F487374

General Info

Members Datasets Scaffolds Average Seq Length
980 296 1960 120

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0000021|Ga0495672_0000021_127660_128085
Length 141
Sequence MMNSNANKPGDAMLGDIADDMILDQVSELDGLGSGSEFGAASFGNQAAGADAGRPKRDLPQMMRKIPVTLTLEVGSARISLQELMAIGPDSVLELDVLAGEPLVIKVNGTPIGRAEVVVAGENYGLKVIDLDGLNLDLMTS

Samples

Sample ID Description Type Environment
1 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
45 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
46 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
61 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
62 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
66 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
68 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
69 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
72 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
78 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
106 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
109 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
119 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
120 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
121 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
122 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
123 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
124 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
125 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
126 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
127 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
135 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
136 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
137 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
138 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
145 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
146 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
147 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
148 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
149 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
150 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
151 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
152 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
155 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
156 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
157 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
158 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
159 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
160 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
161 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
162 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
163 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
164 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
165 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
168 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
169 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
172 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
173 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
174 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
177 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
178 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
184 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
185 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
188 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
191 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
192 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
193 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
194 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
195 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
196 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
203 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
206 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
207 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
208 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
209 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
210 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
211 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
212 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
213 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
214 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
231 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
232 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
233 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
234 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
235 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
236 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
237 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
238 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
239 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
243 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
244 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
247 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
248 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
249 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
250 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
251 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
252 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
253 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
254 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
255 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
256 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
257 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
258 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
259 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
260 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
261 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
262 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
263 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
264 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
265 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
266 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
267 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
268 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
269 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
270 2643221556 Massilia sp. Root1485 Isolate Unclassified
271 2643221638 Duganella sp. Root336D2 Isolate Unclassified
272 2643221645 Massilia sp. Root351 Isolate Unclassified
273 2643221664 Massilia sp. Root418 Isolate Unclassified
274 2643221684 Massilia sp. Root133 Isolate Unclassified
275 2738541280 Massilia sp. GV090 Isolate Unclassified
276 2738541297 Duganella sp. GV083 Isolate Unclassified
277 2738541300 Massilia sp. GV016 Isolate Unclassified
278 2738541357 Duganella sp. GV053 Isolate Unclassified
279 2738543003 Duganella sp. GV066 Isolate Unclassified
280 2738543018 Massilia sp. GV045 Isolate Unclassified
281 2738543026 Duganella sp. GV089 Isolate Unclassified
282 2738543029 Duganella sp. GV039 Isolate Unclassified
283 2738543030 Massilia sp. GV097 Isolate Unclassified
284 2821131069 Duganella sp. 1224 Isolate Unclassified
285 2842711865 Duganella sp. R-73148 Isolate Unclassified
286 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
287 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
288 2857553236 Duganella sp. R-74557 Isolate Unclassified
289 2857558681 Duganella sp. R-74565 Isolate Unclassified
290 2857564685 Duganella sp. R-74599 Isolate Unclassified
291 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
292 2904424332 Duganella sp. 1411 Isolate Rhizosphere
293 2919476304 Duganella sp. 3397 Isolate Unclassified
294 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
295 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
296 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.53
Metatranscriptomes 0.51
Isolates 2.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.63
Nodule 0.31
Rhizoplane 3.78
Rhizosphere 77.96
Stem 0
Stem Tuber 0
Unclassified 0.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495672_0000021 3300047320 Bacteria 422795
2 JGI25154J39366_1001359 3300002738 Bacteria 8917
3 JGI25158J39367_1011773 3300002739 Bacteria 1161
4 JGI25152J39213_1000181 3300002773 Bacteria 42307
5 JGI25152J39213_1000260 3300002773 Bacteria 35206
6 JGI25150J39212_1001789 3300002774 Bacteria 5724
7 JGI25150J39212_1002819 3300002774 Bacteria 4212
8 JGI25150J39212_1006203 3300002774 Bacteria 2489
9 JGI25159J45721_1002010 3300002987 Bacteria 8068
10 JGI25159J45721_1007010 3300002987 Bacteria 3288
11 JGI25159J45721_1008112 3300002987 Bacteria 2921
12 JGI25153J46596_10003686 3300003215 Bacteria 8471
13 rootH1_10207818 3300003323 Bacteria 2214
14 JGI25160J50197_1003973 3300003354 Bacteria 6460
15 JGI25161J50226_1001335 3300003374 Bacteria 7602
16 JGI25161J50226_1001642 3300003374 Bacteria 6459
17 JGI25161J50226_1012929 3300003374 Bacteria 983
18 Ga0055525_1000006 3300003759 Bacteria 642912
19 Ga0055542_1009431 3300003762 Bacteria 1841
20 Ga0055526_1000894 3300003771 Bacteria 22172
21 Ga0055526_1000936 3300003771 Bacteria 21656
22 Ga0055526_1001845 3300003771 Bacteria 14661
23 Ga0055526_1001937 3300003771 Bacteria 14320
24 Ga0055537_1000030 3300003773 Bacteria 100491
25 Ga0055537_1013220 3300003773 Bacteria 1562
26 Ga0055537_1020355 3300003773 Bacteria 1009
27 Ga0055537_1030202 3300003773 Bacteria 703
28 Ga0055524_1000003 3300003775 Bacteria 399748
29 Ga0055524_1000578 3300003775 Bacteria 26928
30 Ga0055524_1002401 3300003775 Bacteria 9714
