ga0207678_10008344 | |||
| 1424 | Ga0207678_10064053 | |||
| 1425 | Ga0207678_10068164 | |||
| 1426 | Ga0207678_10080179 | |||
| 1427 | Ga0207678_10101520 | |||
| 1428 | Ga0207708_10000934 | |||
| 1429 | Ga0207708_10025100 | |||
| 1430 | Ga0207708_10047124 | |||
| 1431 | Ga0207708_10049500 | |||
| 1432 | Ga0207702_10095540 | |||
| 1433 | Ga0207702_10219659 | |||
| 1434 | Ga0207702_10237740 | |||
| 1435 | Ga0207641_10026350 | |||
| 1436 | Ga0207641_10212797 | |||
| 1437 | Ga0207648_10000562 | |||
| 1438 | Ga0207648_10034665 | |||
| 1439 | Ga0207676_10051855 | |||
| 1440 | Ga0207674_10006496 | |||
| 1441 | Ga0207674_10021982 | |||
| 1442 | Ga0207674_10095609 | |||
| 1443 | Ga0207674_10173852 | |||
| 1444 | Ga0207674_10405937 | |||
| 1445 | Ga0207674_10438873 | |||
| 1446 | Ga0207675_100000185 | |||
| 1447 | Ga0207675_100034793 | |||
| 1448 | Ga0207675_100051937 | |||
| 1449 | Ga0207675_100075938 | |||
| 1450 | Ga0207683_10000357 | |||
| 1451 | Ga0207683_10009444 | |||
| 1452 | Ga0207683_10011925 | |||
| 1453 | Ga0207698_10072474 | |||
| 1454 | Ga0207698_10331768 | |||
| 1455 | Ga0209813_10016019 | |||
| 1456 | Ga0268266_10016779 | |||
| 1457 | Ga0268266_10083648 | |||
| 1458 | Ga0268265_10007009 | |||
| 1459 | Ga0268265_10422030 | |||
| 1460 | Ga0268264_10001293 | |||
| 1461 | Ga0265337_1000064 | |||
| 1462 | Ga0265326_10001044 | |||
| 1463 | Ga0265319_1000034 | |||
| 1464 | Ga0265319_1001979 | |||
| 1465 | Ga0265334_10000705 | |||
| 1466 | Ga0265318_10014671 | |||
| 1467 | Ga0265323_10011707 | |||
| 1468 | Ga0265336_10001316 | |||
| 1469 | Ga0307515_10001030 | |||
| 1470 | Ga0307515_10054860 | |||
| 1471 | Ga0307515_10249512 | |||
| 1472 | Ga0307515_10273327 | |||
| 1473 | Ga0307515_10412514 | |||
| 1474 | Ga0265338_10000565 | |||
| 1475 | Ga0265338_10002634 | |||
| 1476 | Ga0265324_10004404 | |||
| 1477 | Ga0307512_10002715 | |||
| 1478 | Ga0307512_10167676 | |||
| 1479 | Ga0316176_1147110 | |||
| 1480 | Ga0314311_1217690 | |||
| 1481 | Ga0265332_10001004 | |||
| 1482 | Ga0265320_10004097 | |||
| 1483 | Ga0265320_10015076 | |||
| 1484 | Ga0265340_10006980 | |||
| 1485 | Ga0265339_10024325 | |||
| 1486 | Ga0265316_10015192 | |||
| 1487 | Ga0307513_10010160 | |||
| 1488 | Ga0307513_10011034 | |||
| 1489 | Ga0307509_10340914 | |||
| 1490 | Ga0307408_100000205 | |||
| 1491 | Ga0307408_100041587 | |||
| 1492 | Ga0307408_100054172 | |||
| 1493 | Ga0307408_100149258 | |||
| 1494 | Ga0307408_100221176 | |||
| 1495 | Ga0265313_10050036 | |||
| 1496 | Ga0307508_10042391 | |||
| 1497 | Ga0307508_10047877 | |||
| 1498 | Ga0307508_10372780 | |||
| 1499 | Ga0316575_10002381 | |||
| 1500 | Ga0265314_10070799 | |||
| 1501 | Ga0265342_10012544 | |||
| 1502 | Ga0316576_10134679 | |||
| 1503 | Ga0316576_10353739 | |||
| 1504 | Ga0316578_10079246 | |||
| 1505 | Ga0316578_10224106 | |||
