F487372

General Info

Members Datasets Scaffolds Average Seq Length
980 486 1960 288

Family's Representative Sequence

Representative Sequence 3300046559|Ga0495667_0213537|Ga0495667_0213537_216_1163
Length 315
Sequence MTETAPAATAFDLDAVSAIDMHVHIEQDSHGCFALDDELMDASAAYFKASDHRAPTLEHVAAYYRQQGMAAVVFTVDASTATGHPALSSEDIADRAAAHPDVLIPFGSVDPHAGPAAVQRARRLVTEHGVRGFKFHPSLQAFEPNDPAFYPLYEALTELGVVALFHTGQTGIGAGLPGGRGIKLRYSAPMLIDDVAADFPGLTIVMAHPSVPWQDEAISIATHKANVYIDLSGWSPKYFPPQLVRAANSMLKCKVLFGSDFPLLTPERWLRDFNDLDIKDDVRPLILKDNAARVLNLGQASRNDVAPGPSGTQAP

Samples

Sample ID Description Type Environment
1 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
102 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
103 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
104 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
120 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
138 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
139 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
140 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
142 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
206 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
207 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
208 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
209 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
210 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
211 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
212 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
213 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
214 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
215 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
216 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
217 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
218 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
219 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
220 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
221 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
222 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
223 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
224 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
225 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
226 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
227 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
228 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
229 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
230 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
231 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
232 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
233 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
234 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
235 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
236 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
237 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
238 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
239 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
240 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
241 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
242 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
243 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
244 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
245 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
246 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
247 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
248 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
249 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
250 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
251 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
252 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
253 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
254 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
255 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
256 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
257 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
258 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
259 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
260 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
261 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
262 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
263 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
264 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
265 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
266 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
267 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
268 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
269 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
270 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
271 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
272 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
273 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
274 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
275 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
276 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
277 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
278 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
279 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
280 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
281 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
282 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
283 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
284 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
285 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
286 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
287 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
288 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
289 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
290 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
291 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
292 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
293 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
294 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
295 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
296 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
297 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
298 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
299 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
300 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
301 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
302 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
303 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
304 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
305 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
306 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
307 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
308 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
309 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
310 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
311 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
312 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
313 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
314 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
315 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
316 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
317 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
318 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
319 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
320 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
321 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
322 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
323 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
324 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
325 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
326 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
327 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
328 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
329 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
330 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
331 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
332 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
333 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
334 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
335 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
336 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
337 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
338 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
339 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
340 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
341 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
342 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
343 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
344 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
345 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
346 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
347 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
348 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
349 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
350 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
351 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
352 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
353 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
354 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
355 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
356 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
357 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
358 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
359 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
360 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
361 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
362 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
363 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
364 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
365 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
366 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
367 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
368 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
369 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
370 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
371 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
372 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
373 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
374 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
375 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
376 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
377 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
