F487384
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 981 | 346 | 1963 | 159 |
Family's Representative Sequence
| Representative Sequence | 3300005577|Ga0068857_100959104|Ga0068857_1009591042 |
| Length | 191 |
| Sequence | MVLPYGWPCYIYWRETEIHLNFPIQSDCMRIALFPGTFDPVTFGPLDIIERSVPLFDKLYIGIGINANKQPMFSAEQRIEWLEDIFRNEPKIEVVLYEGLTVDCCKRVKANYILRGIRYVNDFEYEKAIADMNRSLDGNIETVFLTCLPKFTSVASTLVRDVIRNGGDVSQFVPEAVLHTIHQEGRKALMH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 4 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 5 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 15 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 104 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 105 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 160 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 161 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 162 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 163 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 164 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 165 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 166 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 167 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 168 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 169 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 170 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 171 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 172 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 173 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 174 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 175 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 176 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 177 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 178 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 179 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 180 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 181 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 182 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 183 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 184 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 185 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 186 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 189 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 190 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 191 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 192 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 193 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 194 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 195 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 196 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 197 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 199 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 200 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 201 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 202 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 203 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 204 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 205 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 206 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 207 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 208 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 209 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 210 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 211 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 212 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 213 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 214 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 215 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 216 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 217 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 218 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 219 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 220 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 221 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 222 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 223 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 249 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 251 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 252 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 253 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 254 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 255 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 256 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 274 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 275 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 276 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 277 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 278 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 279 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 280 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 281 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 282 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 283 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 284 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 285 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 286 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 287 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 288 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 289 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 290 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 291 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 292 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 293 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 294 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 295 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 296 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 297 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 298 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 299 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 300 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 301 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 302 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 303 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 307 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 308 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 309 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 310 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 311 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 312 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 313 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 316 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 317 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 318 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 319 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 323 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 324 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 325 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 326 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 327 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 328 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 329 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 330 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 331 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 332 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 333 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 334 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 335 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 336 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 337 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 338 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 339 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 340 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 341 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 342 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 343 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 345 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 346 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.69 |
| Metatranscriptomes | 0.1 |
| Isolates | 0.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.4 |
| Nodule | 0 |
| Rhizoplane | 0.71 |
| Rhizosphere | 90.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068857_100959104 | 3300005577 | Bacteria | 822 |
| 2 | JGI24735J21928_10019377 | 3300002067 | Bacteria | 2091 |
| 3 | JGI25154J39366_1000022 | 3300002738 | Bacteria | 219590 |
| 4 | JGI25154J39366_1011189 | 3300002738 | Bacteria | 1035 |
| 5 | JGI25157J39369_1006168 | 3300002741 | Unclassified | 1859 |
| 6 | JGI25164J39214_1002738 | 3300002772 | Bacteria | 2525 |
| 7 | JGI25165J46597_1000420 | 3300003214 | Bacteria | 43968 |
| 8 | JGI25153J46596_10001856 | 3300003215 | Bacteria | 12524 |
| 9 | rootH1_10022033 | 3300003316 | Bacteria | 1692 |
| 10 | rootH2_10004606 | 3300003320 | Bacteria | 102673 |
| 11 | rootH2_10121353 | 3300003320 | Bacteria | 2461 |
| 12 | rootL2_10058208 | 3300003322 | Bacteria | 5218 |
| 13 | rootL2_10233169 | 3300003322 | Bacteria | 2637 |
| 14 | rootH1_10009287 | 3300003323 | Bacteria | 13181 |
| 15 | rootH1_10016880 | 3300003323 | Bacteria | 64867 |
| 16 | rootH1_10043452 | 3300003316 | Bacteria | 20626 |
| 17 | rootH1_10043452 | 3300003323 | Bacteria | 4798 |
| 18 | rootH1_10255498 | 3300003323 | Bacteria | 2813 |
| 19 | JGI25160J50197_1032470 | 3300003354 | Bacteria | 1326 |
| 20 | Ga0058862_12364578 | 3300004803 | Bacteria | 1316 |
| 21 | Ga0065165_1037858 | 3300005262 | Bacteria | 1459 |
| 22 | Ga0065714_10072714 | 3300005288 | Bacteria | 3232 |
| 23 | Ga0065714_10113882 | 3300005288 | Bacteria | 1436 |
| 24 | Ga0065714_10195570 | 3300005288 | Bacteria | 912 |
| 25 | Ga0065712_10021823 | 3300005290 | Bacteria | 1486 |
| 26 | Ga0065712_10086969 | 3300005290 | Bacteria | 2605 |
| 27 | Ga0070658_10013959 | 3300005327 | Bacteria | 6448 |
| 28 | Ga0070658_10033505 | 3300005327 | Bacteria | 4133 |
| 29 | Ga0070658_10092240 | 3300005327 | Bacteria | 2497 |
| 30 | Ga0070658_10208454 | 3300005327 | Bacteria | 1651 |
| 31 | Ga0070658_10284307 | 3300005327 | Bacteria | 1408 |
| 32 | Ga0070676_10000376 | 3300005328 | Bacteria | 20680 |
| 33 | Ga0070676_10001044 | 3300005328 | Bacteria | 13792 |
| 34 | Ga0070676_10323634 | 3300005328 | Unclassified | 1052 |
| 35 | Ga0070683_100007784 | 3300005329 | Bacteria | 9071 |
| 36 | Ga0070683_100152116 | 3300005329 | Bacteria | 2194 |
| 37 | Ga0070670_100097287 | 3300005331 | Bacteria | 2532 |
| 38 | Ga0070670_100375913 | 3300005331 | Bacteria | 1251 |
| 39 | Ga0070670_100608849 | 3300005331 | Bacteria | 978 |
| 40 | Ga0070677_10029340 | 3300005333 | Bacteria | 2085 |
| 41 | Ga0068869_100077215 | 3300005334 | Bacteria | 2477 |
| 42 | Ga0070666_10000201 | 3300005335 | Bacteria | 40907 |
| 43 | Ga0070680_100001133 | 3300005336 | Bacteria | 19138 |
| 44 | Ga0070680_100017878 | 3300005336 | Bacteria | 5595 |
| 45 | Ga0070680_100087905 | 3300005336 | Bacteria | 2570 |
| 46 | Ga0070680_100099554 | 3300005336 | Bacteria | 2412 |
| 47 | Ga0070680_100111009 | 3300005336 | Bacteria | 2282 |
| 48 | Ga0070680_100700175 | 3300005336 | Bacteria | 872 |
| 49 | Ga0070682_100000060 | 3300005337 | Bacteria | 105136 |
| 50 | Ga0068868_100046531 | 3300005338 | Bacteria | 3397 |
| 51 | Ga0068868_100057225 | 3300005338 | Bacteria | 3080 |
| 52 | Ga0068868_100150522 | 3300005338 | Bacteria | 1916 |
| 53 | Ga0068868_101024500 | 3300005338 | Bacteria | 756 |
| 54 | Ga0070660_100015165 | 3300005339 | Bacteria | 5559 |
| 55 | Ga0070660_100020897 | 3300005339 | Bacteria | 4819 |
| 56 | Ga0070660_100042666 | 3300005339 | Bacteria | 3463 |
| 57 | Ga0070660_100103452 | 3300005339 | Bacteria | 2258 |
| 58 | Ga0070660_100476623 | 3300005339 | Bacteria | 1037 |
| 59 | Ga0070660_100542241 | 3300005339 | Bacteria | 970 |
| 60 | Ga0070660_100619685 | 3300005339 | Bacteria | 905 |
| 61 | Ga0070691_10113522 | 3300005341 | Bacteria | 1357 |
| 62 | Ga0070691_10129750 | 3300005341 | Bacteria | 1276 |
| 63 | Ga0070661_100233976 | 3300005344 | Bacteria | 1413 |
| 64 | Ga0070692_10452620 | 3300005345 | Bacteria | 822 |
| 65 | Ga0070668_100000036 | 3300005347 | Bacteria | 81256 |
| 66 | Ga0070668_100802596 | 3300005347 | Bacteria | 836 |
| 67 | Ga0070669_100149713 | 3300005353 | Bacteria | 1806 |
| 68 | Ga0070675_100011239 | 3300005354 | Bacteria | 7009 |
| 69 | Ga0070675_100027386 | 3300005354 | Bacteria | 4579 |
| 70 | Ga0070675_100095942 | 3300005354 | Bacteria | 2491 |
| 71 | Ga0070675_100159036 | 3300005354 | Bacteria | 1942 |