| 1506 | Ga0307516_10064138 | |||
| 1507 | Ga0307405_10019015 | |||
| 1508 | Ga0307413_10074370 | |||
| 1509 | Ga0307410_10004832 | |||
| 1510 | Ga0307410_10031823 | |||
| 1511 | Ga0307406_10000260 | |||
| 1512 | Ga0307406_10054506 | |||
| 1513 | Ga0307406_10110756 | |||
| 1514 | Ga0307407_10106660 | |||
| 1515 | Ga0307412_10000876 | |||
| 1516 | Ga0307412_10563151 | |||
| 1517 | Ga0307409_100049557 | |||
| 1518 | Ga0307409_100148448 | |||
| 1519 | Ga0307409_100158560 | |||
| 1520 | Ga0307416_100032055 | |||
| 1521 | Ga0307416_100085114 | |||
| 1522 | Ga0307416_100383076 | |||
| 1523 | Ga0307416_100643325 | |||
| 1524 | Ga0307411_10050500 | |||
| 1525 | Ga0307411_10308858 | |||
| 1526 | Ga0307415_100142768 | |||
| 1527 | Ga0307415_100177782 | |||
| 1528 | Ga0316583_10004543 | |||
| 1529 | Ga0316585_10006192 | |||
| 1530 | Ga0316580_10024373 | |||
| 1531 | Ga0316212_1004930 | |||
| 1532 | Ga0373930_0017051 | |||
| 1533 | Ga0373926_0002946 | |||
| 1534 | Ga0373926_0007322 | |||
| 1535 | Ga0373929_0019068 | |||
| 1536 | Ga0373934_0010839 | |||
| 1537 | Ga0373934_0021472 | |||
| 1538 | Ga0373934_0028616 | |||
| 1539 | Ga0373944_0001669 | |||
| 1540 | Ga0373944_0044515 | |||
| 1541 | Ga0373951_0008016 | |||
| 1542 | Ga0373923_0028763 | |||
| 1543 | Ga0373936_0000838 | |||
| 1544 | Ga0373936_0001503 | |||
| 1545 | Ga0373936_0016661 | |||
| 1546 | Ga0373945_0002990 | |||
| 1547 | Ga0373945_0005014 | |||
| 1548 | Ga0373953_0004584 | |||
| 1549 | Ga0373953_0011079 | |||
| 1550 | Ga0373953_0030980 | |||
| 1551 | Ga0373954_0164076 | |||
| 1552 | Ga0373956_0022644 | |||
| 1553 | Ga0373957_0003726 | |||
| 1554 | Ga0373943_0002144 | |||
| 1555 | Ga0373946_0000254 | |||
| 1556 | Ga0373946_0001368 | |||
| 1557 | Ga0373946_0088572 | |||
| 1558 | Ga0373955_0008345 | |||
| 1559 | Ga0373955_0009421 | |||
| 1560 | Ga0373955_0240004 | |||
| 1561 | Ga0373962_0015714 | |||
| 1562 | Ga0316574_0094533 | |||
| 1563 | Ga0373924_0006751 | |||
| 1564 | Ga0373931_0012154 | |||
| 1565 | Ga0373935_0012197 | |||
| 1566 | Ga0373935_0015107 | |||
| 1567 | Ga0373935_0027066 | |||
| 1568 | Ga0373935_0089501 | |||
| 1569 | Ga0373927_0002586 | |||
| 1570 | Ga0373933_0016123 | |||
| 1571 | Ga0373933_0145895 | |||
| 1572 | Ga0373947_0035668 | |||
| 1573 | Ga0373947_0173893 | |||
| 1574 | Ga0373937_0052468 | |||
| 1575 | Ga0373937_0076727 | |||
| 1576 | Ga0373937_0217177 | |||
| 1577 | Ga0372808_000293 | |||
| 1578 | Ga0372808_005815 | |||
| 1579 | Ga0316582_0017488 | |||
| 1580 | Ga0316584_0015074 | |||
| 1581 | Ga0316584_0036707 | |||
| 1582 | Ga0316584_0230304 | |||
| 1583 | Ga0373925_0000520 | |||
| 1584 | Ga0373925_0006196 | |||
| 1585 | Ga0373925_0042326 | |||
| 1586 | Ga0395899_0006498 | |||
| 1587 | Ga0395899_0173520 | |||
| 1588 | Ga0395900_0021768 | |||
| 1589 | Ga0395900_0060686 | |||