378 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
379 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
380 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
381 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
382 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
383 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
384 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
385 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
386 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
387 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
388 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
389 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
390 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
391 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
392 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
393 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
394 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
395 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
396 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
400 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
405 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
406 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
410 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
411 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
412 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
413 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
414 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
415 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
416 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
417 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
418 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
420 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
421 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
422 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
423 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
424 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
425 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
426 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
427 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
428 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
429 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
430 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
431 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
432 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
433 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
434 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
435 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
436 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
437 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
438 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
439 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
440 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
441 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
442 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
443 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
444 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
445 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
446 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
447 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
448 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
449 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
450 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
451 2508501039 Frankia saprophytica CN3 Isolate Nodule
452 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
453 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
454 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
455 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
456 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
457 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
458 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
459 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
460 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
461 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
462 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
463 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
464 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
465 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
466 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
467 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
468 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
469 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
470 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
471 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
472 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
473 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
474 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
475 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
476 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
477 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
478 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
479 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
480 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
481 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
482 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
483 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
484 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
485 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
486 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.51
Metatranscriptomes 0.71
Isolates 3.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.33
Nodule 0.2
Rhizoplane 6.33
Rhizosphere 78.57
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495667_0213537 3300046559 Bacteria 1233
2 LJQas_1006464 3300000549 Bacteria 1458
3 JGI24739J22299_10001011 3300001989 Bacteria 10438
4 JGI24743J22301_10003850 3300001991 Bacteria 2402
5 JGI24750J21931_1006679 3300002070 Bacteria 1440
6 JGI24738J21930_10004652 3300002075 Bacteria 3346
7 JGI24744J21845_10000914 3300002077 Bacteria 5589
8 JGI24744J21845_10004456 3300002077 Bacteria 2894
9 JGI24034J26672_10006466 3300002239 Bacteria 1690
10 JGI25152J39213_1000223 3300002773 Bacteria 38521
11 JGI25404J52841_10005017 3300003659 Bacteria 2719
12 Ga0055542_1003653 3300003762 Bacteria 4050
13 Ga0070658_10116132 3300005327 Bacteria 2220
14 Ga0070658_10121123 3300005327 Bacteria 2174
15 Ga0070658_10197972 3300005327 Bacteria 1694
16 Ga0070658_10431126 3300005327 Bacteria 1135
17 Ga0070676_10003893 3300005328 Bacteria 7833
18 Ga0070676_10042782 3300005328 Bacteria 2632
19 Ga0070683_100207208 3300005329 Bacteria 1862
20 Ga0070690_100001751 3300005330 Bacteria 11475
21 Ga0068869_100040836 3300005334 Bacteria 3319
22 Ga0068869_100046758 3300005334 Bacteria 3121
23 Ga0068869_100107815 3300005334 Bacteria 2115
24 Ga0068869_100325362 3300005334 Bacteria 1248
25 Ga0070666_10084631 3300005335 Bacteria 2171
26 Ga0070680_100549544 3300005336 Bacteria 990
27 Ga0070682_100002159 3300005337 Bacteria 10919
28 Ga0070682_100004022 3300005337 Bacteria 8171
29 Ga0068868_100001850 3300005338 Bacteria 14534
30 Ga0068868_100043299 3300005338 Bacteria 3516
31 Ga0068868_100195797 3300005338 Bacteria 1682
32 Ga0070660_100223542 3300005339 Bacteria 1531
33 Ga0070660_100303344 3300005339 Bacteria 1309
34 Ga0070660_100328877 3300005339 Bacteria 1256
35 Ga0070689_100015053 3300005340 Bacteria 5632
36 Ga0070689_100044218 3300005340 Bacteria 3425
37 Ga0070689_100094210 3300005340 Bacteria 2364
38 Ga0070689_100165173 3300005340 Bacteria 1791
39 Ga0070691_10031877 3300005341 Bacteria 2474
40 Ga0070687_100100196 3300005343 Bacteria 1620
41 Ga0070661_100030858 3300005344 Bacteria 3873
42 Ga0070692_10016910 3300005345 Bacteria 3476
43 Ga0070692_10062596 3300005345 Bacteria 1964
44 Ga0070692_10076025 3300005345 Bacteria 1799
45 Ga0070668_100000260 3300005347 Bacteria 35142
46 Ga0070668_100003086 3300005347 Bacteria 12309
47 Ga0070668_100008605 3300005347 Bacteria 7579
48 Ga0070668_100042721 3300005347 Bacteria 3474
49 Ga0070668_100096070 3300005347 Bacteria 2342
50 Ga0070669_100394691 3300005353 Bacteria 1131
51 Ga0070675_100182153 3300005354 Bacteria 1817
52 Ga0070671_100181586 3300005355 Bacteria 1781
53 Ga0070674_100015264 3300005356 Bacteria 4792
54 Ga0070674_100032985 3300005356 Bacteria 3443
55 Ga0070674_100272373 3300005356 Bacteria 1338
56 Ga0070673_100017797 3300005364 Bacteria 5063
57 Ga0070673_100035514 3300005364 Bacteria 3781
58 Ga0070673_100042527 3300005364 Bacteria 3504
59 Ga0070688_100060704 3300005365 Bacteria 2388
60 Ga0070659_100007076 3300005366 Bacteria 8131
61 Ga0070659_100031560 3300005366 Bacteria 4104
62 Ga0070659_100038587 3300005366 Bacteria 3725
63 Ga0070659_100107352 3300005366 Bacteria 2251
64 Ga0070659_100187708 3300005366 Bacteria 1698
65 Ga0070667_100003272 3300005367 Bacteria 13841
66 Ga0070709_10054287 3300005434 Bacteria 2525
67 Ga0070709_10458522 3300005434 Bacteria 961
68 Ga0070714_100004406 3300005435 Bacteria 10595
69 Ga0070714_100008761 3300005435 Bacteria 7911
70 Ga0070714_100133967 3300005435 Bacteria 2216
71 Ga0070713_100062002 3300005436 Bacteria 3130
72 Ga0070710_10000303 3300005437 Bacteria 23421
73 Ga0070701_10076508 3300005438 Bacteria 1802
74 Ga0070711_100001503 3300005439 Bacteria 12819
75 Ga0070711_100110898 3300005439 Bacteria 2014
76 Ga0070705_100009744 3300005440 Bacteria 4786
77 Ga0070705_100023877 3300005440 Bacteria 3291
78 Ga0070694_100032942 3300005444 Bacteria 3405
79 Ga0070694_100269260 3300005444 Bacteria 1295
80 Ga0070708_100011818 3300005445 Bacteria 7105
81 Ga0070708_100031194 3300005445 Bacteria 4611
82 Ga0070708_100647180 3300005445 Bacteria 996
83 Ga0070663_100018222 3300005455 Bacteria 4597
84 Ga0070663_100086633 3300005455 Bacteria 2313
85 Ga0070663_100146409 3300005455 Bacteria 1807
86 Ga0070663_100168700 3300005455 Bacteria 1690
87 Ga0070663_100242815 3300005455 Bacteria 1422
88 Ga0070663_100382576 3300005455 Bacteria 1146
89 Ga0070678_100005572 3300005456 Bacteria 7302
90 Ga0070678_100034932 3300005456 Bacteria 3505
91 Ga0070662_100002181 3300005457 Bacteria 12005
92 Ga0070662_100026343 3300005457 Bacteria 4026
93 Ga0070662_100210909 3300005457 Bacteria 1545
94 Ga0070681_10119333 3300005458 Bacteria 2573
95 Ga0068867_100002967 3300005459 Bacteria 11948
96 Ga0070685_10034580 3300005466 Bacteria 2847
97 Ga0070685_10059568 3300005466 Bacteria 2230
98 Ga0070685_10103107 3300005466 Bacteria 1745
99 Ga0070706_100000178 3300005467 Bacteria 80600
100 Ga0070706_100049652 3300005467 Bacteria 3871
101 Ga0070707_100159024 3300005468 Bacteria 2201
102 Ga0070698_100004573 3300005471 Bacteria 15192
103 Ga0070698_100016273 3300005471 Bacteria 7852
104 Ga0070698_100205108 3300005471 Unclassified 1907
105 Ga0070698_100277722 3300005471 Bacteria 1607
106 Ga0070698_100339566 3300005471 Bacteria 1433
107 Ga0070699_100147151 3300005518 Bacteria 2081
108 Ga0070679_100016779 3300005530 Bacteria 7077