31 Ga0055524_1007783 3300003775 Bacteria 4517
32 Ga0055524_1013986 3300003775 Bacteria 2997
33 Ga0055534_1000203 3300003784 Bacteria 43799
34 Ga0055534_1002029 3300003784 Bacteria 7338
35 Ga0055534_1010837 3300003784 Bacteria 1883
36 Ga0055528_1000036 3300003790 Bacteria 116393
37 Ga0055528_1009284 3300003790 Bacteria 4123
38 Ga0055530_10016096 3300003791 Bacteria 2406
39 Ga0055531_10002157 3300003794 Bacteria 13449
40 Ga0055531_10016748 3300003794 Bacteria 3140
41 Ga0055543_1000823 3300004625 Bacteria 15179
42 Ga0055543_1002510 3300004625 Bacteria 6004
43 Ga0065165_1000353 3300005262 Bacteria 75343
44 Ga0065165_1000666 3300005262 Bacteria 49564
45 Ga0065165_1024860 3300005262 Bacteria 2003
46 Ga0065165_1039588 3300005262 Bacteria 1410
47 Ga0065714_10068709 3300005288 Bacteria 4545
48 Ga0070658_10085030 3300005327 Bacteria 2601
49 Ga0070658_11864930 3300005327 Bacteria 519
50 Ga0070683_100743401 3300005329 Bacteria 940
51 Ga0068869_100882320 3300005334 Bacteria 773
52 Ga0070661_101529920 3300005344 Bacteria 563
53 Ga0070659_100071453 3300005366 Bacteria 2759
54 Ga0070667_102080444 3300005367 Bacteria 535
55 Ga0070663_100927244 3300005455 Bacteria 754
56 Ga0068867_100379495 3300005459 Bacteria 1187
57 Ga0068867_101545746 3300005459 Bacteria 619
58 Ga0070679_102059700 3300005530 Bacteria 520
59 Ga0070684_100346551 3300005535 Bacteria 1366
60 Ga0070686_100440715 3300005544 Bacteria 999
61 Ga0068855_100078109 3300005563 Bacteria 3840
62 Ga0070664_100115055 3300005564 Bacteria 2350
63 Ga0070664_100506231 3300005564 Bacteria 1113
64 Ga0070664_101607534 3300005564 Bacteria 616
65 Ga0068863_101157369 3300005841 Bacteria 779
66 Ga0070717_10667500 3300006028 Bacteria 944
67 Ga0075363_100176283 3300006048 Bacteria 1215
68 Ga0075362_10018521 3300006177 Bacteria 2883
69 Ga0097621_100228788 3300006237 Bacteria 1623
70 Ga0075370_10160872 3300006353 Bacteria 1318
71 Ga0068871_100118269 3300006358 Bacteria 2236
72 Ga0068865_100269102 3300006881 Bacteria 1352
73 Ga0068865_100623494 3300006881 Bacteria 914
74 Ga0068865_101686523 3300006881 Bacteria 571
75 Ga0079104_1019974 3300006946 Bacteria 1857
76 Ga0099826_10000002 3300006948 Bacteria 1125830
77 Ga0105244_10052471 3300009036 Bacteria 2076
78 Ga0105240_10576713 3300009093 Bacteria 1241
79 Ga0105245_10064563 3300009098 Bacteria 3309
80 Ga0105242_11849732 3300009176 Bacteria 643
81 Ga0105248_11515680 3300009177 Bacteria 759
82 Ga0105237_10151307 3300009545 Bacteria 2317
83 Ga0105238_10144198 3300009551 Bacteria 2358
84 Ga0105246_10634171 3300011119 Bacteria 928
85 Ga0157373_10316352 3300013100 Bacteria 1110
86 Ga0163162_10200776 3300013306 Bacteria 2123
87 Ga0157372_10993665 3300013307 Bacteria 972
88 Ga0157375_12861270 3300013308 Bacteria 577
89 Ga0182008_10000994 3300014497 Bacteria 19717
90 Ga0157379_11022795 3300014968 Bacteria 788
91 Ga0182006_1000175 3300015261 Bacteria 67518
92 Ga0182006_1318238 3300015261 Bacteria 511
93 Ga0182007_10000109 3300015262 Bacteria 57731
94 Ga0182005_1000094 3300015265 Bacteria 66986
95 Ga0163161_10065498 3300017792 Bacteria 2651
96 Ga0163161_10073799 3300017792 Bacteria 2500
97 Ga0213872_10003554 3300021361 Bacteria 8586
98 Ga0213872_10017735 3300021361 Bacteria 3286
99 Ga0213872_10220817 3300021361 Bacteria 806
100 Ga0209436_100579 3300025208 Bacteria 15667
101 Ga0209436_119484 3300025208 Bacteria 939
102 Ga0209563_100022 3300025230 Bacteria 643318
103 Ga0207425_1000001 3300025245 Bacteria 2525432
104 Ga0207425_1000039 3300025245 Bacteria 219078
105 Ga0207425_1000262 3300025245 Bacteria 38967
106 Ga0209646_1000051 3300025246 Bacteria 296525
107 Ga0209677_105381 3300025253 Bacteria 3355
108 Ga0209148_1000638 3300025254 Bacteria 30534
109 Ga0209129_1000001 3300025258 Bacteria 1452436
110 Ga0209129_1005755 3300025258 Bacteria 4251
111 Ga0209565_1000017 3300025263 Bacteria 462438
112 Ga0209565_1000561 3300025263 Bacteria 25571
113 Ga0209565_1002115 3300025263 Bacteria 7563
114 Ga0209565_1005879 3300025263 Bacteria 3516
115 Ga0209565_1007034 3300025263 Bacteria 3081
116 Ga0209565_1033327 3300025263 Bacteria 992
117 Ga0209673_1000007 3300025273 Bacteria 634477
118 Ga0209673_1009510 3300025273 Bacteria 4196
119 Ga0209130_1000078 3300025284 Bacteria 169374
120 Ga0209130_1002318 3300025284 Bacteria 9729
121 Ga0209130_1002816 3300025284 Bacteria 8108
122 Ga0209675_1000009 3300025291 Bacteria 562872
123 Ga0209675_1000243 3300025291 Bacteria 54489
124 Ga0209675_1001406 3300025291 Bacteria 13963
125 Ga0209675_1001675 3300025291 Bacteria 12326
126 Ga0209564_1000011 3300025295 Bacteria 822327
127 Ga0209564_1000036 3300025295 Bacteria 423455
128 Ga0209564_1000055 3300025295 Bacteria 343782
129 Ga0209564_1000089 3300025295 Bacteria 249694
130 Ga0209564_1000109 3300025295 Bacteria 212912
131 Ga0209564_1001236 3300025295 Bacteria 28753
132 Ga0209564_1013242 3300025295 Bacteria 3523
133 Ga0209564_1021516 3300025295 Bacteria 2316
134 Ga0209758_1000020 3300025297 Bacteria 734220
135 Ga0209758_1000625 3300025297 Bacteria 54181
136 Ga0209050_1000074 3300025298 Bacteria 289334
137 Ga0209050_1000116 3300025298 Bacteria 204164
138 Ga0209256_1000007 3300025299 Bacteria 1136599
139 Ga0209256_1000028 3300025299 Bacteria 420213
140 Ga0209256_1000433 3300025299 Bacteria 64898
141 Ga0209256_1000928 3300025299 Bacteria 35783
142 Ga0209256_1001688 3300025299 Bacteria 21364
143 Ga0207426_1004301 3300025302 Bacteria 7037
144 Ga0207426_1108527 3300025302 Bacteria 704
145 Ga0209051_1008888 3300025303 Bacteria 5253
146 Ga0209051_1012422 3300025303 Bacteria 4119
147 Ga0209257_1000003 3300025304 Bacteria 1702593
148 Ga0209257_1072196 3300025304 Bacteria 906
149 Ga0207655_1048839 3300025728 Bacteria 1733
150 Ga0207705_10001211 3300025909 Bacteria 20921
151 Ga0207657_10091868 3300025919 Bacteria 2530
152 Ga0207649_10103172 3300025920 Bacteria 1892
153 Ga0207649_10927827 3300025920 Bacteria 683
154 Ga0207652_11760159 3300025921 Bacteria 524
155 Ga0207694_10245893 3300025924 Bacteria 1463
156 Ga0207659_10797199 3300025926 Bacteria 811
157 Ga0207687_10231169 3300025927 Bacteria 1461
158 Ga0207690_10096501 3300025932 Bacteria 2102
159 Ga0207706_10032815 3300025933 Bacteria 4621
160 Ga0207706_11308951 3300025933 Bacteria 598
161 Ga0207704_10005885 3300025938 Bacteria 5676
162 Ga0207691_10178398 3300025940 Bacteria 1857
163 Ga0207679_10103986 3300025945 Bacteria 2227
164 Ga0207679_10135159 3300025945 Bacteria 1985
165 Ga0207679_11168405 3300025945 Bacteria 706
166 Ga0207679_11181423 3300025945 Bacteria 702
167 Ga0207667_10063869 3300025949 Bacteria 3846
168 Ga0207640_10168908 3300025981 Bacteria 1627
169 Ga0207678_10137650 3300026067 Bacteria 2083
170 Ga0207641_10807558 3300026088 Bacteria 928
171 Ga0207674_10150622 3300026116 Bacteria 2283
172 Ga0207674_11470526 3300026116 Bacteria 650
173 Ga0207683_10425066 3300026121 Bacteria 1224
174 Ga0207698_10894195 3300026142 Bacteria 895
175 Ga0209282_1000001 3300027666 Bacteria 2450367
176 Ga0307515_10406681 3300028794 Bacteria 985
177 Ga0316181_1084405 3300030744 Bacteria 4562
178 Ga0307513_10828997 3300031456 Unclassified 631
179 Ga0307513_10886771 3300031456 Bacteria 599
180 Ga0307408_100000157 3300031548 Bacteria 75915
181 Ga0307408_100011844 3300031548 Bacteria 5770
182 Ga0307408_100016288 3300031548 Bacteria 4959
183 Ga0307408_100187879 3300031548 Bacteria 1662
184 Ga0307408_100288467 3300031548 Bacteria 1369
185 Ga0307408_100644620 3300031548 Bacteria 946
186 Ga0307514_10000369 3300031649 Bacteria 102951
187 Ga0307518_10463597 3300031838 Bacteria 671
188 Ga0307416_100005844 3300032002 Bacteria 7630
189 Ga0307414_10021442 3300032004 Bacteria 4054
190 Ga0307510_10093394 3300033180 Bacteria 2840
191 Ga0395899_0033400 3300037312 Bacteria 3863
192 Ga0395899_0066327 3300037312 Bacteria 2650
193 Ga0395899_0118719 3300037312 Bacteria 1896
194 Ga0395899_0869929 3300037312 Bacteria 552
195 Ga0395900_0030284 3300037418 Bacteria 5555
196 Ga0395900_0159986 3300037418 Bacteria 2297
197 Ga0395900_0220330 3300037418 Bacteria 1912
198 Ga0395898_0339284 3300037466 Bacteria 1433
199 Ga0395905_0075323 3300037471 Bacteria 3163
200 Ga0395905_0091005 3300037471 Bacteria 2860
201 Ga0395905_0947985 3300037471 Bacteria 763
202 Ga0395901_0116842 3300038443 Bacteria 2802
203 Ga0395901_0698200 3300038443 Bacteria 1012
204 Ga0395901_1896944 3300038443 Bacteria 543
205 Ga0436361_0032036 3300039447 Bacteria 7614
206 Ga0436361_0273087 3300039447 Bacteria 545
207 Ga0436361_0275544 3300039447 Bacteria 693
208 Ga0436361_0287651 3300039447 Bacteria 35780
209 Ga0436361_0709397 3300039447 Bacteria 2363
210 Ga0436361_0823985 3300039447 Bacteria 695
211 Ga0439448_0060512 3300042005 Bacteria 1251
212 Ga0439455_0124203 3300042012 Bacteria 725
213 Ga0450911_006248 3300042115 Bacteria 1786
214 Ga0439459_0162881 3300042438 Bacteria 590
215 Ga0466969_0490104 3300044656 Bacteria 561
216 Ga0466972_0016675 3300044658 Bacteria 3672
217 Ga0466972_0230066 3300044658 Bacteria 867
218 Ga0466972_0376676 3300044658 Bacteria 664
219 Ga0466965_0028964 3300044683 Bacteria 2693
220 Ga0466965_0034769 3300044683 Bacteria 2466
221 Ga0466965_0529428 3300044683 Bacteria 663
222 Ga0466964_0000497 3300044706 Bacteria 12201
223 Ga0466968_0000664 3300044735 Bacteria 11780
224 Ga0466970_0625665 3300044765 Bacteria 625
225 Ga0466970_0631329 3300044765 Bacteria 622
226 Ga0466970_0938391 3300044765 Bacteria 509
227 Ga0466957_0082293 3300044842 Bacteria 2006
228 Ga0466960_0590460 3300044901 Bacteria 658
229 Ga0466960_0686386 3300044901 Bacteria 613
230 Ga0466959_0002327 3300045049 Bacteria 12130
231 Ga0466959_0158386 3300045049 Bacteria 1592
232 Ga0466959_0608817 3300045049 Bacteria 734
233 Ga0466958_0823068 3300045836 Bacteria 605