| 72 | Ga0070671_100208926 | 3300005355 | Bacteria | 1656 |
| 73 | Ga0070671_100673987 | 3300005355 | Bacteria | 896 |
| 74 | Ga0070673_100002827 | 3300005364 | Bacteria | 10679 |
| 75 | Ga0070673_100500932 | 3300005364 | Unclassified | 1098 |
| 76 | Ga0070673_100630236 | 3300005364 | Bacteria | 980 |
| 77 | Ga0070673_101309552 | 3300005364 | Unclassified | 680 |
| 78 | Ga0070688_100204213 | 3300005365 | Bacteria | 1384 |
| 79 | Ga0070659_100001238 | 3300005366 | Bacteria | 18539 |
| 80 | Ga0070659_100001469 | 3300005366 | Bacteria | 16968 |
| 81 | Ga0070659_100013081 | 3300005366 | Bacteria | 6172 |
| 82 | Ga0070659_100013744 | 3300005366 | Bacteria | 6036 |
| 83 | Ga0070659_100167342 | 3300005366 | Bacteria | 1799 |
| 84 | Ga0070659_100240531 | 3300005366 | Bacteria | 1498 |
| 85 | Ga0070659_101181305 | 3300005366 | Unclassified | 676 |
| 86 | Ga0070667_100000393 | 3300005367 | Bacteria | 47271 |
| 87 | Ga0070714_100933655 | 3300005435 | Bacteria | 843 |
| 88 | Ga0070663_100046954 | 3300005455 | Bacteria | 3058 |
| 89 | Ga0070663_100616104 | 3300005455 | Bacteria | 914 |
| 90 | Ga0070663_100808401 | 3300005455 | Bacteria | 804 |
| 91 | Ga0070678_100295746 | 3300005456 | Unclassified | 1374 |
| 92 | Ga0070678_100811288 | 3300005456 | Unclassified | 850 |
| 93 | Ga0070662_100000252 | 3300005457 | Bacteria | 31682 |
| 94 | Ga0070662_100008429 | 3300005457 | Bacteria | 6719 |
| 95 | Ga0070681_10003852 | 3300005458 | Bacteria | 14114 |
| 96 | Ga0070681_10006225 | 3300005458 | Bacteria | 11600 |
| 97 | Ga0070681_10068869 | 3300005458 | Bacteria | 3505 |
| 98 | Ga0070681_10082536 | 3300005458 | Bacteria | 3169 |
| 99 | Ga0070681_10167900 | 3300005458 | Bacteria | 2117 |
| 100 | Ga0070681_10314298 | 3300005458 | Bacteria | 1476 |
| 101 | Ga0070681_11518098 | 3300005458 | Bacteria | 595 |
| 102 | Ga0068867_100001529 | 3300005459 | Bacteria | 16051 |
| 103 | Ga0068867_100033952 | 3300005459 | Bacteria | 3697 |
| 104 | Ga0068867_100052975 | 3300005459 | Bacteria | 2995 |
| 105 | Ga0068867_100174850 | 3300005459 | Bacteria | 1703 |
| 106 | Ga0068867_100616433 | 3300005459 | Unclassified | 948 |
| 107 | Ga0070685_10293963 | 3300005466 | Bacteria | 1092 |
| 108 | Ga0070698_100051445 | 3300005471 | Bacteria | 4195 |
| 109 | Ga0070679_100003662 | 3300005530 | Bacteria | 14067 |
| 110 | Ga0070679_100014889 | 3300005530 | Bacteria | 7471 |
| 111 | Ga0070679_100042397 | 3300005530 | Bacteria | 4531 |
| 112 | Ga0070679_100154129 | 3300005530 | Bacteria | 2273 |
| 113 | Ga0070679_100174164 | 3300005530 | Bacteria | 2124 |
| 114 | Ga0070679_100215129 | 3300005530 | Bacteria | 1884 |
| 115 | Ga0070679_101572314 | 3300005530 | Unclassified | 605 |
| 116 | Ga0070684_100001099 | 3300005535 | Bacteria | 19385 |
| 117 | Ga0070684_100022372 | 3300005535 | Bacteria | 5272 |
| 118 | Ga0070684_100037425 | 3300005535 | Bacteria | 4162 |
| 119 | Ga0068853_100001289 | 3300005539 | Bacteria | 17984 |
| 120 | Ga0068853_100005465 | 3300005539 | Bacteria | 9958 |
| 121 | Ga0068853_100007662 | 3300005539 | Bacteria | 8655 |
| 122 | Ga0068853_100022704 | 3300005539 | Bacteria | 5244 |
| 123 | Ga0068853_100059247 | 3300005539 | Bacteria | 3307 |
| 124 | Ga0068853_100158618 | 3300005539 | Bacteria | 2040 |
| 125 | Ga0068853_100227885 | 3300005539 | Bacteria | 1704 |
| 126 | Ga0068853_100235766 | 3300005539 | Bacteria | 1675 |
| 127 | Ga0068853_100381642 | 3300005539 | Bacteria | 1316 |
| 128 | Ga0068853_100693429 | 3300005539 | Bacteria | 971 |
| 129 | Ga0068853_100962417 | 3300005539 | Bacteria | 821 |
| 130 | Ga0070672_100002608 | 3300005543 | Bacteria | 11517 |
| 131 | Ga0070672_100082453 | 3300005543 | Bacteria | 2580 |
| 132 | Ga0070672_100084486 | 3300005543 | Bacteria | 2549 |
| 133 | Ga0070672_100106719 | 3300005543 | Bacteria | 2278 |
| 134 | Ga0070665_100000016 | 3300005548 | Bacteria | 451538 |
| 135 | Ga0070665_100001215 | 3300005548 | Bacteria | 31387 |
| 136 | Ga0068855_100000257 | 3300005563 | Bacteria | 66593 |
| 137 | Ga0068855_100003500 | 3300005563 | Bacteria | 19234 |
| 138 | Ga0068855_100007377 | 3300005563 | Bacteria | 13314 |
| 139 | Ga0068855_100015438 | 3300005563 | Bacteria | 9194 |
| 140 | Ga0068855_100082914 | 3300005563 | Bacteria | 3715 |
| 141 | Ga0068855_100084714 | 3300005563 | Unclassified | 3669 |
| 142 | Ga0068855_100090726 | 3300005563 | Bacteria | 3526 |
| 143 | Ga0068855_100117097 | 3300005563 | Bacteria | 3053 |
| 144 | Ga0068855_100141627 | 3300005563 | Bacteria | 2740 |
| 145 | Ga0068855_100146424 | 3300005563 | Bacteria | 2688 |
| 146 | Ga0068855_100270090 | 3300005563 | Bacteria | 1891 |
| 147 | Ga0068855_100354148 | 3300005563 | Unclassified | 1616 |
| 148 | Ga0068855_100356856 | 3300005563 | Bacteria | 1609 |
| 149 | Ga0068855_100444602 | 3300005563 | Bacteria | 1415 |
| 150 | Ga0070664_100081393 | 3300005564 | Bacteria | 2791 |
| 151 | Ga0070664_100124777 | 3300005564 | Bacteria | 2257 |
| 152 | Ga0070664_100439773 | 3300005564 | Unclassified | 1196 |
| 153 | Ga0068857_100002912 | 3300005577 | Bacteria | 14102 |
| 154 | Ga0068857_100061221 | 3300005577 | Bacteria | 3344 |
| 155 | Ga0068857_100074620 | 3300005577 | Unclassified | 3023 |
| 156 | Ga0068857_100290365 | 3300005577 | Bacteria | 1505 |
| 157 | Ga0068857_100684854 | 3300005577 | Bacteria | 973 |
| 158 | Ga0068857_100816751 | 3300005577 | Bacteria | 891 |
| 159 | Ga0068857_100873807 | 3300005577 | Bacteria | 861 |
| 160 | Ga0068857_100936105 | 3300005577 | Bacteria | 832 |
| 161 | Ga0068854_100044550 | 3300005578 | Bacteria | 3150 |
| 162 | Ga0068854_100120083 | 3300005578 | Bacteria | 1994 |
| 163 | Ga0068854_100200890 | 3300005578 | Bacteria | 1567 |
| 164 | Ga0068854_100323576 | 3300005578 | Bacteria | 1254 |
| 165 | Ga0068854_100872656 | 3300005578 | Bacteria | 789 |
| 166 | Ga0068854_101944093 | 3300005578 | Bacteria | 541 |
| 167 | Ga0068856_100005494 | 3300005614 | Bacteria | 12487 |
| 168 | Ga0068856_100013252 | 3300005614 | Bacteria | 7984 |
| 169 | Ga0068856_100023691 | 3300005614 | Bacteria | 5969 |
| 170 | Ga0068856_100138407 | 3300005614 | Bacteria | 2441 |
| 171 | Ga0068856_100200312 | 3300005614 | Bacteria | 2011 |
| 172 | Ga0068856_100513826 | 3300005614 | Bacteria | 1219 |
| 173 | Ga0068856_100571094 | 3300005614 | Bacteria | 1152 |
| 174 | Ga0068856_101012269 | 3300005614 | Bacteria | 849 |
| 175 | Ga0068852_100003516 | 3300005616 | Bacteria | 10961 |
| 176 | Ga0068852_100004973 | 3300005616 | Bacteria | 9451 |
| 177 | Ga0068852_100013746 | 3300005616 | Bacteria | 6204 |
| 178 | Ga0068852_100034480 | 3300005616 | Bacteria | 4212 |
| 179 | Ga0068852_100053055 | 3300005616 | Bacteria | 3488 |
| 180 | Ga0068852_100156452 | 3300005616 | Unclassified | 2124 |
| 181 | Ga0068852_100215352 | 3300005616 | Bacteria | 1824 |
| 182 | Ga0068852_100250648 | 3300005616 | Unclassified | 1696 |
| 183 | Ga0068852_100582062 | 3300005616 | Bacteria | 1122 |
| 184 | Ga0068852_100594601 | 3300005616 | Bacteria | 1110 |
| 185 | Ga0068852_100618926 | 3300005616 | Bacteria | 1088 |
| 186 | Ga0068859_100067888 | 3300005617 | Bacteria | 3601 |
| 187 | Ga0068859_100100796 | 3300005617 | Bacteria | 2944 |
| 188 | Ga0068859_100735310 | 3300005617 | Bacteria | 1076 |
| 189 | Ga0068864_100002025 | 3300005618 | Bacteria | 16721 |
| 190 | Ga0068866_10064985 | 3300005718 | Bacteria | 1907 |
| 191 | Ga0068861_100022287 | 3300005719 | Bacteria | 4562 |
| 192 | Ga0068861_100147416 | 3300005719 | Bacteria | 1927 |
| 193 | Ga0068851_10001779 | 3300005834 | Bacteria | 9419 |
| 194 | Ga0068851_10282455 | 3300005834 | Bacteria | 950 |
| 195 | Ga0068851_10496774 | 3300005834 | Unclassified | 731 |
| 196 | Ga0068851_10760419 | 3300005834 | Bacteria | 600 |
| 197 | Ga0068863_100007773 | 3300005841 | Bacteria | 10484 |
| 198 | Ga0068863_100284740 | 3300005841 | Bacteria | 1602 |
| 199 | Ga0068863_100634073 | 3300005841 | Bacteria | 1059 |
| 200 | Ga0068863_102027272 | 3300005841 | Unclassified | 585 |
| 201 | Ga0068858_100001071 | 3300005842 | Bacteria | 28302 |
| 202 | Ga0068858_100197393 | 3300005842 | Bacteria | 1902 |
| 203 | Ga0068858_100492381 | 3300005842 | Bacteria | 1184 |
| 204 | Ga0068860_100000006 | 3300005843 | Bacteria | 461966 |
| 205 | Ga0068860_100010347 | 3300005843 | Bacteria | 9226 |
| 206 | Ga0068860_100018512 | 3300005843 | Bacteria | 6774 |
| 207 | Ga0068860_100020538 | 3300005843 | Bacteria | 6397 |
| 208 | Ga0068860_100025063 | 3300005843 | Bacteria | 5757 |
| 209 | Ga0068860_100707528 | 3300005843 | Unclassified | 1017 |
| 210 | Ga0070716_100646257 | 3300006173 | Bacteria | 801 |
| 211 | Ga0075366_10005129 | 3300006195 | Bacteria | 7086 |
| 212 | Ga0075366_10030731 | 3300006195 | Bacteria | 3158 |
| 213 | Ga0075366_10038226 | 3300006195 | Bacteria | 2834 |
| 214 | Ga0075366_10048318 | 3300006195 | Bacteria | 2523 |
| 215 | Ga0075366_10149478 | 3300006195 | Bacteria | 1414 |
| 216 | Ga0075366_10292118 | 3300006195 | Bacteria | 997 |
| 217 | Ga0097621_100000212 | 3300006237 | Bacteria | 38270 |
| 218 | Ga0097621_100001189 | 3300006237 | Bacteria | 18047 |
| 219 | Ga0097621_100006360 | 3300006237 | Bacteria | 8380 |
| 220 | Ga0097621_100143411 | 3300006237 | Bacteria | 2043 |
| 221 | Ga0097621_100833739 | 3300006237 | Unclassified | 856 |
| 222 | Ga0075370_10493931 | 3300006353 | Unclassified | 738 |
| 223 | Ga0068871_100000720 | 3300006358 | Bacteria | 22413 |
| 224 | Ga0068871_100002202 | 3300006358 | Bacteria | 13246 |
| 225 | Ga0068871_100004872 | 3300006358 | Bacteria | 9375 |
| 226 | Ga0068871_100014855 | 3300006358 | Bacteria | 5817 |
| 227 | Ga0068871_100254546 | 3300006358 | Unclassified | 1530 |
| 228 | Ga0068871_101276026 | 3300006358 | Bacteria | 690 |
| 229 | Ga0068865_100000112 | 3300006881 | Bacteria | 41532 |
| 230 | Ga0068865_100034450 | 3300006881 | Bacteria | 3397 |
| 231 | Ga0068865_100869884 | 3300006881 | Bacteria | 782 |
| 232 | Ga0097620_100009589 | 3300006931 | Bacteria | 9777 |
| 233 | Ga0097620_100067889 | 3300006931 | Bacteria | 3601 |
| 234 | Ga0097620_100100795 | 3300006931 | Bacteria | 2944 |
| 235 | Ga0097620_100735476 | 3300006931 | Bacteria | 1076 |
| 236 | Ga0105251_10164099 | 3300009011 | Bacteria | 1001 |
| 237 | Ga0105240_10000155 | 3300009093 | Bacteria | 140485 |
| 238 | Ga0105240_10001144 | 3300009093 | Bacteria | 46441 |
| 239 | Ga0105240_10002687 | 3300009093 | Bacteria | 28319 |
| 240 | Ga0105240_10005022 | 3300009093 | Bacteria | 19855 |
| 241 | Ga0105240_10014688 | 3300009093 | Bacteria | 10685 |
| 242 | Ga0105240_10029329 | 3300009093 | Bacteria | 7171 |
| 243 | Ga0105240_10034681 | 3300009093 | Bacteria | 6507 |
| 244 | Ga0105240_10036495 | 3300009093 | Bacteria | 6322 |
| 245 | Ga0105240_10043386 | 3300009093 | Bacteria | 5723 |
| 246 | Ga0105240_10082059 | 3300009093 | Bacteria | 3960 |
| 247 | Ga0105240_10082254 | 3300009093 | Bacteria | 3955 |
| 248 | Ga0105240_10104381 | 3300009093 | Bacteria | 3442 |
| 249 | Ga0105240_10282755 | 3300009093 | Unclassified | 1905 |
| 250 | Ga0105240_10315411 | 3300009093 | Bacteria | 1784 |
| 251 | Ga0105240_10406339 | 3300009093 | Bacteria | 1533 |
| 252 | Ga0105240_10502764 | 3300009093 | Bacteria | 1347 |
| 253 | Ga0105240_10529364 | 3300009093 | Bacteria | 1307 |
| 254 | Ga0105240_10549317 | 3300009093 | Bacteria | 1278 |
| 255 | Ga0105240_10664159 | 3300009093 | Bacteria | 1141 |
| 256 | Ga0105240_10747832 | 3300009093 | Bacteria | 1063 |
| 257 | Ga0111539_10150124 | 3300009094 | Bacteria | 2728 |
| 258 | Ga0105245_10403857 | 3300009098 | Bacteria | 1366 |
| 259 | Ga0105247_10499798 | 3300009101 | Bacteria | 886 |
| 260 | Ga0114129_10002084 | 3300009147 | Bacteria | 27490 |
| 261 | Ga0105241_10000113 | 3300009174 | Bacteria | 58135 |
| 262 | Ga0105241_10000898 | 3300009174 | Bacteria | 22475 |
| 263 | Ga0105241_10005212 | 3300009174 | Bacteria | 9597 |
| 264 | Ga0105241_10011777 | 3300009174 | Bacteria | 6423 |
| 265 | Ga0105241_10055333 | 3300009174 | Bacteria | 3039 |
| 266 | Ga0105241_10097786 | 3300009174 | Bacteria | 2328 |
| 267 | Ga0105241_10098405 | 3300009174 | Bacteria | 2321 |
| 268 | Ga0105241_10201956 | 3300009174 | Bacteria | 1661 |
| 269 | Ga0105241_10475108 | 3300009174 | Bacteria | 1110 |
| 270 | Ga0105241_11461584 | 3300009174 | Bacteria | 656 |
| 271 | Ga0105242_10070451 | 3300009176 | Bacteria | 2899 |
| 272 | Ga0105242_10213586 | 3300009176 | Bacteria | 1721 |
| 273 | Ga0105242_10967642 | 3300009176 | Bacteria | 856 |
| 274 | Ga0105248_10047599 | 3300009177 | Unclassified | 4809 |
| 275 | Ga0105248_10053635 | 3300009177 | Bacteria | 4524 |
| 276 | Ga0105248_10515153 | 3300009177 | Unclassified | 1349 |
| 277 | Ga0105237_10000061 | 3300009545 | Bacteria | 146107 |
| 278 | Ga0105237_10000417 | 3300009545 | Bacteria | 60658 |
| 279 | Ga0105237_10008194 | 3300009545 | Bacteria | 11352 |
| 280 | Ga0105237_10019539 | 3300009545 | Bacteria | 6997 |
| 281 | Ga0105237_10022631 | 3300009545 | Bacteria | 6446 |