109 Ga0070679_100046295 3300005530 Bacteria 4335
110 Ga0070679_100303068 3300005530 Bacteria 1548
111 Ga0070679_100310072 3300005530 Bacteria 1528
112 Ga0070679_100404092 3300005530 Bacteria 1312
113 Ga0070684_100013218 3300005535 Bacteria 6648
114 Ga0070684_100065121 3300005535 Bacteria 3198
115 Ga0070684_100068544 3300005535 Bacteria 3118
116 Ga0070684_100114155 3300005535 Bacteria 2424
117 Ga0070684_100187052 3300005535 Bacteria 1884
118 Ga0070684_100311379 3300005535 Bacteria 1446
119 Ga0070697_100010094 3300005536 Bacteria 7364
120 Ga0068853_100000732 3300005539 Bacteria 22719
121 Ga0068853_100001940 3300005539 Bacteria 15256
122 Ga0070686_100018403 3300005544 Bacteria 4099
123 Ga0070695_100023646 3300005545 Bacteria 3780
124 Ga0070696_100002906 3300005546 Bacteria 11389
125 Ga0070696_100109461 3300005546 Bacteria 1988
126 Ga0070665_100010056 3300005548 Bacteria 9572
127 Ga0070665_100117145 3300005548 Bacteria 2666
128 Ga0070665_100158871 3300005548 Bacteria 2262
129 Ga0070665_100420585 3300005548 Bacteria 1345
130 Ga0070704_100000340 3300005549 Bacteria 21256
131 Ga0070704_100357605 3300005549 Bacteria 1234
132 Ga0068855_100215102 3300005563 Bacteria 2158
133 Ga0068855_100287260 3300005563 Bacteria 1824
134 Ga0070664_100098862 3300005564 Bacteria 2535
135 Ga0070664_100314505 3300005564 Bacteria 1418
136 Ga0068857_100121715 3300005577 Bacteria 2350
137 Ga0068857_100146914 3300005577 Bacteria 2133
138 Ga0068854_100008668 3300005578 Bacteria 6547
139 Ga0068854_100009181 3300005578 Bacteria 6378
140 Ga0068854_100031524 3300005578 Bacteria 3685
141 Ga0068854_100108594 3300005578 Bacteria 2090
142 Ga0068856_100168955 3300005614 Bacteria 2199
143 Ga0068856_100217420 3300005614 Bacteria 1926
144 Ga0068856_100314483 3300005614 Bacteria 1583
145 Ga0068856_100389568 3300005614 Bacteria 1413
146 Ga0070702_100000276 3300005615 Bacteria 17521
147 Ga0070702_100051345 3300005615 Bacteria 2360
148 Ga0070702_100131298 3300005615 Bacteria 1582
149 Ga0068852_100231180 3300005616 Bacteria 1763
150 Ga0068852_100237611 3300005616 Bacteria 1740
151 Ga0068859_100002195 3300005617 Bacteria 19815
152 Ga0068859_100079926 3300005617 Bacteria 3310
153 Ga0068864_100006253 3300005618 Bacteria 9769
154 Ga0068864_100096957 3300005618 Bacteria 2610
155 Ga0068864_100139174 3300005618 Bacteria 2188
156 Ga0068866_10000121 3300005718 Bacteria 34325
157 Ga0068866_10004057 3300005718 Bacteria 6011
158 Ga0068866_10117444 3300005718 Bacteria 1494
159 Ga0068861_100000790 3300005719 Bacteria 19056
160 Ga0068861_100375402 3300005719 Bacteria 1254
161 Ga0068870_10141590 3300005840 Bacteria 1408
162 Ga0068863_100007024 3300005841 Bacteria 11033
163 Ga0068863_100075265 3300005841 Bacteria 3195
164 Ga0068863_100372820 3300005841 Bacteria 1393
165 Ga0068858_100002942 3300005842 Bacteria 17128
166 Ga0068858_100031184 3300005842 Bacteria 4950
167 Ga0068858_100095602 3300005842 Bacteria 2768
168 Ga0068858_100121274 3300005842 Bacteria 2445
169 Ga0068860_100000694 3300005843 Bacteria 38692
170 Ga0068860_100383684 3300005843 Bacteria 1387
171 Ga0068860_100393167 3300005843 Bacteria 1370
172 Ga0068862_100073297 3300005844 Bacteria 2959
173 Ga0068862_100094842 3300005844 Bacteria 2602
174 Ga0068862_100584198 3300005844 Bacteria 1070
175 Ga0081538_10091329 3300005981 Bacteria 1572
176 Ga0081540_1002936 3300005983 Bacteria 13719
177 Ga0081540_1037636 3300005983 Bacteria 2561
178 Ga0070717_10242983 3300006028 Bacteria 1588
179 Ga0075365_10000777 3300006038 Bacteria 13015
180 Ga0075365_10011637 3300006038 Bacteria 5183
181 Ga0075368_10033147 3300006042 Bacteria 2009
182 Ga0075363_100002184 3300006048 Bacteria 7888
183 Ga0075363_100005192 3300006048 Bacteria 5766
184 Ga0075363_100013065 3300006048 Bacteria 4014
185 Ga0075363_100016120 3300006048 Bacteria 3687
186 Ga0075363_100051356 3300006048 Bacteria 2198
187 Ga0075364_10001722 3300006051 Bacteria 12049
188 Ga0075364_10002641 3300006051 Bacteria 10062
189 Ga0075364_10006989 3300006051 Bacteria 6666
190 Ga0075364_10246628 3300006051 Bacteria 1214
191 Ga0075364_10320666 3300006051 Bacteria 1055
192 Ga0070715_10079249 3300006163 Bacteria 1487
193 Ga0070716_100000551 3300006173 Bacteria 15665
194 Ga0070712_100004121 3300006175 Bacteria 8934
195 Ga0070712_100047113 3300006175 Bacteria 2982
196 Ga0070712_100071380 3300006175 Bacteria 2484
197 Ga0070712_100210657 3300006175 Bacteria 1532
198 Ga0070712_100281094 3300006175 Bacteria 1341
199 Ga0075362_10008480 3300006177 Bacteria 3932
200 Ga0075362_10032711 3300006177 Bacteria 2259
201 Ga0075362_10067933 3300006177 Bacteria 1623
202 Ga0075367_10055104 3300006178 Bacteria 2359
203 Ga0075367_10083181 3300006178 Bacteria 1939
204 Ga0075369_10000746 3300006186 Bacteria 10557
205 Ga0075369_10058712 3300006186 Bacteria 1675
206 Ga0075366_10083210 3300006195 Bacteria 1912
207 Ga0097621_100014529 3300006237 Bacteria 5896
208 Ga0097621_100034294 3300006237 Bacteria 4048
209 Ga0097621_100109080 3300006237 Bacteria 2338
210 Ga0075370_10000407 3300006353 Bacteria 15914
211 Ga0075370_10022616 3300006353 Bacteria 3454
212 Ga0075370_10024714 3300006353 Bacteria 3321
213 Ga0075370_10037882 3300006353 Bacteria 2712
214 Ga0075431_100028346 3300006847 Bacteria 5753
215 Ga0068865_100003268 3300006881 Bacteria 9703
216 Ga0068865_100264313 3300006881 Bacteria 1363
217 Ga0075436_100218673 3300006914 Bacteria 1352
218 Ga0097620_100002195 3300006931 Bacteria 19815
219 Ga0097620_100079928 3300006931 Bacteria 3310
220 Ga0075435_100055045 3300007076 Unclassified 3212
221 Ga0099794_10223646 3300007265 Bacteria 967
222 Ga0099795_10097355 3300007788 Bacteria 1149
223 Ga0105244_10094693 3300009036 Bacteria 1466
224 Ga0105250_10118259 3300009092 Bacteria 1088
225 Ga0105240_10042940 3300009093 Bacteria 5759
226 Ga0105240_10284090 3300009093 Bacteria 1900
227 Ga0111539_10475281 3300009094 Bacteria 1455
228 Ga0105245_10004378 3300009098 Bacteria 12498
229 Ga0105245_10098839 3300009098 Bacteria 2697
230 Ga0105245_10147197 3300009098 Bacteria 2223
231 Ga0105245_10676667 3300009098 Bacteria 1064
232 Ga0105247_10000541 3300009101 Bacteria 30700
233 Ga0105247_10035331 3300009101 Bacteria 3046
234 Ga0114129_10035682 3300009147 Bacteria 7024
235 Ga0114129_10251320 3300009147 Bacteria 2373
236 Ga0114129_10390013 3300009147 Bacteria 1837
237 Ga0105243_10502066 3300009148 Bacteria 1150
238 Ga0105243_10626304 3300009148 Bacteria 1039
239 Ga0105241_10427162 3300009174 Bacteria 1167
240 Ga0105242_10000572 3300009176 Bacteria 29126
241 Ga0105242_10211617 3300009176 Bacteria 1728
242 Ga0105248_10003762 3300009177 Bacteria 16802
243 Ga0105248_10036204 3300009177 Bacteria 5519
244 Ga0105248_10108657 3300009177 Bacteria 3127
245 Ga0105248_10126994 3300009177 Bacteria 2877
246 Ga0105248_10684684 3300009177 Bacteria 1157
247 Ga0105237_10000989 3300009545 Bacteria 38202
248 Ga0105237_10014908 3300009545 Bacteria 8105
249 Ga0105237_10021850 3300009545 Bacteria 6573
250 Ga0105237_10256787 3300009545 Bacteria 1750
251 Ga0105237_10382287 3300009545 Bacteria 1413
252 Ga0105238_10059610 3300009551 Bacteria 3823
253 Ga0105238_10251768 3300009551 Bacteria 1745
254 Ga0105238_10496081 3300009551 Bacteria 1221
255 Ga0105249_10008808 3300009553 Bacteria 8809
256 Ga0105249_10045535 3300009553 Bacteria 3991
257 Ga0105249_10049659 3300009553 Bacteria 3825
258 Ga0105249_10213490 3300009553 Bacteria 1895
259 Ga0105239_10001012 3300010375 Bacteria 39279
260 Ga0105239_10028063 3300010375 Bacteria 6193
261 Ga0105239_10274345 3300010375 Bacteria 1897
262 Ga0105239_10320968 3300010375 Bacteria 1746
263 Ga0105239_10647579 3300010375 Bacteria 1207
264 Ga0105246_10017527 3300011119 Bacteria 4553
265 Ga0105246_10231586 3300011119 Bacteria 1455
266 Ga0105246_10425834 3300011119 Bacteria 1109
267 Ga0157340_1000155 3300012473 Bacteria 2324
268 Ga0157342_1000664 3300012507 Bacteria 2228
269 Ga0157373_10014861 3300013100 Bacteria 5701
270 Ga0157373_10102813 3300013100 Bacteria 2010
271 Ga0157373_10314979 3300013100 Bacteria 1112
272 Ga0157370_10088666 3300013104 Bacteria 2905
273 Ga0157370_10289568 3300013104 Bacteria 1513
274 Ga0157369_10045076 3300013105 Bacteria 4798
275 Ga0157369_10054299 3300013105 Bacteria 4327
276 Ga0157369_10080939 3300013105 Bacteria 3476
277 Ga0157369_10136810 3300013105 Bacteria 2593
278 Ga0157369_10156235 3300013105 Bacteria 2409
279 Ga0157369_10165211 3300013105 Bacteria 2335
280 Ga0157369_10395391 3300013105 Bacteria 1434
281 Ga0157374_10007319 3300013296 Bacteria 9410
282 Ga0157374_10039682 3300013296 Bacteria 4333
283 Ga0157374_10827013 3300013296 Bacteria 942
284 Ga0157378_10027760 3300013297 Bacteria 4993
285 Ga0157378_10088862 3300013297 Bacteria 2805
286 Ga0157378_10516802 3300013297 Bacteria 1195
287 Ga0163162_10018447 3300013306 Bacteria 6837
288 Ga0157372_10216190 3300013307 Bacteria 2222
289 Ga0157372_10250179 3300013307 Bacteria 2057
290 Ga0157372_10336022 3300013307 Bacteria 1759
291 Ga0157372_10429298 3300013307 Bacteria 1540
292 Ga0157372_10476780 3300013307 Bacteria 1455
293 Ga0157375_10047074 3300013308 Bacteria 4209
294 Ga0157375_10168032 3300013308 Bacteria 2339
295 Ga0157375_10777500 3300013308 Bacteria 1107
296 Ga0163163_10060585 3300014325 Bacteria 3748
297 Ga0163163_10397376 3300014325 Bacteria 1436
298 Ga0163163_10668285 3300014325 Bacteria 1102
299 Ga0157380_10004599 3300014326 Bacteria 9582
300 Ga0157380_10126877 3300014326 Bacteria 2170
301 Ga0157377_10010134 3300014745 Bacteria 4651
302 Ga0157377_10015596 3300014745 Bacteria 3892
303 Ga0157377_10031061 3300014745 Bacteria 2900
304 Ga0157379_10026679 3300014968 Bacteria 5142
305 Ga0157379_10073665 3300014968 Bacteria 3057
306 Ga0157376_10117277 3300014969 Bacteria 2353
307 Ga0163161_10001874 3300017792 Bacteria 15351
308 Ga0163161_10038811 3300017792 Bacteria 3416
309 Ga0163161_10079280 3300017792 Bacteria 2415
310 Ga0163161_10405053 3300017792 Bacteria 1094
311 Ga0206356_10161964 3300020070 Bacteria 4504
312 Ga0206353_11031012 3300020082 Bacteria 6999
313 Ga0206353_11285738 3300020082 Bacteria 4475
314 Ga0213874_10057051 3300021377 Bacteria 1214
315 Ga0213876_10013774 3300021384 Bacteria 4286
316 Ga0213875_10000644 3300021388 Bacteria 27796
317 Ga0213875_10019991 3300021388 Bacteria 3215
318 Ga0213875_10022970 3300021388 Bacteria 2982
319 Ga0213875_10039209 3300021388 Bacteria 2232
320 Ga0224712_10146191 3300022467 Bacteria 1044
321 Ga0209129_1000354 3300025258 Bacteria 38625
322 Ga0209051_1022202 3300025303 Bacteria 2677
323 Ga0207697_10000412 3300025315 Bacteria 24182
324 Ga0207697_10000464 3300025315 Bacteria 22857
325 Ga0207655_1011840 3300025728 Bacteria 5153
326 Ga0207655_1013050 3300025728 Bacteria 4796
327 Ga0207653_10007248 3300025885 Bacteria 3459
328 Ga0207692_10003016 3300025898 Bacteria 6527
329 Ga0207692_10069152 3300025898 Bacteria 1854
330 Ga0207692_10221137 3300025898 Bacteria 1122
331 Ga0207642_10001487 3300025899 Bacteria 7237
332 Ga0207642_10093866 3300025899 Bacteria 1489
333 Ga0207710_10011320 3300025900 Bacteria 3756
334 Ga0207710_10012078 3300025900 Bacteria 3630
335 Ga0207710_10167407 3300025900 Bacteria 1073
336 Ga0207688_10000299 3300025901 Bacteria 22710
337 Ga0207688_10007098 3300025901 Bacteria 6092