234 Ga0466958_0888401 3300045836 Bacteria 581
235 Ga0466967_0073467 3300045976 Bacteria 3068
236 Ga0466967_0535014 3300045976 Bacteria 1152
237 Ga0495617_000003 3300046452 Bacteria 541914
238 Ga0495617_000656 3300046452 Bacteria 17375
239 Ga0495617_018444 3300046452 Bacteria 2360
240 Ga0495617_037466 3300046452 Bacteria 1624
241 Ga0495617_087874 3300046452 Bacteria 1016
242 Ga0495627_000057 3300046453 Bacteria 144773
243 Ga0495627_000320 3300046453 Bacteria 47074
244 Ga0495627_010065 3300046453 Bacteria 3455
245 Ga0495627_010159 3300046453 Bacteria 3434
246 Ga0495603_0041818 3300046455 Bacteria 2740
247 Ga0495603_0046252 3300046455 Bacteria 2593
248 Ga0495590_0000045 3300046457 Bacteria 119667
249 Ga0495590_0000604 3300046457 Bacteria 16875
250 Ga0495590_0003106 3300046457 Bacteria 6787
251 Ga0495590_0011629 3300046457 Bacteria 3288
252 Ga0495590_0033328 3300046457 Bacteria 1801
253 Ga0495590_0091971 3300046457 Bacteria 1073
254 Ga0495591_000153 3300046458 Bacteria 73339
255 Ga0495591_111434 3300046458 Bacteria 672
256 Ga0495629_0010302 3300046459 Bacteria 6810
257 Ga0495629_0028042 3300046459 Bacteria 3998
258 Ga0495638_0000017 3300046460 Bacteria 391117
259 Ga0495638_0002577 3300046460 Bacteria 14658
260 Ga0495638_0002667 3300046460 Bacteria 14372
261 Ga0495638_0024438 3300046460 Bacteria 3940
262 Ga0495638_0041700 3300046460 Bacteria 2902
263 Ga0495638_0094365 3300046460 Bacteria 1799
264 Ga0495638_0296650 3300046460 Bacteria 872
265 Ga0495638_0447567 3300046460 Bacteria 660
266 Ga0495653_0000024 3300046463 Bacteria 160810
267 Ga0495653_0010927 3300046463 Bacteria 7434
268 Ga0495653_0088081 3300046463 Bacteria 2278
269 Ga0495650_0000019 3300046471 Bacteria 533849
270 Ga0495650_0000329 3300046471 Bacteria 84971
271 Ga0495650_0000425 3300046471 Bacteria 68464
272 Ga0495650_0000627 3300046471 Bacteria 47536
273 Ga0495650_0000952 3300046471 Bacteria 33485
274 Ga0495650_0004013 3300046471 Bacteria 10330
275 Ga0495650_0009662 3300046471 Bacteria 5467
276 Ga0495650_0013766 3300046471 Bacteria 4255
277 Ga0495650_0071409 3300046471 Bacteria 1361
278 Ga0495650_0100529 3300046471 Bacteria 1086
279 Ga0495580_0161772 3300046472 Bacteria 1549
280 Ga0495582_0015581 3300046473 Bacteria 4173
281 Ga0495582_0122065 3300046473 Bacteria 1468
282 Ga0495605_0000021 3300046474 Bacteria 248512
283 Ga0495605_0000028 3300046474 Bacteria 218471
284 Ga0495605_0003267 3300046474 Bacteria 9730
285 Ga0495605_0007678 3300046474 Bacteria 6113
286 Ga0495605_0011870 3300046474 Bacteria 4845
287 Ga0495605_0023899 3300046474 Bacteria 3206
288 Ga0495605_0026641 3300046474 Bacteria 3003
289 Ga0495605_0042945 3300046474 Bacteria 2244
290 Ga0495605_0074037 3300046474 Bacteria 1604
291 Ga0495605_0156450 3300046474 Bacteria 1013
292 Ga0495605_0226005 3300046474 Bacteria 807
293 Ga0495605_0255203 3300046474 Bacteria 749
294 Ga0495639_0238240 3300046475 Bacteria 897
295 Ga0495584_0000511 3300046491 Bacteria 26555
296 Ga0495584_0001371 3300046491 Bacteria 14700
297 Ga0495584_0004831 3300046491 Bacteria 7198
298 Ga0495584_0005263 3300046491 Bacteria 6854
299 Ga0495584_0005286 3300046491 Bacteria 6839
300 Ga0495584_0005552 3300046491 Bacteria 6676
301 Ga0495584_0008115 3300046491 Bacteria 5454
302 Ga0495584_0009179 3300046491 Bacteria 5099
303 Ga0495584_0010440 3300046491 Bacteria 4771
304 Ga0495584_0012904 3300046491 Bacteria 4265
305 Ga0495584_0039266 3300046491 Bacteria 2391
306 Ga0495584_0039889 3300046491 Bacteria 2372
307 Ga0495584_0068882 3300046491 Bacteria 1777
308 Ga0495584_0171816 3300046491 Bacteria 1101
309 Ga0495584_0198462 3300046491 Bacteria 1020
310 Ga0495585_0000055 3300046492 Bacteria 113899
311 Ga0495585_0000278 3300046492 Bacteria 51304
312 Ga0495585_0000382 3300046492 Bacteria 42557
313 Ga0495585_0003375 3300046492 Bacteria 10812
314 Ga0495585_0004719 3300046492 Bacteria 8776
315 Ga0495585_0012402 3300046492 Bacteria 5022
316 Ga0495585_0012556 3300046492 Bacteria 4990
317 Ga0495585_0012728 3300046492 Bacteria 4951
318 Ga0495585_0014339 3300046492 Bacteria 4619
319 Ga0495585_0020721 3300046492 Bacteria 3779
320 Ga0495585_0022806 3300046492 Bacteria 3594
321 Ga0495585_0027287 3300046492 Bacteria 3258
322 Ga0495585_0034371 3300046492 Bacteria 2865
323 Ga0495585_0035322 3300046492 Bacteria 2825
324 Ga0495585_0121340 3300046492 Bacteria 1382
325 Ga0495585_0121671 3300046492 Bacteria 1380
326 Ga0495585_0168764 3300046492 Bacteria 1131
327 Ga0495585_0312304 3300046492 Bacteria 770
328 Ga0495585_0594585 3300046492 Bacteria 520
329 Ga0495594_0002666 3300046499 Bacteria 9284
330 Ga0495594_0004551 3300046499 Bacteria 7132
331 Ga0495594_0018607 3300046499 Bacteria 3681
332 Ga0495594_0021867 3300046499 Bacteria 3417
333 Ga0495594_0135143 3300046499 Bacteria 1397
334 Ga0495594_0643630 3300046499 Bacteria 600
335 Ga0495596_0000342 3300046500 Bacteria 30218
336 Ga0495596_0001440 3300046500 Bacteria 13630
337 Ga0495596_0005627 3300046500 Bacteria 5885
338 Ga0495596_0007218 3300046500 Bacteria 5026
339 Ga0495596_0007775 3300046500 Bacteria 4810
340 Ga0495596_0011382 3300046500 Bacteria 3841
341 Ga0495596_0012092 3300046500 Bacteria 3705
342 Ga0495596_0013278 3300046500 Bacteria 3498
343 Ga0495596_0021032 3300046500 Bacteria 2666
344 Ga0495596_0027309 3300046500 Bacteria 2296
345 Ga0495596_0043617 3300046500 Bacteria 1767
346 Ga0495596_0059401 3300046500 Bacteria 1490
347 Ga0495596_0104302 3300046500 Bacteria 1101
348 Ga0495596_0143815 3300046500 Bacteria 926
349 Ga0495596_0251089 3300046500 Bacteria 687
350 Ga0495596_0369725 3300046500 Bacteria 558
351 Ga0495607_0001471 3300046501 Bacteria 20986
352 Ga0495607_0001771 3300046501 Bacteria 18464
353 Ga0495607_0002219 3300046501 Bacteria 16083
354 Ga0495607_0005026 3300046501 Bacteria 9593
355 Ga0495607_0018101 3300046501 Bacteria 4500
356 Ga0495607_0026887 3300046501 Bacteria 3565
357 Ga0495607_0027888 3300046501 Bacteria 3486
358 Ga0495607_0031518 3300046501 Bacteria 3245
359 Ga0495607_0032318 3300046501 Bacteria 3195
360 Ga0495607_0038462 3300046501 Bacteria 2866
361 Ga0495607_0054988 3300046501 Bacteria 2291
362 Ga0495607_0163812 3300046501 Bacteria 1127
363 Ga0495607_0195614 3300046501 Bacteria 1004
364 Ga0495607_0208002 3300046501 Bacteria 964
365 Ga0495607_0470319 3300046501 Bacteria 561
366 Ga0495583_0000064 3300046506 Bacteria 192380
367 Ga0495583_0000140 3300046506 Bacteria 123415
368 Ga0495583_0000270 3300046506 Bacteria 85327
369 Ga0495583_0000605 3300046506 Bacteria 48655
370 Ga0495583_0000687 3300046506 Bacteria 43738
371 Ga0495583_0001144 3300046506 Bacteria 28860
372 Ga0495583_0001801 3300046506 Bacteria 20273
373 Ga0495583_0012363 3300046506 Bacteria 4838
374 Ga0495583_0013322 3300046506 Bacteria 4591
375 Ga0495583_0018499 3300046506 Bacteria 3666
376 Ga0495583_0061890 3300046506 Bacteria 1668
377 Ga0495583_0072293 3300046506 Bacteria 1513
378 Ga0495583_0352694 3300046506 Bacteria 580
379 Ga0495606_0000095 3300046507 Bacteria 151634
380 Ga0495606_0000123 3300046507 Bacteria 131654
381 Ga0495606_0000403 3300046507 Bacteria 72945
382 Ga0495606_0000429 3300046507 Bacteria 69904
383 Ga0495606_0004586 3300046507 Bacteria 13705
384 Ga0495606_0005961 3300046507 Bacteria 11431
385 Ga0495606_0017286 3300046507 Bacteria 5461
386 Ga0495606_0038263 3300046507 Bacteria 3248
387 Ga0495606_0041854 3300046507 Bacteria 3069
388 Ga0495606_0100267 3300046507 Bacteria 1764
389 Ga0495606_0123029 3300046507 Bacteria 1550
390 Ga0495606_0350005 3300046507 Bacteria 784
391 Ga0495606_0369506 3300046507 Bacteria 755
392 Ga0495606_0440511 3300046507 Bacteria 669
393 Ga0495610_0000003 3300046512 Bacteria 1203910
394 Ga0495610_0003535 3300046512 Bacteria 12107
395 Ga0495610_0004916 3300046512 Bacteria 9701
396 Ga0495610_0004996 3300046512 Bacteria 9604
397 Ga0495610_0060656 3300046512 Bacteria 1800
398 Ga0495610_0075515 3300046512 Bacteria 1560
399 Ga0495610_0134684 3300046512 Bacteria 1069
400 Ga0495610_0337864 3300046512 Bacteria 570
401 Ga0495616_0000392 3300046513 Bacteria 34039
402 Ga0495616_0000711 3300046513 Bacteria 24661
403 Ga0495616_0008461 3300046513 Bacteria 6095
404 Ga0495616_0011627 3300046513 Bacteria 5035
405 Ga0495616_0013214 3300046513 Bacteria 4665
406 Ga0495616_0017502 3300046513 Bacteria 3953
407 Ga0495616_0020492 3300046513 Bacteria 3594
408 Ga0495616_0025080 3300046513 Bacteria 3189
409 Ga0495616_0034726 3300046513 Bacteria 2615
410 Ga0495616_0040754 3300046513 Bacteria 2371
411 Ga0495616_0078776 3300046513 Bacteria 1580
412 Ga0495616_0170165 3300046513 Bacteria 974
413 Ga0495616_0260881 3300046513 Bacteria 741
414 Ga0495620_0000974 3300046515 Bacteria 17631
415 Ga0495631_0001656 3300046518 Bacteria 13253
416 Ga0495631_0001993 3300046518 Bacteria 11933
417 Ga0495631_0005436 3300046518 Bacteria 6669
418 Ga0495631_0016183 3300046518 Bacteria 3561
419 Ga0495631_0016403 3300046518 Bacteria 3531
420 Ga0495631_0016425 3300046518 Bacteria 3528
421 Ga0495631_0029390 3300046518 Bacteria 2499
422 Ga0495631_0030361 3300046518 Bacteria 2452
423 Ga0495631_0041751 3300046518 Bacteria 2029
424 Ga0495631_0172827 3300046518 Bacteria 926
425 Ga0495631_0188696 3300046518 Bacteria 882
426 Ga0495631_0319542 3300046518 Bacteria 661
427 Ga0495631_0446050 3300046518 Bacteria 551
428 Ga0495632_0000387 3300046519 Bacteria 41981
429 Ga0495632_0001033 3300046519 Bacteria 24056
430 Ga0495632_0006426 3300046519 Bacteria 7559
431 Ga0495632_0033033 3300046519 Bacteria 2660
432 Ga0495632_0041293 3300046519 Bacteria 2318
433 Ga0495632_0070094 3300046519 Bacteria 1686
434 Ga0495632_0147267 3300046519 Bacteria 1090
435 Ga0495632_0295787 3300046519 Bacteria 719
436 Ga0495632_0321509 3300046519 Bacteria 683
437 Ga0495637_0000011 3300046520 Bacteria 337279