| 282 | Ga0105237_10023025 | 3300009545 | Bacteria | 6388 |
| 283 | Ga0105237_10034436 | 3300009545 | Bacteria | 5128 |
| 284 | Ga0105237_10059196 | 3300009545 | Bacteria | 3832 |
| 285 | Ga0105237_10059700 | 3300009545 | Bacteria | 3815 |
| 286 | Ga0105237_10086203 | 3300009545 | Bacteria | 3130 |
| 287 | Ga0105237_10103854 | 3300009545 | Bacteria | 2834 |
| 288 | Ga0105237_10110815 | 3300009545 | Bacteria | 2736 |
| 289 | Ga0105237_10164797 | 3300009545 | Bacteria | 2215 |
| 290 | Ga0105237_10215180 | 3300009545 | Bacteria | 1921 |
| 291 | Ga0105237_10264828 | 3300009545 | Bacteria | 1722 |
| 292 | Ga0105237_10510398 | 3300009545 | Bacteria | 1209 |
| 293 | Ga0105237_10584713 | 3300009545 | Bacteria | 1123 |
| 294 | Ga0105237_10634795 | 3300009545 | Bacteria | 1075 |
| 295 | Ga0105237_10935885 | 3300009545 | Bacteria | 873 |
| 296 | Ga0105237_11085971 | 3300009545 | Unclassified | 807 |
| 297 | Ga0105237_11240726 | 3300009545 | Bacteria | 752 |
| 298 | Ga0105238_10010861 | 3300009551 | Bacteria | 9153 |
| 299 | Ga0105238_10035276 | 3300009551 | Bacteria | 5085 |
| 300 | Ga0105238_10036611 | 3300009551 | Bacteria | 4990 |
| 301 | Ga0105238_10102453 | 3300009551 | Bacteria | 2844 |
| 302 | Ga0105238_10187538 | 3300009551 | Bacteria | 2044 |
| 303 | Ga0105238_10829446 | 3300009551 | Bacteria | 941 |
| 304 | Ga0105238_10931642 | 3300009551 | Bacteria | 888 |
| 305 | Ga0105238_11043513 | 3300009551 | Bacteria | 839 |
| 306 | Ga0105238_11323562 | 3300009551 | Bacteria | 747 |
| 307 | Ga0105249_10003698 | 3300009553 | Bacteria | 13192 |
| 308 | Ga0105249_10011368 | 3300009553 | Bacteria | 7817 |
| 309 | Ga0105249_10239036 | 3300009553 | Unclassified | 1795 |
| 310 | Ga0105249_10286645 | 3300009553 | Bacteria | 1647 |
| 311 | Ga0105239_10000010 | 3300010375 | Bacteria | 341545 |
| 312 | Ga0105239_10000415 | 3300010375 | Bacteria | 62156 |
| 313 | Ga0105239_10000482 | 3300010375 | Bacteria | 58131 |
| 314 | Ga0105239_10005902 | 3300010375 | Bacteria | 14267 |
| 315 | Ga0105239_10006393 | 3300010375 | Bacteria | 13684 |
| 316 | Ga0105239_10006733 | 3300010375 | Bacteria | 13275 |
| 317 | Ga0105239_10029427 | 3300010375 | Bacteria | 6038 |
| 318 | Ga0105239_10030646 | 3300010375 | Bacteria | 5916 |
| 319 | Ga0105239_10041699 | 3300010375 | Bacteria | 5029 |
| 320 | Ga0105239_10131094 | 3300010375 | Bacteria | 2789 |
| 321 | Ga0105239_10290659 | 3300010375 | Bacteria | 1840 |
| 322 | Ga0105239_10355436 | 3300010375 | Bacteria | 1654 |
| 323 | Ga0105239_10398910 | 3300010375 | Bacteria | 1557 |
| 324 | Ga0105239_10438445 | 3300010375 | Bacteria | 1481 |
| 325 | Ga0105239_11389818 | 3300010375 | Bacteria | 810 |
| 326 | Ga0105246_10033878 | 3300011119 | Bacteria | 3398 |
| 327 | Ga0105246_10062211 | 3300011119 | Bacteria | 2600 |
| 328 | Ga0105246_10698507 | 3300011119 | Bacteria | 889 |
| 329 | Ga0105246_10931799 | 3300011119 | Unclassified | 781 |
| 330 | Ga0105246_11962903 | 3300011119 | Bacteria | 564 |
| 331 | Ga0157373_10001922 | 3300013100 | Bacteria | 15789 |
| 332 | Ga0157373_10006674 | 3300013100 | Bacteria | 8597 |
| 333 | Ga0157373_10122746 | 3300013100 | Bacteria | 1826 |
| 334 | Ga0157373_10152466 | 3300013100 | Bacteria | 1626 |
| 335 | Ga0157373_10162996 | 3300013100 | Bacteria | 1569 |
| 336 | Ga0157373_10243602 | 3300013100 | Bacteria | 1271 |
| 337 | Ga0157373_10500493 | 3300013100 | Bacteria | 878 |
| 338 | Ga0157371_10001534 | 3300013102 | Bacteria | 23793 |
| 339 | Ga0157371_10002382 | 3300013102 | Bacteria | 17982 |
| 340 | Ga0157371_10002977 | 3300013102 | Bacteria | 15723 |
| 341 | Ga0157371_10003511 | 3300013102 | Bacteria | 14162 |
| 342 | Ga0157371_10003728 | 3300013102 | Bacteria | 13656 |
| 343 | Ga0157371_10019675 | 3300013102 | Bacteria | 4973 |
| 344 | Ga0157371_10021366 | 3300013102 | Bacteria | 4752 |
| 345 | Ga0157371_10022801 | 3300013102 | Bacteria | 4580 |
| 346 | Ga0157371_10023229 | 3300013102 | Bacteria | 4534 |
| 347 | Ga0157371_10034836 | 3300013102 | Bacteria | 3610 |
| 348 | Ga0157371_10048660 | 3300013102 | Bacteria | 3014 |
| 349 | Ga0157371_10048801 | 3300013102 | Bacteria | 3009 |
| 350 | Ga0157371_10072843 | 3300013102 | Bacteria | 2433 |
| 351 | Ga0157371_10082546 | 3300013102 | Bacteria | 2276 |
| 352 | Ga0157371_10175078 | 3300013102 | Bacteria | 1534 |
| 353 | Ga0157371_10214733 | 3300013102 | Bacteria | 1381 |
| 354 | Ga0157371_10232895 | 3300013102 | Bacteria | 1324 |
| 355 | Ga0157371_10237493 | 3300013102 | Bacteria | 1311 |
| 356 | Ga0157370_10001056 | 3300013104 | Bacteria | 34670 |
| 357 | Ga0157370_10003729 | 3300013104 | Bacteria | 17809 |
| 358 | Ga0157370_10008499 | 3300013104 | Bacteria | 11073 |
| 359 | Ga0157370_10062863 | 3300013104 | Bacteria | 3520 |
| 360 | Ga0157370_10081716 | 3300013104 | Bacteria | 3040 |
| 361 | Ga0157370_10086945 | 3300013104 | Bacteria | 2936 |
| 362 | Ga0157370_10094169 | 3300013104 | Bacteria | 2811 |
| 363 | Ga0157370_10105509 | 3300013104 | Bacteria | 2637 |
| 364 | Ga0157370_10121749 | 3300013104 | Bacteria | 2436 |
| 365 | Ga0157370_10186900 | 3300013104 | Bacteria | 1923 |
| 366 | Ga0157370_10218843 | 3300013104 | Unclassified | 1764 |
| 367 | Ga0157370_10229378 | 3300013104 | Bacteria | 1719 |
| 368 | Ga0157370_10268545 | 3300013104 | Bacteria | 1576 |
| 369 | Ga0157370_10336255 | 3300013104 | Bacteria | 1392 |
| 370 | Ga0157370_10363049 | 3300013104 | Bacteria | 1334 |
| 371 | Ga0157370_10422889 | 3300013104 | Bacteria | 1226 |
| 372 | Ga0157370_10501567 | 3300013104 | Bacteria | 1114 |
| 373 | Ga0157369_10000853 | 3300013105 | Bacteria | 38843 |
| 374 | Ga0157369_10011149 | 3300013105 | Bacteria | 10218 |
| 375 | Ga0157369_10016348 | 3300013105 | Bacteria | 8350 |
| 376 | Ga0157369_10080482 | 3300013105 | Bacteria | 3488 |
| 377 | Ga0157369_10120997 | 3300013105 | Bacteria | 2778 |
| 378 | Ga0157369_10210665 | 3300013105 | Bacteria | 2037 |
| 379 | Ga0157369_10265309 | 3300013105 | Bacteria | 1790 |
| 380 | Ga0157369_10369743 | 3300013105 | Bacteria | 1488 |
| 381 | Ga0157369_11811351 | 3300013105 | Unclassified | 620 |
| 382 | Ga0157369_12021259 | 3300013105 | Bacteria | 585 |
| 383 | Ga0157374_10000408 | 3300013296 | Bacteria | 38980 |
| 384 | Ga0157374_10000618 | 3300013296 | Bacteria | 31268 |
| 385 | Ga0157374_10009788 | 3300013296 | Bacteria | 8233 |
| 386 | Ga0157374_10041703 | 3300013296 | Bacteria | 4231 |
| 387 | Ga0157374_10059021 | 3300013296 | Bacteria | 3586 |
| 388 | Ga0157374_10164510 | 3300013296 | Bacteria | 2162 |
| 389 | Ga0157374_10477610 | 3300013296 | Unclassified | 1250 |
| 390 | Ga0157374_10585923 | 3300013296 | Bacteria | 1125 |
| 391 | Ga0157374_10588861 | 3300013296 | Bacteria | 1122 |
| 392 | Ga0157374_11219675 | 3300013296 | Bacteria | 774 |
| 393 | Ga0157374_12242791 | 3300013296 | Bacteria | 573 |
| 394 | Ga0157378_10072207 | 3300013297 | Bacteria | 3101 |
| 395 | Ga0157378_10077124 | 3300013297 | Bacteria | 3004 |
| 396 | Ga0157378_10120809 | 3300013297 | Bacteria | 2415 |
| 397 | Ga0157378_10147983 | 3300013297 | Bacteria | 2186 |
| 398 | Ga0157378_10317568 | 3300013297 | Unclassified | 1512 |
| 399 | Ga0157378_10580165 | 3300013297 | Bacteria | 1130 |
| 400 | Ga0157378_11453243 | 3300013297 | Bacteria | 729 |
| 401 | Ga0163162_10000040 | 3300013306 | Bacteria | 133855 |
| 402 | Ga0163162_10001209 | 3300013306 | Bacteria | 24116 |
| 403 | Ga0163162_10001777 | 3300013306 | Bacteria | 20207 |
| 404 | Ga0163162_10002037 | 3300013306 | Bacteria | 19017 |
| 405 | Ga0163162_10002657 | 3300013306 | Bacteria | 16942 |
| 406 | Ga0163162_10054155 | 3300013306 | Bacteria | 4035 |
| 407 | Ga0163162_10093304 | 3300013306 | Bacteria | 3095 |
| 408 | Ga0163162_10250454 | 3300013306 | Unclassified | 1903 |
| 409 | Ga0163162_10503489 | 3300013306 | Unclassified | 1341 |
| 410 | Ga0163162_10650697 | 3300013306 | Bacteria | 1178 |
| 411 | Ga0163162_12323449 | 3300013306 | Unclassified | 616 |
| 412 | Ga0157372_10000011 | 3300013307 | Bacteria | 277202 |
| 413 | Ga0157372_10000491 | 3300013307 | Bacteria | 43650 |
| 414 | Ga0157372_10000743 | 3300013307 | Bacteria | 35537 |
| 415 | Ga0157372_10013303 | 3300013307 | Bacteria | 8782 |
| 416 | Ga0157372_10022186 | 3300013307 | Bacteria | 6868 |
| 417 | Ga0157372_10022799 | 3300013307 | Bacteria | 6778 |
| 418 | Ga0157372_10023113 | 3300013307 | Bacteria | 6737 |
| 419 | Ga0157372_10026508 | 3300013307 | Bacteria | 6306 |
| 420 | Ga0157372_10027365 | 3300013307 | Bacteria | 6208 |
| 421 | Ga0157372_10028841 | 3300013307 | Bacteria | 6058 |
| 422 | Ga0157372_10068044 | 3300013307 | Bacteria | 4004 |
| 423 | Ga0157372_10096034 | 3300013307 | Bacteria | 3377 |
| 424 | Ga0157372_10126998 | 3300013307 | Bacteria | 2932 |
| 425 | Ga0157372_10155883 | 3300013307 | Bacteria | 2638 |
| 426 | Ga0157372_10158258 | 3300013307 | Bacteria | 2617 |
| 427 | Ga0157372_10163110 | 3300013307 | Bacteria | 2576 |
| 428 | Ga0157372_10194104 | 3300013307 | Bacteria | 2352 |
| 429 | Ga0157372_10247929 | 3300013307 | Unclassified | 2067 |
| 430 | Ga0157372_10273431 | 3300013307 | Bacteria | 1963 |
| 431 | Ga0157372_10379938 | 3300013307 | Bacteria | 1646 |
| 432 | Ga0157372_10383313 | 3300013307 | Bacteria | 1638 |
| 433 | Ga0157372_10411411 | 3300013307 | Bacteria | 1576 |
| 434 | Ga0157372_10470354 | 3300013307 | Bacteria | 1465 |
| 435 | Ga0157372_10488169 | 3300013307 | Unclassified | 1436 |
| 436 | Ga0157372_10504147 | 3300013307 | Bacteria | 1411 |
| 437 | Ga0157372_10639285 | 3300013307 | Unclassified | 1239 |
| 438 | Ga0157372_10642061 | 3300013307 | Bacteria | 1236 |
| 439 | Ga0157372_10756841 | 3300013307 | Bacteria | 1129 |
| 440 | Ga0157372_11056316 | 3300013307 | Unclassified | 940 |
| 441 | Ga0157372_11194029 | 3300013307 | Bacteria | 879 |
| 442 | Ga0157372_11746619 | 3300013307 | Bacteria | 716 |
| 443 | Ga0157372_12277419 | 3300013307 | Bacteria | 622 |
| 444 | Ga0157375_10005786 | 3300013308 | Bacteria | 10756 |
| 445 | Ga0157375_10358647 | 3300013308 | Bacteria | 1624 |
| 446 | Ga0157375_10680630 | 3300013308 | Bacteria | 1183 |
| 447 | Ga0157375_11605296 | 3300013308 | Unclassified | 769 |
| 448 | Ga0163163_10000110 | 3300014325 | Bacteria | 87033 |
| 449 | Ga0163163_10000141 | 3300014325 | Bacteria | 74842 |
| 450 | Ga0163163_10624401 | 3300014325 | Bacteria | 1141 |
| 451 | Ga0157380_10017302 | 3300014326 | Bacteria | 5334 |
| 452 | Ga0157380_10027950 | 3300014326 | Bacteria | 4296 |
| 453 | Ga0157377_10859473 | 3300014745 | Unclassified | 674 |
| 454 | Ga0157379_10000173 | 3300014968 | Bacteria | 48672 |
| 455 | Ga0157379_10111532 | 3300014968 | Unclassified | 2457 |
| 456 | Ga0157379_10128901 | 3300014968 | Bacteria | 2276 |
| 457 | Ga0157379_11149748 | 3300014968 | Bacteria | 745 |
| 458 | Ga0157376_10000161 | 3300014969 | Bacteria | 46915 |
| 459 | Ga0157376_10038978 | 3300014969 | Bacteria | 3870 |
| 460 | Ga0157376_10071207 | 3300014969 | Bacteria | 2954 |
| 461 | Ga0157376_10112971 | 3300014969 | Bacteria | 2394 |
| 462 | Ga0157376_10128605 | 3300014969 | Bacteria | 2257 |
| 463 | Ga0157376_10130015 | 3300014969 | Unclassified | 2245 |
| 464 | Ga0157376_10215878 | 3300014969 | Bacteria | 1774 |
| 465 | Ga0182007_10061606 | 3300015262 | Bacteria | 1230 |
| 466 | Ga0163161_10025549 | 3300017792 | Bacteria | 4180 |
| 467 | Ga0163161_10055069 | 3300017792 | Bacteria | 2887 |
| 468 | Ga0163161_10417795 | 3300017792 | Bacteria | 1078 |
| 469 | Ga0209258_118393 | 3300025242 | Bacteria | 754 |
| 470 | Ga0209646_1000003 | 3300025246 | Bacteria | 1160860 |
| 471 | Ga0209646_1004846 | 3300025246 | Bacteria | 2412 |
| 472 | Ga0209026_1000354 | 3300025250 | Bacteria | 43355 |
| 473 | Ga0209758_1010470 | 3300025297 | Bacteria | 5543 |
| 474 | Ga0207426_1000187 | 3300025302 | Bacteria | 153809 |
| 475 | Ga0207656_10000689 | 3300025321 | Bacteria | 11059 |
| 476 | Ga0207656_10325344 | 3300025321 | Unclassified | 764 |
| 477 | Ga0207656_10372948 | 3300025321 | Bacteria | 715 |
| 478 | Ga0207642_10875472 | 3300025899 | Bacteria | 574 |
| 479 | Ga0207680_10025199 | 3300025903 | Bacteria | 3278 |
| 480 | Ga0207680_10026610 | 3300025903 | Bacteria | 3209 |
| 481 | Ga0207647_10027144 | 3300025904 | Bacteria | 3736 |
| 482 | Ga0207647_10152937 | 3300025904 | Bacteria | 1348 |
| 483 | Ga0207645_10002633 | 3300025907 | Bacteria | 13991 |
| 484 | Ga0207705_10038378 | 3300025909 | Unclassified | 3429 |
| 485 | Ga0207705_10045442 | 3300025909 | Bacteria | 3156 |
| 486 | Ga0207705_10085977 | 3300025909 | Bacteria | 2298 |
| 487 | Ga0207705_10138589 | 3300025909 | Bacteria | 1815 |
| 488 | Ga0207705_10141615 | 3300025909 | Bacteria | 1796 |
| 489 | Ga0207705_10458448 | 3300025909 | Unclassified | 989 |
| 490 | Ga0207654_10000461 | 3300025911 | Bacteria | 23222 |
| 491 | Ga0207654_10075484 | 3300025911 | Bacteria | 2015 |
| 492 | Ga0207654_10327240 | 3300025911 | Bacteria | 1049 |
| 493 | Ga0207707_10000189 | 3300025912 | Bacteria | 65118 |
| 494 | Ga0207707_10019690 | 3300025912 | Bacteria | 5891 |