| 1590 | Ga0395898_0005196 | |||
| 1591 | Ga0395898_0051572 | |||
| 1592 | Ga0395898_0100517 | |||
| 1593 | Ga0395898_0125179 | |||
| 1594 | Ga0395898_0293042 | |||
| 1595 | Ga0395898_0412419 | |||
| 1596 | Ga0395905_0350047 | |||
| 1597 | Ga0436364_0060564 | |||
| 1598 | Ga0436364_0330965 | |||
| 1599 | Ga0436364_0520351 | |||
| 1600 | Ga0436364_0815241 | |||
| 1601 | Ga0436364_1204317 | |||
| 1602 | Ga0436364_1390946 | |||
| 1603 | Ga0436364_1473432 | |||
| 1604 | Ga0395901_0004622 | |||
| 1605 | Ga0395901_0004781 | |||
| 1606 | Ga0400485_15239 | |||
| 1607 | Ga0400483_015512 | |||
| 1608 | Ga0400483_027222 | |||
| 1609 | Ga0400483_054530 | |||
| 1610 | Ga0400483_082538 | |||
| 1611 | Ga0400483_166542 | |||
| 1612 | Ga0400483_195596 | |||
| 1613 | Ga0400483_237393 | |||
| 1614 | Ga0400483_259886 | |||
| 1615 | Ga0436365_0252452 | |||
| 1616 | Ga0436365_1676582 | |||
| 1617 | Ga0436363_1152983 | |||
| 1618 | Ga0439461_0008116 | |||
| 1619 | Ga0439466_0019531 | |||
| 1620 | Ga0439466_0026588 | |||
| 1621 | Ga0439465_0050098 | |||
| 1622 | Ga0451797_0029876 | |||
| 1623 | Ga0451797_0047916 | |||
| 1624 | Ga0451795_0507694 | |||
| 1625 | Ga0451841_0255082 | |||
| 1626 | Ga0451853_0504170 | |||
| 1627 | Ga0439448_0006405 | |||
| 1628 | Ga0439448_0017671 | |||
| 1629 | Ga0439455_0076553 | |||
| 1630 | Ga0450903_000239 | |||
| 1631 | Ga0439458_0006273 | |||
| 1632 | Ga0439464_0021459 | |||
| 1633 | Ga0466972_0004889 | |||
| 1634 | Ga0466972_0112940 | |||
| 1635 | Ga0466972_0210887 | |||
| 1636 | Ga0466965_0000595 | |||
| 1637 | Ga0466965_0006940 | |||
| 1638 | Ga0466961_0104050 | |||
| 1639 | Ga0466963_0121145 | |||
| 1640 | Ga0466963_0138893 | |||
| 1641 | Ga0466963_0145076 | |||
| 1642 | Ga0466971_0096291 | |||
| 1643 | Ga0466968_0095932 | |||
| 1644 | Ga0466970_0024260 | |||
| 1645 | Ga0466970_0030660 | |||
| 1646 | Ga0466970_0039325 | |||
| 1647 | Ga0466970_0054530 | |||
| 1648 | Ga0466957_0134340 | |||
| 1649 | Ga0466960_0018318 | |||
| 1650 | Ga0466960_0029256 | |||
| 1651 | Ga0466960_0093120 | |||
| 1652 | Ga0466959_0010327 | |||
| 1653 | Ga0466958_0185596 | |||
| 1654 | Ga0466967_0003660 | |||
| 1655 | Ga0466967_0056848 | |||
| 1656 | Ga0466967_0095884 | |||
| 1657 | Ga0466967_0102930 | |||
| 1658 | Ga0466967_0140003 | |||
| 1659 | Ga0466967_0147581 | |||
| 1660 | Ga0466967_0154495 | |||
| 1661 | Ga0466967_0304541 | |||
| 1662 | Ga0466967_0490806 | |||
| 1663 | Ga0495592_0008331 | |||
| 1664 | Ga0495603_0029188 | |||
| 1665 | Ga0495629_0005204 | |||
| 1666 | Ga0495641_0001209 | |||
| 1667 | Ga0495651_0007507 | |||
| 1668 | Ga0495651_0012160 | |||
| 1669 | Ga0495651_0024686 | |||
| 1670 | Ga0495653_0003497 | |||
| 1671 | Ga0495653_0015813 | |||
| 1672 | Ga0495653_0059332 | |||
| 1673 | Ga0495653_0070602 | |||
| 1674 | Ga0495580_0026734 | |||