438 Ga0495637_0000581 3300046520 Bacteria 26014
439 Ga0495637_0009711 3300046520 Bacteria 4685
440 Ga0495637_0018292 3300046520 Bacteria 3252
441 Ga0495637_0022982 3300046520 Bacteria 2838
442 Ga0495637_0034402 3300046520 Bacteria 2219
443 Ga0495637_0236307 3300046520 Bacteria 661
444 Ga0495643_0002429 3300046522 Bacteria 14812
445 Ga0495643_0004008 3300046522 Bacteria 10519
446 Ga0495643_0006347 3300046522 Bacteria 7808
447 Ga0495643_0014915 3300046522 Bacteria 4608
448 Ga0495643_0034003 3300046522 Bacteria 2815
449 Ga0495643_0043916 3300046522 Bacteria 2429
450 Ga0495643_0050558 3300046522 Bacteria 2238
451 Ga0495643_0127710 3300046522 Bacteria 1279
452 Ga0495643_0129415 3300046522 Bacteria 1268
453 Ga0495643_0153846 3300046522 Bacteria 1137
454 Ga0495643_0264383 3300046522 Bacteria 797
455 Ga0495644_0001335 3300046523 Bacteria 10094
456 Ga0495644_0004450 3300046523 Bacteria 5506
457 Ga0495644_0004904 3300046523 Bacteria 5250
458 Ga0495644_0009794 3300046523 Bacteria 3690
459 Ga0495644_0016261 3300046523 Bacteria 2848
460 Ga0495644_0021350 3300046523 Bacteria 2470
461 Ga0495644_0021673 3300046523 Bacteria 2449
462 Ga0495644_0028623 3300046523 Bacteria 2108
463 Ga0495644_0030159 3300046523 Bacteria 2048
464 Ga0495644_0034553 3300046523 Bacteria 1908
465 Ga0495644_0059249 3300046523 Bacteria 1439
466 Ga0495644_0339694 3300046523 Bacteria 590
467 Ga0495648_0000040 3300046524 Bacteria 184782
468 Ga0495648_0000136 3300046524 Bacteria 87034
469 Ga0495648_0000707 3300046524 Bacteria 35622
470 Ga0495648_0001392 3300046524 Bacteria 23785
471 Ga0495648_0016806 3300046524 Bacteria 5259
472 Ga0495648_0017286 3300046524 Bacteria 5164
473 Ga0495648_0022737 3300046524 Bacteria 4308
474 Ga0495648_0022978 3300046524 Bacteria 4279
475 Ga0495648_0030256 3300046524 Bacteria 3582
476 Ga0495648_0034157 3300046524 Bacteria 3313
477 Ga0495648_0050099 3300046524 Bacteria 2555
478 Ga0495648_0108511 3300046524 Bacteria 1515
479 Ga0495648_0254603 3300046524 Bacteria 845
480 Ga0495663_0085426 3300046525 Bacteria 1022
481 Ga0495663_0304176 3300046525 Bacteria 574
482 Ga0495666_0004338 3300046526 Bacteria 7162
483 Ga0495666_0014892 3300046526 Bacteria 3871
484 Ga0495666_0043142 3300046526 Bacteria 2180
485 Ga0495666_0336726 3300046526 Bacteria 680
486 Ga0495642_0000395 3300046528 Bacteria 23454
487 Ga0495642_0001159 3300046528 Bacteria 12115
488 Ga0495642_0003270 3300046528 Bacteria 6410
489 Ga0495642_0007806 3300046528 Bacteria 4100
490 Ga0495642_0012490 3300046528 Bacteria 3274
491 Ga0495642_0016586 3300046528 Bacteria 2873
492 Ga0495642_0018972 3300046528 Bacteria 2693
493 Ga0495642_0022962 3300046528 Bacteria 2460
494 Ga0495642_0046124 3300046528 Bacteria 1782
495 Ga0495642_0074342 3300046528 Bacteria 1424
496 Ga0495642_0107304 3300046528 Bacteria 1192
497 Ga0495642_0238019 3300046528 Bacteria 795
498 Ga0495642_0271362 3300046528 Bacteria 742
499 Ga0495642_0464669 3300046528 Bacteria 559
500 Ga0495652_0002899 3300046529 Bacteria 17268
501 Ga0495654_0000015 3300046530 Bacteria 307873
502 Ga0495654_0006348 3300046530 Bacteria 6723
503 Ga0495654_0029135 3300046530 Bacteria 2817
504 Ga0495654_0058934 3300046530 Bacteria 1850
505 Ga0495654_0111191 3300046530 Bacteria 1250
506 Ga0495654_0176392 3300046530 Bacteria 928
507 Ga0495654_0319320 3300046530 Bacteria 630
508 Ga0495665_0003206 3300046531 Bacteria 8845
509 Ga0495665_0007299 3300046531 Bacteria 5968
510 Ga0495665_0036167 3300046531 Bacteria 2636
511 Ga0495586_0004319 3300046535 Bacteria 7592
512 Ga0495586_0301261 3300046535 Bacteria 918
513 Ga0495587_0085804 3300046536 Bacteria 1822
514 Ga0495598_0048301 3300046537 Bacteria 1272
515 Ga0495609_0000046 3300046538 Bacteria 158102
516 Ga0495609_0000617 3300046538 Bacteria 27691
517 Ga0495609_0001563 3300046538 Bacteria 14977
518 Ga0495609_0001850 3300046538 Bacteria 13518
519 Ga0495609_0002620 3300046538 Bacteria 10921
520 Ga0495609_0005449 3300046538 Bacteria 6675
521 Ga0495609_0015092 3300046538 Bacteria 3619
522 Ga0495609_0020069 3300046538 Bacteria 3089
523 Ga0495609_0023641 3300046538 Bacteria 2823
524 Ga0495609_0063835 3300046538 Bacteria 1625
525 Ga0495609_0085494 3300046538 Bacteria 1376
526 Ga0495609_0102903 3300046538 Bacteria 1236
527 Ga0495609_0112467 3300046538 Bacteria 1174
528 Ga0495609_0114556 3300046538 Bacteria 1162
529 Ga0495609_0193813 3300046538 Bacteria 851
530 Ga0495621_0273825 3300046539 Bacteria 694
531 Ga0495597_0000021 3300046542 Bacteria 157613
532 Ga0495597_0000819 3300046542 Bacteria 24504
533 Ga0495597_0001286 3300046542 Bacteria 18454
534 Ga0495597_0001309 3300046542 Bacteria 18263
535 Ga0495597_0002009 3300046542 Bacteria 13637
536 Ga0495597_0003998 3300046542 Bacteria 8284
537 Ga0495597_0013888 3300046542 Bacteria 3849
538 Ga0495597_0055331 3300046542 Bacteria 1740
539 Ga0495597_0065627 3300046542 Bacteria 1574
540 Ga0495597_0083111 3300046542 Bacteria 1367
541 Ga0495597_0152683 3300046542 Bacteria 946
542 Ga0495597_0197680 3300046542 Bacteria 806
543 Ga0495597_0266757 3300046542 Bacteria 669
544 Ga0495597_0311630 3300046542 Bacteria 609
545 Ga0495597_0363780 3300046542 Bacteria 554
546 Ga0495645_0174197 3300046543 Bacteria 1479
547 Ga0495622_0000001 3300046557 Bacteria 365248
548 Ga0495622_0000421 3300046557 Bacteria 27994
549 Ga0495622_0000661 3300046557 Bacteria 19493
550 Ga0495622_0022360 3300046557 Bacteria 2946
551 Ga0495622_0141736 3300046557 Bacteria 1091
552 Ga0495633_0000141 3300046558 Bacteria 95989
553 Ga0495633_0000639 3300046558 Bacteria 32745
554 Ga0495633_0002287 3300046558 Bacteria 13693
555 Ga0495633_0004185 3300046558 Bacteria 9259
556 Ga0495633_0005823 3300046558 Bacteria 7430
557 Ga0495633_0006401 3300046558 Bacteria 6985
558 Ga0495633_0006737 3300046558 Bacteria 6759
559 Ga0495633_0008716 3300046558 Bacteria 5685
560 Ga0495633_0012344 3300046558 Bacteria 4549
561 Ga0495633_0023320 3300046558 Bacteria 3067
562 Ga0495633_0028472 3300046558 Bacteria 2722
563 Ga0495633_0087072 3300046558 Bacteria 1452
564 Ga0495633_0131635 3300046558 Bacteria 1157
565 Ga0495633_0223688 3300046558 Bacteria 861
566 Ga0495656_0009364 3300046615 Bacteria 3520
567 Ga0495656_0013337 3300046615 Bacteria 3055
568 Ga0495656_0170282 3300046615 Bacteria 1064
569 Ga0495656_0190983 3300046615 Bacteria 1011
570 Ga0495668_0000285 3300046616 Bacteria 70023
571 Ga0495668_0000472 3300046616 Bacteria 50873
572 Ga0495668_0000596 3300046616 Bacteria 43960
573 Ga0495668_0000651 3300046616 Bacteria 41671
574 Ga0495668_0001314 3300046616 Bacteria 24454
575 Ga0495668_0003596 3300046616 Bacteria 11496
576 Ga0495668_0004016 3300046616 Bacteria 10709
577 Ga0495668_0011458 3300046616 Bacteria 5307
578 Ga0495668_0017549 3300046616 Bacteria 4148
579 Ga0495668_0026525 3300046616 Bacteria 3287
580 Ga0495668_0089534 3300046616 Bacteria 1686
581 Ga0495668_0107774 3300046616 Bacteria 1523
582 Ga0495668_0110775 3300046616 Bacteria 1501
583 Ga0495668_0159841 3300046616 Bacteria 1234
584 Ga0495611_0001075 3300046648 Bacteria 14440
585 Ga0495611_0001766 3300046648 Bacteria 10452
586 Ga0495611_0008656 3300046648 Bacteria 4306
587 Ga0495611_0010316 3300046648 Bacteria 3951
588 Ga0495611_0019090 3300046648 Bacteria 2944
589 Ga0495611_0046060 3300046648 Bacteria 1954
590 Ga0495611_0115713 3300046648 Bacteria 1249
591 Ga0495611_0119313 3300046648 Bacteria 1229
592 Ga0495611_0120079 3300046648 Bacteria 1225
593 Ga0495611_0150548 3300046648 Bacteria 1086
594 Ga0495611_0212158 3300046648 Bacteria 901
595 Ga0495611_0319443 3300046648 Bacteria 714
596 Ga0495625_0000244 3300046660 Bacteria 85455
597 Ga0495625_0000695 3300046660 Bacteria 47797
598 Ga0495625_0002152 3300046660 Bacteria 21908
599 Ga0495625_0004881 3300046660 Bacteria 12496
600 Ga0495625_0007287 3300046660 Bacteria 9667
601 Ga0495625_0014939 3300046660 Bacteria 6172
602 Ga0495625_0047869 3300046660 Bacteria 3082
603 Ga0495625_0104628 3300046660 Bacteria 1940
604 Ga0495625_0211298 3300046660 Bacteria 1275
605 Ga0495625_0260630 3300046660 Bacteria 1122
606 Ga0495625_0277856 3300046660 Bacteria 1078
607 Ga0495635_0007424 3300046663 Bacteria 7651
608 Ga0495659_0000028 3300046664 Bacteria 67734
609 Ga0495659_0000183 3300046664 Bacteria 27260
610 Ga0495659_0001588 3300046664 Bacteria 7644
611 Ga0495659_0215627 3300046664 Bacteria 791
612 Ga0495659_0217144 3300046664 Bacteria 789
613 Ga0495659_0314093 3300046664 Bacteria 664
614 Ga0495659_0342705 3300046664 Bacteria 637
615 Ga0495661_0001135 3300046665 Bacteria 23294
616 Ga0495661_0003691 3300046665 Bacteria 11244
617 Ga0495661_0004820 3300046665 Bacteria 9670
618 Ga0495661_0008435 3300046665 Bacteria 7125
619 Ga0495661_0016282 3300046665 Bacteria 4931
620 Ga0495661_0017964 3300046665 Bacteria 4660
621 Ga0495661_0021691 3300046665 Bacteria 4183
622 Ga0495661_0025799 3300046665 Bacteria 3791
623 Ga0495661_0034408 3300046665 Bacteria 3188
624 Ga0495661_0043278 3300046665 Bacteria 2769
625 Ga0495661_0054485 3300046665 Bacteria 2401
626 Ga0495661_0080194 3300046665 Bacteria 1884
627 Ga0495661_0086010 3300046665 Bacteria 1800
628 Ga0495661_0101377 3300046665 Bacteria 1619
629 Ga0495661_0107292 3300046665 Bacteria 1561
630 Ga0495661_0135993 3300046665 Bacteria 1341
631 Ga0495661_0138947 3300046665 Bacteria 1323
632 Ga0495661_0153589 3300046665 Bacteria 1241
633 Ga0495661_0255029 3300046665 Bacteria 893
634 Ga0495661_0362361 3300046665 Bacteria 711
635 Ga0495661_0439221 3300046665 Bacteria 629
636 Ga0495661_0451565 3300046665 Bacteria 618
637 Ga0495661_0557978 3300046665 Bacteria 541
638 Ga0495661_0626153 3300046665 Bacteria 504
639 Ga0495588_0014765 3300046674 Bacteria 3745
640 Ga0495588_0024373 3300046674 Bacteria 3005
641 Ga0495588_0128694 3300046674 Bacteria 1335