| 495 | Ga0207707_10454074 | 3300025912 | Bacteria | 1096 |
| 496 | Ga0207707_10684626 | 3300025912 | Bacteria | 862 |
| 497 | Ga0207707_10878749 | 3300025912 | Bacteria | 742 |
| 498 | Ga0207707_11038884 | 3300025912 | Unclassified | 671 |
| 499 | Ga0207695_10000043 | 3300025913 | Bacteria | 444585 |
| 500 | Ga0207695_10000165 | 3300025913 | Bacteria | 195908 |
| 501 | Ga0207695_10000245 | 3300025913 | Bacteria | 141090 |
| 502 | Ga0207695_10018911 | 3300025913 | Bacteria | 7947 |
| 503 | Ga0207695_10022033 | 3300025913 | Bacteria | 7249 |
| 504 | Ga0207695_10045636 | 3300025913 | Bacteria | 4650 |
| 505 | Ga0207695_10132246 | 3300025913 | Bacteria | 2452 |
| 506 | Ga0207695_10343294 | 3300025913 | Bacteria | 1381 |
| 507 | Ga0207695_10471786 | 3300025913 | Bacteria | 1137 |
| 508 | Ga0207695_10514895 | 3300025913 | Bacteria | 1078 |
| 509 | Ga0207695_10917415 | 3300025913 | Bacteria | 755 |
| 510 | Ga0207671_10001487 | 3300025914 | Bacteria | 27036 |
| 511 | Ga0207671_10003937 | 3300025914 | Bacteria | 14476 |
| 512 | Ga0207671_10021318 | 3300025914 | Bacteria | 4917 |
| 513 | Ga0207671_10054170 | 3300025914 | Bacteria | 2972 |
| 514 | Ga0207671_10157562 | 3300025914 | Bacteria | 1757 |
| 515 | Ga0207671_10880713 | 3300025914 | Unclassified | 708 |
| 516 | Ga0207671_10894361 | 3300025914 | Bacteria | 702 |
| 517 | Ga0207671_11059949 | 3300025914 | Bacteria | 638 |
| 518 | Ga0207660_10008768 | 3300025917 | Bacteria | 6536 |
| 519 | Ga0207660_10089470 | 3300025917 | Bacteria | 2279 |
| 520 | Ga0207657_10030828 | 3300025919 | Bacteria | 4861 |
| 521 | Ga0207657_10117679 | 3300025919 | Bacteria | 2188 |
| 522 | Ga0207649_10147263 | 3300025920 | Bacteria | 1618 |
| 523 | Ga0207649_11470301 | 3300025920 | Unclassified | 539 |
| 524 | Ga0207652_10000108 | 3300025921 | Bacteria | 90141 |
| 525 | Ga0207652_10000488 | 3300025921 | Bacteria | 40566 |
| 526 | Ga0207652_10000541 | 3300025921 | Bacteria | 38299 |
| 527 | Ga0207652_10006784 | 3300025921 | Bacteria | 9232 |
| 528 | Ga0207652_10302214 | 3300025921 | Bacteria | 1444 |
| 529 | Ga0207652_10580575 | 3300025921 | Unclassified | 1006 |
| 530 | Ga0207652_11022573 | 3300025921 | Bacteria | 725 |
| 531 | Ga0207681_10333896 | 3300025923 | Bacteria | 1209 |
| 532 | Ga0207694_10071132 | 3300025924 | Bacteria | 2718 |
| 533 | Ga0207694_10361507 | 3300025924 | Bacteria | 1203 |
| 534 | Ga0207650_10079343 | 3300025925 | Bacteria | 2486 |
| 535 | Ga0207650_10124027 | 3300025925 | Bacteria | 2014 |
| 536 | Ga0207650_10349277 | 3300025925 | Bacteria | 1216 |
| 537 | Ga0207650_10409968 | 3300025925 | Unclassified | 1123 |
| 538 | Ga0207650_10655848 | 3300025925 | Bacteria | 885 |
| 539 | Ga0207659_10045959 | 3300025926 | Bacteria | 3081 |
| 540 | Ga0207659_10279631 | 3300025926 | Unclassified | 1364 |
| 541 | Ga0207659_10411885 | 3300025926 | Bacteria | 1132 |
| 542 | Ga0207659_10761216 | 3300025926 | Bacteria | 831 |
| 543 | Ga0207687_10277810 | 3300025927 | Bacteria | 1341 |
| 544 | Ga0207664_10790997 | 3300025929 | Bacteria | 853 |
| 545 | Ga0207644_10361149 | 3300025931 | Bacteria | 1181 |
| 546 | Ga0207690_10052425 | 3300025932 | Bacteria | 2732 |
| 547 | Ga0207690_10119304 | 3300025932 | Bacteria | 1913 |
| 548 | Ga0207690_11118076 | 3300025932 | Unclassified | 657 |
| 549 | Ga0207690_11407193 | 3300025932 | Bacteria | 583 |
| 550 | Ga0207706_10011353 | 3300025933 | Bacteria | 8117 |
| 551 | Ga0207686_10302721 | 3300025934 | Unclassified | 1188 |
| 552 | Ga0207704_10011472 | 3300025938 | Bacteria | 4362 |
| 553 | Ga0207704_10329890 | 3300025938 | Bacteria | 1180 |
| 554 | Ga0207691_10000504 | 3300025940 | Bacteria | 38867 |
| 555 | Ga0207691_10088931 | 3300025940 | Bacteria | 2770 |
| 556 | Ga0207691_11166351 | 3300025940 | Unclassified | 639 |
| 557 | Ga0207711_10088422 | 3300025941 | Bacteria | 2720 |
| 558 | Ga0207689_11126832 | 3300025942 | Bacteria | 661 |
| 559 | Ga0207661_10005276 | 3300025944 | Bacteria | 9098 |
| 560 | Ga0207661_10120463 | 3300025944 | Bacteria | 2233 |
| 561 | Ga0207661_10172657 | 3300025944 | Bacteria | 1883 |
| 562 | Ga0207661_10302191 | 3300025944 | Bacteria | 1435 |
| 563 | Ga0207679_10023361 | 3300025945 | Bacteria | 4227 |
| 564 | Ga0207679_10042309 | 3300025945 | Bacteria | 3273 |
| 565 | Ga0207667_10000440 | 3300025949 | Bacteria | 55666 |
| 566 | Ga0207667_10000913 | 3300025949 | Bacteria | 37630 |
| 567 | Ga0207667_10005535 | 3300025949 | Bacteria | 15417 |
| 568 | Ga0207667_10026291 | 3300025949 | Bacteria | 6361 |
| 569 | Ga0207667_10029218 | 3300025949 | Bacteria | 5980 |
| 570 | Ga0207667_10076678 | 3300025949 | Bacteria | 3469 |
| 571 | Ga0207667_10118271 | 3300025949 | Bacteria | 2731 |
| 572 | Ga0207667_10208352 | 3300025949 | Bacteria | 2004 |
| 573 | Ga0207667_10306641 | 3300025949 | Unclassified | 1622 |
| 574 | Ga0207667_10635462 | 3300025949 | Bacteria | 1074 |
| 575 | Ga0207651_10006216 | 3300025960 | Bacteria | 6220 |
| 576 | Ga0207712_10185645 | 3300025961 | Bacteria | 1637 |
| 577 | Ga0207712_10224263 | 3300025961 | Bacteria | 1504 |
| 578 | Ga0207712_10398572 | 3300025961 | Bacteria | 1156 |
| 579 | Ga0207668_10002658 | 3300025972 | Bacteria | 10461 |
| 580 | Ga0207668_10968648 | 3300025972 | Bacteria | 759 |
| 581 | Ga0207640_10011035 | 3300025981 | Bacteria | 5103 |
| 582 | Ga0207640_10056140 | 3300025981 | Bacteria | 2583 |
| 583 | Ga0207640_10056558 | 3300025981 | Unclassified | 2576 |
| 584 | Ga0207640_10376113 | 3300025981 | Bacteria | 1149 |
| 585 | Ga0207640_10574856 | 3300025981 | Bacteria | 950 |
| 586 | Ga0207640_10577986 | 3300025981 | Unclassified | 948 |
| 587 | Ga0207640_11103547 | 3300025981 | Bacteria | 702 |
| 588 | Ga0207658_10005579 | 3300025986 | Bacteria | 8609 |
| 589 | Ga0207658_11639447 | 3300025986 | Bacteria | 588 |
| 590 | Ga0207677_10005078 | 3300026023 | Bacteria | 7113 |
| 591 | Ga0207677_10068348 | 3300026023 | Bacteria | 2493 |
| 592 | Ga0207677_10748268 | 3300026023 | Bacteria | 871 |
| 593 | Ga0207677_10770476 | 3300026023 | Bacteria | 859 |
| 594 | Ga0207703_11514825 | 3300026035 | Bacteria | 645 |
| 595 | Ga0207639_10002969 | 3300026041 | Bacteria | 11409 |
| 596 | Ga0207639_10024472 | 3300026041 | Bacteria | 4370 |
| 597 | Ga0207639_10027754 | 3300026041 | Bacteria | 4127 |
| 598 | Ga0207639_10057585 | 3300026041 | Bacteria | 2985 |
| 599 | Ga0207639_10059783 | 3300026041 | Bacteria | 2938 |
| 600 | Ga0207639_10066611 | 3300026041 | Bacteria | 2800 |
| 601 | Ga0207639_10135570 | 3300026041 | Bacteria | 2044 |
| 602 | Ga0207639_10287741 | 3300026041 | Bacteria | 1448 |
| 603 | Ga0207639_10314621 | 3300026041 | Bacteria | 1388 |
| 604 | Ga0207639_10431171 | 3300026041 | Bacteria | 1194 |
| 605 | Ga0207639_10888374 | 3300026041 | Bacteria | 833 |
| 606 | Ga0207639_10998902 | 3300026041 | Bacteria | 784 |
| 607 | Ga0207639_11121637 | 3300026041 | Bacteria | 738 |
| 608 | Ga0207639_11142419 | 3300026041 | Unclassified | 731 |
| 609 | Ga0207678_10051627 | 3300026067 | Bacteria | 3550 |
| 610 | Ga0207678_10230755 | 3300026067 | Bacteria | 1585 |
| 611 | Ga0207702_10000196 | 3300026078 | Bacteria | 71703 |
| 612 | Ga0207702_10310831 | 3300026078 | Bacteria | 1498 |
| 613 | Ga0207702_10348991 | 3300026078 | Bacteria | 1415 |
| 614 | Ga0207702_10454063 | 3300026078 | Bacteria | 1244 |
| 615 | Ga0207702_10511677 | 3300026078 | Bacteria | 1171 |
| 616 | Ga0207702_10530628 | 3300026078 | Bacteria | 1150 |
| 617 | Ga0207702_10704480 | 3300026078 | Bacteria | 995 |
| 618 | Ga0207641_10009580 | 3300026088 | Bacteria | 7981 |
| 619 | Ga0207641_10233320 | 3300026088 | Bacteria | 1711 |
| 620 | Ga0207641_10767029 | 3300026088 | Bacteria | 953 |
| 621 | Ga0207641_11010939 | 3300026088 | Bacteria | 828 |
| 622 | Ga0207648_10016152 | 3300026089 | Bacteria | 6835 |
| 623 | Ga0207648_10146611 | 3300026089 | Bacteria | 2082 |
| 624 | Ga0207648_11108245 | 3300026089 | Bacteria | 742 |
| 625 | Ga0207648_11475912 | 3300026089 | Bacteria | 639 |
| 626 | Ga0207676_10003314 | 3300026095 | Bacteria | 11431 |
| 627 | Ga0207676_10527722 | 3300026095 | Bacteria | 1125 |
| 628 | Ga0207674_10004216 | 3300026116 | Bacteria | 17351 |
| 629 | Ga0207674_10064985 | 3300026116 | Unclassified | 3679 |
| 630 | Ga0207674_10075665 | 3300026116 | Bacteria | 3376 |
| 631 | Ga0207674_10166256 | 3300026116 | Bacteria | 2160 |
| 632 | Ga0207674_10571067 | 3300026116 | Unclassified | 1092 |
| 633 | Ga0207674_10885068 | 3300026116 | Bacteria | 861 |
| 634 | Ga0207674_11598521 | 3300026116 | Bacteria | 620 |
| 635 | Ga0207675_100314802 | 3300026118 | Bacteria | 1527 |
| 636 | Ga0207683_10821794 | 3300026121 | Unclassified | 863 |
| 637 | Ga0207698_10006493 | 3300026142 | Bacteria | 7301 |
| 638 | Ga0207698_10013137 | 3300026142 | Bacteria | 5451 |
| 639 | Ga0207698_10015088 | 3300026142 | Bacteria | 5163 |
| 640 | Ga0207698_10039245 | 3300026142 | Bacteria | 3506 |
| 641 | Ga0207698_10125756 | 3300026142 | Bacteria | 2180 |
| 642 | Ga0207698_10166241 | 3300026142 | Unclassified | 1936 |
| 643 | Ga0207698_10258120 | 3300026142 | Bacteria | 1599 |
| 644 | Ga0207698_10459509 | 3300026142 | Bacteria | 1231 |
| 645 | Ga0207698_10543750 | 3300026142 | Bacteria | 1137 |
| 646 | Ga0207698_10717569 | 3300026142 | Bacteria | 996 |
| 647 | Ga0207698_10819015 | 3300026142 | Unclassified | 934 |
| 648 | Ga0209974_10218506 | 3300027876 | Bacteria | 709 |
| 649 | Ga0268266_10000149 | 3300028379 | Bacteria | 134809 |
| 650 | Ga0268266_10001023 | 3300028379 | Bacteria | 35230 |
| 651 | Ga0268265_11818903 | 3300028380 | Unclassified | 616 |
| 652 | Ga0268264_10000064 | 3300028381 | Bacteria | 301274 |
| 653 | Ga0268264_10003688 | 3300028381 | Bacteria | 13141 |
| 654 | Ga0268264_10006580 | 3300028381 | Bacteria | 9783 |
| 655 | Ga0268264_10007122 | 3300028381 | Bacteria | 9374 |
| 656 | Ga0268264_10010089 | 3300028381 | Bacteria | 7819 |
| 657 | Ga0268264_10949680 | 3300028381 | Bacteria | 865 |
| 658 | Ga0268264_11061143 | 3300028381 | Bacteria | 818 |
| 659 | Ga0307517_10005503 | 3300028786 | Bacteria | 19046 |
| 660 | Ga0307517_10152802 | 3300028786 | Bacteria | 1578 |
| 661 | Ga0307517_10159858 | 3300028786 | Bacteria | 1516 |
| 662 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 663 | Ga0307511_10000138 | 3300030521 | Bacteria | 67742 |
| 664 | Ga0307512_10133321 | 3300030522 | Bacteria | 1549 |
| 665 | Ga0265328_10000178 | 3300031239 | Bacteria | 29493 |
| 666 | Ga0265331_10192826 | 3300031250 | Bacteria | 919 |
| 667 | Ga0265327_10006475 | 3300031251 | Bacteria | 9351 |
| 668 | Ga0265327_10117858 | 3300031251 | Bacteria | 1262 |
| 669 | Ga0307513_10191568 | 3300031456 | Bacteria | 1896 |
| 670 | Ga0307513_10353112 | 3300031456 | Bacteria | 1217 |
| 671 | Ga0307513_10475104 | 3300031456 | Bacteria | 971 |
| 672 | Ga0307509_10069660 | 3300031507 | Bacteria | 3676 |
| 673 | Ga0307509_10097887 | 3300031507 | Bacteria | 2981 |
| 674 | Ga0307408_100459300 | 3300031548 | Unclassified | 1106 |
| 675 | Ga0307516_10001145 | 3300031730 | Bacteria | 37050 |
| 676 | Ga0307516_10359410 | 3300031730 | Bacteria | 1121 |
| 677 | Ga0307405_10378338 | 3300031731 | Unclassified | 1101 |
| 678 | Ga0307405_10466476 | 3300031731 | Unclassified | 1005 |
| 679 | Ga0307413_10017191 | 3300031824 | Bacteria | 3761 |
| 680 | Ga0307410_10107562 | 3300031852 | Unclassified | 2012 |
| 681 | Ga0307410_10749031 | 3300031852 | Bacteria | 827 |
| 682 | Ga0307406_10059138 | 3300031901 | Bacteria | 2466 |
| 683 | Ga0307407_10133542 | 3300031903 | Unclassified | 1591 |
| 684 | Ga0307412_10360837 | 3300031911 | Bacteria | 1170 |
| 685 | Ga0307412_10518966 | 3300031911 | Bacteria | 995 |
| 686 | Ga0307409_100187413 | 3300031995 | Bacteria | 1838 |
| 687 | Ga0307416_100220455 | 3300032002 | Unclassified | 1818 |
| 688 | Ga0307411_10576888 | 3300032005 | Unclassified | 964 |
| 689 | Ga0307411_10684159 | 3300032005 | Bacteria | 892 |
| 690 | Ga0307415_100080628 | 3300032126 | Unclassified | 2322 |
| 691 | Ga0307510_10000079 | 3300033180 | Bacteria | 73286 |
| 692 | Ga0373945_0145253 | 3300035116 | Bacteria | 959 |
| 693 | Ga0373953_0281453 | 3300035117 | Bacteria | 725 |
| 694 | Ga0373935_0814793 | 3300035692 | Unclassified | 690 |
| 695 | Ga0373927_0066611 | 3300035695 | Bacteria | 2330 |
| 696 | Ga0373933_0578245 | 3300035724 | Bacteria | 737 |
| 697 | Ga0373937_0409249 | 3300036401 | Bacteria | 1287 |
| 698 | Ga0373937_0932126 | 3300036401 | Bacteria | 817 |
| 699 | Ga0373925_1437866 | 3300037068 | Unclassified | 565 |
| 700 | Ga0395899_0003463 | 3300037312 | Bacteria | 12509 |
| 701 | Ga0395899_0009069 | 3300037312 | Bacteria | 7646 |
| 702 | Ga0395899_0096340 | 3300037312 | Bacteria | 2139 |
| 703 | Ga0395899_0371871 | 3300037312 | Bacteria | 951 |
| 704 | Ga0395899_0726682 | 3300037312 | Bacteria | 620 |
| 705 | Ga0395900_0014175 | 3300037418 | Bacteria | 8140 |
| 706 | Ga0395900_0022808 | 3300037418 | Bacteria | 6404 |
| 707 | Ga0395900_0071784 | 3300037418 | Bacteria | 3559 |