338 Ga0207688_10008717 3300025901 Bacteria 5519
339 Ga0207688_10150493 3300025901 Bacteria 1374
340 Ga0207647_10008657 3300025904 Bacteria 7270
341 Ga0207647_10022023 3300025904 Bacteria 4240
342 Ga0207647_10072007 3300025904 Bacteria 2085
343 Ga0207647_10130467 3300025904 Bacteria 1477
344 Ga0207685_10133024 3300025905 Bacteria 1106
345 Ga0207699_10008657 3300025906 Bacteria 5032
346 Ga0207699_10014821 3300025906 Bacteria 4033
347 Ga0207699_10107488 3300025906 Bacteria 1782
348 Ga0207645_10005579 3300025907 Bacteria 9103
349 Ga0207643_10002999 3300025908 Bacteria 9101
350 Ga0207643_10037827 3300025908 Bacteria 2708
351 Ga0207643_10203958 3300025908 Bacteria 1205
352 Ga0207705_10246987 3300025909 Bacteria 1360
353 Ga0207684_10000029 3300025910 Bacteria 305483
354 Ga0207707_10031989 3300025912 Bacteria 4606
355 Ga0207695_10084420 3300025913 Bacteria 3206
356 Ga0207671_10006521 3300025914 Bacteria 10371
357 Ga0207671_10016946 3300025914 Bacteria 5639
358 Ga0207671_10139657 3300025914 Bacteria 1866
359 Ga0207671_10251878 3300025914 Bacteria 1388
360 Ga0207693_10000174 3300025915 Bacteria 58853
361 Ga0207693_10003641 3300025915 Bacteria 13161
362 Ga0207693_10035884 3300025915 Bacteria 3908
363 Ga0207693_10145809 3300025915 Bacteria 1861
364 Ga0207693_10184358 3300025915 Bacteria 1643
365 Ga0207663_10000793 3300025916 Bacteria 14165
366 Ga0207663_10015934 3300025916 Bacteria 4158
367 Ga0207663_10062833 3300025916 Bacteria 2362
368 Ga0207663_10277159 3300025916 Bacteria 1244
369 Ga0207663_10299460 3300025916 Bacteria 1201
370 Ga0207660_10047938 3300025917 Bacteria 3023
371 Ga0207660_10114314 3300025917 Unclassified 2036
372 Ga0207657_10051676 3300025919 Bacteria 3572
373 Ga0207657_10121289 3300025919 Bacteria 2151
374 Ga0207657_10140271 3300025919 Bacteria 1975
375 Ga0207657_10146816 3300025919 Bacteria 1923
376 Ga0207649_10067995 3300025920 Bacteria 2264
377 Ga0207652_10029348 3300025921 Bacteria 4598
378 Ga0207652_10077787 3300025921 Bacteria 2895
379 Ga0207652_10111207 3300025921 Bacteria 2429
380 Ga0207652_10188929 3300025921 Bacteria 1853
381 Ga0207652_10238815 3300025921 Bacteria 1638
382 Ga0207652_10285860 3300025921 Bacteria 1488
383 Ga0207681_10151313 3300025923 Bacteria 1739
384 Ga0207694_10348687 3300025924 Bacteria 1225
385 Ga0207687_10001202 3300025927 Bacteria 17707
386 Ga0207687_10018873 3300025927 Bacteria 4560
387 Ga0207687_10071276 3300025927 Bacteria 2483
388 Ga0207700_10018882 3300025928 Bacteria 4645
389 Ga0207700_10105498 3300025928 Bacteria 2257
390 Ga0207700_10136303 3300025928 Bacteria 2011
391 Ga0207700_10177212 3300025928 Bacteria 1782
392 Ga0207664_10005914 3300025929 Bacteria 8368
393 Ga0207664_10008142 3300025929 Bacteria 7295
394 Ga0207664_10039317 3300025929 Bacteria 3673
395 Ga0207664_10310908 3300025929 Bacteria 1388
396 Ga0207644_10205925 3300025931 Bacteria 1553
397 Ga0207690_10080913 3300025932 Bacteria 2268
398 Ga0207690_10094211 3300025932 Bacteria 2124
399 Ga0207690_10178365 3300025932 Bacteria 1597
400 Ga0207706_10005203 3300025933 Bacteria 12138
401 Ga0207706_10019886 3300025933 Bacteria 6035
402 Ga0207709_10006674 3300025935 Bacteria 6473
403 Ga0207709_10024929 3300025935 Bacteria 3421
404 Ga0207670_10076467 3300025936 Bacteria 2329
405 Ga0207670_10313151 3300025936 Bacteria 1233
406 Ga0207669_10005973 3300025937 Bacteria 5519
407 Ga0207669_10013767 3300025937 Bacteria 4032
408 Ga0207669_10351779 3300025937 Bacteria 1139
409 Ga0207669_10387893 3300025937 Bacteria 1090
410 Ga0207704_10000200 3300025938 Bacteria 30767
411 Ga0207665_10007301 3300025939 Bacteria 7311
412 Ga0207665_10009571 3300025939 Bacteria 6363
413 Ga0207665_10095499 3300025939 Bacteria 2066
414 Ga0207665_10126321 3300025939 Bacteria 1811
415 Ga0207691_10020004 3300025940 Bacteria 6332
416 Ga0207691_10047976 3300025940 Bacteria 3916
417 Ga0207691_10258942 3300025940 Bacteria 1500
418 Ga0207691_10366335 3300025940 Bacteria 1231
419 Ga0207711_10051632 3300025941 Bacteria 3522
420 Ga0207689_10005029 3300025942 Bacteria 11916
421 Ga0207689_10022286 3300025942 Bacteria 5326
422 Ga0207689_10054309 3300025942 Bacteria 3300
423 Ga0207689_10210243 3300025942 Bacteria 1607
424 Ga0207661_10003808 3300025944 Bacteria 10516
425 Ga0207661_10004385 3300025944 Bacteria 9893
426 Ga0207661_10105833 3300025944 Bacteria 2371
427 Ga0207667_10108847 3300025949 Bacteria 2858
428 Ga0207712_10020201 3300025961 Bacteria 4360
429 Ga0207712_10086315 3300025961 Bacteria 2299
430 Ga0207668_10103139 3300025972 Bacteria 2123
431 Ga0207668_10119311 3300025972 Bacteria 1994
432 Ga0207668_10312265 3300025972 Bacteria 1301
433 Ga0207640_10008556 3300025981 Bacteria 5683
434 Ga0207640_10076669 3300025981 Bacteria 2270
435 Ga0207658_10020989 3300025986 Bacteria 4528
436 Ga0207677_10019275 3300026023 Bacteria 4117
437 Ga0207677_10080142 3300026023 Bacteria 2338
438 Ga0207703_10003338 3300026035 Bacteria 13477
439 Ga0207703_10045927 3300026035 Bacteria 3515
440 Ga0207703_10053181 3300026035 Bacteria 3291
441 Ga0207703_10120213 3300026035 Bacteria 2254
442 Ga0207639_10020609 3300026041 Bacteria 4722
443 Ga0207678_10008344 3300026067 Bacteria 9135
444 Ga0207678_10064053 3300026067 Bacteria 3159
445 Ga0207678_10068164 3300026067 Bacteria 3053
446 Ga0207678_10080179 3300026067 Bacteria 2795
447 Ga0207678_10101520 3300026067 Bacteria 2456
448 Ga0207708_10000934 3300026075 Bacteria 21911
449 Ga0207708_10025100 3300026075 Bacteria 4508
450 Ga0207708_10047124 3300026075 Bacteria 3283
451 Ga0207708_10049500 3300026075 Bacteria 3200
452 Ga0207702_10095540 3300026078 Bacteria 2612
453 Ga0207702_10219659 3300026078 Bacteria 1771
454 Ga0207702_10237740 3300026078 Bacteria 1705
455 Ga0207641_10026350 3300026088 Bacteria 4798
456 Ga0207641_10212797 3300026088 Bacteria 1788
457 Ga0207648_10000562 3300026089 Bacteria 41578
458 Ga0207648_10034665 3300026089 Bacteria 4448
459 Ga0207676_10051855 3300026095 Bacteria 3205
460 Ga0207674_10006496 3300026116 Bacteria 13748
461 Ga0207674_10021982 3300026116 Bacteria 6860
462 Ga0207674_10095609 3300026116 Bacteria 2957
463 Ga0207674_10173852 3300026116 Bacteria 2106
464 Ga0207674_10405937 3300026116 Bacteria 1317
465 Ga0207674_10438873 3300026116 Bacteria 1262
466 Ga0207675_100000185 3300026118 Bacteria 56425
467 Ga0207675_100034793 3300026118 Bacteria 4698
468 Ga0207675_100051937 3300026118 Bacteria 3825
469 Ga0207675_100075938 3300026118 Bacteria 3146
470 Ga0207683_10000357 3300026121 Bacteria 41951
471 Ga0207683_10009444 3300026121 Bacteria 8311
472 Ga0207683_10011925 3300026121 Bacteria 7417
473 Ga0207698_10072474 3300026142 Bacteria 2739
474 Ga0207698_10331768 3300026142 Bacteria 1429
475 Ga0209813_10016019 3300027866 Bacteria 2039
476 Ga0268266_10016779 3300028379 Bacteria 6260
477 Ga0268266_10083648 3300028379 Bacteria 2786
478 Ga0268265_10007009 3300028380 Bacteria 7622
479 Ga0268265_10422030 3300028380 Bacteria 1239
480 Ga0268264_10001293 3300028381 Bacteria 23636
481 Ga0265337_1000064 3300028556 Bacteria 48829
482 Ga0265326_10001044 3300028558 Bacteria 9894
483 Ga0265319_1000034 3300028563 Bacteria 117363
484 Ga0265319_1001979 3300028563 Bacteria 11555
485 Ga0265334_10000705 3300028573 Bacteria 16743
486 Ga0265318_10014671 3300028577 Bacteria 3284
487 Ga0265323_10011707 3300028653 Bacteria 3531
488 Ga0265336_10001316 3300028666 Bacteria 11601
489 Ga0307515_10001030 3300028794 Bacteria 63698
490 Ga0307515_10054860 3300028794 Bacteria 5839
491 Ga0307515_10249512 3300028794 Bacteria 1530
492 Ga0307515_10273327 3300028794 Bacteria 1407
493 Ga0307515_10412514 3300028794 Bacteria 973
494 Ga0265338_10000565 3300028800 Bacteria 65112
495 Ga0265338_10002634 3300028800 Bacteria 26472
496 Ga0265324_10004404 3300029957 Bacteria 6384
497 Ga0307512_10002715 3300030522 Bacteria 21708
498 Ga0307512_10167676 3300030522 Bacteria 1267
499 Ga0316176_1147110 3300030732 Bacteria 2009
500 Ga0314311_1217690 3300030733 Bacteria 1984
501 Ga0265332_10001004 3300031238 Bacteria 16641
502 Ga0265320_10004097 3300031240 Bacteria 9576
503 Ga0265320_10015076 3300031240 Bacteria 4377
504 Ga0265340_10006980 3300031247 Bacteria 6165
505 Ga0265339_10024325 3300031249 Bacteria 3491
506 Ga0265316_10015192 3300031344 Bacteria 6742
507 Ga0307513_10010160 3300031456 Bacteria 11836
508 Ga0307513_10011034 3300031456 Bacteria 11270
509 Ga0307509_10340914 3300031507 Bacteria 1226
510 Ga0307408_100000205 3300031548 Bacteria 63434
511 Ga0307408_100041587 3300031548 Bacteria 3258
512 Ga0307408_100054172 3300031548 Bacteria 2900
513 Ga0307408_100149258 3300031548 Bacteria 1844
514 Ga0307408_100221176 3300031548 Bacteria 1545
515 Ga0265313_10050036 3300031595 Bacteria 2007
516 Ga0307508_10042391 3300031616 Bacteria 4083
517 Ga0307508_10047877 3300031616 Bacteria 3810
518 Ga0307508_10372780 3300031616 Bacteria 1018
519 Ga0316575_10002381 3300031665 Bacteria 6301
520 Ga0265314_10070799 3300031711 Bacteria 2335
521 Ga0265342_10012544 3300031712 Bacteria 5736
522 Ga0316576_10134679 3300031727 Bacteria 1859
523 Ga0316576_10353739 3300031727 Bacteria 1093
524 Ga0316578_10079246 3300031728 Bacteria 1952
525 Ga0316578_10224106 3300031728 Bacteria 1130
526 Ga0307516_10064138 3300031730 Bacteria 3554
527 Ga0307405_10019015 3300031731 Bacteria 3805
528 Ga0307413_10074370 3300031824 Bacteria 2152
529 Ga0307410_10004832 3300031852 Bacteria 7039
530 Ga0307410_10031823 3300031852 Bacteria 3389
531 Ga0307406_10000260 3300031901 Bacteria 31960
532 Ga0307406_10054506 3300031901 Bacteria 2552
533 Ga0307406_10110756 3300031901 Bacteria 1890
534 Ga0307407_10106660 3300031903 Bacteria 1751
535 Ga0307412_10000876 3300031911 Bacteria 17305
536 Ga0307412_10563151 3300031911 Bacteria 959
537 Ga0307409_100049557 3300031995 Bacteria 3203
538 Ga0307409_100148448 3300031995 Bacteria 2031
539 Ga0307409_100158560 3300031995 Bacteria 1976
540 Ga0307416_100032055 3300032002 Bacteria 3966
541 Ga0307416_100085114 3300032002 Bacteria 2690
542 Ga0307416_100383076 3300032002 Bacteria 1437
543 Ga0307416_100643325 3300032002 Bacteria 1144
544 Ga0307411_10050500 3300032005 Bacteria 2709
545 Ga0307411_10308858 3300032005 Bacteria 1272
546 Ga0307415_100142768 3300032126 Bacteria 1831
547 Ga0307415_100177782 3300032126 Bacteria 1666
548 Ga0316583_10004543 3300032133 Bacteria 4951
549 Ga0316585_10006192 3300032137 Bacteria 3413
550 Ga0316580_10024373 3300032139 Bacteria 1870
551 Ga0316212_1004930 3300033547 Bacteria 1938
552 Ga0373930_0017051 3300034816 Bacteria 1381
553 Ga0373926_0002946 3300035083 Bacteria 5452
554 Ga0373926_0007322 3300035083 Bacteria 3677
555 Ga0373929_0019068 3300035085 Bacteria 1370
556 Ga0373934_0010839 3300035086 Bacteria 3425
557 Ga0373934_0021472 3300035086 Bacteria 2485
558 Ga0373934_0028616 3300035086 Bacteria 2173
559 Ga0373944_0001669 3300035089 Bacteria 5611
560 Ga0373944_0044515 3300035089 Bacteria 1382
561 Ga0373951_0008016 3300035091 Bacteria 2394
562 Ga0373923_0028763 3300035111 Bacteria 2225
563 Ga0373936_0000838 3300035113 Bacteria 10935
564 Ga0373936_0001503 3300035113 Bacteria 8461
565 Ga0373936_0016661 3300035113 Bacteria 2828
566 Ga0373945_0002990 3300035116 Bacteria 5313
567 Ga0373945_0005014 3300035116 Bacteria 4217