642 Ga0495599_0290834 3300046678 Bacteria 988
643 Ga0495623_0002282 3300046679 Bacteria 12779
644 Ga0495623_0094275 3300046679 Bacteria 1831
645 Ga0495669_0000048 3300046684 Bacteria 81519
646 Ga0495669_0001152 3300046684 Bacteria 10975
647 Ga0495669_0001222 3300046684 Bacteria 10684
648 Ga0495669_0016557 3300046684 Bacteria 3158
649 Ga0495669_0082545 3300046684 Bacteria 1476
650 Ga0495669_0223048 3300046684 Bacteria 903
651 Ga0495669_0256902 3300046684 Bacteria 839
652 Ga0495669_0378036 3300046684 Bacteria 685
653 Ga0495613_0094503 3300046689 Bacteria 2163
654 Ga0495624_0001671 3300046690 Bacteria 16996
655 Ga0495670_0000736 3300046691 Bacteria 15648
656 Ga0495670_0001547 3300046691 Bacteria 11256
657 Ga0495670_0006989 3300046691 Bacteria 5563
658 Ga0495670_0012722 3300046691 Bacteria 4139
659 Ga0495670_0015268 3300046691 Bacteria 3775
660 Ga0495670_0018130 3300046691 Bacteria 3466
661 Ga0495670_0019423 3300046691 Bacteria 3348
662 Ga0495670_0024573 3300046691 Bacteria 2978
663 Ga0495670_0026192 3300046691 Bacteria 2886
664 Ga0495670_0145254 3300046691 Bacteria 1242
665 Ga0495670_0205652 3300046691 Bacteria 1043
666 Ga0495670_0464991 3300046691 Bacteria 686
667 Ga0495670_0639904 3300046691 Bacteria 579
668 Ga0495671_0000099 3300046692 Bacteria 79624
669 Ga0495671_0000270 3300046692 Bacteria 43565
670 Ga0495671_0001112 3300046692 Bacteria 18576
671 Ga0495671_0005811 3300046692 Bacteria 7187
672 Ga0495671_0020787 3300046692 Bacteria 3454
673 Ga0495671_0036200 3300046692 Bacteria 2501
674 Ga0495671_0124242 3300046692 Bacteria 1258
675 Ga0495671_0126228 3300046692 Bacteria 1247
676 Ga0495671_0352817 3300046692 Bacteria 705
677 Ga0495649_0000558 3300046694 Bacteria 31491
678 Ga0495649_0002468 3300046694 Bacteria 12994
679 Ga0495649_0004199 3300046694 Bacteria 9456
680 Ga0495649_0012038 3300046694 Bacteria 5049
681 Ga0495649_0035455 3300046694 Bacteria 2744
682 Ga0495649_0044347 3300046694 Bacteria 2428
683 Ga0495649_0069096 3300046694 Bacteria 1895
684 Ga0495649_0090096 3300046694 Bacteria 1635
685 Ga0495649_0122044 3300046694 Bacteria 1377
686 Ga0495649_0212414 3300046694 Bacteria 1002
687 Ga0495649_0215718 3300046694 Bacteria 993
688 Ga0495649_0385240 3300046694 Bacteria 705
689 Ga0495649_0570703 3300046694 Bacteria 559
690 Ga0495589_0000039 3300046794 Bacteria 148833
691 Ga0495589_0000418 3300046794 Bacteria 31752
692 Ga0495589_0002965 3300046794 Bacteria 9349
693 Ga0495589_0005254 3300046794 Bacteria 6844
694 Ga0495589_0006468 3300046794 Bacteria 6177
695 Ga0495589_0006847 3300046794 Bacteria 5993
696 Ga0495589_0033442 3300046794 Bacteria 2582
697 Ga0495589_0036954 3300046794 Bacteria 2447
698 Ga0495589_0055939 3300046794 Bacteria 1943
699 Ga0495589_0077590 3300046794 Bacteria 1618
700 Ga0495589_0207146 3300046794 Bacteria 924
701 Ga0495589_0208064 3300046794 Bacteria 921
702 Ga0495589_0255812 3300046794 Bacteria 817
703 Ga0495660_0000027 3300046810 Bacteria 254331
704 Ga0495660_0000260 3300046810 Bacteria 50150
705 Ga0495660_0000574 3300046810 Bacteria 29507
706 Ga0495660_0001373 3300046810 Bacteria 16759
707 Ga0495660_0002464 3300046810 Bacteria 11810
708 Ga0495660_0008409 3300046810 Bacteria 6040
709 Ga0495660_0018554 3300046810 Bacteria 4000
710 Ga0495660_0021752 3300046810 Bacteria 3668
711 Ga0495660_0027394 3300046810 Bacteria 3224
712 Ga0495660_0030496 3300046810 Bacteria 3037
713 Ga0495660_0043199 3300046810 Bacteria 2487
714 Ga0495660_0044277 3300046810 Bacteria 2449
715 Ga0495660_0053610 3300046810 Bacteria 2188
716 Ga0495660_0082349 3300046810 Bacteria 1685
717 Ga0495660_0102940 3300046810 Bacteria 1467
718 Ga0495660_0155338 3300046810 Bacteria 1126
719 Ga0495660_0160207 3300046810 Bacteria 1104
720 Ga0495660_0230772 3300046810 Bacteria 867
721 Ga0495660_0286179 3300046810 Bacteria 752
722 Ga0495581_0003071 3300047315 Bacteria 9552
723 Ga0495581_0003834 3300047315 Bacteria 8646
724 Ga0495604_0001078 3300047317 Bacteria 22621
725 Ga0495604_0151057 3300047317 Bacteria 1650
726 Ga0495636_0000400 3300047318 Bacteria 16239
727 Ga0495636_0001186 3300047318 Bacteria 9827
728 Ga0495636_0009795 3300047318 Bacteria 3773
729 Ga0495636_0111446 3300047318 Bacteria 1204
730 Ga0495636_0186990 3300047318 Bacteria 942
731 Ga0495636_0322459 3300047318 Bacteria 725
732 Ga0495674_0001246 3300047319 Bacteria 24703
733 Ga0495672_0000121 3300047320 Bacteria 121680
734 Ga0495672_0000336 3300047320 Bacteria 61206
735 Ga0495672_0000388 3300047320 Bacteria 54085
736 Ga0495672_0000675 3300047320 Bacteria 37966
737 Ga0495672_0013264 3300047320 Bacteria 5692
738 Ga0495672_0024108 3300047320 Bacteria 3926
739 Ga0495672_0024597 3300047320 Bacteria 3875
740 Ga0495672_0035765 3300047320 Bacteria 3056
741 Ga0495672_0110378 3300047320 Bacteria 1477
742 Ga0495676_0000093 3300047321 Bacteria 66312
743 Ga0495676_0034917 3300047321 Bacteria 4213
744 Ga0495676_0054610 3300047321 Bacteria 3174
745 Ga0495676_0123963 3300047321 Bacteria 1875
746 Ga0495680_0012068 3300047322 Bacteria 7623
747 Ga0495683_0000484 3300047323 Bacteria 30878
748 Ga0495683_0001424 3300047323 Bacteria 15759
749 Ga0495683_0008047 3300047323 Bacteria 5659
750 Ga0495683_0010091 3300047323 Bacteria 5005
751 Ga0495683_0011743 3300047323 Bacteria 4606
752 Ga0495683_0020316 3300047323 Bacteria 3426
753 Ga0495683_0028412 3300047323 Bacteria 2859
754 Ga0495683_0037145 3300047323 Bacteria 2470
755 Ga0495683_0037181 3300047323 Bacteria 2469
756 Ga0495683_0073421 3300047323 Bacteria 1677
757 Ga0495683_0096505 3300047323 Bacteria 1426
758 Ga0495683_0192256 3300047323 Bacteria 925
759 Ga0495683_0303921 3300047323 Bacteria 684
760 Ga0495687_000008 3300047443 Bacteria 546666
761 Ga0495687_000096 3300047443 Bacteria 133560
762 Ga0495687_000124 3300047443 Bacteria 118111
763 Ga0495687_000753 3300047443 Bacteria 35041
764 Ga0495687_002774 3300047443 Bacteria 13566
765 Ga0495687_007095 3300047443 Bacteria 6684
766 Ga0495675_0104496 3300047444 Bacteria 1770
767 Ga0495677_0000008 3300047445 Bacteria 175183
768 Ga0495677_0000633 3300047445 Bacteria 14178
769 Ga0495677_0000688 3300047445 Bacteria 13689
770 Ga0495677_0000919 3300047445 Bacteria 11866
771 Ga0495677_0001085 3300047445 Bacteria 10912
772 Ga0495677_0003891 3300047445 Bacteria 5773
773 Ga0495677_0006829 3300047445 Bacteria 4293
774 Ga0495677_0015765 3300047445 Bacteria 2743
775 Ga0495677_0020301 3300047445 Bacteria 2408
776 Ga0495677_0024619 3300047445 Bacteria 2183
777 Ga0495677_0025813 3300047445 Bacteria 2131
778 Ga0495677_0028616 3300047445 Bacteria 2024
779 Ga0495677_0037914 3300047445 Bacteria 1761
780 Ga0495677_0087242 3300047445 Bacteria 1173
781 Ga0495677_0120505 3300047445 Bacteria 1000
782 Ga0495677_0259607 3300047445 Bacteria 680
783 Ga0495679_000898 3300047446 Bacteria 18688
784 Ga0495679_002023 3300047446 Bacteria 10721
785 Ga0495679_002455 3300047446 Bacteria 9444
786 Ga0495679_058142 3300047446 Bacteria 1141
787 Ga0495685_000177 3300047447 Bacteria 21593
788 Ga0495685_001435 3300047447 Bacteria 7288
789 Ga0495685_002937 3300047447 Bacteria 5391
790 Ga0495685_033230 3300047447 Bacteria 1772
791 Ga0495685_050834 3300047447 Bacteria 1406
792 Ga0495685_080942 3300047447 Bacteria 1081
793 Ga0495673_0000003 3300047469 Bacteria 1491337
794 Ga0495673_0000016 3300047469 Bacteria 580643
795 Ga0495673_0000285 3300047469 Bacteria 68361
796 Ga0495673_0008260 3300047469 Bacteria 5873
797 Ga0495673_0029063 3300047469 Bacteria 2612
798 Ga0495681_0002310 3300047470 Bacteria 13715
799 Ga0495681_0005731 3300047470 Bacteria 8263
800 Ga0495681_0009265 3300047470 Bacteria 6086
801 Ga0495681_0011291 3300047470 Bacteria 5329
802 Ga0495681_0012847 3300047470 Bacteria 4897
803 Ga0495681_0019625 3300047470 Bacteria 3684
804 Ga0495681_0021201 3300047470 Bacteria 3505
805 Ga0495681_0024042 3300047470 Bacteria 3220
806 Ga0495681_0065511 3300047470 Bacteria 1661
807 Ga0495681_0100318 3300047470 Bacteria 1266
808 Ga0495686_0001154 3300047472 Bacteria 31042
809 Ga0495686_0002916 3300047472 Bacteria 15343
810 Ga0495686_0005142 3300047472 Bacteria 10438
811 Ga0495686_0009323 3300047472 Bacteria 7083
812 Ga0495686_0017355 3300047472 Bacteria 4853
813 Ga0495686_0176337 3300047472 Bacteria 1241
814 Ga0495686_0320240 3300047472 Bacteria 850
815 Ga0495593_0001349 3300047673 Bacteria 14350
816 Ga0495593_0106385 3300047673 Bacteria 1435
817 Ga0495602_0251233 3300048088 Bacteria 1318
818 Ga0495614_0005342 3300048089 Bacteria 5796
819 Ga0495614_0006127 3300048089 Bacteria 5405
820 Ga0495614_0630153 3300048089 Bacteria 516
821 Ga0495626_0000050 3300048091 Bacteria 160905
822 Ga0495626_0000575 3300048091 Bacteria 36385
823 Ga0495626_0001659 3300048091 Bacteria 17185
824 Ga0495626_0005191 3300048091 Bacteria 7714
825 Ga0495626_0016757 3300048091 Bacteria 3715
826 Ga0495626_0017185 3300048091 Bacteria 3659
827 Ga0495626_0020392 3300048091 Bacteria 3304
828 Ga0495626_0027308 3300048091 Bacteria 2776
829 Ga0495626_0033570 3300048091 Bacteria 2458
830 Ga0495626_0079093 3300048091 Bacteria 1463
831 Ga0495626_0082294 3300048091 Bacteria 1428
832 Ga0495626_0118319 3300048091 Bacteria 1141
833 Ga0495626_0180729 3300048091 Bacteria 874
834 Ga0495626_0305188 3300048091 Bacteria 628
835 Ga0495626_0313029 3300048091 Bacteria 618
836 Ga0495626_0339667 3300048091 Bacteria 587
837 Ga0496100_0023945 3300048903 Bacteria 3716
838 Ga0496100_0330098 3300048903 Bacteria 1148
839 Ga0496101_0014189 3300048904 Bacteria 5351
840 Ga0496101_0807648 3300048904 Bacteria 740
841 Ga0496102_0000334 3300048905 Bacteria 57709
842 Ga0496102_0016206 3300048905 Bacteria 6512
843 Ga0496102_0121833 3300048905 Bacteria 2436
844 Ga0496102_0336385 3300048905 Bacteria 1422
845 Ga0496102_0484767 3300048905 Bacteria 1158