| 708 | Ga0395900_0206909 | 3300037418 | Bacteria | 1983 |
| 709 | Ga0395900_0252503 | 3300037418 | Bacteria | 1764 |
| 710 | Ga0395900_0524837 | 3300037418 | Bacteria | 1131 |
| 711 | Ga0395900_0853988 | 3300037418 | Bacteria | 836 |
| 712 | Ga0395898_0006358 | 3300037466 | Bacteria | 12617 |
| 713 | Ga0395898_0051146 | 3300037466 | Bacteria | 4041 |
| 714 | Ga0395898_0065837 | 3300037466 | Bacteria | 3513 |
| 715 | Ga0395898_0086973 | 3300037466 | Unclassified | 3011 |
| 716 | Ga0395898_0839248 | 3300037466 | Bacteria | 858 |
| 717 | Ga0395905_0012427 | 3300037471 | Bacteria | 8195 |
| 718 | Ga0395905_0092339 | 3300037471 | Bacteria | 2839 |
| 719 | Ga0395905_0098529 | 3300037471 | Bacteria | 2745 |
| 720 | Ga0395905_0330809 | 3300037471 | Bacteria | 1414 |
| 721 | Ga0395905_1105057 | 3300037471 | Bacteria | 696 |
| 722 | Ga0395901_0005285 | 3300038443 | Bacteria | 13046 |
| 723 | Ga0395901_0007090 | 3300038443 | Bacteria | 11330 |
| 724 | Ga0395901_0208681 | 3300038443 | Bacteria | 2045 |
| 725 | Ga0395901_0228237 | 3300038443 | Bacteria | 1944 |
| 726 | Ga0395901_0261342 | 3300038443 | Bacteria | 1802 |
| 727 | Ga0395901_0272795 | 3300038443 | Bacteria | 1759 |
| 728 | Ga0400489_65840 | 3300039093 | Bacteria | 109575 |
| 729 | Ga0439439_0008781 | 3300041406 | Bacteria | 2392 |
| 730 | Ga0439439_0098972 | 3300041406 | Bacteria | 802 |
| 731 | Ga0439466_0130768 | 3300041411 | Bacteria | 773 |
| 732 | Ga0439465_0021806 | 3300041413 | Bacteria | 2011 |
| 733 | Ga0451791_0054266 | 3300041451 | Bacteria | 576 |
| 734 | Ga0451797_0773780 | 3300041453 | Bacteria | 645 |
| 735 | Ga0451800_0408194 | 3300041459 | Bacteria | 1201 |
| 736 | Ga0451804_0480600 | 3300041463 | Bacteria | 569 |
| 737 | Ga0451839_1376007 | 3300041496 | Bacteria | 771 |
| 738 | Ga0451853_1710672 | 3300041512 | Bacteria | 714 |
| 739 | Ga0439433_0045135 | 3300041999 | Unclassified | 1031 |
| 740 | Ga0439445_0204515 | 3300042004 | Unclassified | 584 |
| 741 | Ga0439449_0006193 | 3300042007 | Bacteria | 4573 |
| 742 | Ga0439449_0023388 | 3300042007 | Bacteria | 2311 |
| 743 | Ga0439449_0129548 | 3300042007 | Bacteria | 937 |
| 744 | Ga0439457_002491 | 3300042014 | Bacteria | 5244 |
| 745 | Ga0439457_003703 | 3300042014 | Bacteria | 4118 |
| 746 | Ga0439457_063908 | 3300042014 | Bacteria | 835 |
| 747 | Ga0439462_0112443 | 3300042015 | Bacteria | 754 |
| 748 | Ga0439434_0069067 | 3300042435 | Bacteria | 1111 |
| 749 | Ga0451577_0751752 | 3300042876 | Unclassified | 882 |
| 750 | Ga0466969_0000137 | 3300044656 | Bacteria | 39423 |
| 751 | Ga0466972_0000022 | 3300044658 | Bacteria | 193802 |
| 752 | Ga0466972_0000092 | 3300044658 | Bacteria | 80656 |
| 753 | Ga0466972_0032139 | 3300044658 | Bacteria | 2578 |
| 754 | Ga0466972_0316773 | 3300044658 | Bacteria | 729 |
| 755 | Ga0466965_0019968 | 3300044683 | Bacteria | 3218 |
| 756 | Ga0466966_0000099 | 3300044684 | Bacteria | 53474 |
| 757 | Ga0466966_0770624 | 3300044684 | Unclassified | 580 |
| 758 | Ga0466966_0889819 | 3300044684 | Bacteria | 537 |
| 759 | Ga0466961_0070712 | 3300044693 | Bacteria | 2215 |
| 760 | Ga0466964_0153667 | 3300044706 | Bacteria | 1069 |
| 761 | Ga0453684_0055495 | 3300044712 | Bacteria | 5150 |
| 762 | Ga0466968_0082961 | 3300044735 | Unclassified | 1411 |
| 763 | Ga0466970_0000532 | 3300044765 | Bacteria | 18635 |
| 764 | Ga0466970_0174417 | 3300044765 | Bacteria | 1192 |
| 765 | Ga0466970_0258952 | 3300044765 | Bacteria | 976 |
| 766 | Ga0466957_0000466 | 3300044842 | Bacteria | 20090 |
| 767 | Ga0466957_0004991 | 3300044842 | Bacteria | 7424 |
| 768 | Ga0466960_0166591 | 3300044901 | Bacteria | 1187 |
| 769 | Ga0466959_0000168 | 3300045049 | Bacteria | 43448 |
| 770 | Ga0466959_0005279 | 3300045049 | Bacteria | 8826 |
| 771 | Ga0451576_0391922 | 3300045051 | Unclassified | 1456 |
| 772 | Ga0495629_0076785 | 3300046459 | Bacteria | 2332 |
| 773 | Ga0495638_0063666 | 3300046460 | Bacteria | 2273 |
| 774 | Ga0495638_0175877 | 3300046460 | Bacteria | 1225 |
| 775 | Ga0495638_0240024 | 3300046460 | Bacteria | 1004 |
| 776 | Ga0495638_0290966 | 3300046460 | Bacteria | 884 |
| 777 | Ga0495651_0591747 | 3300046462 | Bacteria | 701 |
| 778 | Ga0495580_0359711 | 3300046472 | Unclassified | 985 |
| 779 | Ga0495606_0025229 | 3300046507 | Bacteria | 4262 |
| 780 | Ga0495630_0265099 | 3300046517 | Bacteria | 1312 |
| 781 | Ga0495630_0358162 | 3300046517 | Unclassified | 1117 |
| 782 | Ga0495632_0514253 | 3300046519 | Bacteria | 515 |
| 783 | Ga0495643_0198624 | 3300046522 | Bacteria | 964 |
| 784 | Ga0495648_0002037 | 3300046524 | Bacteria | 19167 |
| 785 | Ga0495586_0115541 | 3300046535 | Bacteria | 1496 |
| 786 | Ga0495645_0328102 | 3300046543 | Unclassified | 992 |
| 787 | Ga0495633_0147540 | 3300046558 | Bacteria | 1087 |
| 788 | Ga0495668_0000154 | 3300046616 | Bacteria | 104449 |
| 789 | Ga0495668_0000677 | 3300046616 | Bacteria | 41080 |
| 790 | Ga0495668_0015303 | 3300046616 | Bacteria | 4484 |
| 791 | Ga0495611_0000332 | 3300046648 | Bacteria | 30928 |
| 792 | Ga0495611_0078841 | 3300046648 | Bacteria | 1512 |
| 793 | Ga0495625_0052916 | 3300046660 | Unclassified | 2906 |
| 794 | Ga0495647_0025952 | 3300046681 | Bacteria | 2144 |
| 795 | Ga0495658_0187101 | 3300046683 | Bacteria | 1286 |
| 796 | Ga0495649_0353854 | 3300046694 | Bacteria | 742 |
| 797 | Ga0495600_0711016 | 3300046809 | Bacteria | 604 |
| 798 | Ga0495604_0957620 | 3300047317 | Bacteria | 532 |
| 799 | Ga0495674_0057744 | 3300047319 | Unclassified | 3396 |
| 800 | Ga0495672_0018373 | 3300047320 | Bacteria | 4645 |
| 801 | Ga0495672_0059736 | 3300047320 | Bacteria | 2205 |
| 802 | Ga0495672_0320735 | 3300047320 | Bacteria | 728 |
| 803 | Ga0495680_0172064 | 3300047322 | Unclassified | 1568 |
| 804 | Ga0495687_000158 | 3300047443 | Bacteria | 103129 |
| 805 | Ga0495686_0000039 | 3300047472 | Bacteria | 304821 |
| 806 | Ga0496107_0767771 | 3300048910 | Unclassified | 707 |
| 807 | Ga0496109_0059916 | 3300048912 | Bacteria | 3478 |
| 808 | Ga0496110_0451990 | 3300048913 | Bacteria | 1171 |
| 809 | Ga0501290_001874 | 3300049513 | Bacteria | 2782 |
| 810 | Ga0501296_047512 | 3300049519 | Unclassified | 621 |
| 811 | Ga0501297_001523 | 3300049520 | Bacteria | 2144 |
| 812 | Ga0501298_000658 | 3300049521 | Bacteria | 4774 |
| 813 | Ga0501303_016736 | 3300049526 | Bacteria | 745 |
| 814 | Ga0501031_0622664 | 3300049568 | Bacteria | 694 |
| 815 | Ga0501032_0023384 | 3300049569 | Bacteria | 4271 |
| 816 | Ga0501032_0238516 | 3300049569 | Bacteria | 1182 |
| 817 | Ga0501032_0257147 | 3300049569 | Bacteria | 1133 |
| 818 | Ga0501033_0059991 | 3300049570 | Bacteria | 2808 |
| 819 | Ga0501033_0213880 | 3300049570 | Bacteria | 1374 |
| 820 | Ga0501033_0388736 | 3300049570 | Bacteria | 974 |
| 821 | Ga0501033_0459996 | 3300049570 | Bacteria | 883 |
| 822 | Ga0501033_0705414 | 3300049570 | Bacteria | 686 |
| 823 | Ga0501034_0000017 | 3300049571 | Bacteria | 285938 |
| 824 | Ga0501034_0028132 | 3300049571 | Bacteria | 5718 |
| 825 | Ga0501034_0132885 | 3300049571 | Bacteria | 2471 |
| 826 | Ga0501034_0196888 | 3300049571 | Bacteria | 1974 |
| 827 | Ga0501034_0313961 | 3300049571 | Bacteria | 1501 |
| 828 | Ga0501034_0797795 | 3300049571 | Bacteria | 837 |
| 829 | Ga0501036_0065446 | 3300049572 | Bacteria | 3077 |
| 830 | Ga0501036_0440885 | 3300049572 | Bacteria | 1085 |
| 831 | Ga0501037_0014175 | 3300049573 | Bacteria | 5869 |
| 832 | Ga0501037_0242565 | 3300049573 | Bacteria | 1263 |
| 833 | Ga0501038_0129016 | 3300049574 | Bacteria | 2078 |
| 834 | Ga0501038_0320067 | 3300049574 | Bacteria | 1214 |
| 835 | Ga0501039_0119485 | 3300049575 | Bacteria | 2065 |
| 836 | Ga0501039_0222623 | 3300049575 | Bacteria | 1483 |
| 837 | Ga0501043_0046149 | 3300049579 | Bacteria | 3426 |
| 838 | Ga0501043_0055913 | 3300049579 | Bacteria | 3100 |
| 839 | Ga0501043_0099720 | 3300049579 | Bacteria | 2283 |
| 840 | Ga0501046_0038760 | 3300049580 | Bacteria | 3822 |
| 841 | Ga0501046_0274617 | 3300049580 | Bacteria | 1236 |
| 842 | Ga0501046_0863469 | 3300049580 | Bacteria | 632 |
| 843 | Ga0501047_0030221 | 3300049581 | Bacteria | 5224 |
| 844 | Ga0501047_0033592 | 3300049581 | Bacteria | 4951 |
| 845 | Ga0501047_0058284 | 3300049581 | Bacteria | 3731 |
| 846 | Ga0501047_0080375 | 3300049581 | Bacteria | 3133 |
| 847 | Ga0501047_0219648 | 3300049581 | Bacteria | 1757 |
| 848 | Ga0501047_0459782 | 3300049581 | Bacteria | 1102 |
| 849 | Ga0501068_0296085 | 3300049584 | Bacteria | 1035 |
| 850 | Ga0501069_0008721 | 3300049585 | Bacteria | 5340 |
| 851 | Ga0501070_0015045 | 3300049586 | Bacteria | 6511 |
| 852 | Ga0501070_0190520 | 3300049586 | Bacteria | 1686 |
| 853 | Ga0501070_0282817 | 3300049586 | Bacteria | 1353 |
| 854 | Ga0501071_0334070 | 3300049587 | Bacteria | 1152 |
| 855 | Ga0501073_0057263 | 3300049589 | Bacteria | 2725 |
| 856 | Ga0501074_0082207 | 3300049590 | Bacteria | 2310 |
| 857 | Ga0501198_000777 | 3300049649 | Bacteria | 3979 |
| 858 | Ga0501198_001784 | 3300049649 | Bacteria | 2841 |
| 859 | Ga0501201_013587 | 3300049651 | Bacteria | 818 |
| 860 | Ga0501202_001001 | 3300049652 | Bacteria | 4371 |
| 861 | Ga0501202_006139 | 3300049652 | Bacteria | 2144 |
| 862 | Ga0501202_029099 | 3300049652 | Bacteria | 1144 |
| 863 | Ga0501202_030359 | 3300049652 | Bacteria | 1124 |
| 864 | Ga0501202_072408 | 3300049652 | Bacteria | 797 |
| 865 | Ga0501206_006929 | 3300049653 | Bacteria | 1479 |
| 866 | Ga0501207_009759 | 3300049654 | Bacteria | 1406 |
| 867 | Ga0501209_208440 | 3300049656 | Bacteria | 603 |
| 868 | Ga0501216_016161 | 3300049660 | Bacteria | 1264 |
| 869 | Ga0501217_001447 | 3300049661 | Bacteria | 4450 |
| 870 | Ga0501217_030240 | 3300049661 | Bacteria | 1328 |
| 871 | Ga0501217_080562 | 3300049661 | Bacteria | 900 |
| 872 | Ga0501222_001059 | 3300049662 | Bacteria | 3892 |
| 873 | Ga0501222_013996 | 3300049662 | Bacteria | 1057 |
| 874 | Ga0501223_001511 | 3300049663 | Bacteria | 5368 |
| 875 | Ga0501223_003075 | 3300049663 | Bacteria | 3645 |
| 876 | Ga0501223_013336 | 3300049663 | Bacteria | 1638 |
| 877 | Ga0501223_140393 | 3300049663 | Bacteria | 520 |
| 878 | Ga0501228_017431 | 3300049666 | Bacteria | 784 |
| 879 | Ga0501233_002077 | 3300049668 | Bacteria | 3493 |
| 880 | Ga0501233_068635 | 3300049668 | Unclassified | 894 |
| 881 | Ga0501235_001131 | 3300049669 | Bacteria | 5594 |
| 882 | Ga0501235_043301 | 3300049669 | Unclassified | 1033 |
| 883 | Ga0501235_071188 | 3300049669 | Unclassified | 823 |
| 884 | Ga0501236_094090 | 3300049670 | Unclassified | 579 |
| 885 | Ga0501238_045298 | 3300049671 | Unclassified | 653 |
| 886 | Ga0501240_001076 | 3300049673 | Bacteria | 2539 |
| 887 | Ga0501240_001307 | 3300049673 | Bacteria | 2389 |
| 888 | Ga0501242_000055 | 3300049674 | Bacteria | 7020 |
| 889 | Ga0501242_012656 | 3300049674 | Bacteria | 1029 |
| 890 | Ga0501243_000076 | 3300049675 | Bacteria | 9930 |
| 891 | Ga0501251_003567 | 3300049681 | Unclassified | 1563 |
| 892 | Ga0501252_008652 | 3300049682 | Bacteria | 1173 |
| 893 | Ga0501253_005555 | 3300049683 | Bacteria | 1661 |
| 894 | Ga0501253_041367 | 3300049683 | Unclassified | 930 |
| 895 | Ga0501253_112155 | 3300049683 | Bacteria | 651 |
| 896 | Ga0501256_027286 | 3300049685 | Unclassified | 628 |
| 897 | Ga0501257_003176 | 3300049686 | Bacteria | 3503 |
| 898 | Ga0501257_050221 | 3300049686 | Bacteria | 1039 |
| 899 | Ga0501257_057675 | 3300049686 | Bacteria | 977 |
| 900 | Ga0501259_000372 | 3300049688 | Bacteria | 7050 |
| 901 | Ga0501261_000749 | 3300049690 | Bacteria | 4039 |
| 902 | Ga0501219_000125 | 3300049703 | Bacteria | 13450 |
| 903 | Ga0501221_000930 | 3300049704 | Bacteria | 4798 |
| 904 | Ga0501221_012115 | 3300049704 | Bacteria | 1564 |
| 905 | Ga0501225_0002496 | 3300049705 | Bacteria | 5692 |
| 906 | Ga0501225_0008265 | 3300049705 | Bacteria | 2993 |
| 907 | Ga0501225_0021845 | 3300049705 | Bacteria | 1766 |
| 908 | Ga0501234_001139 | 3300049707 | Bacteria | 4200 |
| 909 | Ga0501234_004250 | 3300049707 | Bacteria | 2247 |
| 910 | Ga0501245_002798 | 3300049708 | Bacteria | 2344 |
| 911 | Ga0501245_055874 | 3300049708 | Unclassified | 710 |
| 912 | Ga0501079_0161539 | 3300049741 | Bacteria | 1747 |
| 913 | Ga0501080_0137358 | 3300049742 | Bacteria | 2261 |
| 914 | Ga0501083_0710872 | 3300049744 | Bacteria | 653 |
| 915 | Ga0501241_076992 | 3300049758 | Bacteria | 689 |
| 916 | Ga0501263_002383 | 3300049760 | Bacteria | 1908 |
| 917 | Ga0501264_035675 | 3300049761 | Bacteria | 591 |
| 918 | Ga0501268_003833 | 3300049765 | Bacteria | 2084 |
| 919 | Ga0501268_024368 | 3300049765 | Bacteria | 1057 |
| 920 | Ga0501268_035098 | 3300049765 | Bacteria | 924 |
| 921 | Ga0501273_002795 | 3300049770 | Bacteria | 1805 |
| 922 | Ga0501280_013972 | 3300049776 | Bacteria | 1139 |
| 923 | Ga0501283_001578 | 3300049779 | Bacteria | 2959 |
| 924 | Ga0501035_0059951 | 3300049822 | Bacteria | 3389 |
| 925 | Ga0501035_0134106 | 3300049822 | Bacteria | 2157 |