568 Ga0373953_0004584 3300035117 Bacteria 4413
569 Ga0373953_0011079 3300035117 Bacteria 3153
570 Ga0373953_0030980 3300035117 Bacteria 2078
571 Ga0373954_0164076 3300035118 Bacteria 1087
572 Ga0373956_0022644 3300035119 Bacteria 2690
573 Ga0373957_0003726 3300035120 Bacteria 4557
574 Ga0373943_0002144 3300035170 Bacteria 8972
575 Ga0373946_0000254 3300035171 Bacteria 16948
576 Ga0373946_0001368 3300035171 Bacteria 8446
577 Ga0373946_0088572 3300035171 Bacteria 1368
578 Ga0373955_0008345 3300035172 Bacteria 4808
579 Ga0373955_0009421 3300035172 Bacteria 4569
580 Ga0373955_0240004 3300035172 Bacteria 1085
581 Ga0373962_0015714 3300035242 Bacteria 1944
582 Ga0316574_0094533 3300035398 Bacteria 1909
583 Ga0373924_0006751 3300035410 Bacteria 4121
584 Ga0373931_0012154 3300035691 Bacteria 4168
585 Ga0373935_0012197 3300035692 Bacteria 5168
586 Ga0373935_0015107 3300035692 Bacteria 4662
587 Ga0373935_0027066 3300035692 Bacteria 3544
588 Ga0373935_0089501 3300035692 Bacteria 2013
589 Ga0373927_0002586 3300035695 Bacteria 13198
590 Ga0373933_0016123 3300035724 Bacteria 4174
591 Ga0373933_0145895 3300035724 Bacteria 1496
592 Ga0373947_0035668 3300035725 Bacteria 2945
593 Ga0373947_0173893 3300035725 Bacteria 1399
594 Ga0373937_0052468 3300036401 Bacteria 3738
595 Ga0373937_0076727 3300036401 Unclassified 3087
596 Ga0373937_0217177 3300036401 Bacteria 1799
597 Ga0372808_000293 3300036459 Bacteria 3504
598 Ga0372808_005815 3300036459 Bacteria 1641
599 Ga0316582_0017488 3300036647 Bacteria 4150
600 Ga0316584_0015074 3300036712 Bacteria 5523
601 Ga0316584_0036707 3300036712 Bacteria 3637
602 Ga0316584_0230304 3300036712 Bacteria 1358
603 Ga0373925_0000520 3300037068 Bacteria 38381
604 Ga0373925_0006196 3300037068 Bacteria 8836
605 Ga0373925_0042326 3300037068 Bacteria 3379
606 Ga0395899_0006498 3300037312 Bacteria 9057
607 Ga0395899_0173520 3300037312 Bacteria 1517
608 Ga0395900_0021768 3300037418 Bacteria 6555
609 Ga0395900_0060686 3300037418 Bacteria 3891
610 Ga0395898_0005196 3300037466 Bacteria 14074
611 Ga0395898_0051572 3300037466 Bacteria 4023
612 Ga0395898_0100517 3300037466 Bacteria 2777
613 Ga0395898_0125179 3300037466 Bacteria 2462
614 Ga0395898_0293042 3300037466 Bacteria 1552
615 Ga0395898_0412419 3300037466 Bacteria 1287
616 Ga0395905_0350047 3300037471 Bacteria 1369
617 Ga0436364_0060564 3300037853 Bacteria 1909
618 Ga0436364_0330965 3300037853 Bacteria 247749
619 Ga0436364_0520351 3300037853 Bacteria 12767
620 Ga0436364_0815241 3300037853 Bacteria 2809
621 Ga0436364_1204317 3300037853 Bacteria 2264
622 Ga0436364_1390946 3300037853 Bacteria 2071
623 Ga0436364_1473432 3300037853 Bacteria 3096
624 Ga0395901_0004622 3300038443 Bacteria 13894
625 Ga0395901_0004781 3300038443 Bacteria 13667
626 Ga0400485_15239 3300038735 Bacteria 4327
627 Ga0400483_015512 3300039062 Bacteria 2559
628 Ga0400483_027222 3300039062 Bacteria 3990
629 Ga0400483_054530 3300039062 Bacteria 6982
630 Ga0400483_082538 3300039062 Bacteria 11182
631 Ga0400483_166542 3300039062 Bacteria 1673
632 Ga0400483_195596 3300039062 Bacteria 42851
633 Ga0400483_237393 3300039062 Bacteria 3981
634 Ga0400483_259886 3300039062 Bacteria 6528
635 Ga0436365_0252452 3300039437 Bacteria 1292
636 Ga0436365_1676582 3300039437 Bacteria 1647
637 Ga0436363_1152983 3300039450 Bacteria 1660
638 Ga0439461_0008116 3300041410 Bacteria 1875
639 Ga0439466_0019531 3300041411 Bacteria 2425
640 Ga0439466_0026588 3300041411 Bacteria 2011
641 Ga0439465_0050098 3300041413 Bacteria 1365
642 Ga0451797_0029876 3300041453 Bacteria 1581
643 Ga0451797_0047916 3300041453 Bacteria 1038
644 Ga0451795_0507694 3300041456 Bacteria 2686
645 Ga0451841_0255082 3300041498 Bacteria 2216
646 Ga0451853_0504170 3300041512 Bacteria 3951
647 Ga0439448_0006405 3300042005 Bacteria 3384
648 Ga0439448_0017671 3300042005 Bacteria 2179
649 Ga0439455_0076553 3300042012 Bacteria 905
650 Ga0450903_000239 3300042138 Bacteria 12251
651 Ga0439458_0006273 3300042157 Bacteria 2651
652 Ga0439464_0021459 3300042439 Bacteria 1773
653 Ga0466972_0004889 3300044658 Bacteria 6720
654 Ga0466972_0112940 3300044658 Bacteria 1283
655 Ga0466972_0210887 3300044658 Bacteria 909
656 Ga0466965_0000595 3300044683 Bacteria 13193
657 Ga0466965_0006940 3300044683 Bacteria 5182
658 Ga0466961_0104050 3300044693 Bacteria 1788
659 Ga0466963_0121145 3300044694 Bacteria 1800
660 Ga0466963_0138893 3300044694 Bacteria 1682
661 Ga0466963_0145076 3300044694 Bacteria 1646
662 Ga0466971_0096291 3300044719 Bacteria 1357
663 Ga0466968_0095932 3300044735 Bacteria 1320
664 Ga0466970_0024260 3300044765 Bacteria 3171
665 Ga0466970_0030660 3300044765 Bacteria 2836
666 Ga0466970_0039325 3300044765 Bacteria 2510
667 Ga0466970_0054530 3300044765 Bacteria 2135
668 Ga0466957_0134340 3300044842 Bacteria 1588
669 Ga0466960_0018318 3300044901 Bacteria 3066
670 Ga0466960_0029256 3300044901 Bacteria 2527
671 Ga0466960_0093120 3300044901 Bacteria 1539
672 Ga0466959_0010327 3300045049 Bacteria 6668
673 Ga0466958_0185596 3300045836 Bacteria 1320
674 Ga0466967_0003660 3300045976 Bacteria 10114
675 Ga0466967_0056848 3300045976 Bacteria 3452
676 Ga0466967_0095884 3300045976 Bacteria 2705
677 Ga0466967_0102930 3300045976 Bacteria 2613
678 Ga0466967_0140003 3300045976 Bacteria 2253
679 Ga0466967_0147581 3300045976 Bacteria 2195
680 Ga0466967_0154495 3300045976 Bacteria 2148
681 Ga0466967_0304541 3300045976 Bacteria 1534
682 Ga0466967_0490806 3300045976 Bacteria 1204
683 Ga0495592_0008331 3300046454 Bacteria 7777
684 Ga0495603_0029188 3300046455 Bacteria 3326
685 Ga0495629_0005204 3300046459 Bacteria 9741
686 Ga0495641_0001209 3300046461 Bacteria 22153
687 Ga0495651_0007507 3300046462 Bacteria 8339
688 Ga0495651_0012160 3300046462 Bacteria 6627
689 Ga0495651_0024686 3300046462 Bacteria 4675
690 Ga0495653_0003497 3300046463 Bacteria 12634
691 Ga0495653_0015813 3300046463 Bacteria 6152
692 Ga0495653_0059332 3300046463 Bacteria 2904
693 Ga0495653_0070602 3300046463 Bacteria 2613
694 Ga0495580_0026734 3300046472 Bacteria 4203
695 Ga0495582_0001277 3300046473 Bacteria 14138
696 Ga0495639_0012119 3300046475 Bacteria 3716
697 Ga0495639_0126462 3300046475 Bacteria 1222
698 Ga0495662_0000438 3300046476 Bacteria 18719
699 Ga0495664_0002025 3300046477 Bacteria 10827
700 Ga0495664_0275772 3300046477 Bacteria 1016
701 Ga0495594_0296947 3300046499 Bacteria 920
702 Ga0495606_0036389 3300046507 Bacteria 3353
703 Ga0495608_0002688 3300046511 Bacteria 12772
704 Ga0495608_0011474 3300046511 Bacteria 6167
705 Ga0495608_0012319 3300046511 Bacteria 5940
706 Ga0495618_0047110 3300046514 Bacteria 2721
707 Ga0495628_0018242 3300046516 Bacteria 5817
708 Ga0495628_0034343 3300046516 Bacteria 4079
709 Ga0495628_0108400 3300046516 Bacteria 2138
710 Ga0495630_0005067 3300046517 Bacteria 9266
711 Ga0495630_0007080 3300046517 Bacteria 7990
712 Ga0495632_0027616 3300046519 Bacteria 2971
713 Ga0495648_0034453 3300046524 Bacteria 3294
714 Ga0495666_0017251 3300046526 Bacteria 3596
715 Ga0495652_0026075 3300046529 Bacteria 5165
716 Ga0495652_0062155 3300046529 Bacteria 3149
717 Ga0495652_0108206 3300046529 Bacteria 2241
718 Ga0495665_0000615 3300046531 Bacteria 18098
719 Ga0495665_0047701 3300046531 Bacteria 2272
720 Ga0495640_0006440 3300046533 Bacteria 9280
721 Ga0495640_0183364 3300046533 Bacteria 1333
722 Ga0495586_0003867 3300046535 Bacteria 8026
723 Ga0495586_0041107 3300046535 Bacteria 2490
724 Ga0495586_0041560 3300046535 Bacteria 2476
725 Ga0495587_0016061 3300046536 Bacteria 4660
726 Ga0495587_0019313 3300046536 Bacteria 4220
727 Ga0495645_0006820 3300046543 Bacteria 7933
728 Ga0495633_0010590 3300046558 Bacteria 5025
729 Ga0495667_0005694 3300046559 Bacteria 8436
730 Ga0495667_0012212 3300046559 Bacteria 5818
731 Ga0495667_0017386 3300046559 Bacteria 4856
732 Ga0495667_0028080 3300046559 Bacteria 3788
733 Ga0495656_0000824 3300046615 Bacteria 9975
734 Ga0495668_0030235 3300046616 Bacteria 3059
735 Ga0495634_0022882 3300046642 Bacteria 4399
736 Ga0495611_0018202 3300046648 Bacteria 3011
737 Ga0495635_0000969 3300046663 Bacteria 18900
738 Ga0495635_0007463 3300046663 Bacteria 7633
739 Ga0495635_0015652 3300046663 Bacteria 5297
740 Ga0495635_0296108 3300046663 Bacteria 1085
741 Ga0495588_0012962 3300046674 Bacteria 3958
742 Ga0495657_0013369 3300046675 Bacteria 6060
743 Ga0495657_0016451 3300046675 Bacteria 5389
744 Ga0495657_0017706 3300046675 Bacteria 5168
745 Ga0495623_0010837 3300046679 Bacteria 5901
746 Ga0495623_0138650 3300046679 Bacteria 1449
747 Ga0495646_0017692 3300046680 Bacteria 4518
748 Ga0495647_0006996 3300046681 Bacteria 3759
749 Ga0495658_0008689 3300046683 Bacteria 5044
750 Ga0495613_0001172 3300046689 Bacteria 19992
751 Ga0495624_0014416 3300046690 Bacteria 5364
752 Ga0495670_0000592 3300046691 Bacteria 17270
753 Ga0495671_0049402 3300046692 Bacteria 2097
754 Ga0495649_0143711 3300046694 Bacteria 1255
755 Ga0495600_0019880 3300046809 Bacteria 4292
756 Ga0495581_0001358 3300047315 Bacteria 13543
757 Ga0495581_0033931 3300047315 Bacteria 2953
758 Ga0495604_0004541 3300047317 Bacteria 10993
759 Ga0495604_0089973 3300047317 Bacteria 2280
760 Ga0495604_0149931 3300047317 Bacteria 1658
761 Ga0495636_0134946 3300047318 Bacteria 1099
762 Ga0495674_0002882 3300047319 Bacteria 16731
763 Ga0495674_0016835 3300047319 Bacteria 6817
764 Ga0495674_0220174 3300047319 Bacteria 1569
765 Ga0495672_0019952 3300047320 Bacteria 4405
766 Ga0495676_0005426 3300047321 Bacteria 11697
767 Ga0495676_0006517 3300047321 Bacteria 10758
768 Ga0495676_0017360 3300047321 Bacteria 6364
769 Ga0495680_0005478 3300047322 Bacteria 11932
770 Ga0495680_0019108 3300047322 Bacteria 5798
771 Ga0495680_0041822 3300047322 Bacteria 3640
772 Ga0495680_0268681 3300047322 Bacteria 1204
773 Ga0495675_0035481 3300047444 Bacteria 3185
774 Ga0495685_013005 3300047447 Bacteria 2823
775 Ga0495673_0002322 3300047469 Bacteria 13589
776 Ga0495681_0012674 3300047470 Bacteria 4941
777 Ga0495684_0011391 3300047471 Bacteria 6866
778 Ga0495684_0020900 3300047471 Bacteria 5043
779 Ga0495684_0058354 3300047471 Bacteria 2940
780 Ga0495593_0000574 3300047673 Bacteria 20889
781 Ga0495593_0042265 3300047673 Bacteria 2447
782 Ga0495602_0048163 3300048088 Bacteria 3834
783 Ga0495602_0100321 3300048088 Bacteria 2378
784 Ga0495602_0139400 3300048088 Bacteria 1921
785 Ga0495614_0002354 3300048089 Bacteria 8409
786 Ga0496100_0000851 3300048903 Bacteria 14590
787 Ga0496100_0004104 3300048903 Bacteria 7681
788 Ga0496100_0082473 3300048903 Bacteria 2174
789 Ga0496100_0157332 3300048903 Bacteria 1626
790 Ga0496101_0000049 3300048904 Bacteria 146432
791 Ga0496101_0028470 3300048904 Bacteria 3900
792 Ga0496101_0210558 3300048904 Bacteria 1506
793 Ga0496102_0000011 3300048905 Bacteria 321716
794 Ga0496102_0059645 3300048905 Bacteria 3489
795 Ga0496102_0270078 3300048905 Bacteria 1603
796 Ga0496102_0338410 3300048905 Bacteria 1417
797 Ga0496102_0360247 3300048905 Bacteria 1369
798 Ga0496103_0000032 3300048906 Bacteria 201453
799 Ga0496103_0000570 3300048906 Bacteria 29250
800 Ga0496104_0018057 3300048907 Bacteria 6431
801 Ga0496104_0278106 3300048907 Bacteria 1587
802 Ga0496104_0344276 3300048907 Bacteria 1404
803 Ga0496105_0077108 3300048908 Bacteria 2752
804 Ga0496105_0140652 3300048908 Bacteria 1986
805 Ga0496105_0246144 3300048908 Bacteria 1450
806 Ga0496105_0302524 3300048908 Bacteria 1285
807 Ga0496106_0000351 3300048909 Bacteria 32650
808 Ga0496106_0043232 3300048909 Bacteria 3380
809 Ga0496107_0000393 3300048910 Bacteria 23705
810 Ga0496107_0094691 3300048910 Bacteria 2184
811 Ga0496108_0017926 3300048911 Bacteria 5792
812 Ga0496108_0108039 3300048911 Bacteria 2376
813 Ga0496108_0149252 3300048911 Bacteria 2017
814 Ga0496108_0236789 3300048911 Bacteria 1588
815 Ga0496108_0240914 3300048911 Bacteria 1573
816 Ga0496108_0297618 3300048911 Bacteria 1405
817 Ga0496108_0302142 3300048911 Bacteria 1394
818 Ga0496109_0006185 3300048912 Bacteria 10063
819 Ga0496109_0062471 3300048912 Bacteria 3406
820 Ga0496109_0079591 3300048912 Bacteria 3020
821 Ga0496109_0088367 3300048912 Bacteria 2864
822 Ga0496109_0100831 3300048912 Bacteria 2679
823 Ga0496109_0107845 3300048912 Bacteria 2588
824 Ga0496109_0180159 3300048912 Bacteria 1984
825 Ga0496110_0005576 3300048913 Bacteria 9879
826 Ga0496110_0114800 3300048913 Bacteria 2424
827 Ga0496110_0278624 3300048913 Bacteria 1523
828 Ga0496110_0515061 3300048913 Bacteria 1088
829 Ga0496111_0107684 3300048914 Bacteria 2052
830 Ga0496112_0003719 3300048915 Bacteria 12731
831 Ga0496112_0031803 3300048915 Bacteria 5120
832 Ga0496112_0042192 3300048915 Bacteria 4463
833 Ga0496112_0165420 3300048915 Bacteria 2178
834 Ga0496112_0485215 3300048915 Bacteria 1172
835 Ga0496113_0001680 3300048916 Bacteria 12533
836 Ga0496113_0046043 3300048916 Bacteria 3238
837 Ga0496113_0060775 3300048916 Bacteria 2849
838 Ga0496114_0012870 3300048917 Bacteria 6701
839 Ga0496114_0017369 3300048917 Bacteria 5806
840 Ga0496114_0243655 3300048917 Bacteria 1581
841 Ga0496114_0375558 3300048917 Bacteria 1258
842 Ga0496115_0016536 3300048918 Bacteria 5620
843 Ga0496115_0092718 3300048918 Bacteria 2469
844 Ga0496115_0234913 3300048918 Bacteria 1511
845 Ga0496116_0000072 3300048919 Bacteria 238158
846 Ga0496116_0094659 3300048919 Bacteria 1805
847 Ga0496117_0000039 3300048920 Bacteria 322143
848 Ga0496117_0030781 3300048920 Bacteria 4110
849 Ga0496118_0000035 3300048921 Bacteria 322143
850 Ga0496118_0063425 3300048921 Bacteria 2719
851 Ga0496119_0001807 3300048922 Bacteria 24866
852 Ga0496120_0000190 3300048923 Bacteria 105211
853 Ga0496120_0049351 3300048923 Bacteria 2416
854 Ga0496121_0000351 3300048924 Bacteria 95963
855 Ga0496122_0019334 3300048925 Bacteria 6226
856 Ga0496122_0052731 3300048925 Bacteria 3075
857 Ga0496123_0019828 3300048926 Bacteria 5280
858 Ga0496124_0021037 3300048927 Bacteria 6016
859 Ga0496126_0004142 3300048929 Bacteria 17532
860 Ga0496126_0005807 3300048929 Bacteria 13950
861 Ga0496126_0008968 3300048929 Bacteria 10706
862 Ga0496126_0037423 3300048929 Bacteria 4528
863 Ga0496126_0071321 3300048929 Bacteria 3092
864 Ga0496126_0323305 3300048929 Bacteria 1267
865 Ga0501306_009305 3300049127 Bacteria 1217
866 Ga0501033_0003027 3300049570 Bacteria 14002
867 Ga0501034_0000488 3300049571 Bacteria 64385
868 Ga0501034_0020532 3300049571 Bacteria 6746
869 Ga0501036_0005155 3300049572 Bacteria 10563
870 Ga0501036_0025516 3300049572 Bacteria 4987
871 Ga0501037_0048457 3300049573 Bacteria 3113
872 Ga0501038_0018506 3300049574 Bacteria 6290
873 Ga0501039_0027961 3300049575 Bacteria 4338
874 Ga0501039_0059130 3300049575 Bacteria 2969
875 Ga0501040_0188924 3300049576 Bacteria 1461
876 Ga0501040_0249525 3300049576 Bacteria 1266
877 Ga0501041_0055807 3300049577 Bacteria 2412
878 Ga0501041_0080966 3300049577 Bacteria 1999
879 Ga0501042_0039401 3300049578 Bacteria 3357
880 Ga0501042_0257911 3300049578 Bacteria 1258
881 Ga0501043_0009206 3300049579 Bacteria 7761
882 Ga0501046_0030006 3300049580 Bacteria 4417
883 Ga0501046_0131295 3300049580 Bacteria 1900
884 Ga0501047_0061332 3300049581 Bacteria 3628
885 Ga0501069_0009508 3300049585 Bacteria 5131
886 Ga0501070_0082207 3300049586 Bacteria 2666
887 Ga0501070_0259890 3300049586 Bacteria 1419
888 Ga0501070_0486278 3300049586 Bacteria 992
889 Ga0501072_0147441 3300049588 Bacteria 1876
890 Ga0501073_0093963 3300049589 Bacteria 2083
891 Ga0501073_0318369 3300049589 Bacteria 1073
892 Ga0501074_0062594 3300049590 Bacteria 2680
893 Ga0501076_0137762 3300049592 Bacteria 1982
894 Ga0501079_0124067 3300049741 Bacteria 2009
895 Ga0501081_0213699 3300049743 Bacteria 1401
896 Ga0501035_0018391 3300049822 Bacteria 6439
897 Ga0501035_0191804 3300049822 Bacteria 1757
898 Ga0501044_0007886 3300049823 Bacteria 11703
899 Ga0501045_0049155 3300049824 Bacteria 3075
900 Ga0501045_0089044 3300049824 Bacteria 2280
901 nmdc:mga03n38_15161_c1 3300050490 Bacteria 2970
902 nmdc:mga03n38_45330_c1 3300050490 Bacteria 1936
903 nmdc:mga03n38_51777_c1 3300050490 Bacteria 1835
904 nmdc:mga03n38_53321_c1 3300050490 Bacteria 1813
905 nmdc:mga03n38_8103_c1 3300050490 Bacteria 3752
906 nmdc:mga00v17_2925_c1 3300050491 Bacteria 8758
907 nmdc:mga00v17_9318_c1 3300050491 Bacteria 5310
908 nmdc:mga0k408_107198_c1 3300050493 Bacteria 1650
909 nmdc:mga06z11_61383_c1 3300050494 Bacteria 1960
910 nmdc:mga04h51_12549_c1 3300050495 Bacteria 2380
911 nmdc:mga07m45_19707_c1 3300050496 Bacteria 3656
912 nmdc:mga07m45_27300_c1 3300050496 Bacteria 3144
913 nmdc:mga05p37_70519_c1 3300050507 Bacteria 4298
914 nmdc:mga05p37_77715_c2 3300050507 Bacteria 3424
915 nmdc:mga06r32_126560_c1 3300050510 Bacteria 2524
916 nmdc:mga0rr50_194393_c1 3300050513 Bacteria 1664
917 nmdc:mga0sz30_27116_c1 3300050516 Bacteria 2352
918 nmdc:mga0sz30_46883_c1 3300050516 Bacteria 1825
919 nmdc:mga0sz30_951_c1 3300050516 Bacteria 10377
920 Ga0495601_0009930 3300053077 Bacteria 5641
921 Ga0495612_0000809 3300053078 Bacteria 12742
922 Ga0495595_0036357 3300053084 Bacteria 2235
923 Ga0495619_0001138 3300053085 Bacteria 17467
924 Ga0500643_005407 3300053087 Bacteria 5509
925 Ga0500556_0000163 3300053104 Bacteria 54246
926 Ga0500562_001298 3300053108 Bacteria 6165
927 Ga0500593_005587 3300053117 Bacteria 4973
928 Ga0500608_125976 3300053122 Bacteria 1155
929 Ga0500642_0085005 3300053130 Bacteria 1458
930 Ga0500652_014170 3300053131 Bacteria 2844
931 Ga0500559_0000513 3300053136 Bacteria 27259
932 Ga0500559_0004792 3300053136 Bacteria 6335
933 Ga0500568_0052258 3300053139 Bacteria 1605
934 Ga0500579_069132 3300053143 Bacteria 2048
935 Ga0500600_0167553 3300053149 Bacteria 1072
936 Ga0500616_0000060 3300053153 Bacteria 252252
937 Ga0500616_0071982 3300053153 Bacteria 1758
938 Ga0500627_0010274 3300053158 Bacteria 3408
939 Ga0500645_000025 3300053730 Bacteria 125835
940 Ga0500645_011725 3300053730 Bacteria 2852
941 Ga0501084_0197057 3300054114 Bacteria 1699
942 Ga0501082_0520272 3300060353 Bacteria 1040
943 Ga0530510_0060449 3300061734 Bacteria 2742
944 2508673384 2508501039 Bacteria 9978592
945 2523384505 2523231044 Bacteria 6434991
946 2738707321 2738541274 Bacteria 6909446
947 2739328627 2738543028 Bacteria 6917070
948 2739363524 2738543034 Bacteria 6084756
949 2739365499 2738543034 Bacteria 6084756
950 2785369367 2784746768 Bacteria 10036182
951 2808850769 2808606360 Bacteria 4404006
952 2812318706 2811994871 Bacteria 4497550
953 2816503847 2816332139 Bacteria 9138787
954 2832007023 2832004796 Bacteria 6538017
955 2842139670 2842134933 Bacteria 5847019
956 2857740908 2857740372 Bacteria 4782044
957 2866070329 2866065130 Bacteria 6518152
958 2870790144 2870782633 Bacteria 9624083
959 2902797453 2902792274 Bacteria 7270173
960 2902799827 2902799365 Bacteria 5419524
961 2904501484 2904497146 Bacteria 4731781
962 2904766918 2904765812 Bacteria 5369154
963 2904775070 2904770941 Bacteria 5580202
964 2904778112 2904776348 Bacteria 4658726
965 2910811247 2910809715 Bacteria 4982797
966 2919035458 2919034639 Bacteria 4763403
967 2919055018 2919051321 Bacteria 4210889
968 2919420647 2919420072 Bacteria 5390363
969 2919433595 2919432681 Bacteria 5390474
970 2919539326 2919538618 Bacteria 4677069
971 2932427878 2932426870 Bacteria 4547726
972 2933422360 2933418574 Bacteria 4476724
973 2939601887 2939598168 Bacteria 4687164
974 2939677748 2939674588 Bacteria 4844420
975 2997605434 2997600082 Bacteria 9896405
976 3006430889 3006425503 Bacteria 6491253
977 8003317789 8003314358 Bacteria 10575343
978 8054476820 8054472261 Bacteria 7464355
979 8055034678 8055034563 Bacteria 3562128
980 8056064004 8056060235 Bacteria 7259403
981 Ga0495667_0213537
982 LJQas_1006464
983 JGI24739J22299_10001011
984 JGI24743J22301_10003850
985 JGI24750J21931_1006679
986 JGI24738J21930_10004652
987 JGI24744J21845_10000914
988 JGI24744J21845_10004456
989 JGI24034J26672_10006466
990 JGI25152J39213_1000223
991 JGI25404J52841_10005017
992 Ga0055542_1003653
993 Ga0070658_10116132
994 Ga0070658_10121123
995 Ga0070658_10197972
996 Ga0070658_10431126
997 Ga0070676_10003893
998 Ga0070676_10042782
999 Ga0070683_100207208
1000 Ga0070690_100001751
1001 Ga0068869_100040836
1002 Ga0068869_100046758
1003 Ga0068869_100107815
1004 Ga0068869_100325362
1005 Ga0070666_10084631
1006 Ga0070680_100549544
1007 Ga0070682_100002159
1008 Ga0070682_100004022
1009 Ga0068868_100001850
1010 Ga0068868_100043299
1011 Ga0068868_100195797
1012 Ga0070660_100223542
1013 Ga0070660_100303344
1014 Ga0070660_100328877
1015 Ga0070689_100015053
1016 Ga0070689_100044218
1017 Ga0070689_100094210
1018 Ga0070689_100165173
1019 Ga0070691_10031877
1020 Ga0070687_100100196
1021 Ga0070661_100030858
1022 Ga0070692_10016910
1023 Ga0070692_10062596
1024 Ga0070692_10076025
1025 Ga0070668_100000260
1026 Ga0070668_100003086
1027 Ga0070668_100008605
1028 Ga0070668_100042721
1029 Ga0070668_100096070
1030 Ga0070669_100394691
1031 Ga0070675_100182153
1032 Ga0070671_100181586
1033 Ga0070674_100015264
1034 Ga0070674_100032985
1035 Ga0070674_100272373
1036 Ga0070673_100017797
1037 Ga0070673_100035514
1038 Ga0070673_100042527
1039 Ga0070688_100060704
1040 Ga0070659_100007076
1041 Ga0070659_100031560
1042 Ga0070659_100038587
1043 Ga0070659_100107352
1044 Ga0070659_100187708
1045 Ga0070667_100003272
1046 Ga0070709_10054287
1047 Ga0070709_10458522
1048 Ga0070714_100004406
1049 Ga0070714_100008761
1050 Ga0070714_100133967
1051 Ga0070713_100062002
1052 Ga0070710_10000303
1053 Ga0070701_10076508
1054 Ga0070711_100001503
1055 Ga0070711_100110898
1056 Ga0070705_100009744
1057 Ga0070705_100023877
1058 Ga0070694_100032942
1059 Ga0070694_100269260
1060 Ga0070708_100011818
1061 Ga0070708_100031194
1062 Ga0070708_100647180
1063 Ga0070663_100018222
1064 Ga0070663_100086633
1065 Ga0070663_100146409
1066 Ga0070663_100168700
1067 Ga0070663_100242815
1068 Ga0070663_100382576
1069 Ga0070678_100005572
1070 Ga0070678_100034932
1071 Ga0070662_100002181
1072 Ga0070662_100026343
1073 Ga0070662_100210909
1074 Ga0070681_10119333
1075 Ga0068867_100002967
1076 Ga0070685_10034580
1077 Ga0070685_10059568
1078 Ga0070685_10103107
1079 Ga0070706_100000178
1080 Ga0070706_100049652
1081 Ga0070707_100159024
1082 Ga0070698_100004573
1083 Ga0070698_100016273
1084 Ga0070698_100205108
1085 Ga0070698_100277722
1086 Ga0070698_100339566
1087 Ga0070699_100147151
1088 Ga0070679_100016779
1089 Ga0070679_100046295
1090 Ga0070679_100303068
1091 Ga0070679_100310072
1092 Ga0070679_100404092
1093 Ga0070684_100013218
1094 Ga0070684_100065121
1095 Ga0070684_100068544
1096 Ga0070684_100114155
1097 Ga0070684_100187052
1098 Ga0070684_100311379
1099 Ga0070697_100010094
1100 Ga0068853_100000732
1101 Ga0068853_100001940
1102 Ga0070686_100018403
1103 Ga0070695_100023646
1104 Ga0070696_100002906
1105 Ga0070696_100109461
1106 Ga0070665_100010056
1107 Ga0070665_100117145
1108 Ga0070665_100158871
1109 Ga0070665_100420585
1110 Ga0070704_100000340
1111 Ga0070704_100357605
1112 Ga0068855_100215102
1113 Ga0068855_100287260
1114 Ga0070664_100098862
1115 Ga0070664_100314505
1116 Ga0068857_100121715
1117 Ga0068857_100146914
1118 Ga0068854_100008668
1119 Ga0068854_100009181
1120 Ga0068854_100031524
1121 Ga0068854_100108594
1122 Ga0068856_100168955
1123 Ga0068856_100217420
1124 Ga0068856_100314483
1125 Ga0068856_100389568
1126 Ga0070702_100000276
1127 Ga0070702_100051345
1128 Ga0070702_100131298
1129 Ga0068852_100231180
1130 Ga0068852_100237611
1131 Ga0068859_100002195
1132 Ga0068859_100079926
1133 Ga0068864_100006253
1134 Ga0068864_100096957
1135 Ga0068864_100139174
1136 Ga0068866_10000121
1137 Ga0068866_10004057
1138 Ga0068866_10117444
1139 Ga0068861_100000790
1140 Ga0068861_100375402
1141 Ga0068870_10141590
1142 Ga0068863_100007024
1143 Ga0068863_100075265
1144 Ga0068863_100372820
1145 Ga0068858_100002942
1146 Ga0068858_100031184
1147 Ga0068858_100095602
1148 Ga0068858_100121274
1149 Ga0068860_100000694
1150 Ga0068860_100383684
1151 Ga0068860_100393167
1152 Ga0068862_100073297
1153 Ga0068862_100094842
1154 Ga0068862_100584198
1155 Ga0081538_10091329
1156 Ga0081540_1002936
1157 Ga0081540_1037636
1158 Ga0070717_10242983
1159 Ga0075365_10000777
1160 Ga0075365_10011637
1161 Ga0075368_10033147
1162 Ga0075363_100002184
1163 Ga0075363_100005192
1164 Ga0075363_100013065
1165 Ga0075363_100016120
1166 Ga0075363_100051356
1167 Ga0075364_10001722
1168 Ga0075364_10002641
1169 Ga0075364_10006989
1170 Ga0075364_10246628
1171 Ga0075364_10320666
1172 Ga0070715_10079249
1173 Ga0070716_100000551
1174 Ga0070712_100004121
1175 Ga0070712_100047113
1176 Ga0070712_100071380
1177 Ga0070712_100210657
1178 Ga0070712_100281094
1179 Ga0075362_10008480
1180 Ga0075362_10032711
1181 Ga0075362_10067933
1182 Ga0075367_10055104
1183 Ga0075367_10083181
1184 Ga0075369_10000746
1185 Ga0075369_10058712
1186 Ga0075366_10083210
1187 Ga0097621_100014529
1188 Ga0097621_100034294
1189 Ga0097621_100109080
1190 Ga0075370_10000407
1191 Ga0075370_10022616
1192 Ga0075370_10024714
1193 Ga0075370_10037882
1194 Ga0075431_100028346
1195 Ga0068865_100003268
1196 Ga0068865_100264313
1197 Ga0075436_100218673
1198 Ga0097620_100002195
1199 Ga0097620_100079928
1200 Ga0075435_100055045
1201 Ga0099794_10223646
1202 Ga0099795_10097355
1203 Ga0105244_10094693
1204 Ga0105250_10118259
1205 Ga0105240_10042940
1206 Ga0105240_10284090
1207 Ga0111539_10475281
1208 Ga0105245_10004378
1209 Ga0105245_10098839
1210 Ga0105245_10147197
1211 Ga0105245_10676667
1212 Ga0105247_10000541
1213 Ga0105247_10035331
1214 Ga0114129_10035682
1215 Ga0114129_10251320
1216 Ga0114129_10390013
1217 Ga0105243_10502066
1218 Ga0105243_10626304
1219 Ga0105241_10427162
1220 Ga0105242_10000572
1221 Ga0105242_10211617
1222 Ga0105248_10003762
1223 Ga0105248_10036204
1224 Ga0105248_10108657
1225 Ga0105248_10126994
1226 Ga0105248_10684684
1227 Ga0105237_10000989
1228 Ga0105237_10014908
1229 Ga0105237_10021850
1230 Ga0105237_10256787
1231 Ga0105237_10382287
1232 Ga0105238_10059610
1233 Ga0105238_10251768
1234 Ga0105238_10496081
1235 Ga0105249_10008808
1236 Ga0105249_10045535
1237 Ga0105249_10049659
1238 Ga0105249_10213490
1239 Ga0105239_10001012
1240 Ga0105239_10028063
1241 Ga0105239_10274345
1242 Ga0105239_10320968
1243 Ga0105239_10647579
1244 Ga0105246_10017527
1245 Ga0105246_10231586
1246 Ga0105246_10425834
1247 Ga0157340_1000155
1248 Ga0157342_1000664
1249 Ga0157373_10014861
1250 Ga0157373_10102813
1251 Ga0157373_10314979
1252 Ga0157370_10088666
1253 Ga0157370_10289568
1254 Ga0157369_10045076
1255 Ga0157369_10054299
1256 Ga0157369_10080939
1257 Ga0157369_10136810
1258 Ga0157369_10156235
1259 Ga0157369_10165211
1260 Ga0157369_10395391
1261 Ga0157374_10007319
1262 Ga0157374_10039682
1263 Ga0157374_10827013
1264 Ga0157378_10027760
1265 Ga0157378_10088862
1266 Ga0157378_10516802
1267 Ga0163162_10018447
1268 Ga0157372_10216190
1269 Ga0157372_10250179
1270 Ga0157372_10336022
1271 Ga0157372_10429298
1272 Ga0157372_10476780
1273 Ga0157375_10047074
1274 Ga0157375_10168032
1275 Ga0157375_10777500
1276 Ga0163163_10060585
1277 Ga0163163_10397376
1278 Ga0163163_10668285
1279 Ga0157380_10004599
1280 Ga0157380_10126877
1281 Ga0157377_10010134
1282 Ga0157377_10015596
1283 Ga0157377_10031061
1284 Ga0157379_10026679
1285 Ga0157379_10073665
1286 Ga0157376_10117277
1287 Ga0163161_10001874
1288 Ga0163161_10038811
1289 Ga0163161_10079280
1290 Ga0163161_10405053
1291 Ga0206356_10161964
1292 Ga0206353_11031012
1293 Ga0206353_11285738
1294 Ga0213874_10057051
1295 Ga0213876_10013774
1296 Ga0213875_10000644
1297 Ga0213875_10019991
1298 Ga0213875_10022970
1299 Ga0213875_10039209
1300 Ga0224712_10146191
1301 Ga0209129_1000354
1302 Ga0209051_1022202
1303 Ga0207697_10000412
1304 Ga0207697_10000464
1305 Ga0207655_1011840
1306 Ga0207655_1013050
1307 Ga0207653_10007248
1308 Ga0207692_10003016
1309 Ga0207692_10069152
1310 Ga0207692_10221137
1311 Ga0207642_10001487
1312 Ga0207642_10093866
1313 Ga0207710_10011320
1314 Ga0207710_10012078
1315 Ga0207710_10167407
1316 Ga0207688_10000299
1317 Ga0207688_10007098
1318 Ga0207688_10008717
1319 Ga0207688_10150493
1320 Ga0207647_10008657
1321 Ga0207647_10022023
1322 Ga0207647_10072007
1323 Ga0207647_10130467
1324 Ga0207685_10133024
1325 Ga0207699_10008657
1326 Ga0207699_10014821
1327 Ga0207699_10107488
1328 Ga0207645_10005579
1329 Ga0207643_10002999
1330 Ga0207643_10037827
1331 Ga0207643_10203958
1332 Ga0207705_10246987
1333 Ga0207684_10000029
1334 Ga0207707_10031989
1335 Ga0207695_10084420
1336 Ga0207671_10006521
1337 Ga0207671_10016946
1338 Ga0207671_10139657
1339 Ga0207671_10251878
1340 Ga0207693_10000174
1341 Ga0207693_10003641
1342 Ga0207693_10035884
1343 Ga0207693_10145809
1344 Ga0207693_10184358
1345 Ga0207663_10000793
1346 Ga0207663_10015934
1347 Ga0207663_10062833
1348 Ga0207663_10277159
1349 Ga0207663_10299460
1350 Ga0207660_10047938
1351 Ga0207660_10114314
1352 Ga0207657_10051676
1353 Ga0207657_10121289
1354 Ga0207657_10140271
1355 Ga0207657_10146816
1356 Ga0207649_10067995
1357 Ga0207652_10029348
1358 Ga0207652_10077787
1359 Ga0207652_10111207
1360 Ga0207652_10188929
1361 Ga0207652_10238815
1362 Ga0207652_10285860
1363 Ga0207681_10151313
1364 Ga0207694_10348687
1365 Ga0207687_10001202
1366 Ga0207687_10018873
1367 Ga0207687_10071276
1368 Ga0207700_10018882
1369 Ga0207700_10105498
1370 Ga0207700_10136303
1371 Ga0207700_10177212
1372 Ga0207664_10005914
1373 Ga0207664_10008142
1374 Ga0207664_10039317
1375 Ga0207664_10310908
1376 Ga0207644_10205925
1377 Ga0207690_10080913
1378 Ga0207690_10094211
1379 Ga0207690_10178365
1380 Ga0207706_10005203
1381 Ga0207706_10019886
1382 Ga0207709_10006674
1383 Ga0207709_10024929
1384 Ga0207670_10076467
1385 Ga0207670_10313151
1386 Ga0207669_10005973
1387 Ga0207669_10013767
1388 Ga0207669_10351779
1389 Ga0207669_10387893
1390 Ga0207704_10000200
1391 Ga0207665_10007301
1392 Ga0207665_10009571
1393 Ga0207665_10095499
1394 Ga0207665_10126321
1395 Ga0207691_10020004
1396 Ga0207691_10047976
1397 Ga0207691_10258942
1398 Ga0207691_10366335
1399 Ga0207711_10051632
1400 Ga0207689_10005029
1401 Ga0207689_10022286
1402 Ga0207689_10054309
1403 Ga0207689_10210243
1404 Ga0207661_10003808
1405 Ga0207661_10004385
1406 Ga0207661_10105833
1407 Ga0207667_10108847
1408 Ga0207712_10020201
1409 Ga0207712_10086315
1410 Ga0207668_10103139
1411 Ga0207668_10119311
1412 Ga0207668_10312265
1413 Ga0207640_10008556
1414 Ga0207640_10076669
1415 Ga0207658_10020989
1416 Ga0207677_10019275
1417 Ga0207677_10080142
1418 Ga0207703_10003338
1419 Ga0207703_10045927
1420 Ga0207703_10053181
1421 Ga0207703_10120213
1422 Ga0207639_10020609
1423 Ga0207678_10008344
1424 Ga0207678_10064053
1425 Ga0207678_10068164
1426 Ga0207678_10080179
1427 Ga0207678_10101520
1428 Ga0207708_10000934
1429 Ga0207708_10025100
1430 Ga0207708_10047124
1431 Ga0207708_10049500
1432 Ga0207702_10095540
1433 Ga0207702_10219659
1434 Ga0207702_10237740
1435 Ga0207641_10026350
1436 Ga0207641_10212797
1437 Ga0207648_10000562
1438 Ga0207648_10034665
1439 Ga0207676_10051855
1440 Ga0207674_10006496
1441 Ga0207674_10021982
1442 Ga0207674_10095609
1443 Ga0207674_10173852
1444 Ga0207674_10405937
1445 Ga0207674_10438873
1446 Ga0207675_100000185
1447 Ga0207675_100034793
1448 Ga0207675_100051937
1449 Ga0207675_100075938
1450 Ga0207683_10000357
1451 Ga0207683_10009444
1452 Ga0207683_10011925
1453 Ga0207698_10072474
1454 Ga0207698_10331768
1455 Ga0209813_10016019
1456 Ga0268266_10016779
1457 Ga0268266_10083648
1458 Ga0268265_10007009
1459 Ga0268265_10422030
1460 Ga0268264_10001293
1461 Ga0265337_1000064
1462 Ga0265326_10001044
1463 Ga0265319_1000034
1464 Ga0265319_1001979
1465 Ga0265334_10000705
1466 Ga0265318_10014671
1467 Ga0265323_10011707
1468 Ga0265336_10001316
1469 Ga0307515_10001030
1470 Ga0307515_10054860
1471 Ga0307515_10249512
1472 Ga0307515_10273327
1473 Ga0307515_10412514
1474 Ga0265338_10000565
1475 Ga0265338_10002634
1476 Ga0265324_10004404
1477 Ga0307512_10002715
1478 Ga0307512_10167676
1479 Ga0316176_1147110
1480 Ga0314311_1217690
1481 Ga0265332_10001004
1482 Ga0265320_10004097
1483 Ga0265320_10015076
1484 Ga0265340_10006980
1485 Ga0265339_10024325
1486 Ga0265316_10015192
1487 Ga0307513_10010160
1488 Ga0307513_10011034
1489 Ga0307509_10340914
1490 Ga0307408_100000205
1491 Ga0307408_100041587
1492 Ga0307408_100054172
1493 Ga0307408_100149258
1494 Ga0307408_100221176
1495 Ga0265313_10050036
1496 Ga0307508_10042391
1497 Ga0307508_10047877
1498 Ga0307508_10372780
1499 Ga0316575_10002381
1500 Ga0265314_10070799
1501 Ga0265342_10012544
1502 Ga0316576_10134679
1503 Ga0316576_10353739
1504 Ga0316578_10079246
1505 Ga0316578_10224106
1506 Ga0307516_10064138
1507 Ga0307405_10019015
1508 Ga0307413_10074370
1509 Ga0307410_10004832
1510 Ga0307410_10031823
1511 Ga0307406_10000260
1512 Ga0307406_10054506
1513 Ga0307406_10110756
1514 Ga0307407_10106660
1515 Ga0307412_10000876
1516 Ga0307412_10563151
1517 Ga0307409_100049557
1518 Ga0307409_100148448
1519 Ga0307409_100158560
1520 Ga0307416_100032055
1521 Ga0307416_100085114
1522 Ga0307416_100383076
1523 Ga0307416_100643325
1524 Ga0307411_10050500
1525 Ga0307411_10308858
1526 Ga0307415_100142768
1527 Ga0307415_100177782
1528 Ga0316583_10004543
1529 Ga0316585_10006192
1530 Ga0316580_10024373
1531 Ga0316212_1004930
1532 Ga0373930_0017051
1533 Ga0373926_0002946
1534 Ga0373926_0007322
1535 Ga0373929_0019068
1536 Ga0373934_0010839
1537 Ga0373934_0021472
1538 Ga0373934_0028616
1539 Ga0373944_0001669
1540 Ga0373944_0044515
1541 Ga0373951_0008016
1542 Ga0373923_0028763
1543 Ga0373936_0000838
1544 Ga0373936_0001503
1545 Ga0373936_0016661
1546 Ga0373945_0002990
1547 Ga0373945_0005014
1548 Ga0373953_0004584
1549 Ga0373953_0011079
1550 Ga0373953_0030980
1551 Ga0373954_0164076
1552 Ga0373956_0022644
1553 Ga0373957_0003726
1554 Ga0373943_0002144
1555 Ga0373946_0000254
1556 Ga0373946_0001368
1557 Ga0373946_0088572
1558 Ga0373955_0008345
1559 Ga0373955_0009421
1560 Ga0373955_0240004
1561 Ga0373962_0015714
1562 Ga0316574_0094533
1563 Ga0373924_0006751
1564 Ga0373931_0012154
1565 Ga0373935_0012197
1566 Ga0373935_0015107
1567 Ga0373935_0027066
1568 Ga0373935_0089501
1569 Ga0373927_0002586
1570 Ga0373933_0016123
1571 Ga0373933_0145895
1572 Ga0373947_0035668
1573 Ga0373947_0173893
1574 Ga0373937_0052468
1575 Ga0373937_0076727
1576 Ga0373937_0217177
1577 Ga0372808_000293
1578 Ga0372808_005815
1579 Ga0316582_0017488
1580 Ga0316584_0015074
1581 Ga0316584_0036707
1582 Ga0316584_0230304
1583 Ga0373925_0000520
1584 Ga0373925_0006196
1585 Ga0373925_0042326
1586 Ga0395899_0006498
1587 Ga0395899_0173520
1588 Ga0395900_0021768
1589 Ga0395900_0060686
1590 Ga0395898_0005196
1591 Ga0395898_0051572
1592 Ga0395898_0100517
1593 Ga0395898_0125179
1594 Ga0395898_0293042
1595 Ga0395898_0412419
1596 Ga0395905_0350047
1597 Ga0436364_0060564
1598 Ga0436364_0330965
1599 Ga0436364_0520351
1600 Ga0436364_0815241
1601 Ga0436364_1204317
1602 Ga0436364_1390946
1603 Ga0436364_1473432
1604 Ga0395901_0004622
1605 Ga0395901_0004781
1606 Ga0400485_15239
1607 Ga0400483_015512
1608 Ga0400483_027222
1609 Ga0400483_054530
1610 Ga0400483_082538
1611 Ga0400483_166542
1612 Ga0400483_195596
1613 Ga0400483_237393
1614 Ga0400483_259886
1615 Ga0436365_0252452
1616 Ga0436365_1676582
1617 Ga0436363_1152983
1618 Ga0439461_0008116
1619 Ga0439466_0019531
1620 Ga0439466_0026588
1621 Ga0439465_0050098
1622 Ga0451797_0029876
1623 Ga0451797_0047916
1624 Ga0451795_0507694
1625 Ga0451841_0255082
1626 Ga0451853_0504170
1627 Ga0439448_0006405
1628 Ga0439448_0017671
1629 Ga0439455_0076553
1630 Ga0450903_000239
1631 Ga0439458_0006273
1632 Ga0439464_0021459
1633 Ga0466972_0004889
1634 Ga0466972_0112940
1635 Ga0466972_0210887
1636 Ga0466965_0000595
1637 Ga0466965_0006940
1638 Ga0466961_0104050
1639 Ga0466963_0121145
1640 Ga0466963_0138893
1641 Ga0466963_0145076
1642 Ga0466971_0096291
1643 Ga0466968_0095932
1644 Ga0466970_0024260
1645 Ga0466970_0030660
1646 Ga0466970_0039325
1647 Ga0466970_0054530
1648 Ga0466957_0134340
1649 Ga0466960_0018318
1650 Ga0466960_0029256
1651 Ga0466960_0093120
1652 Ga0466959_0010327
1653 Ga0466958_0185596
1654 Ga0466967_0003660
1655 Ga0466967_0056848
1656 Ga0466967_0095884
1657 Ga0466967_0102930
1658 Ga0466967_0140003
1659 Ga0466967_0147581
1660 Ga0466967_0154495
1661 Ga0466967_0304541
1662 Ga0466967_0490806
1663 Ga0495592_0008331
1664 Ga0495603_0029188
1665 Ga0495629_0005204
1666 Ga0495641_0001209
1667 Ga0495651_0007507
1668 Ga0495651_0012160
1669 Ga0495651_0024686
1670 Ga0495653_0003497
1671 Ga0495653_0015813
1672 Ga0495653_0059332
1673 Ga0495653_0070602
1674 Ga0495580_0026734
1675 Ga0495582_0001277
1676 Ga0495639_0012119
1677 Ga0495639_0126462
1678 Ga0495662_0000438
1679 Ga0495664_0002025
1680 Ga0495664_0275772
1681 Ga0495594_0296947
1682 Ga0495606_0036389
1683 Ga0495608_0002688
1684 Ga0495608_0011474
1685 Ga0495608_0012319
1686 Ga0495618_0047110
1687 Ga0495628_0018242
1688 Ga0495628_0034343
1689 Ga0495628_0108400
1690 Ga0495630_0005067
1691 Ga0495630_0007080
1692 Ga0495632_0027616
1693 Ga0495648_0034453
1694 Ga0495666_0017251
1695 Ga0495652_0026075
1696 Ga0495652_0062155
1697 Ga0495652_0108206
1698 Ga0495665_0000615
1699 Ga0495665_0047701
1700 Ga0495640_0006440
1701 Ga0495640_0183364
1702 Ga0495586_0003867
1703 Ga0495586_0041107
1704 Ga0495586_0041560
1705 Ga0495587_0016061
1706 Ga0495587_0019313
1707 Ga0495645_0006820
1708 Ga0495633_0010590
1709 Ga0495667_0005694
1710 Ga0495667_0012212
1711 Ga0495667_0017386
1712 Ga0495667_0028080
1713 Ga0495656_0000824
1714 Ga0495668_0030235
1715 Ga0495634_0022882
1716 Ga0495611_0018202
1717 Ga0495635_0000969
1718 Ga0495635_0007463
1719 Ga0495635_0015652
1720 Ga0495635_0296108
1721 Ga0495588_0012962
1722 Ga0495657_0013369
1723 Ga0495657_0016451
1724 Ga0495657_0017706
1725 Ga0495623_0010837
1726 Ga0495623_0138650
1727 Ga0495646_0017692
1728 Ga0495647_0006996
1729 Ga0495658_0008689
1730 Ga0495613_0001172
1731 Ga0495624_0014416
1732 Ga0495670_0000592
1733 Ga0495671_0049402
1734 Ga0495649_0143711
1735 Ga0495600_0019880
1736 Ga0495581_0001358
1737 Ga0495581_0033931
1738 Ga0495604_0004541
1739 Ga0495604_0089973
1740 Ga0495604_0149931
1741 Ga0495636_0134946
1742 Ga0495674_0002882
1743 Ga0495674_0016835
1744 Ga0495674_0220174
1745 Ga0495672_0019952
1746 Ga0495676_0005426
1747 Ga0495676_0006517
1748 Ga0495676_0017360
1749 Ga0495680_0005478
1750 Ga0495680_0019108
1751 Ga0495680_0041822
1752 Ga0495680_0268681
1753 Ga0495675_0035481
1754 Ga0495685_013005
1755 Ga0495673_0002322
1756 Ga0495681_0012674
1757 Ga0495684_0011391
1758 Ga0495684_0020900
1759 Ga0495684_0058354
1760 Ga0495593_0000574
1761 Ga0495593_0042265
1762 Ga0495602_0048163
1763 Ga0495602_0100321
1764 Ga0495602_0139400
1765 Ga0495614_0002354
1766 Ga0496100_0000851
1767 Ga0496100_0004104
1768 Ga0496100_0082473
1769 Ga0496100_0157332
1770 Ga0496101_0000049
1771 Ga0496101_0028470
1772 Ga0496101_0210558
1773 Ga0496102_0000011
1774 Ga0496102_0059645
1775 Ga0496102_0270078
1776 Ga0496102_0338410
1777 Ga0496102_0360247
1778 Ga0496103_0000032
1779 Ga0496103_0000570
1780 Ga0496104_0018057
1781 Ga0496104_0278106
1782 Ga0496104_0344276
1783 Ga0496105_0077108
1784 Ga0496105_0140652
1785 Ga0496105_0246144
1786 Ga0496105_0302524
1787 Ga0496106_0000351
1788 Ga0496106_0043232
1789 Ga0496107_0000393
1790 Ga0496107_0094691
1791 Ga0496108_0017926
1792 Ga0496108_0108039
1793 Ga0496108_0149252
1794 Ga0496108_0236789
1795 Ga0496108_0240914
1796 Ga0496108_0297618
1797 Ga0496108_0302142
1798 Ga0496109_0006185
1799 Ga0496109_0062471
1800 Ga0496109_0079591
1801 Ga0496109_0088367
1802 Ga0496109_0100831
1803 Ga0496109_0107845
1804 Ga0496109_0180159
1805 Ga0496110_0005576
1806 Ga0496110_0114800
1807 Ga0496110_0278624
1808 Ga0496110_0515061
1809 Ga0496111_0107684
1810 Ga0496112_0003719
1811 Ga0496112_0031803
1812 Ga0496112_0042192
1813 Ga0496112_0165420
1814 Ga0496112_0485215
1815 Ga0496113_0001680
1816 Ga0496113_0046043
1817 Ga0496113_0060775
1818 Ga0496114_0012870
1819 Ga0496114_0017369
1820 Ga0496114_0243655
1821 Ga0496114_0375558
1822 Ga0496115_0016536
1823 Ga0496115_0092718
1824 Ga0496115_0234913
1825 Ga0496116_0000072
1826 Ga0496116_0094659
1827 Ga0496117_0000039
1828 Ga0496117_0030781
1829 Ga0496118_0000035
1830 Ga0496118_0063425
1831 Ga0496119_0001807
1832 Ga0496120_0000190
1833 Ga0496120_0049351
1834 Ga0496121_0000351
1835 Ga0496122_0019334
1836 Ga0496122_0052731
1837 Ga0496123_0019828
1838 Ga0496124_0021037
1839 Ga0496126_0004142
1840 Ga0496126_0005807
1841 Ga0496126_0008968
1842 Ga0496126_0037423
1843 Ga0496126_0071321
1844 Ga0496126_0323305
1845 Ga0501306_009305
1846 Ga0501033_0003027
1847 Ga0501034_0000488
1848 Ga0501034_0020532
1849 Ga0501036_0005155
1850 Ga0501036_0025516
1851 Ga0501037_0048457
1852 Ga0501038_0018506
1853 Ga0501039_0027961
1854 Ga0501039_0059130
1855 Ga0501040_0188924
1856 Ga0501040_0249525
1857 Ga0501041_0055807
1858 Ga0501041_0080966
1859 Ga0501042_0039401
1860 Ga0501042_0257911
1861 Ga0501043_0009206
1862 Ga0501046_0030006
1863 Ga0501046_0131295
1864 Ga0501047_0061332
1865 Ga0501069_0009508
1866 Ga0501070_0082207
1867 Ga0501070_0259890
1868 Ga0501070_0486278
1869 Ga0501072_0147441
1870 Ga0501073_0093963
1871 Ga0501073_0318369
1872 Ga0501074_0062594
1873 Ga0501076_0137762
1874 Ga0501079_0124067
1875 Ga0501081_0213699
1876 Ga0501035_0018391
1877 Ga0501035_0191804
1878 Ga0501044_0007886
1879 Ga0501045_0049155
1880 Ga0501045_0089044
1881 nmdc:mga03n38_15161_c1
1882 nmdc:mga03n38_45330_c1
1883 nmdc:mga03n38_51777_c1
1884 nmdc:mga03n38_53321_c1
1885 nmdc:mga03n38_8103_c1
1886 nmdc:mga00v17_2925_c1
1887 nmdc:mga00v17_9318_c1
1888 nmdc:mga0k408_107198_c1
1889 nmdc:mga06z11_61383_c1
1890 nmdc:mga04h51_12549_c1
1891 nmdc:mga07m45_19707_c1
1892 nmdc:mga07m45_27300_c1
1893 nmdc:mga05p37_70519_c1
1894 nmdc:mga05p37_77715_c2
1895 nmdc:mga06r32_126560_c1
1896 nmdc:mga0rr50_194393_c1
1897 nmdc:mga0sz30_27116_c1
1898 nmdc:mga0sz30_46883_c1
1899 nmdc:mga0sz30_951_c1
1900 Ga0495601_0009930
1901 Ga0495612_0000809
1902 Ga0495595_0036357
1903 Ga0495619_0001138
1904 Ga0500643_005407
1905 Ga0500556_0000163
1906 Ga0500562_001298
1907 Ga0500593_005587
1908 Ga0500608_125976
1909 Ga0500642_0085005
1910 Ga0500652_014170
1911 Ga0500559_0000513
1912 Ga0500559_0004792
1913 Ga0500568_0052258
1914 Ga0500579_069132
1915 Ga0500600_0167553
1916 Ga0500616_0000060
1917 Ga0500616_0071982
1918 Ga0500627_0010274
1919 Ga0500645_000025
1920 Ga0500645_011725
1921 Ga0501084_0197057
1922 Ga0501082_0520272
1923 Ga0530510_0060449
1924 2508673384
1925 2523384505
1926 2738707321
1927 2739328627
1928 2739363524
1929 2739365499
1930 2785369367
1931 2808850769
1932 2812318706
1933 2816503847
1934 2832007023
1935 2842139670
1936 2857740908
1937 2866070329
1938 2870790144
1939 2902797453
1940 2902799827
1941 2904501484
1942 2904766918
1943 2904775070
1944 2904778112
1945 2910811247
1946 2919035458
1947 2919055018
1948 2919420647
1949 2919433595
1950 2919539326
1951 2932427878
1952 2933422360
1953 2939601887
1954 2939677748
1955 2997605434
1956 3006430889
1957 8003317789
1958 8054476820
1959 8055034678
1960 8056064004

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

19

297

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3irs-assembly1.cif.gz_B crystal structure of uncharacterized tim-barrel protein bb4693 from bordetella bronchiseptica 0.8263 9 289
3irs-assembly1.cif.gz_B crystal structure of uncharacterized tim-barrel protein bb4693 from bordetella bronchiseptica 0.8127 9 289
2dvx-assembly1.cif.gz_B crystal structure of 2,6-dihydroxybenzoate decarboxylase complexed with inhibitor 2,3-dihydroxybenzaldehyde 0.7295 9 289
7wjr-assembly1.cif.gz_D crystal structure of dihydroxybenzoate decarboxylase mutant a63s from aspergillus oryzae in complex with catechol 0.7244 9 291
7wkl-assembly1.cif.gz_B crystal structure of dihydroxybenzoate decarboxylase mutant f296y from aspergillus oryzae in complex with catechol 0.7227 9 291
ID Description Score Start End Superfamily
af_I6Y3Q7_2_272_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9064 12 291 3.20.20.140
af_I6Y3Q7_2_272_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8969 12 291 3.20.20.140
af_Q50662_37_305_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8466 28 289 3.20.20.140
3k4wC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8118 9 289 3.20.20.140
af_Q50662_37_305_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8115 28 289 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A4Q5T3P5-F1-model_v4 4-hydroxyphenyl-beta-ketoacyl-CoA hydrolase 0.9995 200 289 GO:0016787
AF-A0A1F2T0B5-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9982 211 291 GO:0016787
GO:0016829
AF-A0A848Q373-F1-model_v4 deleted 0.9973 213 291
AF-K8X6S5-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9956 125 272 GO:0016787
GO:0016831
AF-A0A4Y3RBL5-F1-model_v4 4-hydroxyphenyl-beta-ketoacyl-CoA hydrolase 0.995 34 289 GO:0016787
GO:0016831

Map