| 1675 | Ga0495582_0001277 | |||
| 1676 | Ga0495639_0012119 | |||
| 1677 | Ga0495639_0126462 | |||
| 1678 | Ga0495662_0000438 | |||
| 1679 | Ga0495664_0002025 | |||
| 1680 | Ga0495664_0275772 | |||
| 1681 | Ga0495594_0296947 | |||
| 1682 | Ga0495606_0036389 | |||
| 1683 | Ga0495608_0002688 | |||
| 1684 | Ga0495608_0011474 | |||
| 1685 | Ga0495608_0012319 | |||
| 1686 | Ga0495618_0047110 | |||
| 1687 | Ga0495628_0018242 | |||
| 1688 | Ga0495628_0034343 | |||
| 1689 | Ga0495628_0108400 | |||
| 1690 | Ga0495630_0005067 | |||
| 1691 | Ga0495630_0007080 | |||
| 1692 | Ga0495632_0027616 | |||
| 1693 | Ga0495648_0034453 | |||
| 1694 | Ga0495666_0017251 | |||
| 1695 | Ga0495652_0026075 | |||
| 1696 | Ga0495652_0062155 | |||
| 1697 | Ga0495652_0108206 | |||
| 1698 | Ga0495665_0000615 | |||
| 1699 | Ga0495665_0047701 | |||
| 1700 | Ga0495640_0006440 | |||
| 1701 | Ga0495640_0183364 | |||
| 1702 | Ga0495586_0003867 | |||
| 1703 | Ga0495586_0041107 | |||
| 1704 | Ga0495586_0041560 | |||
| 1705 | Ga0495587_0016061 | |||
| 1706 | Ga0495587_0019313 | |||
| 1707 | Ga0495645_0006820 | |||
| 1708 | Ga0495633_0010590 | |||
| 1709 | Ga0495667_0005694 | |||
| 1710 | Ga0495667_0012212 | |||
| 1711 | Ga0495667_0017386 | |||
| 1712 | Ga0495667_0028080 | |||
| 1713 | Ga0495656_0000824 | |||
| 1714 | Ga0495668_0030235 | |||
| 1715 | Ga0495634_0022882 | |||
| 1716 | Ga0495611_0018202 | |||
| 1717 | Ga0495635_0000969 | |||
| 1718 | Ga0495635_0007463 | |||
| 1719 | Ga0495635_0015652 | |||
| 1720 | Ga0495635_0296108 | |||
| 1721 | Ga0495588_0012962 | |||
| 1722 | Ga0495657_0013369 | |||
| 1723 | Ga0495657_0016451 | |||
| 1724 | Ga0495657_0017706 | |||
| 1725 | Ga0495623_0010837 | |||
| 1726 | Ga0495623_0138650 | |||
| 1727 | Ga0495646_0017692 | |||
| 1728 | Ga0495647_0006996 | |||
| 1729 | Ga0495658_0008689 | |||
| 1730 | Ga0495613_0001172 | |||
| 1731 | Ga0495624_0014416 | |||
| 1732 | Ga0495670_0000592 | |||
| 1733 | Ga0495671_0049402 | |||
| 1734 | Ga0495649_0143711 | |||
| 1735 | Ga0495600_0019880 | |||
| 1736 | Ga0495581_0001358 | |||
| 1737 | Ga0495581_0033931 | |||
| 1738 | Ga0495604_0004541 | |||
| 1739 | Ga0495604_0089973 | |||
| 1740 | Ga0495604_0149931 | |||
| 1741 | Ga0495636_0134946 | |||
| 1742 | Ga0495674_0002882 | |||
| 1743 | Ga0495674_0016835 | |||
| 1744 | Ga0495674_0220174 | |||
| 1745 | Ga0495672_0019952 | |||
| 1746 | Ga0495676_0005426 | |||
| 1747 | Ga0495676_0006517 | |||
| 1748 | Ga0495676_0017360 | |||
| 1749 | Ga0495680_0005478 | |||
| 1750 | Ga0495680_0019108 | |||
| 1751 | Ga0495680_0041822 | |||
| 1752 | Ga0495680_0268681 | |||
| 1753 | Ga0495675_0035481 | |||
| 1754 | Ga0495685_013005 | |||
| 1755 | Ga0495673_0002322 | |||
| 1756 | Ga0495681_0012674 | |||
| 1757 | Ga0495684_0011391 | |||
| 1758 | Ga0495684_0020900 | |||
| 1759 | Ga0495684_0058354 | |||