| 926 | Ga0501035_0425957 | 3300049822 | Bacteria | 1101 |
| 927 | Ga0501035_0855139 | 3300049822 | Bacteria | 723 |
| 928 | Ga0501044_0019152 | 3300049823 | Bacteria | 7327 |
| 929 | Ga0501044_0103134 | 3300049823 | Bacteria | 2867 |
| 930 | Ga0501044_0155291 | 3300049823 | Bacteria | 2268 |
| 931 | Ga0501044_0467521 | 3300049823 | Bacteria | 1166 |
| 932 | Ga0501044_1008850 | 3300049823 | Unclassified | 704 |
| 933 | Ga0501212_001332 | 3300049851 | Bacteria | 2763 |
| 934 | Ga0501284_00045 | 3300050005 | Bacteria | 48266 |
| 935 | nmdc:mga0k408_117051_c1 | 3300050493 | Bacteria | 1577 |
| 936 | nmdc:mga0k408_165544_c1 | 3300050493 | Bacteria | 1317 |
| 937 | nmdc:mga0k408_28006_c1 | 3300050493 | Bacteria | 3202 |
| 938 | nmdc:mga0k408_43685_c1 | 3300050493 | Bacteria | 2583 |
| 939 | nmdc:mga0k408_680723_c1 | 3300050493 | Bacteria | 603 |
| 940 | nmdc:mga07m45_66317_c1 | 3300050496 | Bacteria | 2050 |
| 941 | nmdc:mga05p37_8699_c1 | 3300050507 | Bacteria | 11994 |
| 942 | nmdc:mga08y16_195457_c1 | 3300050511 | Bacteria | 2097 |
| 943 | Ga0495619_0292841 | 3300053085 | Unclassified | 1128 |
| 944 | Ga0500578_0001189 | 3300053086 | Bacteria | 27522 |
| 945 | Ga0500578_0100816 | 3300053086 | Bacteria | 1827 |
| 946 | Ga0500578_0301507 | 3300053086 | Bacteria | 950 |
| 947 | Ga0500644_0028545 | 3300053088 | Bacteria | 1746 |
| 948 | Ga0500646_0025903 | 3300053090 | Bacteria | 1587 |
| 949 | Ga0500583_0000018 | 3300053092 | Bacteria | 138148 |
| 950 | Ga0500583_0000832 | 3300053092 | Bacteria | 8881 |
| 951 | Ga0500583_0100582 | 3300053092 | Bacteria | 1416 |
| 952 | Ga0500651_0302033 | 3300053093 | Bacteria | 918 |
| 953 | Ga0500650_0282150 | 3300053098 | Bacteria | 738 |
| 954 | Ga0500556_0015828 | 3300053104 | Unclassified | 2335 |
| 955 | Ga0500556_0276711 | 3300053104 | Bacteria | 658 |
| 956 | Ga0500642_0001731 | 3300053130 | Bacteria | 6295 |
| 957 | Ga0500642_0006130 | 3300053130 | Bacteria | 3936 |
| 958 | Ga0500642_0203315 | 3300053130 | Bacteria | 921 |
| 959 | Ga0500652_002787 | 3300053131 | Bacteria | 5278 |
| 960 | Ga0500655_028713 | 3300053133 | Bacteria | 1066 |
| 961 | Ga0500573_0268649 | 3300053140 | Bacteria | 869 |
| 962 | Ga0500585_232892 | 3300053144 | Bacteria | 595 |
| 963 | Ga0500588_0051786 | 3300053146 | Bacteria | 1283 |
| 964 | Ga0500588_0099851 | 3300053146 | Bacteria | 999 |
| 965 | Ga0500589_001565 | 3300053147 | Bacteria | 6952 |
| 966 | Ga0500604_0002215 | 3300053151 | Bacteria | 5334 |
| 967 | Ga0500616_0000717 | 3300053153 | Bacteria | 38423 |
| 968 | Ga0500622_0000923 | 3300053156 | Bacteria | 24952 |
| 969 | Ga0500622_0138997 | 3300053156 | Bacteria | 1160 |
| 970 | Ga0500639_058587 | 3300053163 | Bacteria | 1990 |
| 971 | Ga0500636_0212292 | 3300053177 | Bacteria | 1015 |
| 972 | Ga0500636_0218806 | 3300053177 | Bacteria | 994 |
| 973 | Ga0500637_0050147 | 3300053178 | Bacteria | 2377 |
| 974 | Ga0500637_0136328 | 3300053178 | Bacteria | 1422 |
| 975 | Ga0500611_000907 | 3300053727 | Bacteria | 3099 |
| 976 | Ga0501082_0127383 | 3300060353 | Bacteria | 2208 |
| 977 | Ga0466962_0011225 | 3300061719 | Bacteria | 4314 |
| 978 | Ga0466962_0120109 | 3300061719 | Bacteria | 1268 |
| 979 | Ga0466962_0175920 | 3300061719 | Bacteria | 1043 |
| 980 | Ga0466962_0239857 | 3300061719 | Bacteria | 890 |
| 981 | 2819588819 | 2818991444 | Bacteria | 6968812 |
| 982 | 8003156241 | 8003151029 | Bacteria | 8187759 |
| 983 | Ga0068857_100959104 | |||
| 984 | JGI24735J21928_10019377 | |||
| 985 | JGI25154J39366_1000022 | |||
| 986 | JGI25154J39366_1011189 | |||
| 987 | JGI25157J39369_1006168 | |||
| 988 | JGI25164J39214_1002738 | |||
| 989 | JGI25165J46597_1000420 | |||
| 990 | JGI25153J46596_10001856 | |||
| 991 | rootH1_10022033 | |||
| 992 | rootH2_10004606 | |||
| 993 | rootH2_10121353 | |||
| 994 | rootL2_10058208 | |||
| 995 | rootL2_10233169 | |||
| 996 | rootH1_10009287 | |||
| 997 | rootH1_10016880 | |||
| 998 | rootH1_10043452 | |||
| 999 | rootH1_10255498 | |||
| 1000 | JGI25160J50197_1032470 | |||
| 1001 | Ga0058862_12364578 | |||
| 1002 | Ga0065165_1037858 | |||
| 1003 | Ga0065714_10072714 | |||
| 1004 | Ga0065714_10113882 | |||
| 1005 | Ga0065714_10195570 | |||
| 1006 | Ga0065712_10021823 | |||
| 1007 | Ga0065712_10086969 | |||
| 1008 | Ga0070658_10013959 | |||
| 1009 | Ga0070658_10033505 | |||
| 1010 | Ga0070658_10092240 | |||
| 1011 | Ga0070658_10208454 | |||
| 1012 | Ga0070658_10284307 | |||
| 1013 | Ga0070676_10000376 | |||
| 1014 | Ga0070676_10001044 | |||
| 1015 | Ga0070676_10323634 | |||
| 1016 | Ga0070683_100007784 | |||
| 1017 | Ga0070683_100152116 | |||
| 1018 | Ga0070670_100097287 | |||
| 1019 | Ga0070670_100375913 | |||
| 1020 | Ga0070670_100608849 | |||
| 1021 | Ga0070677_10029340 | |||
| 1022 | Ga0068869_100077215 | |||
| 1023 | Ga0070666_10000201 | |||
| 1024 | Ga0070680_100001133 | |||
| 1025 | Ga0070680_100017878 | |||
| 1026 | Ga0070680_100087905 | |||
| 1027 | Ga0070680_100099554 | |||
| 1028 | Ga0070680_100111009 | |||
| 1029 | Ga0070680_100700175 | |||
| 1030 | Ga0070682_100000060 | |||
| 1031 | Ga0068868_100046531 | |||
| 1032 | Ga0068868_100057225 | |||
| 1033 | Ga0068868_100150522 | |||
| 1034 | Ga0068868_101024500 | |||
| 1035 | Ga0070660_100015165 | |||
| 1036 | Ga0070660_100020897 | |||
| 1037 | Ga0070660_100042666 | |||
| 1038 | Ga0070660_100103452 | |||
| 1039 | Ga0070660_100476623 | |||
| 1040 | Ga0070660_100542241 | |||
| 1041 | Ga0070660_100619685 | |||
| 1042 | Ga0070691_10113522 | |||
| 1043 | Ga0070691_10129750 | |||
| 1044 | Ga0070661_100233976 | |||
| 1045 | Ga0070692_10452620 | |||
| 1046 | Ga0070668_100000036 | |||
| 1047 | Ga0070668_100802596 | |||
| 1048 | Ga0070669_100149713 | |||
| 1049 | Ga0070675_100011239 | |||
| 1050 | Ga0070675_100027386 | |||
| 1051 | Ga0070675_100095942 | |||
| 1052 | Ga0070675_100159036 | |||
| 1053 | Ga0070671_100208926 | |||
| 1054 | Ga0070671_100673987 | |||
| 1055 | Ga0070673_100002827 | |||
| 1056 | Ga0070673_100500932 | |||
| 1057 | Ga0070673_100630236 | |||
| 1058 | Ga0070673_101309552 | |||
| 1059 | Ga0070688_100204213 | |||
| 1060 | Ga0070659_100001238 | |||
| 1061 | Ga0070659_100001469 | |||
| 1062 | Ga0070659_100013081 | |||
| 1063 | Ga0070659_100013744 | |||
| 1064 | Ga0070659_100167342 | |||
| 1065 | Ga0070659_100240531 | |||
| 1066 | Ga0070659_101181305 | |||
| 1067 | Ga0070667_100000393 | |||
| 1068 | Ga0070714_100933655 | |||
| 1069 | Ga0070663_100046954 | |||
| 1070 | Ga0070663_100616104 | |||
| 1071 | Ga0070663_100808401 | |||
| 1072 | Ga0070678_100295746 | |||
| 1073 | Ga0070678_100811288 | |||
| 1074 | Ga0070662_100000252 | |||
| 1075 | Ga0070662_100008429 | |||
| 1076 | Ga0070681_10003852 | |||
| 1077 | Ga0070681_10006225 | |||
| 1078 | Ga0070681_10068869 | |||
| 1079 | Ga0070681_10082536 | |||
| 1080 | Ga0070681_10167900 | |||
| 1081 | Ga0070681_10314298 | |||
| 1082 | Ga0070681_11518098 | |||
| 1083 | Ga0068867_100001529 | |||
| 1084 | Ga0068867_100033952 | |||
| 1085 | Ga0068867_100052975 | |||
| 1086 | Ga0068867_100174850 | |||
| 1087 | Ga0068867_100616433 | |||
| 1088 | Ga0070685_10293963 | |||
| 1089 | Ga0070698_100051445 | |||
| 1090 | Ga0070679_100003662 | |||
| 1091 | Ga0070679_100014889 | |||
| 1092 | Ga0070679_100042397 | |||
| 1093 | Ga0070679_100154129 | |||
| 1094 | Ga0070679_100174164 | |||
| 1095 | Ga0070679_100215129 | |||
| 1096 | Ga0070679_101572314 | |||
| 1097 | Ga0070684_100001099 | |||
| 1098 | Ga0070684_100022372 | |||
| 1099 | Ga0070684_100037425 | |||
| 1100 | Ga0068853_100001289 | |||
| 1101 | Ga0068853_100005465 | |||
| 1102 | Ga0068853_100007662 | |||
| 1103 | Ga0068853_100022704 | |||
| 1104 | Ga0068853_100059247 | |||
| 1105 | Ga0068853_100158618 | |||
| 1106 | Ga0068853_100227885 | |||
| 1107 | Ga0068853_100235766 | |||
| 1108 | Ga0068853_100381642 | |||
| 1109 | Ga0068853_100693429 | |||
| 1110 | Ga0068853_100962417 | |||
| 1111 | Ga0070672_100002608 | |||
| 1112 | Ga0070672_100082453 | |||
| 1113 | Ga0070672_100084486 | |||
| 1114 | Ga0070672_100106719 | |||
| 1115 | Ga0070665_100000016 | |||
| 1116 | Ga0070665_100001215 | |||
| 1117 | Ga0068855_100000257 | |||
| 1118 | Ga0068855_100003500 | |||
| 1119 | Ga0068855_100007377 | |||
| 1120 | Ga0068855_100015438 | |||
| 1121 | Ga0068855_100082914 | |||
| 1122 | Ga0068855_100084714 | |||
| 1123 | Ga0068855_100090726 | |||
| 1124 | Ga0068855_100117097 | |||
| 1125 | Ga0068855_100141627 | |||
| 1126 | Ga0068855_100146424 | |||
| 1127 | Ga0068855_100270090 | |||
| 1128 | Ga0068855_100354148 | |||
| 1129 | Ga0068855_100356856 | |||
| 1130 | Ga0068855_100444602 | |||
| 1131 | Ga0070664_100081393 | |||
| 1132 | Ga0070664_100124777 | |||
| 1133 | Ga0070664_100439773 | |||
| 1134 | Ga0068857_100002912 | |||
| 1135 | Ga0068857_100061221 | |||
| 1136 | Ga0068857_100074620 | |||
| 1137 | Ga0068857_100290365 | |||
| 1138 | Ga0068857_100684854 | |||
| 1139 | Ga0068857_100816751 | |||
| 1140 | Ga0068857_100873807 | |||
| 1141 | Ga0068857_100936105 | |||
| 1142 | Ga0068854_100044550 | |||
| 1143 | Ga0068854_100120083 | |||
| 1144 | Ga0068854_100200890 | |||
| 1145 | Ga0068854_100323576 | |||
| 1146 | Ga0068854_100872656 | |||
| 1147 | Ga0068854_101944093 | |||
| 1148 | Ga0068856_100005494 | |||
| 1149 | Ga0068856_100013252 | |||
| 1150 | Ga0068856_100023691 | |||
| 1151 | Ga0068856_100138407 | |||
| 1152 | Ga0068856_100200312 | |||
| 1153 | Ga0068856_100513826 | |||
| 1154 | Ga0068856_100571094 | |||
| 1155 | Ga0068856_101012269 | |||
| 1156 | Ga0068852_100003516 | |||
| 1157 | Ga0068852_100004973 | |||
| 1158 | Ga0068852_100013746 | |||
| 1159 | Ga0068852_100034480 | |||
| 1160 | Ga0068852_100053055 | |||
| 1161 | Ga0068852_100156452 | |||
| 1162 | Ga0068852_100215352 | |||
| 1163 | Ga0068852_100250648 | |||
| 1164 | Ga0068852_100582062 | |||
| 1165 | Ga0068852_100594601 | |||
| 1166 | Ga0068852_100618926 | |||
| 1167 | Ga0068859_100067888 | |||
| 1168 | Ga0068859_100100796 | |||
| 1169 | Ga0068859_100735310 | |||
| 1170 | Ga0068864_100002025 | |||
| 1171 | Ga0068866_10064985 | |||
| 1172 | Ga0068861_100022287 | |||
| 1173 | Ga0068861_100147416 | |||
| 1174 | Ga0068851_10001779 | |||
| 1175 | Ga0068851_10282455 | |||
| 1176 | Ga0068851_10496774 | |||
| 1177 | Ga0068851_10760419 | |||
| 1178 | Ga0068863_100007773 | |||
| 1179 | Ga0068863_100284740 | |||
| 1180 | Ga0068863_100634073 | |||
| 1181 | Ga0068863_102027272 | |||
| 1182 | Ga0068858_100001071 | |||
| 1183 | Ga0068858_100197393 | |||
| 1184 | Ga0068858_100492381 | |||
| 1185 | Ga0068860_100000006 | |||
| 1186 | Ga0068860_100010347 | |||
| 1187 | Ga0068860_100018512 | |||
| 1188 | Ga0068860_100020538 | |||
| 1189 | Ga0068860_100025063 | |||
| 1190 | Ga0068860_100707528 | |||
| 1191 | Ga0070716_100646257 | |||
| 1192 | Ga0075366_10005129 | |||
| 1193 | Ga0075366_10030731 | |||
| 1194 | Ga0075366_10038226 | |||
| 1195 | Ga0075366_10048318 | |||
| 1196 | Ga0075366_10149478 | |||
| 1197 | Ga0075366_10292118 | |||
| 1198 | Ga0097621_100000212 | |||
| 1199 | Ga0097621_100001189 | |||
| 1200 | Ga0097621_100006360 | |||
| 1201 | Ga0097621_100143411 | |||
| 1202 | Ga0097621_100833739 | |||
| 1203 | Ga0075370_10493931 | |||
| 1204 | Ga0068871_100000720 | |||
| 1205 | Ga0068871_100002202 | |||
| 1206 | Ga0068871_100004872 | |||
| 1207 | Ga0068871_100014855 | |||
| 1208 | Ga0068871_100254546 | |||
| 1209 | Ga0068871_101276026 | |||
| 1210 | Ga0068865_100000112 | |||
| 1211 | Ga0068865_100034450 | |||
| 1212 | Ga0068865_100869884 | |||
| 1213 | Ga0097620_100009589 | |||
| 1214 | Ga0097620_100067889 | |||
| 1215 | Ga0097620_100100795 | |||
| 1216 | Ga0097620_100735476 | |||
| 1217 | Ga0105251_10164099 | |||
| 1218 | Ga0105240_10000155 | |||
| 1219 | Ga0105240_10001144 | |||
| 1220 | Ga0105240_10002687 | |||
| 1221 | Ga0105240_10005022 | |||
| 1222 | Ga0105240_10014688 | |||
| 1223 | Ga0105240_10029329 | |||
| 1224 | Ga0105240_10034681 | |||
| 1225 | Ga0105240_10036495 | |||
| 1226 | Ga0105240_10043386 | |||
| 1227 | Ga0105240_10082059 | |||
| 1228 | Ga0105240_10082254 | |||
| 1229 | Ga0105240_10104381 | |||
| 1230 | Ga0105240_10282755 | |||
| 1231 | Ga0105240_10315411 | |||
| 1232 | Ga0105240_10406339 | |||
| 1233 | Ga0105240_10502764 | |||
| 1234 | Ga0105240_10529364 | |||
| 1235 | Ga0105240_10549317 | |||
| 1236 | Ga0105240_10664159 | |||
| 1237 | Ga0105240_10747832 | |||
| 1238 | Ga0111539_10150124 | |||
| 1239 | Ga0105245_10403857 | |||
| 1240 | Ga0105247_10499798 | |||
| 1241 | Ga0114129_10002084 | |||
| 1242 | Ga0105241_10000113 | |||
| 1243 | Ga0105241_10000898 | |||
| 1244 | Ga0105241_10005212 | |||
| 1245 | Ga0105241_10011777 | |||
| 1246 | Ga0105241_10055333 | |||
| 1247 | Ga0105241_10097786 | |||
| 1248 | Ga0105241_10098405 | |||
| 1249 | Ga0105241_10201956 | |||
| 1250 | Ga0105241_10475108 | |||
| 1251 | Ga0105241_11461584 | |||
| 1252 | Ga0105242_10070451 | |||
| 1253 | Ga0105242_10213586 | |||
| 1254 | Ga0105242_10967642 | |||