846 Ga0496102_1348028 3300048905 Bacteria 632
847 Ga0496103_0001170 3300048906 Bacteria 18045
848 Ga0496103_0039836 3300048906 Bacteria 2887
849 Ga0496103_0040201 3300048906 Bacteria 2874
850 Ga0496103_0673490 3300048906 Bacteria 656
851 Ga0496104_0309371 3300048907 Bacteria 1493
852 Ga0496105_0381933 3300048908 Bacteria 1121
853 Ga0496105_0609941 3300048908 Bacteria 846
854 Ga0496106_0034139 3300048909 Bacteria 3799
855 Ga0496106_0787213 3300048909 Bacteria 755
856 Ga0496108_0077895 3300048911 Bacteria 2805
857 Ga0496109_0071973 3300048912 Bacteria 3175
858 Ga0496109_0153057 3300048912 Bacteria 2160
859 Ga0496109_1960030 3300048912 Bacteria 518
860 Ga0496110_0000110 3300048913 Bacteria 44789
861 Ga0496110_0034492 3300048913 Bacteria 4383
862 Ga0496111_0100508 3300048914 Bacteria 2124
863 Ga0496111_0263655 3300048914 Bacteria 1278
864 Ga0496111_0758781 3300048914 Bacteria 703
865 Ga0496111_0813934 3300048914 Bacteria 675
866 Ga0496112_0415881 3300048915 Bacteria 1284
867 Ga0496113_0031384 3300048916 Bacteria 3856
868 Ga0496113_0053185 3300048916 Bacteria 3027
869 Ga0496114_0134467 3300048917 Bacteria 2137
870 Ga0496114_0158615 3300048917 Bacteria 1966
871 Ga0496115_0021770 3300048918 Bacteria 4956
872 Ga0496115_0129716 3300048918 Bacteria 2078
873 Ga0496116_0017351 3300048919 Bacteria 5589
874 Ga0496116_0092855 3300048919 Bacteria 1829
875 Ga0496116_0094828 3300048919 Bacteria 1803
876 Ga0496117_0000094 3300048920 Bacteria 201853
877 Ga0496118_0000071 3300048921 Bacteria 201853
878 Ga0496118_0173106 3300048921 Bacteria 1316
879 Ga0496121_0060866 3300048924 Bacteria 3102
880 Ga0496121_0089241 3300048924 Bacteria 2414
881 Ga0496121_0319625 3300048924 Bacteria 1046
882 Ga0496121_0576761 3300048924 Bacteria 699
883 Ga0496122_0000535 3300048925 Bacteria 78641
884 Ga0496122_0004965 3300048925 Bacteria 16116
885 Ga0496122_0123290 3300048925 Bacteria 1665
886 Ga0496122_0440093 3300048925 Bacteria 650
887 Ga0496123_0000778 3300048926 Bacteria 51674
888 Ga0496123_0001755 3300048926 Bacteria 28623
889 Ga0496123_0003467 3300048926 Bacteria 17624
890 Ga0496124_0002043 3300048927 Bacteria 27439
891 Ga0496124_0222499 3300048927 Bacteria 1418
892 Ga0496124_0245251 3300048927 Bacteria 1329
893 Ga0496124_0327700 3300048927 Bacteria 1093
894 Ga0496124_0380352 3300048927 Bacteria 987
895 Ga0496124_0425566 3300048927 Bacteria 913
896 Ga0496124_0579355 3300048927 Bacteria 734
897 Ga0496125_0000530 3300048928 Bacteria 65734
898 Ga0496125_0119737 3300048928 Bacteria 1881
899 Ga0496125_0185095 3300048928 Bacteria 1382
900 Ga0496125_0206159 3300048928 Bacteria 1282
901 Ga0496126_0012091 3300048929 Bacteria 8864
902 Ga0496126_0700544 3300048929 Bacteria 787
903 Ga0496126_1086498 3300048929 Bacteria 595
904 Ga0501308_000414 3300049128 Bacteria 2745
905 Ga0501309_006901 3300049129 Bacteria 1395
906 Ga0501304_001124 3300049160 Bacteria 1644
907 Ga0495678_000030 3300049459 Bacteria 217986
908 Ga0495678_000251 3300049459 Bacteria 60106
909 Ga0495678_000331 3300049459 Bacteria 49785
910 Ga0495678_000772 3300049459 Bacteria 28907
911 Ga0495678_001595 3300049459 Bacteria 17367
912 Ga0495678_002283 3300049459 Bacteria 13306
913 Ga0495678_005567 3300049459 Bacteria 6901
914 Ga0495678_015323 3300049459 Bacteria 3532
915 Ga0495678_026461 3300049459 Bacteria 2477
916 Ga0495678_058109 3300049459 Bacteria 1462
917 Ga0495682_0000710 3300049460 Bacteria 21826
918 Ga0495682_0008294 3300049460 Bacteria 4101
919 Ga0495682_0008685 3300049460 Bacteria 4000
920 Ga0495682_0072617 3300049460 Bacteria 1238
921 Ga0495682_0074111 3300049460 Bacteria 1224
922 Ga0495682_0076547 3300049460 Bacteria 1203
923 Ga0495682_0114290 3300049460 Bacteria 967
924 Ga0501315_009404 3300049531 Bacteria 1155
925 Ga0501320_027759 3300049536 Bacteria 690
926 Ga0501222_006655 3300049662 Bacteria 1551
927 Ga0501222_007904 3300049662 Bacteria 1416
928 Ga0501227_005093 3300049665 Bacteria 2820
929 Ga0501269_000362 3300049766 Bacteria 11337
930 Ga0501279_000707 3300049775 Bacteria 4362
931 nmdc:mga03683_12818_c1 3300050489 Bacteria 3070
932 nmdc:mga03n38_35017_c1 3300050490 Bacteria 2148
933 nmdc:mga07m45_480270_c1 3300050496 Bacteria 720
934 Ga0500644_0003045 3300053088 Bacteria 4154
935 Ga0500651_0052534 3300053093 Bacteria 2556
936 Ga0500594_0010801 3300053118 Bacteria 2124
937 Ga0500618_000179 3300053125 Bacteria 52538
938 Ga0500652_125043 3300053131 Bacteria 1074
939 Ga0500655_034083 3300053133 Bacteria 987
940 Ga0500559_0000021 3300053136 Bacteria 129980
941 Ga0500559_0249842 3300053136 Bacteria 836
942 Ga0500573_0331486 3300053140 Bacteria 747
943 Ga0500586_000754 3300053145 Bacteria 6637
944 Ga0500588_0167416 3300053146 Bacteria 803
945 Ga0500622_0001819 3300053156 Bacteria 16208
946 Ga0500622_0002314 3300053156 Bacteria 13932
947 Ga0500636_0156638 3300053177 Bacteria 1246
948 Ga0500636_0196716 3300053177 Bacteria 1070
949 Ga0500645_017561 3300053730 Bacteria 2241
950 Ga0500587_023583 3300053739 Bacteria 813
951 Ga0466962_0033635 3300061719 Bacteria 2453
952 2601669725 2600255292 Bacteria 6300551
953 2643790638 2643221554 Bacteria 6603920
954 2643796667 2643221556 Bacteria 7251154
955 2644211582 2643221638 Bacteria 6579467
956 2644253364 2643221645 Bacteria 7207331
957 2644355589 2643221664 Bacteria 7272945
958 2644470228 2643221684 Bacteria 7145183
959 2738737291 2738541280 Bacteria 6630198
960 2738830061 2738541297 Bacteria 6549566
961 2738841511 2738541300 Bacteria 6675882
962 2739153857 2738541357 Bacteria 6549408
963 2739195777 2738543003 Bacteria 6549560
964 2739272381 2738543018 Bacteria 6718814
965 2739322253 2738543026 Bacteria 6549408
966 2739340494 2738543029 Bacteria 6549249
967 2739341425 2738543030 Bacteria 6719714
968 2821131999 2821131069 Bacteria 6108407
969 2842712758 2842711865 Bacteria 7155354
970 2843694053 2843690924 Bacteria 5169057
971 2857551207 2857547612 Bacteria 6179999
972 2857557740 2857553236 Bacteria 6166726
973 2857564003 2857558681 Bacteria 6617694
974 2857568546 2857564685 Bacteria 6290584
975 2885085262 2885080285 Bacteria 6355622
976 2904425537 2904424332 Bacteria 7633521
977 2919480271 2919476304 Bacteria 5888696
978 2932413212 2932410948 Bacteria 6312192
979 2932417273 2932416698 Bacteria 6315112
980 8047677071 8047673197 Bacteria 7395230
981 Ga0495672_0000021
982 JGI25154J39366_1001359
983 JGI25158J39367_1011773
984 JGI25152J39213_1000181
985 JGI25152J39213_1000260
986 JGI25150J39212_1001789
987 JGI25150J39212_1002819
988 JGI25150J39212_1006203
989 JGI25159J45721_1002010
990 JGI25159J45721_1007010
991 JGI25159J45721_1008112
992 JGI25153J46596_10003686
993 rootH1_10207818
994 JGI25160J50197_1003973
995 JGI25161J50226_1001335
996 JGI25161J50226_1001642
997 JGI25161J50226_1012929
998 Ga0055525_1000006
999 Ga0055542_1009431
1000 Ga0055526_1000894
1001 Ga0055526_1000936
1002 Ga0055526_1001845
1003 Ga0055526_1001937
1004 Ga0055537_1000030
1005 Ga0055537_1013220
1006 Ga0055537_1020355
1007 Ga0055537_1030202
1008 Ga0055524_1000003
1009 Ga0055524_1000578
1010 Ga0055524_1002401
1011 Ga0055524_1007783
1012 Ga0055524_1013986
1013 Ga0055534_1000203
1014 Ga0055534_1002029
1015 Ga0055534_1010837
1016 Ga0055528_1000036
1017 Ga0055528_1009284
1018 Ga0055530_10016096
1019 Ga0055531_10002157
1020 Ga0055531_10016748
1021 Ga0055543_1000823
1022 Ga0055543_1002510
1023 Ga0065165_1000353
1024 Ga0065165_1000666
1025 Ga0065165_1024860
1026 Ga0065165_1039588
1027 Ga0065714_10068709
1028 Ga0070658_10085030
1029 Ga0070658_11864930
1030 Ga0070683_100743401
1031 Ga0068869_100882320
1032 Ga0070661_101529920
1033 Ga0070659_100071453
1034 Ga0070667_102080444
1035 Ga0070663_100927244
1036 Ga0068867_100379495
1037 Ga0068867_101545746
1038 Ga0070679_102059700
1039 Ga0070684_100346551
1040 Ga0070686_100440715
1041 Ga0068855_100078109
1042 Ga0070664_100115055
1043 Ga0070664_100506231
1044 Ga0070664_101607534
1045 Ga0068863_101157369
1046 Ga0070717_10667500
1047 Ga0075363_100176283
1048 Ga0075362_10018521
1049 Ga0097621_100228788
1050 Ga0075370_10160872
1051 Ga0068871_100118269
1052 Ga0068865_100269102
1053 Ga0068865_100623494
1054 Ga0068865_101686523
1055 Ga0079104_1019974
1056 Ga0099826_10000002
1057 Ga0105244_10052471
1058 Ga0105240_10576713
1059 Ga0105245_10064563
1060 Ga0105242_11849732
1061 Ga0105248_11515680
1062 Ga0105237_10151307
1063 Ga0105238_10144198
1064 Ga0105246_10634171
1065 Ga0157373_10316352
1066 Ga0163162_10200776
1067 Ga0157372_10993665
1068 Ga0157375_12861270
1069 Ga0182008_10000994
1070 Ga0157379_11022795
1071 Ga0182006_1000175
1072 Ga0182006_1318238
1073 Ga0182007_10000109
1074 Ga0182005_1000094
1075 Ga0163161_10065498
1076 Ga0163161_10073799
1077 Ga0213872_10003554
1078 Ga0213872_10017735
1079 Ga0213872_10220817
1080 Ga0209436_100579
1081 Ga0209436_119484
1082 Ga0209563_100022
1083 Ga0207425_1000001
1084 Ga0207425_1000039
1085 Ga0207425_1000262
1086 Ga0209646_1000051
1087 Ga0209677_105381
1088 Ga0209148_1000638
1089 Ga0209129_1000001
1090 Ga0209129_1005755
1091 Ga0209565_1000017
1092 Ga0209565_1000561
1093 Ga0209565_1002115
1094 Ga0209565_1005879
1095 Ga0209565_1007034
1096 Ga0209565_1033327
1097 Ga0209673_1000007
1098 Ga0209673_1009510
1099 Ga0209130_1000078
1100 Ga0209130_1002318
1101 Ga0209130_1002816
1102 Ga0209675_1000009
1103 Ga0209675_1000243
1104 Ga0209675_1001406
1105 Ga0209675_1001675
1106 Ga0209564_1000011
1107 Ga0209564_1000036
1108 Ga0209564_1000055
1109 Ga0209564_1000089
1110 Ga0209564_1000109
1111 Ga0209564_1001236
1112 Ga0209564_1013242
1113 Ga0209564_1021516
1114 Ga0209758_1000020
1115 Ga0209758_1000625
1116 Ga0209050_1000074
1117 Ga0209050_1000116
1118 Ga0209256_1000007
1119 Ga0209256_1000028
1120 Ga0209256_1000433
1121 Ga0209256_1000928
1122 Ga0209256_1001688