| 1760 | Ga0495593_0000574 | |||
| 1761 | Ga0495593_0042265 | |||
| 1762 | Ga0495602_0048163 | |||
| 1763 | Ga0495602_0100321 | |||
| 1764 | Ga0495602_0139400 | |||
| 1765 | Ga0495614_0002354 | |||
| 1766 | Ga0496100_0000851 | |||
| 1767 | Ga0496100_0004104 | |||
| 1768 | Ga0496100_0082473 | |||
| 1769 | Ga0496100_0157332 | |||
| 1770 | Ga0496101_0000049 | |||
| 1771 | Ga0496101_0028470 | |||
| 1772 | Ga0496101_0210558 | |||
| 1773 | Ga0496102_0000011 | |||
| 1774 | Ga0496102_0059645 | |||
| 1775 | Ga0496102_0270078 | |||
| 1776 | Ga0496102_0338410 | |||
| 1777 | Ga0496102_0360247 | |||
| 1778 | Ga0496103_0000032 | |||
| 1779 | Ga0496103_0000570 | |||
| 1780 | Ga0496104_0018057 | |||
| 1781 | Ga0496104_0278106 | |||
| 1782 | Ga0496104_0344276 | |||
| 1783 | Ga0496105_0077108 | |||
| 1784 | Ga0496105_0140652 | |||
| 1785 | Ga0496105_0246144 | |||
| 1786 | Ga0496105_0302524 | |||
| 1787 | Ga0496106_0000351 | |||
| 1788 | Ga0496106_0043232 | |||
| 1789 | Ga0496107_0000393 | |||
| 1790 | Ga0496107_0094691 | |||
| 1791 | Ga0496108_0017926 | |||
| 1792 | Ga0496108_0108039 | |||
| 1793 | Ga0496108_0149252 | |||
| 1794 | Ga0496108_0236789 | |||
| 1795 | Ga0496108_0240914 | |||
| 1796 | Ga0496108_0297618 | |||
| 1797 | Ga0496108_0302142 | |||
| 1798 | Ga0496109_0006185 | |||
| 1799 | Ga0496109_0062471 | |||
| 1800 | Ga0496109_0079591 | |||
| 1801 | Ga0496109_0088367 | |||
| 1802 | Ga0496109_0100831 | |||
| 1803 | Ga0496109_0107845 | |||
| 1804 | Ga0496109_0180159 | |||
| 1805 | Ga0496110_0005576 | |||
| 1806 | Ga0496110_0114800 | |||
| 1807 | Ga0496110_0278624 | |||
| 1808 | Ga0496110_0515061 | |||
| 1809 | Ga0496111_0107684 | |||
| 1810 | Ga0496112_0003719 | |||
| 1811 | Ga0496112_0031803 | |||
| 1812 | Ga0496112_0042192 | |||
| 1813 | Ga0496112_0165420 | |||
| 1814 | Ga0496112_0485215 | |||
| 1815 | Ga0496113_0001680 | |||
| 1816 | Ga0496113_0046043 | |||
| 1817 | Ga0496113_0060775 | |||
| 1818 | Ga0496114_0012870 | |||
| 1819 | Ga0496114_0017369 | |||
| 1820 | Ga0496114_0243655 | |||
| 1821 | Ga0496114_0375558 | |||
| 1822 | Ga0496115_0016536 | |||
| 1823 | Ga0496115_0092718 | |||
| 1824 | Ga0496115_0234913 | |||
| 1825 | Ga0496116_0000072 | |||
| 1826 | Ga0496116_0094659 | |||
| 1827 | Ga0496117_0000039 | |||
| 1828 | Ga0496117_0030781 | |||
| 1829 | Ga0496118_0000035 | |||
| 1830 | Ga0496118_0063425 | |||
| 1831 | Ga0496119_0001807 | |||
| 1832 | Ga0496120_0000190 | |||
| 1833 | Ga0496120_0049351 | |||
| 1834 | Ga0496121_0000351 | |||
| 1835 | Ga0496122_0019334 | |||
| 1836 | Ga0496122_0052731 | |||
| 1837 | Ga0496123_0019828 | |||
| 1838 | Ga0496124_0021037 | |||
| 1839 | Ga0496126_0004142 | |||
| 1840 | Ga0496126_0005807 | |||
| 1841 | Ga0496126_0008968 | |||
| 1842 | Ga0496126_0037423 | |||
| 1843 | Ga0496126_0071321 | |||
| 1844 | Ga0496126_0323305 | |||
| 1845 | Ga0501306_009305 | |||
| 1846 | Ga0501033_0003027 | |||
| 1847 | Ga0501034_0000488 | |||
| 1848 | Ga0501034_0020532 | |||
| 1849 | Ga0501036_0005155 | |||
| 1850 | Ga0501036_0025516 | |||
| 1851 | Ga0501037_0048457 | |||
| 1852 | Ga0501038_0018506 | |||
| 1853 | Ga0501039_0027961 | |||
| 1854 | Ga0501039_0059130 | |||
| 1855 | Ga0501040_0188924 | |||
| 1856 | Ga0501040_0249525 | |||
| 1857 | Ga0501041_0055807 | |||
| 1858 | Ga0501041_0080966 | |||
| 1859 | Ga0501042_0039401 | |||
| 1860 | Ga0501042_0257911 | |||
| 1861 | Ga0501043_0009206 | |||
| 1862 | Ga0501046_0030006 | |||
| 1863 | Ga0501046_0131295 | |||
| 1864 | Ga0501047_0061332 | |||
| 1865 | Ga0501069_0009508 | |||
| 1866 | Ga0501070_0082207 | |||
| 1867 | Ga0501070_0259890 | |||
| 1868 | Ga0501070_0486278 | |||
| 1869 | Ga0501072_0147441 | |||
| 1870 | Ga0501073_0093963 | |||
| 1871 | Ga0501073_0318369 | |||
| 1872 | Ga0501074_0062594 | |||
| 1873 | Ga0501076_0137762 | |||
| 1874 | Ga0501079_0124067 | |||
| 1875 | Ga0501081_0213699 | |||
| 1876 | Ga0501035_0018391 | |||
| 1877 | Ga0501035_0191804 | |||
| 1878 | Ga0501044_0007886 | |||
| 1879 | Ga0501045_0049155 | |||
| 1880 | Ga0501045_0089044 | |||
| 1881 | nmdc:mga03n38_15161_c1 | |||
| 1882 | nmdc:mga03n38_45330_c1 | |||
| 1883 | nmdc:mga03n38_51777_c1 | |||
| 1884 | nmdc:mga03n38_53321_c1 | |||
| 1885 | nmdc:mga03n38_8103_c1 | |||
| 1886 | nmdc:mga00v17_2925_c1 | |||
| 1887 | nmdc:mga00v17_9318_c1 | |||
| 1888 | nmdc:mga0k408_107198_c1 | |||
| 1889 | nmdc:mga06z11_61383_c1 | |||
| 1890 | nmdc:mga04h51_12549_c1 | |||
| 1891 | nmdc:mga07m45_19707_c1 | |||
| 1892 | nmdc:mga07m45_27300_c1 | |||
| 1893 | nmdc:mga05p37_70519_c1 | |||
| 1894 | nmdc:mga05p37_77715_c2 | |||
| 1895 | nmdc:mga06r32_126560_c1 | |||
| 1896 | nmdc:mga0rr50_194393_c1 | |||
| 1897 | nmdc:mga0sz30_27116_c1 | |||
| 1898 | nmdc:mga0sz30_46883_c1 | |||
| 1899 | nmdc:mga0sz30_951_c1 | |||
| 1900 | Ga0495601_0009930 | |||
| 1901 | Ga0495612_0000809 | |||
| 1902 | Ga0495595_0036357 | |||
| 1903 | Ga0495619_0001138 | |||
| 1904 | Ga0500643_005407 | |||
| 1905 | Ga0500556_0000163 | |||
| 1906 | Ga0500562_001298 | |||
| 1907 | Ga0500593_005587 | |||
| 1908 | Ga0500608_125976 | |||
| 1909 | Ga0500642_0085005 | |||
| 1910 | Ga0500652_014170 | |||
| 1911 | Ga0500559_0000513 | |||
| 1912 | Ga0500559_0004792 | |||
| 1913 | Ga0500568_0052258 | |||
| 1914 | Ga0500579_069132 | |||
| 1915 | Ga0500600_0167553 | |||
| 1916 | Ga0500616_0000060 | |||
| 1917 | Ga0500616_0071982 | |||
| 1918 | Ga0500627_0010274 | |||
| 1919 | Ga0500645_000025 | |||
| 1920 | Ga0500645_011725 | |||
| 1921 | Ga0501084_0197057 | |||
| 1922 | Ga0501082_0520272 | |||
| 1923 | Ga0530510_0060449 | |||
| 1924 | 2508673384 | |||
| 1925 | 2523384505 | |||
| 1926 | 2738707321 | |||
| 1927 | 2739328627 | |||
| 1928 | 2739363524 | |||
| 1929 | 2739365499 | |||
| 1930 | 2785369367 | |||
| 1931 | 2808850769 | |||
| 1932 | 2812318706 | |||
| 1933 | 2816503847 | |||
| 1934 | 2832007023 | |||
| 1935 | 2842139670 | |||
| 1936 | 2857740908 | |||
| 1937 | 2866070329 | |||
| 1938 | 2870790144 | |||
| 1939 | 2902797453 | |||
| 1940 | 2902799827 | |||
| 1941 | 2904501484 | |||
| 1942 | 2904766918 | |||
| 1943 | 2904775070 | |||
| 1944 | 2904778112 | |||
| 1945 | 2910811247 | |||
| 1946 | 2919035458 | |||
| 1947 | 2919055018 | |||
| 1948 | 2919420647 | |||
| 1949 | 2919433595 | |||
| 1950 | 2919539326 | |||
| 1951 | 2932427878 | |||
| 1952 | 2933422360 | |||
| 1953 | 2939601887 | |||
| 1954 | 2939677748 | |||
| 1955 | 2997605434 | |||
| 1956 | 3006430889 | |||
| 1957 | 8003317789 | |||
| 1958 | 8054476820 | |||
| 1959 | 8055034678 | |||
| 1960 | 8056064004 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3irs-assembly1.cif.gz_B | crystal structure of uncharacterized tim-barrel protein bb4693 from bordetella bronchiseptica | 0.8263 | 9 | 289 |
| 3irs-assembly1.cif.gz_B | crystal structure of uncharacterized tim-barrel protein bb4693 from bordetella bronchiseptica | 0.8127 | 9 | 289 |
| 2dvx-assembly1.cif.gz_B | crystal structure of 2,6-dihydroxybenzoate decarboxylase complexed with inhibitor 2,3-dihydroxybenzaldehyde | 0.7295 | 9 | 289 |
| 7wjr-assembly1.cif.gz_D | crystal structure of dihydroxybenzoate decarboxylase mutant a63s from aspergillus oryzae in complex with catechol | 0.7244 | 9 | 291 |
| 7wkl-assembly1.cif.gz_B | crystal structure of dihydroxybenzoate decarboxylase mutant f296y from aspergillus oryzae in complex with catechol | 0.7227 | 9 | 291 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6Y3Q7_2_272_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9064 | 12 | 291 | 3.20.20.140 |
| af_I6Y3Q7_2_272_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8969 | 12 | 291 | 3.20.20.140 |
| af_Q50662_37_305_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8466 | 28 | 289 | 3.20.20.140 |
| 3k4wC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8118 | 9 | 289 | 3.20.20.140 |
| af_Q50662_37_305_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8115 | 28 | 289 | 3.20.20.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q5T3P5-F1-model_v4 | 4-hydroxyphenyl-beta-ketoacyl-CoA hydrolase | 0.9995 | 200 | 289 |
GO:0016787
|
| AF-A0A1F2T0B5-F1-model_v4 | Amidohydrolase-related domain-containing protein | 0.9982 | 211 | 291 |
GO:0016787
GO:0016829 |
| AF-A0A848Q373-F1-model_v4 | deleted | 0.9973 | 213 | 291 |
|
| AF-K8X6S5-F1-model_v4 | Amidohydrolase-related domain-containing protein | 0.9956 | 125 | 272 |
GO:0016787
GO:0016831 |
| AF-A0A4Y3RBL5-F1-model_v4 | 4-hydroxyphenyl-beta-ketoacyl-CoA hydrolase | 0.995 | 34 | 289 |
GO:0016787
GO:0016831 |