| 1255 | Ga0105248_10047599 | |||
| 1256 | Ga0105248_10053635 | |||
| 1257 | Ga0105248_10515153 | |||
| 1258 | Ga0105237_10000061 | |||
| 1259 | Ga0105237_10000417 | |||
| 1260 | Ga0105237_10008194 | |||
| 1261 | Ga0105237_10019539 | |||
| 1262 | Ga0105237_10022631 | |||
| 1263 | Ga0105237_10023025 | |||
| 1264 | Ga0105237_10034436 | |||
| 1265 | Ga0105237_10059196 | |||
| 1266 | Ga0105237_10059700 | |||
| 1267 | Ga0105237_10086203 | |||
| 1268 | Ga0105237_10103854 | |||
| 1269 | Ga0105237_10110815 | |||
| 1270 | Ga0105237_10164797 | |||
| 1271 | Ga0105237_10215180 | |||
| 1272 | Ga0105237_10264828 | |||
| 1273 | Ga0105237_10510398 | |||
| 1274 | Ga0105237_10584713 | |||
| 1275 | Ga0105237_10634795 | |||
| 1276 | Ga0105237_10935885 | |||
| 1277 | Ga0105237_11085971 | |||
| 1278 | Ga0105237_11240726 | |||
| 1279 | Ga0105238_10010861 | |||
| 1280 | Ga0105238_10035276 | |||
| 1281 | Ga0105238_10036611 | |||
| 1282 | Ga0105238_10102453 | |||
| 1283 | Ga0105238_10187538 | |||
| 1284 | Ga0105238_10829446 | |||
| 1285 | Ga0105238_10931642 | |||
| 1286 | Ga0105238_11043513 | |||
| 1287 | Ga0105238_11323562 | |||
| 1288 | Ga0105249_10003698 | |||
| 1289 | Ga0105249_10011368 | |||
| 1290 | Ga0105249_10239036 | |||
| 1291 | Ga0105249_10286645 | |||
| 1292 | Ga0105239_10000010 | |||
| 1293 | Ga0105239_10000415 | |||
| 1294 | Ga0105239_10000482 | |||
| 1295 | Ga0105239_10005902 | |||
| 1296 | Ga0105239_10006393 | |||
| 1297 | Ga0105239_10006733 | |||
| 1298 | Ga0105239_10029427 | |||
| 1299 | Ga0105239_10030646 | |||
| 1300 | Ga0105239_10041699 | |||
| 1301 | Ga0105239_10131094 | |||
| 1302 | Ga0105239_10290659 | |||
| 1303 | Ga0105239_10355436 | |||
| 1304 | Ga0105239_10398910 | |||
| 1305 | Ga0105239_10438445 | |||
| 1306 | Ga0105239_11389818 | |||
| 1307 | Ga0105246_10033878 | |||
| 1308 | Ga0105246_10062211 | |||
| 1309 | Ga0105246_10698507 | |||
| 1310 | Ga0105246_10931799 | |||
| 1311 | Ga0105246_11962903 | |||
| 1312 | Ga0157373_10001922 | |||
| 1313 | Ga0157373_10006674 | |||
| 1314 | Ga0157373_10122746 | |||
| 1315 | Ga0157373_10152466 | |||
| 1316 | Ga0157373_10162996 | |||
| 1317 | Ga0157373_10243602 | |||
| 1318 | Ga0157373_10500493 | |||
| 1319 | Ga0157371_10001534 | |||
| 1320 | Ga0157371_10002382 | |||
| 1321 | Ga0157371_10002977 | |||
| 1322 | Ga0157371_10003511 | |||
| 1323 | Ga0157371_10003728 | |||
| 1324 | Ga0157371_10019675 | |||
| 1325 | Ga0157371_10021366 | |||
| 1326 | Ga0157371_10022801 | |||
| 1327 | Ga0157371_10023229 | |||
| 1328 | Ga0157371_10034836 | |||
| 1329 | Ga0157371_10048660 | |||
| 1330 | Ga0157371_10048801 | |||
| 1331 | Ga0157371_10072843 | |||
| 1332 | Ga0157371_10082546 | |||
| 1333 | Ga0157371_10175078 | |||
| 1334 | Ga0157371_10214733 | |||
| 1335 | Ga0157371_10232895 | |||
| 1336 | Ga0157371_10237493 | |||
| 1337 | Ga0157370_10001056 | |||
| 1338 | Ga0157370_10003729 | |||
| 1339 | Ga0157370_10008499 | |||
| 1340 | Ga0157370_10062863 | |||
| 1341 | Ga0157370_10081716 | |||
| 1342 | Ga0157370_10086945 | |||
| 1343 | Ga0157370_10094169 | |||
| 1344 | Ga0157370_10105509 | |||
| 1345 | Ga0157370_10121749 | |||
| 1346 | Ga0157370_10186900 | |||
| 1347 | Ga0157370_10218843 | |||
| 1348 | Ga0157370_10229378 | |||
| 1349 | Ga0157370_10268545 | |||
| 1350 | Ga0157370_10336255 | |||
| 1351 | Ga0157370_10363049 | |||
| 1352 | Ga0157370_10422889 | |||
| 1353 | Ga0157370_10501567 | |||
| 1354 | Ga0157369_10000853 | |||
| 1355 | Ga0157369_10011149 | |||
| 1356 | Ga0157369_10016348 | |||
| 1357 | Ga0157369_10080482 | |||
| 1358 | Ga0157369_10120997 | |||
| 1359 | Ga0157369_10210665 | |||
| 1360 | Ga0157369_10265309 | |||
| 1361 | Ga0157369_10369743 | |||
| 1362 | Ga0157369_11811351 | |||
| 1363 | Ga0157369_12021259 | |||
| 1364 | Ga0157374_10000408 | |||
| 1365 | Ga0157374_10000618 | |||
| 1366 | Ga0157374_10009788 | |||
| 1367 | Ga0157374_10041703 | |||
| 1368 | Ga0157374_10059021 | |||
| 1369 | Ga0157374_10164510 | |||
| 1370 | Ga0157374_10477610 | |||
| 1371 | Ga0157374_10585923 | |||
| 1372 | Ga0157374_10588861 | |||
| 1373 | Ga0157374_11219675 | |||
| 1374 | Ga0157374_12242791 | |||
| 1375 | Ga0157378_10072207 | |||
| 1376 | Ga0157378_10077124 | |||
| 1377 | Ga0157378_10120809 | |||
| 1378 | Ga0157378_10147983 | |||
| 1379 | Ga0157378_10317568 | |||
| 1380 | Ga0157378_10580165 | |||
| 1381 | Ga0157378_11453243 | |||
| 1382 | Ga0163162_10000040 | |||
| 1383 | Ga0163162_10001209 | |||
| 1384 | Ga0163162_10001777 | |||
| 1385 | Ga0163162_10002037 | |||
| 1386 | Ga0163162_10002657 | |||
| 1387 | Ga0163162_10054155 | |||
| 1388 | Ga0163162_10093304 | |||
| 1389 | Ga0163162_10250454 | |||
| 1390 | Ga0163162_10503489 | |||
| 1391 | Ga0163162_10650697 | |||
| 1392 | Ga0163162_12323449 | |||
| 1393 | Ga0157372_10000011 | |||
| 1394 | Ga0157372_10000491 | |||
| 1395 | Ga0157372_10000743 | |||
| 1396 | Ga0157372_10013303 | |||
| 1397 | Ga0157372_10022186 | |||
| 1398 | Ga0157372_10022799 | |||
| 1399 | Ga0157372_10023113 | |||
| 1400 | Ga0157372_10026508 | |||
| 1401 | Ga0157372_10027365 | |||
| 1402 | Ga0157372_10028841 | |||
| 1403 | Ga0157372_10068044 | |||
| 1404 | Ga0157372_10096034 | |||
| 1405 | Ga0157372_10126998 | |||
| 1406 | Ga0157372_10155883 | |||
| 1407 | Ga0157372_10158258 | |||
| 1408 | Ga0157372_10163110 | |||
| 1409 | Ga0157372_10194104 | |||
| 1410 | Ga0157372_10247929 | |||
| 1411 | Ga0157372_10273431 | |||
| 1412 | Ga0157372_10379938 | |||
| 1413 | Ga0157372_10383313 | |||
| 1414 | Ga0157372_10411411 | |||
| 1415 | Ga0157372_10470354 | |||
| 1416 | Ga0157372_10488169 | |||
| 1417 | Ga0157372_10504147 | |||
| 1418 | Ga0157372_10639285 | |||
| 1419 | Ga0157372_10642061 | |||
| 1420 | Ga0157372_10756841 | |||
| 1421 | Ga0157372_11056316 | |||
| 1422 | Ga0157372_11194029 | |||
| 1423 | Ga0157372_11746619 | |||
| 1424 | Ga0157372_12277419 | |||
| 1425 | Ga0157375_10005786 | |||
| 1426 | Ga0157375_10358647 | |||
| 1427 | Ga0157375_10680630 | |||
| 1428 | Ga0157375_11605296 | |||
| 1429 | Ga0163163_10000110 | |||
| 1430 | Ga0163163_10000141 | |||
| 1431 | Ga0163163_10624401 | |||
| 1432 | Ga0157380_10017302 | |||
| 1433 | Ga0157380_10027950 | |||
| 1434 | Ga0157377_10859473 | |||
| 1435 | Ga0157379_10000173 | |||
| 1436 | Ga0157379_10111532 | |||
| 1437 | Ga0157379_10128901 | |||
| 1438 | Ga0157379_11149748 | |||
| 1439 | Ga0157376_10000161 | |||
| 1440 | Ga0157376_10038978 | |||
| 1441 | Ga0157376_10071207 | |||
| 1442 | Ga0157376_10112971 | |||
| 1443 | Ga0157376_10128605 | |||
| 1444 | Ga0157376_10130015 | |||
| 1445 | Ga0157376_10215878 | |||
| 1446 | Ga0182007_10061606 | |||
| 1447 | Ga0163161_10025549 | |||
| 1448 | Ga0163161_10055069 | |||
| 1449 | Ga0163161_10417795 | |||
| 1450 | Ga0209258_118393 | |||
| 1451 | Ga0209646_1000003 | |||
| 1452 | Ga0209646_1004846 | |||
| 1453 | Ga0209026_1000354 | |||
| 1454 | Ga0209758_1010470 | |||
| 1455 | Ga0207426_1000187 | |||
| 1456 | Ga0207656_10000689 | |||
| 1457 | Ga0207656_10325344 | |||
| 1458 | Ga0207656_10372948 | |||
| 1459 | Ga0207642_10875472 | |||
| 1460 | Ga0207680_10025199 | |||
| 1461 | Ga0207680_10026610 | |||
| 1462 | Ga0207647_10027144 | |||
| 1463 | Ga0207647_10152937 | |||
| 1464 | Ga0207645_10002633 | |||
| 1465 | Ga0207705_10038378 | |||
| 1466 | Ga0207705_10045442 | |||
| 1467 | Ga0207705_10085977 | |||
| 1468 | Ga0207705_10138589 | |||
| 1469 | Ga0207705_10141615 | |||
| 1470 | Ga0207705_10458448 | |||
| 1471 | Ga0207654_10000461 | |||
| 1472 | Ga0207654_10075484 | |||
| 1473 | Ga0207654_10327240 | |||
| 1474 | Ga0207707_10000189 | |||
| 1475 | Ga0207707_10019690 | |||
| 1476 | Ga0207707_10454074 | |||
| 1477 | Ga0207707_10684626 | |||
| 1478 | Ga0207707_10878749 | |||
| 1479 | Ga0207707_11038884 | |||
| 1480 | Ga0207695_10000043 | |||
| 1481 | Ga0207695_10000165 | |||
| 1482 | Ga0207695_10000245 | |||
| 1483 | Ga0207695_10018911 | |||
| 1484 | Ga0207695_10022033 | |||
| 1485 | Ga0207695_10045636 | |||
| 1486 | Ga0207695_10132246 | |||
| 1487 | Ga0207695_10343294 | |||
| 1488 | Ga0207695_10471786 | |||
| 1489 | Ga0207695_10514895 | |||
| 1490 | Ga0207695_10917415 | |||
| 1491 | Ga0207671_10001487 | |||
| 1492 | Ga0207671_10003937 | |||
| 1493 | Ga0207671_10021318 | |||
| 1494 | Ga0207671_10054170 | |||
| 1495 | Ga0207671_10157562 | |||
| 1496 | Ga0207671_10880713 | |||
| 1497 | Ga0207671_10894361 | |||
| 1498 | Ga0207671_11059949 | |||
| 1499 | Ga0207660_10008768 | |||
| 1500 | Ga0207660_10089470 | |||
| 1501 | Ga0207657_10030828 | |||
| 1502 | Ga0207657_10117679 | |||
| 1503 | Ga0207649_10147263 | |||
| 1504 | Ga0207649_11470301 | |||
| 1505 | Ga0207652_10000108 | |||
| 1506 | Ga0207652_10000488 | |||
| 1507 | Ga0207652_10000541 | |||
| 1508 | Ga0207652_10006784 | |||
| 1509 | Ga0207652_10302214 | |||
| 1510 | Ga0207652_10580575 | |||
| 1511 | Ga0207652_11022573 | |||
| 1512 | Ga0207681_10333896 | |||
| 1513 | Ga0207694_10071132 | |||
| 1514 | Ga0207694_10361507 | |||
| 1515 | Ga0207650_10079343 | |||
| 1516 | Ga0207650_10124027 | |||
| 1517 | Ga0207650_10349277 | |||
| 1518 | Ga0207650_10409968 | |||
| 1519 | Ga0207650_10655848 | |||
| 1520 | Ga0207659_10045959 | |||
| 1521 | Ga0207659_10279631 | |||
| 1522 | Ga0207659_10411885 | |||
| 1523 | Ga0207659_10761216 | |||
| 1524 | Ga0207687_10277810 | |||
| 1525 | Ga0207664_10790997 | |||
| 1526 | Ga0207644_10361149 | |||
| 1527 | Ga0207690_10052425 | |||
| 1528 | Ga0207690_10119304 | |||
| 1529 | Ga0207690_11118076 | |||
| 1530 | Ga0207690_11407193 | |||
| 1531 | Ga0207706_10011353 | |||
| 1532 | Ga0207686_10302721 | |||
| 1533 | Ga0207704_10011472 | |||
| 1534 | Ga0207704_10329890 | |||
| 1535 | Ga0207691_10000504 | |||
| 1536 | Ga0207691_10088931 | |||
| 1537 | Ga0207691_11166351 | |||
| 1538 | Ga0207711_10088422 | |||
| 1539 | Ga0207689_11126832 | |||
| 1540 | Ga0207661_10005276 | |||
| 1541 | Ga0207661_10120463 | |||
| 1542 | Ga0207661_10172657 | |||
| 1543 | Ga0207661_10302191 | |||
| 1544 | Ga0207679_10023361 | |||
| 1545 | Ga0207679_10042309 | |||
| 1546 | Ga0207667_10000440 | |||
| 1547 | Ga0207667_10000913 | |||
| 1548 | Ga0207667_10005535 | |||
| 1549 | Ga0207667_10026291 | |||
| 1550 | Ga0207667_10029218 | |||
| 1551 | Ga0207667_10076678 | |||
| 1552 | Ga0207667_10118271 | |||
| 1553 | Ga0207667_10208352 | |||
| 1554 | Ga0207667_10306641 | |||
| 1555 | Ga0207667_10635462 | |||
| 1556 | Ga0207651_10006216 | |||
| 1557 | Ga0207712_10185645 | |||
| 1558 | Ga0207712_10224263 | |||
| 1559 | Ga0207712_10398572 | |||
| 1560 | Ga0207668_10002658 | |||
| 1561 | Ga0207668_10968648 | |||
| 1562 | Ga0207640_10011035 | |||
| 1563 | Ga0207640_10056140 | |||
| 1564 | Ga0207640_10056558 | |||
| 1565 | Ga0207640_10376113 | |||
| 1566 | Ga0207640_10574856 | |||
| 1567 | Ga0207640_10577986 | |||
| 1568 | Ga0207640_11103547 | |||
| 1569 | Ga0207658_10005579 | |||
| 1570 | Ga0207658_11639447 | |||
| 1571 | Ga0207677_10005078 | |||
| 1572 | Ga0207677_10068348 | |||
| 1573 | Ga0207677_10748268 | |||
| 1574 | Ga0207677_10770476 | |||
| 1575 | Ga0207703_11514825 | |||
| 1576 | Ga0207639_10002969 | |||
| 1577 | Ga0207639_10024472 | |||
| 1578 | Ga0207639_10027754 | |||
| 1579 | Ga0207639_10057585 | |||
| 1580 | Ga0207639_10059783 | |||
| 1581 | Ga0207639_10066611 | |||
| 1582 | Ga0207639_10135570 | |||
| 1583 | Ga0207639_10287741 | |||
| 1584 | Ga0207639_10314621 | |||
| 1585 | Ga0207639_10431171 | |||
| 1586 | Ga0207639_10888374 | |||
| 1587 | Ga0207639_10998902 | |||
| 1588 | Ga0207639_11121637 | |||
| 1589 | Ga0207639_11142419 | |||
| 1590 | Ga0207678_10051627 | |||
| 1591 | Ga0207678_10230755 | |||
| 1592 | Ga0207702_10000196 | |||
| 1593 | Ga0207702_10310831 | |||
| 1594 | Ga0207702_10348991 | |||
| 1595 | Ga0207702_10454063 | |||
| 1596 | Ga0207702_10511677 | |||
| 1597 | Ga0207702_10530628 | |||
| 1598 | Ga0207702_10704480 | |||
| 1599 | Ga0207641_10009580 | |||
| 1600 | Ga0207641_10233320 | |||
| 1601 | Ga0207641_10767029 | |||
| 1602 | Ga0207641_11010939 | |||
| 1603 | Ga0207648_10016152 | |||
| 1604 | Ga0207648_10146611 | |||
| 1605 | Ga0207648_11108245 | |||
| 1606 | Ga0207648_11475912 | |||
| 1607 | Ga0207676_10003314 | |||
| 1608 | Ga0207676_10527722 | |||
| 1609 | Ga0207674_10004216 | |||
| 1610 | Ga0207674_10064985 | |||
| 1611 | Ga0207674_10075665 | |||
| 1612 | Ga0207674_10166256 | |||
| 1613 | Ga0207674_10571067 | |||
| 1614 | Ga0207674_10885068 | |||
| 1615 | Ga0207674_11598521 | |||
| 1616 | Ga0207675_100314802 | |||
| 1617 | Ga0207683_10821794 | |||
| 1618 | Ga0207698_10006493 | |||
| 1619 | Ga0207698_10013137 | |||
| 1620 | Ga0207698_10015088 | |||
| 1621 | Ga0207698_10039245 | |||
| 1622 | Ga0207698_10125756 | |||
| 1623 | Ga0207698_10166241 | |||
| 1624 | Ga0207698_10258120 | |||
| 1625 | Ga0207698_10459509 | |||
| 1626 | Ga0207698_10543750 | |||
| 1627 | Ga0207698_10717569 | |||
| 1628 | Ga0207698_10819015 | |||
| 1629 | Ga0209974_10218506 | |||
| 1630 | Ga0268266_10000149 | |||
| 1631 | Ga0268266_10001023 | |||
| 1632 | Ga0268265_11818903 | |||