1123 Ga0207426_1004301
1124 Ga0207426_1108527
1125 Ga0209051_1008888
1126 Ga0209051_1012422
1127 Ga0209257_1000003
1128 Ga0209257_1072196
1129 Ga0207655_1048839
1130 Ga0207705_10001211
1131 Ga0207657_10091868
1132 Ga0207649_10103172
1133 Ga0207649_10927827
1134 Ga0207652_11760159
1135 Ga0207694_10245893
1136 Ga0207659_10797199
1137 Ga0207687_10231169
1138 Ga0207690_10096501
1139 Ga0207706_10032815
1140 Ga0207706_11308951
1141 Ga0207704_10005885
1142 Ga0207691_10178398
1143 Ga0207679_10103986
1144 Ga0207679_10135159
1145 Ga0207679_11168405
1146 Ga0207679_11181423
1147 Ga0207667_10063869
1148 Ga0207640_10168908
1149 Ga0207678_10137650
1150 Ga0207641_10807558
1151 Ga0207674_10150622
1152 Ga0207674_11470526
1153 Ga0207683_10425066
1154 Ga0207698_10894195
1155 Ga0209282_1000001
1156 Ga0307515_10406681
1157 Ga0316181_1084405
1158 Ga0307513_10828997
1159 Ga0307513_10886771
1160 Ga0307408_100000157
1161 Ga0307408_100011844
1162 Ga0307408_100016288
1163 Ga0307408_100187879
1164 Ga0307408_100288467
1165 Ga0307408_100644620
1166 Ga0307514_10000369
1167 Ga0307518_10463597
1168 Ga0307416_100005844
1169 Ga0307414_10021442
1170 Ga0307510_10093394
1171 Ga0395899_0033400
1172 Ga0395899_0066327
1173 Ga0395899_0118719
1174 Ga0395899_0869929
1175 Ga0395900_0030284
1176 Ga0395900_0159986
1177 Ga0395900_0220330
1178 Ga0395898_0339284
1179 Ga0395905_0075323
1180 Ga0395905_0091005
1181 Ga0395905_0947985
1182 Ga0395901_0116842
1183 Ga0395901_0698200
1184 Ga0395901_1896944
1185 Ga0436361_0032036
1186 Ga0436361_0273087
1187 Ga0436361_0275544
1188 Ga0436361_0287651
1189 Ga0436361_0709397
1190 Ga0436361_0823985
1191 Ga0439448_0060512
1192 Ga0439455_0124203
1193 Ga0450911_006248
1194 Ga0439459_0162881
1195 Ga0466969_0490104
1196 Ga0466972_0016675
1197 Ga0466972_0230066
1198 Ga0466972_0376676
1199 Ga0466965_0028964
1200 Ga0466965_0034769
1201 Ga0466965_0529428
1202 Ga0466964_0000497
1203 Ga0466968_0000664
1204 Ga0466970_0625665
1205 Ga0466970_0631329
1206 Ga0466970_0938391
1207 Ga0466957_0082293
1208 Ga0466960_0590460
1209 Ga0466960_0686386
1210 Ga0466959_0002327
1211 Ga0466959_0158386
1212 Ga0466959_0608817
1213 Ga0466958_0823068
1214 Ga0466958_0888401
1215 Ga0466967_0073467
1216 Ga0466967_0535014
1217 Ga0495617_000003
1218 Ga0495617_000656
1219 Ga0495617_018444
1220 Ga0495617_037466
1221 Ga0495617_087874
1222 Ga0495627_000057
1223 Ga0495627_000320
1224 Ga0495627_010065
1225 Ga0495627_010159
1226 Ga0495603_0041818
1227 Ga0495603_0046252
1228 Ga0495590_0000045
1229 Ga0495590_0000604
1230 Ga0495590_0003106
1231 Ga0495590_0011629
1232 Ga0495590_0033328
1233 Ga0495590_0091971
1234 Ga0495591_000153
1235 Ga0495591_111434
1236 Ga0495629_0010302
1237 Ga0495629_0028042
1238 Ga0495638_0000017
1239 Ga0495638_0002577
1240 Ga0495638_0002667
1241 Ga0495638_0024438
1242 Ga0495638_0041700
1243 Ga0495638_0094365
1244 Ga0495638_0296650
1245 Ga0495638_0447567
1246 Ga0495653_0000024
1247 Ga0495653_0010927
1248 Ga0495653_0088081
1249 Ga0495650_0000019
1250 Ga0495650_0000329
1251 Ga0495650_0000425
1252 Ga0495650_0000627
1253 Ga0495650_0000952
1254 Ga0495650_0004013
1255 Ga0495650_0009662
1256 Ga0495650_0013766
1257 Ga0495650_0071409
1258 Ga0495650_0100529
1259 Ga0495580_0161772
1260 Ga0495582_0015581
1261 Ga0495582_0122065
1262 Ga0495605_0000021
1263 Ga0495605_0000028
1264 Ga0495605_0003267
1265 Ga0495605_0007678
1266 Ga0495605_0011870
1267 Ga0495605_0023899
1268 Ga0495605_0026641
1269 Ga0495605_0042945
1270 Ga0495605_0074037
1271 Ga0495605_0156450
1272 Ga0495605_0226005
1273 Ga0495605_0255203
1274 Ga0495639_0238240
1275 Ga0495584_0000511
1276 Ga0495584_0001371
1277 Ga0495584_0004831
1278 Ga0495584_0005263
1279 Ga0495584_0005286
1280 Ga0495584_0005552
1281 Ga0495584_0008115
1282 Ga0495584_0009179
1283 Ga0495584_0010440
1284 Ga0495584_0012904
1285 Ga0495584_0039266
1286 Ga0495584_0039889
1287 Ga0495584_0068882
1288 Ga0495584_0171816
1289 Ga0495584_0198462
1290 Ga0495585_0000055
1291 Ga0495585_0000278
1292 Ga0495585_0000382
1293 Ga0495585_0003375
1294 Ga0495585_0004719
1295 Ga0495585_0012402
1296 Ga0495585_0012556
1297 Ga0495585_0012728
1298 Ga0495585_0014339
1299 Ga0495585_0020721
1300 Ga0495585_0022806
1301 Ga0495585_0027287
1302 Ga0495585_0034371
1303 Ga0495585_0035322
1304 Ga0495585_0121340
1305 Ga0495585_0121671
1306 Ga0495585_0168764
1307 Ga0495585_0312304
1308 Ga0495585_0594585
1309 Ga0495594_0002666
1310 Ga0495594_0004551
1311 Ga0495594_0018607
1312 Ga0495594_0021867
1313 Ga0495594_0135143
1314 Ga0495594_0643630
1315 Ga0495596_0000342
1316 Ga0495596_0001440
1317 Ga0495596_0005627
1318 Ga0495596_0007218
1319 Ga0495596_0007775
1320 Ga0495596_0011382
1321 Ga0495596_0012092
1322 Ga0495596_0013278
1323 Ga0495596_0021032
1324 Ga0495596_0027309
1325 Ga0495596_0043617
1326 Ga0495596_0059401
1327 Ga0495596_0104302
1328 Ga0495596_0143815
1329 Ga0495596_0251089
1330 Ga0495596_0369725
1331 Ga0495607_0001471
1332 Ga0495607_0001771
1333 Ga0495607_0002219
1334 Ga0495607_0005026
1335 Ga0495607_0018101
1336 Ga0495607_0026887
1337 Ga0495607_0027888
1338 Ga0495607_0031518
1339 Ga0495607_0032318
1340 Ga0495607_0038462
1341 Ga0495607_0054988
1342 Ga0495607_0163812
1343 Ga0495607_0195614
1344 Ga0495607_0208002
1345 Ga0495607_0470319
1346 Ga0495583_0000064
1347 Ga0495583_0000140
1348 Ga0495583_0000270
1349 Ga0495583_0000605
1350 Ga0495583_0000687
1351 Ga0495583_0001144
1352 Ga0495583_0001801
1353 Ga0495583_0012363
1354 Ga0495583_0013322
1355 Ga0495583_0018499
1356 Ga0495583_0061890
1357 Ga0495583_0072293
1358 Ga0495583_0352694
1359 Ga0495606_0000095
1360 Ga0495606_0000123
1361 Ga0495606_0000403
1362 Ga0495606_0000429
1363 Ga0495606_0004586
1364 Ga0495606_0005961
1365 Ga0495606_0017286
1366 Ga0495606_0038263
1367 Ga0495606_0041854
1368 Ga0495606_0100267
1369 Ga0495606_0123029
1370 Ga0495606_0350005
1371 Ga0495606_0369506
1372 Ga0495606_0440511
1373 Ga0495610_0000003
1374 Ga0495610_0003535
1375 Ga0495610_0004916
1376 Ga0495610_0004996
1377 Ga0495610_0060656
1378 Ga0495610_0075515
1379 Ga0495610_0134684
1380 Ga0495610_0337864
1381 Ga0495616_0000392
1382 Ga0495616_0000711
1383 Ga0495616_0008461
1384 Ga0495616_0011627
1385 Ga0495616_0013214
1386 Ga0495616_0017502
1387 Ga0495616_0020492
1388 Ga0495616_0025080
1389 Ga0495616_0034726
1390 Ga0495616_0040754
1391 Ga0495616_0078776
1392 Ga0495616_0170165
1393 Ga0495616_0260881
1394 Ga0495620_0000974
1395 Ga0495631_0001656
1396 Ga0495631_0001993
1397 Ga0495631_0005436
1398 Ga0495631_0016183
1399 Ga0495631_0016403
1400 Ga0495631_0016425
1401 Ga0495631_0029390
1402 Ga0495631_0030361
1403 Ga0495631_0041751
1404 Ga0495631_0172827
1405 Ga0495631_0188696
1406 Ga0495631_0319542
1407 Ga0495631_0446050
1408 Ga0495632_0000387
1409 Ga0495632_0001033
1410 Ga0495632_0006426
1411 Ga0495632_0033033
1412 Ga0495632_0041293
1413 Ga0495632_0070094
1414 Ga0495632_0147267
1415 Ga0495632_0295787
1416 Ga0495632_0321509
1417 Ga0495637_0000011
1418 Ga0495637_0000581
1419 Ga0495637_0009711
1420 Ga0495637_0018292
1421 Ga0495637_0022982
1422 Ga0495637_0034402
1423 Ga0495637_0236307
1424 Ga0495643_0002429
1425 Ga0495643_0004008
1426 Ga0495643_0006347
1427 Ga0495643_0014915
1428 Ga0495643_0034003
1429 Ga0495643_0043916
1430 Ga0495643_0050558
1431 Ga0495643_0127710
1432 Ga0495643_0129415
1433 Ga0495643_0153846
1434 Ga0495643_0264383
1435 Ga0495644_0001335
1436 Ga0495644_0004450
1437 Ga0495644_0004904
1438 Ga0495644_0009794
1439 Ga0495644_0016261
1440 Ga0495644_0021350
1441 Ga0495644_0021673
1442 Ga0495644_0028623
1443 Ga0495644_0030159
1444 Ga0495644_0034553
1445 Ga0495644_0059249
1446 Ga0495644_0339694
1447 Ga0495648_0000040
1448 Ga0495648_0000136
1449 Ga0495648_0000707
1450 Ga0495648_0001392
1451 Ga0495648_0016806
1452 Ga0495648_0017286
1453 Ga0495648_0022737
1454 Ga0495648_0022978
1455 Ga0495648_0030256
1456 Ga0495648_0034157
1457 Ga0495648_0050099
1458 Ga0495648_0108511
1459 Ga0495648_0254603
1460 Ga0495663_0085426
1461 Ga0495663_0304176
1462 Ga0495666_0004338
1463 Ga0495666_0014892
1464 Ga0495666_0043142
1465 Ga0495666_0336726
1466 Ga0495642_0000395
1467 Ga0495642_0001159
1468 Ga0495642_0003270
1469 Ga0495642_0007806
1470 Ga0495642_0012490
1471 Ga0495642_0016586
1472 Ga0495642_0018972
1473 Ga0495642_0022962
1474 Ga0495642_0046124
1475 Ga0495642_0074342
1476 Ga0495642_0107304
1477 Ga0495642_0238019
1478 Ga0495642_0271362
1479 Ga0495642_0464669
1480 Ga0495652_0002899
1481 Ga0495654_0000015
1482 Ga0495654_0006348
1483 Ga0495654_0029135
1484 Ga0495654_0058934
1485 Ga0495654_0111191
1486 Ga0495654_0176392
1487 Ga0495654_0319320
1488 Ga0495665_0003206
1489 Ga0495665_0007299
1490 Ga0495665_0036167
1491 Ga0495586_0004319
1492 Ga0495586_0301261
1493 Ga0495587_0085804
1494 Ga0495598_0048301
1495 Ga0495609_0000046
1496 Ga0495609_0000617
1497 Ga0495609_0001563
1498 Ga0495609_0001850
1499 Ga0495609_0002620
1500 Ga0495609_0005449
1501 Ga0495609_0015092
1502 Ga0495609_0020069
1503 Ga0495609_0023641
1504 Ga0495609_0063835
1505 Ga0495609_0085494
1506 Ga0495609_0102903
1507 Ga0495609_0112467
1508 Ga0495609_0114556
1509 Ga0495609_0193813
1510 Ga0495621_0273825
1511 Ga0495597_0000021
1512 Ga0495597_0000819
1513 Ga0495597_0001286
1514 Ga0495597_0001309
1515 Ga0495597_0002009
1516 Ga0495597_0003998
1517 Ga0495597_0013888
1518 Ga0495597_0055331
1519 Ga0495597_0065627
1520 Ga0495597_0083111
1521 Ga0495597_0152683
1522 Ga0495597_0197680
1523 Ga0495597_0266757
1524 Ga0495597_0311630
1525 Ga0495597_0363780
1526 Ga0495645_0174197
1527 Ga0495622_0000001
1528 Ga0495622_0000421
1529 Ga0495622_0000661
1530 Ga0495622_0022360
1531 Ga0495622_0141736
1532 Ga0495633_0000141
1533 Ga0495633_0000639
1534 Ga0495633_0002287
1535 Ga0495633_0004185
1536 Ga0495633_0005823
1537 Ga0495633_0006401
1538 Ga0495633_0006737
1539 Ga0495633_0008716
1540 Ga0495633_0012344
1541 Ga0495633_0023320
1542 Ga0495633_0028472
1543 Ga0495633_0087072
1544 Ga0495633_0131635
1545 Ga0495633_0223688
1546 Ga0495656_0009364
1547 Ga0495656_0013337
1548 Ga0495656_0170282
1549 Ga0495656_0190983
1550 Ga0495668_0000285
1551 Ga0495668_0000472
1552 Ga0495668_0000596
1553 Ga0495668_0000651
1554 Ga0495668_0001314
1555 Ga0495668_0003596
1556 Ga0495668_0004016
1557 Ga0495668_0011458
1558 Ga0495668_0017549
1559 Ga0495668_0026525
1560 Ga0495668_0089534
1561 Ga0495668_0107774
1562 Ga0495668_0110775
1563 Ga0495668_0159841
1564 Ga0495611_0001075
1565 Ga0495611_0001766
1566 Ga0495611_0008656
1567 Ga0495611_0010316
1568 Ga0495611_0019090
1569 Ga0495611_0046060
1570 Ga0495611_0115713
1571 Ga0495611_0119313
1572 Ga0495611_0120079
1573 Ga0495611_0150548
1574 Ga0495611_0212158
1575 Ga0495611_0319443
1576 Ga0495625_0000244
1577 Ga0495625_0000695
1578 Ga0495625_0002152
1579 Ga0495625_0004881
1580 Ga0495625_0007287
1581 Ga0495625_0014939
1582 Ga0495625_0047869
1583 Ga0495625_0104628
1584 Ga0495625_0211298
1585 Ga0495625_0260630
1586 Ga0495625_0277856
1587 Ga0495635_0007424
1588 Ga0495659_0000028
1589 Ga0495659_0000183
1590 Ga0495659_0001588
1591 Ga0495659_0215627
1592 Ga0495659_0217144
1593 Ga0495659_0314093
1594 Ga0495659_0342705
1595 Ga0495661_0001135
1596 Ga0495661_0003691
1597 Ga0495661_0004820
1598 Ga0495661_0008435
1599 Ga0495661_0016282
1600 Ga0495661_0017964
1601 Ga0495661_0021691
1602 Ga0495661_0025799
1603 Ga0495661_0034408
1604 Ga0495661_0043278
1605 Ga0495661_0054485
1606 Ga0495661_0080194
1607 Ga0495661_0086010
1608 Ga0495661_0101377
1609 Ga0495661_0107292
1610 Ga0495661_0135993
1611 Ga0495661_0138947
1612 Ga0495661_0153589
1613 Ga0495661_0255029
1614 Ga0495661_0362361
1615 Ga0495661_0439221
1616 Ga0495661_0451565
1617 Ga0495661_0557978
1618 Ga0495661_0626153
1619 Ga0495588_0014765
1620 Ga0495588_0024373
1621 Ga0495588_0128694
1622 Ga0495599_0290834
1623 Ga0495623_0002282
1624 Ga0495623_0094275
1625 Ga0495669_0000048
1626 Ga0495669_0001152
1627 Ga0495669_0001222
1628 Ga0495669_0016557
1629 Ga0495669_0082545
1630 Ga0495669_0223048
1631 Ga0495669_0256902
1632 Ga0495669_0378036
1633 Ga0495613_0094503
1634 Ga0495624_0001671
1635 Ga0495670_0000736
1636 Ga0495670_0001547
1637 Ga0495670_0006989
1638 Ga0495670_0012722
1639 Ga0495670_0015268
1640 Ga0495670_0018130
1641 Ga0495670_0019423
1642 Ga0495670_0024573
1643 Ga0495670_0026192
1644 Ga0495670_0145254
1645 Ga0495670_0205652
1646 Ga0495670_0464991
1647 Ga0495670_0639904
1648 Ga0495671_0000099
1649 Ga0495671_0000270
1650 Ga0495671_0001112
1651 Ga0495671_0005811
1652 Ga0495671_0020787
1653 Ga0495671_0036200
1654 Ga0495671_0124242
1655 Ga0495671_0126228
1656 Ga0495671_0352817
1657 Ga0495649_0000558
1658 Ga0495649_0002468
1659 Ga0495649_0004199
1660 Ga0495649_0012038
1661 Ga0495649_0035455
1662 Ga0495649_0044347
1663 Ga0495649_0069096
1664 Ga0495649_0090096
1665 Ga0495649_0122044
1666 Ga0495649_0212414
1667 Ga0495649_0215718
1668 Ga0495649_0385240
1669 Ga0495649_0570703
1670 Ga0495589_0000039
1671 Ga0495589_0000418
1672 Ga0495589_0002965
1673 Ga0495589_0005254
1674 Ga0495589_0006468
1675 Ga0495589_0006847
1676 Ga0495589_0033442
1677 Ga0495589_0036954
1678 Ga0495589_0055939
1679 Ga0495589_0077590
1680 Ga0495589_0207146
1681 Ga0495589_0208064
1682 Ga0495589_0255812
1683 Ga0495660_0000027
1684 Ga0495660_0000260
1685 Ga0495660_0000574
1686 Ga0495660_0001373
1687 Ga0495660_0002464
1688 Ga0495660_0008409
1689 Ga0495660_0018554
1690 Ga0495660_0021752
1691 Ga0495660_0027394
1692 Ga0495660_0030496
1693 Ga0495660_0043199
1694 Ga0495660_0044277
1695 Ga0495660_0053610
1696 Ga0495660_0082349
1697 Ga0495660_0102940
1698 Ga0495660_0155338
1699 Ga0495660_0160207
1700 Ga0495660_0230772
1701 Ga0495660_0286179
1702 Ga0495581_0003071
1703 Ga0495581_0003834
1704 Ga0495604_0001078
1705 Ga0495604_0151057
1706 Ga0495636_0000400
1707 Ga0495636_0001186
1708 Ga0495636_0009795
1709 Ga0495636_0111446
1710 Ga0495636_0186990
1711 Ga0495636_0322459
1712 Ga0495674_0001246
1713 Ga0495672_0000121
1714 Ga0495672_0000336
1715 Ga0495672_0000388
1716 Ga0495672_0000675
1717 Ga0495672_0013264
1718 Ga0495672_0024108
1719 Ga0495672_0024597
1720 Ga0495672_0035765
1721 Ga0495672_0110378
1722 Ga0495676_0000093
1723 Ga0495676_0034917
1724 Ga0495676_0054610
1725 Ga0495676_0123963
1726 Ga0495680_0012068
1727 Ga0495683_0000484
1728 Ga0495683_0001424
1729 Ga0495683_0008047
1730 Ga0495683_0010091
1731 Ga0495683_0011743
1732 Ga0495683_0020316
1733 Ga0495683_0028412
1734 Ga0495683_0037145
1735 Ga0495683_0037181
1736 Ga0495683_0073421
1737 Ga0495683_0096505
1738 Ga0495683_0192256
1739 Ga0495683_0303921
1740 Ga0495687_000008
1741 Ga0495687_000096
1742 Ga0495687_000124
1743 Ga0495687_000753
1744 Ga0495687_002774
1745 Ga0495687_007095
1746 Ga0495675_0104496
1747 Ga0495677_0000008
1748 Ga0495677_0000633
1749 Ga0495677_0000688
1750 Ga0495677_0000919
1751 Ga0495677_0001085
1752 Ga0495677_0003891
1753 Ga0495677_0006829
1754 Ga0495677_0015765
1755 Ga0495677_0020301
1756 Ga0495677_0024619
1757 Ga0495677_0025813
1758 Ga0495677_0028616
1759 Ga0495677_0037914
1760 Ga0495677_0087242
1761 Ga0495677_0120505
1762 Ga0495677_0259607
1763 Ga0495679_000898
1764 Ga0495679_002023
1765 Ga0495679_002455
1766 Ga0495679_058142
1767 Ga0495685_000177
1768 Ga0495685_001435
1769 Ga0495685_002937
1770 Ga0495685_033230
1771 Ga0495685_050834
1772 Ga0495685_080942
1773 Ga0495673_0000003
1774 Ga0495673_0000016
1775 Ga0495673_0000285
1776 Ga0495673_0008260
1777 Ga0495673_0029063
1778 Ga0495681_0002310
1779 Ga0495681_0005731
1780 Ga0495681_0009265
1781 Ga0495681_0011291
1782 Ga0495681_0012847
1783 Ga0495681_0019625
1784 Ga0495681_0021201
1785 Ga0495681_0024042
1786 Ga0495681_0065511
1787 Ga0495681_0100318
1788 Ga0495686_0001154
1789 Ga0495686_0002916
1790 Ga0495686_0005142
1791 Ga0495686_0009323
1792 Ga0495686_0017355
1793 Ga0495686_0176337
1794 Ga0495686_0320240
1795 Ga0495593_0001349
1796 Ga0495593_0106385
1797 Ga0495602_0251233
1798 Ga0495614_0005342
1799 Ga0495614_0006127
1800 Ga0495614_0630153
1801 Ga0495626_0000050
1802 Ga0495626_0000575
1803 Ga0495626_0001659
1804 Ga0495626_0005191
1805 Ga0495626_0016757
1806 Ga0495626_0017185
1807 Ga0495626_0020392
1808 Ga0495626_0027308
1809 Ga0495626_0033570
1810 Ga0495626_0079093
1811 Ga0495626_0082294
1812 Ga0495626_0118319
1813 Ga0495626_0180729
1814 Ga0495626_0305188
1815 Ga0495626_0313029
1816 Ga0495626_0339667
1817 Ga0496100_0023945
1818 Ga0496100_0330098
1819 Ga0496101_0014189
1820 Ga0496101_0807648
1821 Ga0496102_0000334
1822 Ga0496102_0016206
1823 Ga0496102_0121833
1824 Ga0496102_0336385
1825 Ga0496102_0484767
1826 Ga0496102_1348028
1827 Ga0496103_0001170
1828 Ga0496103_0039836
1829 Ga0496103_0040201
1830 Ga0496103_0673490
1831 Ga0496104_0309371
1832 Ga0496105_0381933
1833 Ga0496105_0609941
1834 Ga0496106_0034139
1835 Ga0496106_0787213
1836 Ga0496108_0077895
1837 Ga0496109_0071973
1838 Ga0496109_0153057
1839 Ga0496109_1960030
1840 Ga0496110_0000110
1841 Ga0496110_0034492
1842 Ga0496111_0100508
1843 Ga0496111_0263655
1844 Ga0496111_0758781
1845 Ga0496111_0813934
1846 Ga0496112_0415881
1847 Ga0496113_0031384
1848 Ga0496113_0053185
1849 Ga0496114_0134467
1850 Ga0496114_0158615
1851 Ga0496115_0021770
1852 Ga0496115_0129716
1853 Ga0496116_0017351
1854 Ga0496116_0092855
1855 Ga0496116_0094828
1856 Ga0496117_0000094
1857 Ga0496118_0000071
1858 Ga0496118_0173106
1859 Ga0496121_0060866
1860 Ga0496121_0089241
1861 Ga0496121_0319625
1862 Ga0496121_0576761
1863 Ga0496122_0000535
1864 Ga0496122_0004965
1865 Ga0496122_0123290
1866 Ga0496122_0440093
1867 Ga0496123_0000778
1868 Ga0496123_0001755
1869 Ga0496123_0003467
1870 Ga0496124_0002043
1871 Ga0496124_0222499
1872 Ga0496124_0245251
1873 Ga0496124_0327700
1874 Ga0496124_0380352
1875 Ga0496124_0425566
1876 Ga0496124_0579355
1877 Ga0496125_0000530
1878 Ga0496125_0119737
1879 Ga0496125_0185095
1880 Ga0496125_0206159
1881 Ga0496126_0012091
1882 Ga0496126_0700544
1883 Ga0496126_1086498
1884 Ga0501308_000414
1885 Ga0501309_006901
1886 Ga0501304_001124
1887 Ga0495678_000030
1888 Ga0495678_000251
1889 Ga0495678_000331
1890 Ga0495678_000772
1891 Ga0495678_001595
1892 Ga0495678_002283
1893 Ga0495678_005567
1894 Ga0495678_015323
1895 Ga0495678_026461
1896 Ga0495678_058109
1897 Ga0495682_0000710
1898 Ga0495682_0008294
1899 Ga0495682_0008685
1900 Ga0495682_0072617
1901 Ga0495682_0074111
1902 Ga0495682_0076547
1903 Ga0495682_0114290
1904 Ga0501315_009404
1905 Ga0501320_027759
1906 Ga0501222_006655
1907 Ga0501222_007904
1908 Ga0501227_005093
1909 Ga0501269_000362
1910 Ga0501279_000707
1911 nmdc:mga03683_12818_c1
1912 nmdc:mga03n38_35017_c1
1913 nmdc:mga07m45_480270_c1
1914 Ga0500644_0003045
1915 Ga0500651_0052534
1916 Ga0500594_0010801
1917 Ga0500618_000179
1918 Ga0500652_125043
1919 Ga0500655_034083
1920 Ga0500559_0000021
1921 Ga0500559_0249842
1922 Ga0500573_0331486
1923 Ga0500586_000754
1924 Ga0500588_0167416
1925 Ga0500622_0001819
1926 Ga0500622_0002314
1927 Ga0500636_0156638
1928 Ga0500636_0196716
1929 Ga0500645_017561
1930 Ga0500587_023583
1931 Ga0466962_0033635
1932 2601669725
1933 2643790638
1934 2643796667
1935 2644211582
1936 2644253364
1937 2644355589
1938 2644470228
1939 2738737291
1940 2738830061
1941 2738841511
1942 2739153857
1943 2739195777
1944 2739272381
1945 2739322253
1946 2739340494
1947 2739341425
1948 2821131999
1949 2842712758
1950 2843694053
1951 2857551207
1952 2857557740
1953 2857564003
1954 2857568546
1955 2885085262
1956 2904425537
1957 2919480271
1958 2932413212
1959 2932417273
1960 8047677071

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01052

FliMN_C

Type III flagellar switch regulator (C-ring) FliN C-term

61

131

0.97

Map