| 1633 | Ga0268264_10000064 | |||
| 1634 | Ga0268264_10003688 | |||
| 1635 | Ga0268264_10006580 | |||
| 1636 | Ga0268264_10007122 | |||
| 1637 | Ga0268264_10010089 | |||
| 1638 | Ga0268264_10949680 | |||
| 1639 | Ga0268264_11061143 | |||
| 1640 | Ga0307517_10005503 | |||
| 1641 | Ga0307517_10152802 | |||
| 1642 | Ga0307517_10159858 | |||
| 1643 | Ga0307515_10000001 | |||
| 1644 | Ga0307511_10000138 | |||
| 1645 | Ga0307512_10133321 | |||
| 1646 | Ga0265328_10000178 | |||
| 1647 | Ga0265331_10192826 | |||
| 1648 | Ga0265327_10006475 | |||
| 1649 | Ga0265327_10117858 | |||
| 1650 | Ga0307513_10191568 | |||
| 1651 | Ga0307513_10353112 | |||
| 1652 | Ga0307513_10475104 | |||
| 1653 | Ga0307509_10069660 | |||
| 1654 | Ga0307509_10097887 | |||
| 1655 | Ga0307408_100459300 | |||
| 1656 | Ga0307516_10001145 | |||
| 1657 | Ga0307516_10359410 | |||
| 1658 | Ga0307405_10378338 | |||
| 1659 | Ga0307405_10466476 | |||
| 1660 | Ga0307413_10017191 | |||
| 1661 | Ga0307410_10107562 | |||
| 1662 | Ga0307410_10749031 | |||
| 1663 | Ga0307406_10059138 | |||
| 1664 | Ga0307407_10133542 | |||
| 1665 | Ga0307412_10360837 | |||
| 1666 | Ga0307412_10518966 | |||
| 1667 | Ga0307409_100187413 | |||
| 1668 | Ga0307416_100220455 | |||
| 1669 | Ga0307411_10576888 | |||
| 1670 | Ga0307411_10684159 | |||
| 1671 | Ga0307415_100080628 | |||
| 1672 | Ga0307510_10000079 | |||
| 1673 | Ga0373945_0145253 | |||
| 1674 | Ga0373953_0281453 | |||
| 1675 | Ga0373935_0814793 | |||
| 1676 | Ga0373927_0066611 | |||
| 1677 | Ga0373933_0578245 | |||
| 1678 | Ga0373937_0409249 | |||
| 1679 | Ga0373937_0932126 | |||
| 1680 | Ga0373925_1437866 | |||
| 1681 | Ga0395899_0003463 | |||
| 1682 | Ga0395899_0009069 | |||
| 1683 | Ga0395899_0096340 | |||
| 1684 | Ga0395899_0371871 | |||
| 1685 | Ga0395899_0726682 | |||
| 1686 | Ga0395900_0014175 | |||
| 1687 | Ga0395900_0022808 | |||
| 1688 | Ga0395900_0071784 | |||
| 1689 | Ga0395900_0206909 | |||
| 1690 | Ga0395900_0252503 | |||
| 1691 | Ga0395900_0524837 | |||
| 1692 | Ga0395900_0853988 | |||
| 1693 | Ga0395898_0006358 | |||
| 1694 | Ga0395898_0051146 | |||
| 1695 | Ga0395898_0065837 | |||
| 1696 | Ga0395898_0086973 | |||
| 1697 | Ga0395898_0839248 | |||
| 1698 | Ga0395905_0012427 | |||
| 1699 | Ga0395905_0092339 | |||
| 1700 | Ga0395905_0098529 | |||
| 1701 | Ga0395905_0330809 | |||
| 1702 | Ga0395905_1105057 | |||
| 1703 | Ga0395901_0005285 | |||
| 1704 | Ga0395901_0007090 | |||
| 1705 | Ga0395901_0208681 | |||
| 1706 | Ga0395901_0228237 | |||
| 1707 | Ga0395901_0261342 | |||
| 1708 | Ga0395901_0272795 | |||
| 1709 | Ga0400489_65840 | |||
| 1710 | Ga0439439_0008781 | |||
| 1711 | Ga0439439_0098972 | |||
| 1712 | Ga0439466_0130768 | |||
| 1713 | Ga0439465_0021806 | |||
| 1714 | Ga0451791_0054266 | |||
| 1715 | Ga0451797_0773780 | |||
| 1716 | Ga0451800_0408194 | |||
| 1717 | Ga0451804_0480600 | |||
| 1718 | Ga0451839_1376007 | |||
| 1719 | Ga0451853_1710672 | |||
| 1720 | Ga0439433_0045135 | |||
| 1721 | Ga0439445_0204515 | |||
| 1722 | Ga0439449_0006193 | |||
| 1723 | Ga0439449_0023388 | |||
| 1724 | Ga0439449_0129548 | |||
| 1725 | Ga0439457_002491 | |||
| 1726 | Ga0439457_003703 | |||
| 1727 | Ga0439457_063908 | |||
| 1728 | Ga0439462_0112443 | |||
| 1729 | Ga0439434_0069067 | |||
| 1730 | Ga0451577_0751752 | |||
| 1731 | Ga0466969_0000137 | |||
| 1732 | Ga0466972_0000022 | |||
| 1733 | Ga0466972_0000092 | |||
| 1734 | Ga0466972_0032139 | |||
| 1735 | Ga0466972_0316773 | |||
| 1736 | Ga0466965_0019968 | |||
| 1737 | Ga0466966_0000099 | |||
| 1738 | Ga0466966_0770624 | |||
| 1739 | Ga0466966_0889819 | |||
| 1740 | Ga0466961_0070712 | |||
| 1741 | Ga0466964_0153667 | |||
| 1742 | Ga0453684_0055495 | |||
| 1743 | Ga0466968_0082961 | |||
| 1744 | Ga0466970_0000532 | |||
| 1745 | Ga0466970_0174417 | |||
| 1746 | Ga0466970_0258952 | |||
| 1747 | Ga0466957_0000466 | |||
| 1748 | Ga0466957_0004991 | |||
| 1749 | Ga0466960_0166591 | |||
| 1750 | Ga0466959_0000168 | |||
| 1751 | Ga0466959_0005279 | |||
| 1752 | Ga0451576_0391922 | |||
| 1753 | Ga0495629_0076785 | |||
| 1754 | Ga0495638_0063666 | |||
| 1755 | Ga0495638_0175877 | |||
| 1756 | Ga0495638_0240024 | |||
| 1757 | Ga0495638_0290966 | |||
| 1758 | Ga0495651_0591747 | |||
| 1759 | Ga0495580_0359711 | |||
| 1760 | Ga0495606_0025229 | |||
| 1761 | Ga0495630_0265099 | |||
| 1762 | Ga0495630_0358162 | |||
| 1763 | Ga0495632_0514253 | |||
| 1764 | Ga0495643_0198624 | |||
| 1765 | Ga0495648_0002037 | |||
| 1766 | Ga0495586_0115541 | |||
| 1767 | Ga0495645_0328102 | |||
| 1768 | Ga0495633_0147540 | |||
| 1769 | Ga0495668_0000154 | |||
| 1770 | Ga0495668_0000677 | |||
| 1771 | Ga0495668_0015303 | |||
| 1772 | Ga0495611_0000332 | |||
| 1773 | Ga0495611_0078841 | |||
| 1774 | Ga0495625_0052916 | |||
| 1775 | Ga0495647_0025952 | |||
| 1776 | Ga0495658_0187101 | |||
| 1777 | Ga0495649_0353854 | |||
| 1778 | Ga0495600_0711016 | |||
| 1779 | Ga0495604_0957620 | |||
| 1780 | Ga0495674_0057744 | |||
| 1781 | Ga0495672_0018373 | |||
| 1782 | Ga0495672_0059736 | |||
| 1783 | Ga0495672_0320735 | |||
| 1784 | Ga0495680_0172064 | |||
| 1785 | Ga0495687_000158 | |||
| 1786 | Ga0495686_0000039 | |||
| 1787 | Ga0496107_0767771 | |||
| 1788 | Ga0496109_0059916 | |||
| 1789 | Ga0496110_0451990 | |||
| 1790 | Ga0501290_001874 | |||
| 1791 | Ga0501296_047512 | |||
| 1792 | Ga0501297_001523 | |||
| 1793 | Ga0501298_000658 | |||
| 1794 | Ga0501303_016736 | |||
| 1795 | Ga0501031_0622664 | |||
| 1796 | Ga0501032_0023384 | |||
| 1797 | Ga0501032_0238516 | |||
| 1798 | Ga0501032_0257147 | |||
| 1799 | Ga0501033_0059991 | |||
| 1800 | Ga0501033_0213880 | |||
| 1801 | Ga0501033_0388736 | |||
| 1802 | Ga0501033_0459996 | |||
| 1803 | Ga0501033_0705414 | |||
| 1804 | Ga0501034_0000017 | |||
| 1805 | Ga0501034_0028132 | |||
| 1806 | Ga0501034_0132885 | |||
| 1807 | Ga0501034_0196888 | |||
| 1808 | Ga0501034_0313961 | |||
| 1809 | Ga0501034_0797795 | |||
| 1810 | Ga0501036_0065446 | |||
| 1811 | Ga0501036_0440885 | |||
| 1812 | Ga0501037_0014175 | |||
| 1813 | Ga0501037_0242565 | |||
| 1814 | Ga0501038_0129016 | |||
| 1815 | Ga0501038_0320067 | |||
| 1816 | Ga0501039_0119485 | |||
| 1817 | Ga0501039_0222623 | |||
| 1818 | Ga0501043_0046149 | |||
| 1819 | Ga0501043_0055913 | |||
| 1820 | Ga0501043_0099720 | |||
| 1821 | Ga0501046_0038760 | |||
| 1822 | Ga0501046_0274617 | |||
| 1823 | Ga0501046_0863469 | |||
| 1824 | Ga0501047_0030221 | |||
| 1825 | Ga0501047_0033592 | |||
| 1826 | Ga0501047_0058284 | |||
| 1827 | Ga0501047_0080375 | |||
| 1828 | Ga0501047_0219648 | |||
| 1829 | Ga0501047_0459782 | |||
| 1830 | Ga0501068_0296085 | |||
| 1831 | Ga0501069_0008721 | |||
| 1832 | Ga0501070_0015045 | |||
| 1833 | Ga0501070_0190520 | |||
| 1834 | Ga0501070_0282817 | |||
| 1835 | Ga0501071_0334070 | |||
| 1836 | Ga0501073_0057263 | |||
| 1837 | Ga0501074_0082207 | |||
| 1838 | Ga0501198_000777 | |||
| 1839 | Ga0501198_001784 | |||
| 1840 | Ga0501201_013587 | |||
| 1841 | Ga0501202_001001 | |||
| 1842 | Ga0501202_006139 | |||
| 1843 | Ga0501202_029099 | |||
| 1844 | Ga0501202_030359 | |||
| 1845 | Ga0501202_072408 | |||
| 1846 | Ga0501206_006929 | |||
| 1847 | Ga0501207_009759 | |||
| 1848 | Ga0501209_208440 | |||
| 1849 | Ga0501216_016161 | |||
| 1850 | Ga0501217_001447 | |||
| 1851 | Ga0501217_030240 | |||
| 1852 | Ga0501217_080562 | |||
| 1853 | Ga0501222_001059 | |||
| 1854 | Ga0501222_013996 | |||
| 1855 | Ga0501223_001511 | |||
| 1856 | Ga0501223_003075 | |||
| 1857 | Ga0501223_013336 | |||
| 1858 | Ga0501223_140393 | |||
| 1859 | Ga0501228_017431 | |||
| 1860 | Ga0501233_002077 | |||
| 1861 | Ga0501233_068635 | |||
| 1862 | Ga0501235_001131 | |||
| 1863 | Ga0501235_043301 | |||
| 1864 | Ga0501235_071188 | |||
| 1865 | Ga0501236_094090 | |||
| 1866 | Ga0501238_045298 | |||
| 1867 | Ga0501240_001076 | |||
| 1868 | Ga0501240_001307 | |||
| 1869 | Ga0501242_000055 | |||
| 1870 | Ga0501242_012656 | |||
| 1871 | Ga0501243_000076 | |||
| 1872 | Ga0501251_003567 | |||
| 1873 | Ga0501252_008652 | |||
| 1874 | Ga0501253_005555 | |||
| 1875 | Ga0501253_041367 | |||
| 1876 | Ga0501253_112155 | |||
| 1877 | Ga0501256_027286 | |||
| 1878 | Ga0501257_003176 | |||
| 1879 | Ga0501257_050221 | |||
| 1880 | Ga0501257_057675 | |||
| 1881 | Ga0501259_000372 | |||
| 1882 | Ga0501261_000749 | |||
| 1883 | Ga0501219_000125 | |||
| 1884 | Ga0501221_000930 | |||
| 1885 | Ga0501221_012115 | |||
| 1886 | Ga0501225_0002496 | |||
| 1887 | Ga0501225_0008265 | |||
| 1888 | Ga0501225_0021845 | |||
| 1889 | Ga0501234_001139 | |||
| 1890 | Ga0501234_004250 | |||
| 1891 | Ga0501245_002798 | |||
| 1892 | Ga0501245_055874 | |||
| 1893 | Ga0501079_0161539 | |||
| 1894 | Ga0501080_0137358 | |||
| 1895 | Ga0501083_0710872 | |||
| 1896 | Ga0501241_076992 | |||
| 1897 | Ga0501263_002383 | |||
| 1898 | Ga0501264_035675 | |||
| 1899 | Ga0501268_003833 | |||
| 1900 | Ga0501268_024368 | |||
| 1901 | Ga0501268_035098 | |||
| 1902 | Ga0501273_002795 | |||
| 1903 | Ga0501280_013972 | |||
| 1904 | Ga0501283_001578 | |||
| 1905 | Ga0501035_0059951 | |||
| 1906 | Ga0501035_0134106 | |||
| 1907 | Ga0501035_0425957 | |||
| 1908 | Ga0501035_0855139 | |||
| 1909 | Ga0501044_0019152 | |||
| 1910 | Ga0501044_0103134 | |||
| 1911 | Ga0501044_0155291 | |||
| 1912 | Ga0501044_0467521 | |||
| 1913 | Ga0501044_1008850 | |||
| 1914 | Ga0501212_001332 | |||
| 1915 | Ga0501284_00045 | |||
| 1916 | nmdc:mga0k408_117051_c1 | |||
| 1917 | nmdc:mga0k408_165544_c1 | |||
| 1918 | nmdc:mga0k408_28006_c1 | |||
| 1919 | nmdc:mga0k408_43685_c1 | |||
| 1920 | nmdc:mga0k408_680723_c1 | |||
| 1921 | nmdc:mga07m45_66317_c1 | |||
| 1922 | nmdc:mga05p37_8699_c1 | |||
| 1923 | nmdc:mga08y16_195457_c1 | |||
| 1924 | Ga0495619_0292841 | |||
| 1925 | Ga0500578_0001189 | |||
| 1926 | Ga0500578_0100816 | |||
| 1927 | Ga0500578_0301507 | |||
| 1928 | Ga0500644_0028545 | |||
| 1929 | Ga0500646_0025903 | |||
| 1930 | Ga0500583_0000018 | |||
| 1931 | Ga0500583_0000832 | |||
| 1932 | Ga0500583_0100582 | |||
| 1933 | Ga0500651_0302033 | |||
| 1934 | Ga0500650_0282150 | |||
| 1935 | Ga0500556_0015828 | |||
| 1936 | Ga0500556_0276711 | |||
| 1937 | Ga0500642_0001731 | |||
| 1938 | Ga0500642_0006130 | |||
| 1939 | Ga0500642_0203315 | |||
| 1940 | Ga0500652_002787 | |||
| 1941 | Ga0500655_028713 | |||
| 1942 | Ga0500573_0268649 | |||
| 1943 | Ga0500585_232892 | |||
| 1944 | Ga0500588_0051786 | |||
| 1945 | Ga0500588_0099851 | |||
| 1946 | Ga0500589_001565 | |||
| 1947 | Ga0500604_0002215 | |||
| 1948 | Ga0500616_0000717 | |||
| 1949 | Ga0500622_0000923 | |||
| 1950 | Ga0500622_0138997 | |||
| 1951 | Ga0500639_058587 | |||
| 1952 | Ga0500636_0212292 | |||
| 1953 | Ga0500636_0218806 | |||
| 1954 | Ga0500637_0050147 | |||
| 1955 | Ga0500637_0136328 | |||
| 1956 | Ga0500611_000907 | |||
| 1957 | Ga0501082_0127383 | |||
| 1958 | Ga0466962_0011225 | |||
| 1959 | Ga0466962_0120109 | |||
| 1960 | Ga0466962_0175920 | |||
| 1961 | Ga0466962_0239857 | |||
| 1962 | 2819588819 | |||
| 1963 | 8003156241 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6g6v-assembly1.cif.gz_A | phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 4-(2-carboxybenzoyl)-2-nitrobenzoic acid at 1.9a resolution. | 0.9632 | 1 | 151 |
| 6qmi-assembly1.cif.gz_A | phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 3-(1h-indol-1-yl)propanoic acid at 1.7a resolution. | 0.9624 | 1 | 151 |
| 3otw-assembly1.cif.gz_F | structural and functional studies of helicobacter pylori wild-type and mutated proteins phosphopantetheine adenylyltransferase | 0.9548 | 2 | 152 |
| 5h16-assembly1.cif.gz_D | crystal structure of the complex of phosphopantetheine adenylyltransferase from acinetobacter baumannii with citrate at 2.3 a resolution. | 0.9547 | 1 | 151 |
| 6b7b-assembly1.cif.gz_A | crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 5-methoxy-2-methyl-1h-indole | 0.9546 | 2 | 152 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6g7vA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9624 | 1 | 151 | 3.40.50.620 |
| 3nd7D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9538 | 2 | 153 | 3.40.50.620 |
| 3nbkD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9464 | 1 | 151 | 3.40.50.620 |
| 4f3rC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9405 | 1 | 153 | 3.40.50.620 |
| 5ts2A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9353 | 1 | 152 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Z9EZB5-F1-model_v4 | deleted | 0.9889 | 2 | 152 |
|
| AF-A0A520CJY5-F1-model_v4 | Pantetheine-phosphate adenylyltransferase (EC 2.7.7.3) | 0.9876 | 1 | 136 |
GO:0004595
GO:0005737 GO:0015937 |
| AF-A0A7X8FMF0-F1-model_v4 | deleted | 0.9862 | 1 | 148 |
|
| AF-A0A7C7FMZ9-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.9859 | 2 | 148 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
| AF-A0A2A5FK01-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.9854 | 1 | 153 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |