F487384

General Info

Members Datasets Scaffolds Average Seq Length
981 346 1963 159

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100959104|Ga0068857_1009591042
Length 191
Sequence MVLPYGWPCYIYWRETEIHLNFPIQSDCMRIALFPGTFDPVTFGPLDIIERSVPLFDKLYIGIGINANKQPMFSAEQRIEWLEDIFRNEPKIEVVLYEGLTVDCCKRVKANYILRGIRYVNDFEYEKAIADMNRSLDGNIETVFLTCLPKFTSVASTLVRDVIRNGGDVSQFVPEAVLHTIHQEGRKALMH

Samples

Sample ID Description Type Environment
1 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
104 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
160 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
161 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
162 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
163 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
164 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
165 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
166 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
167 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
182 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
194 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
195 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
196 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
197 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
198 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
199 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
200 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
201 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
202 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
203 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
204 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
205 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
206 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
207 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
208 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
209 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
210 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
211 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
212 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
213 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
214 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
215 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
216 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
217 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
218 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
219 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
220 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
221 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
222 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
223 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
224 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
225 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
226 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
227 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
228 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
229 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
230 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
231 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
232 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
235 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
236 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
237 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
238 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
239 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
240 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
241 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
242 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
243 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
244 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
245 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
246 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
247 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
252 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
253 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
254 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
255 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
256 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
268 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
269 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
270 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
271 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
272 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
273 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
274 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
275 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
276 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
277 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
278 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
279 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
280 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
281 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
282 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
283 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
284 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
285 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
286 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
287 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
288 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
289 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
290 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
291 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
292 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
293 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
294 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
295 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
296 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
297 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
298 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
299 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
300 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
301 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
302 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
303 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
304 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
305 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
306 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
307 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
308 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
309 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
310 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
311 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
312 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
313 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
316 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
317 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
318 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
319 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
320 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
321 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
322 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
323 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
324 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
325 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
326 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
327 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
328 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
329 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
330 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
331 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
332 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
333 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
334 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
335 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
336 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
337 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
338 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
339 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
340 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
341 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
342 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
343 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
344 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
345 2818991444 Filimonas endophytica 3197 Isolate Unclassified
346 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.1
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.4
Nodule 0
Rhizoplane 0.71
Rhizosphere 90.42
Stem 0
Stem Tuber 0
Unclassified 10.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068857_100959104 3300005577 Bacteria 822
2 JGI24735J21928_10019377 3300002067 Bacteria 2091
3 JGI25154J39366_1000022 3300002738 Bacteria 219590
4 JGI25154J39366_1011189 3300002738 Bacteria 1035
5 JGI25157J39369_1006168 3300002741 Unclassified 1859
6 JGI25164J39214_1002738 3300002772 Bacteria 2525
7 JGI25165J46597_1000420 3300003214 Bacteria 43968
8 JGI25153J46596_10001856 3300003215 Bacteria 12524
9 rootH1_10022033 3300003316 Bacteria 1692
10 rootH2_10004606 3300003320 Bacteria 102673
11 rootH2_10121353 3300003320 Bacteria 2461
12 rootL2_10058208 3300003322 Bacteria 5218
13 rootL2_10233169 3300003322 Bacteria 2637
14 rootH1_10009287 3300003323 Bacteria 13181
15 rootH1_10016880 3300003323 Bacteria 64867
16 rootH1_10043452 3300003316 Bacteria 20626
17 rootH1_10043452 3300003323 Bacteria 4798
18 rootH1_10255498 3300003323 Bacteria 2813
19 JGI25160J50197_1032470 3300003354 Bacteria 1326
20 Ga0058862_12364578 3300004803 Bacteria 1316
21 Ga0065165_1037858 3300005262 Bacteria 1459
22 Ga0065714_10072714 3300005288 Bacteria 3232
23 Ga0065714_10113882 3300005288 Bacteria 1436
24 Ga0065714_10195570 3300005288 Bacteria 912
25 Ga0065712_10021823 3300005290 Bacteria 1486
26 Ga0065712_10086969 3300005290 Bacteria 2605
27 Ga0070658_10013959 3300005327 Bacteria 6448
28 Ga0070658_10033505 3300005327 Bacteria 4133
29 Ga0070658_10092240 3300005327 Bacteria 2497
30 Ga0070658_10208454 3300005327 Bacteria 1651
31 Ga0070658_10284307 3300005327 Bacteria 1408
32 Ga0070676_10000376 3300005328 Bacteria 20680
33 Ga0070676_10001044 3300005328 Bacteria 13792
34 Ga0070676_10323634 3300005328 Unclassified 1052
35 Ga0070683_100007784 3300005329 Bacteria 9071
36 Ga0070683_100152116 3300005329 Bacteria 2194
37 Ga0070670_100097287 3300005331 Bacteria 2532
38 Ga0070670_100375913 3300005331 Bacteria 1251
39 Ga0070670_100608849 3300005331 Bacteria 978
40 Ga0070677_10029340 3300005333 Bacteria 2085
41 Ga0068869_100077215 3300005334 Bacteria 2477
42 Ga0070666_10000201 3300005335 Bacteria 40907
43 Ga0070680_100001133 3300005336 Bacteria 19138
44 Ga0070680_100017878 3300005336 Bacteria 5595
45 Ga0070680_100087905 3300005336 Bacteria 2570
46 Ga0070680_100099554 3300005336 Bacteria 2412
47 Ga0070680_100111009 3300005336 Bacteria 2282
48 Ga0070680_100700175 3300005336 Bacteria 872
49 Ga0070682_100000060 3300005337 Bacteria 105136
50 Ga0068868_100046531 3300005338 Bacteria 3397
51 Ga0068868_100057225 3300005338 Bacteria 3080
52 Ga0068868_100150522 3300005338 Bacteria 1916
53 Ga0068868_101024500 3300005338 Bacteria 756
54 Ga0070660_100015165 3300005339 Bacteria 5559
55 Ga0070660_100020897 3300005339 Bacteria 4819
56 Ga0070660_100042666 3300005339 Bacteria 3463
57 Ga0070660_100103452 3300005339 Bacteria 2258
58 Ga0070660_100476623 3300005339 Bacteria 1037
59 Ga0070660_100542241 3300005339 Bacteria 970
60 Ga0070660_100619685 3300005339 Bacteria 905
61 Ga0070691_10113522 3300005341 Bacteria 1357
62 Ga0070691_10129750 3300005341 Bacteria 1276
63 Ga0070661_100233976 3300005344 Bacteria 1413
64 Ga0070692_10452620 3300005345 Bacteria 822
65 Ga0070668_100000036 3300005347 Bacteria 81256
66 Ga0070668_100802596 3300005347 Bacteria 836
67 Ga0070669_100149713 3300005353 Bacteria 1806
68 Ga0070675_100011239 3300005354 Bacteria 7009
69 Ga0070675_100027386 3300005354 Bacteria 4579
70 Ga0070675_100095942 3300005354 Bacteria 2491
71 Ga0070675_100159036 3300005354 Bacteria 1942
72 Ga0070671_100208926 3300005355 Bacteria 1656
73 Ga0070671_100673987 3300005355 Bacteria 896
74 Ga0070673_100002827 3300005364 Bacteria 10679
75 Ga0070673_100500932 3300005364 Unclassified 1098
76 Ga0070673_100630236 3300005364 Bacteria 980
77 Ga0070673_101309552 3300005364 Unclassified 680
78 Ga0070688_100204213 3300005365 Bacteria 1384
79 Ga0070659_100001238 3300005366 Bacteria 18539
80 Ga0070659_100001469 3300005366 Bacteria 16968
81 Ga0070659_100013081 3300005366 Bacteria 6172
82 Ga0070659_100013744 3300005366 Bacteria 6036
83 Ga0070659_100167342 3300005366 Bacteria 1799
84 Ga0070659_100240531 3300005366 Bacteria 1498
85 Ga0070659_101181305 3300005366 Unclassified 676
86 Ga0070667_100000393 3300005367 Bacteria 47271
87 Ga0070714_100933655 3300005435 Bacteria 843
88 Ga0070663_100046954 3300005455 Bacteria 3058
89 Ga0070663_100616104 3300005455 Bacteria 914
90 Ga0070663_100808401 3300005455 Bacteria 804
91 Ga0070678_100295746 3300005456 Unclassified 1374
92 Ga0070678_100811288 3300005456 Unclassified 850
93 Ga0070662_100000252 3300005457 Bacteria 31682
94 Ga0070662_100008429 3300005457 Bacteria 6719
95 Ga0070681_10003852 3300005458 Bacteria 14114
96 Ga0070681_10006225 3300005458 Bacteria 11600
97 Ga0070681_10068869 3300005458 Bacteria 3505
98 Ga0070681_10082536 3300005458 Bacteria 3169
99 Ga0070681_10167900 3300005458 Bacteria 2117
100 Ga0070681_10314298 3300005458 Bacteria 1476
101 Ga0070681_11518098 3300005458 Bacteria 595
102 Ga0068867_100001529 3300005459 Bacteria 16051
103 Ga0068867_100033952 3300005459 Bacteria 3697
104 Ga0068867_100052975 3300005459 Bacteria 2995
105 Ga0068867_100174850 3300005459 Bacteria 1703
106 Ga0068867_100616433 3300005459 Unclassified 948
107 Ga0070685_10293963 3300005466 Bacteria 1092
108 Ga0070698_100051445 3300005471 Bacteria 4195
109 Ga0070679_100003662 3300005530 Bacteria 14067
110 Ga0070679_100014889 3300005530 Bacteria 7471
111 Ga0070679_100042397 3300005530 Bacteria 4531
112 Ga0070679_100154129 3300005530 Bacteria 2273
113 Ga0070679_100174164 3300005530 Bacteria 2124
114 Ga0070679_100215129 3300005530 Bacteria 1884
115 Ga0070679_101572314 3300005530 Unclassified 605
116 Ga0070684_100001099 3300005535 Bacteria 19385
117 Ga0070684_100022372 3300005535 Bacteria 5272
118 Ga0070684_100037425 3300005535 Bacteria 4162
119 Ga0068853_100001289 3300005539 Bacteria 17984
120 Ga0068853_100005465 3300005539 Bacteria 9958
121 Ga0068853_100007662 3300005539 Bacteria 8655
122 Ga0068853_100022704 3300005539 Bacteria 5244
123 Ga0068853_100059247 3300005539 Bacteria 3307
124 Ga0068853_100158618 3300005539 Bacteria 2040
125 Ga0068853_100227885 3300005539 Bacteria 1704
126 Ga0068853_100235766 3300005539 Bacteria 1675
127 Ga0068853_100381642 3300005539 Bacteria 1316
128 Ga0068853_100693429 3300005539 Bacteria 971
129 Ga0068853_100962417 3300005539 Bacteria 821
130 Ga0070672_100002608 3300005543 Bacteria 11517
131 Ga0070672_100082453 3300005543 Bacteria 2580
132 Ga0070672_100084486 3300005543 Bacteria 2549
133 Ga0070672_100106719 3300005543 Bacteria 2278
134 Ga0070665_100000016 3300005548 Bacteria 451538
135 Ga0070665_100001215 3300005548 Bacteria 31387
136 Ga0068855_100000257 3300005563 Bacteria 66593
137 Ga0068855_100003500 3300005563 Bacteria 19234
138 Ga0068855_100007377 3300005563 Bacteria 13314
139 Ga0068855_100015438 3300005563 Bacteria 9194
140 Ga0068855_100082914 3300005563 Bacteria 3715
141 Ga0068855_100084714 3300005563 Unclassified 3669
142 Ga0068855_100090726 3300005563 Bacteria 3526
143 Ga0068855_100117097 3300005563 Bacteria 3053
144 Ga0068855_100141627 3300005563 Bacteria 2740
145 Ga0068855_100146424 3300005563 Bacteria 2688
146 Ga0068855_100270090 3300005563 Bacteria 1891
147 Ga0068855_100354148 3300005563 Unclassified 1616
148 Ga0068855_100356856 3300005563 Bacteria 1609
149 Ga0068855_100444602 3300005563 Bacteria 1415
150 Ga0070664_100081393 3300005564 Bacteria 2791
151 Ga0070664_100124777 3300005564 Bacteria 2257
152 Ga0070664_100439773 3300005564 Unclassified 1196
153 Ga0068857_100002912 3300005577 Bacteria 14102
154 Ga0068857_100061221 3300005577 Bacteria 3344
155 Ga0068857_100074620 3300005577 Unclassified 3023
156 Ga0068857_100290365 3300005577 Bacteria 1505
157 Ga0068857_100684854 3300005577 Bacteria 973
158 Ga0068857_100816751 3300005577 Bacteria 891
159 Ga0068857_100873807 3300005577 Bacteria 861
160 Ga0068857_100936105 3300005577 Bacteria 832
161 Ga0068854_100044550 3300005578 Bacteria 3150
162 Ga0068854_100120083 3300005578 Bacteria 1994
163 Ga0068854_100200890 3300005578 Bacteria 1567
164 Ga0068854_100323576 3300005578 Bacteria 1254
165 Ga0068854_100872656 3300005578 Bacteria 789
166 Ga0068854_101944093 3300005578 Bacteria 541
167 Ga0068856_100005494 3300005614 Bacteria 12487
168 Ga0068856_100013252 3300005614 Bacteria 7984
169 Ga0068856_100023691 3300005614 Bacteria 5969
170 Ga0068856_100138407 3300005614 Bacteria 2441
171 Ga0068856_100200312 3300005614 Bacteria 2011
172 Ga0068856_100513826 3300005614 Bacteria 1219
173 Ga0068856_100571094 3300005614 Bacteria 1152
174 Ga0068856_101012269 3300005614 Bacteria 849
175 Ga0068852_100003516 3300005616 Bacteria 10961
176 Ga0068852_100004973 3300005616 Bacteria 9451
177 Ga0068852_100013746 3300005616 Bacteria 6204
178 Ga0068852_100034480 3300005616 Bacteria 4212
179 Ga0068852_100053055 3300005616 Bacteria 3488
180 Ga0068852_100156452 3300005616 Unclassified 2124
181 Ga0068852_100215352 3300005616 Bacteria 1824
182 Ga0068852_100250648 3300005616 Unclassified 1696
183 Ga0068852_100582062 3300005616 Bacteria 1122
184 Ga0068852_100594601 3300005616 Bacteria 1110
185 Ga0068852_100618926 3300005616 Bacteria 1088
186 Ga0068859_100067888 3300005617 Bacteria 3601
187 Ga0068859_100100796 3300005617 Bacteria 2944
188 Ga0068859_100735310 3300005617 Bacteria 1076
189 Ga0068864_100002025 3300005618 Bacteria 16721
190 Ga0068866_10064985 3300005718 Bacteria 1907
191 Ga0068861_100022287 3300005719 Bacteria 4562
192 Ga0068861_100147416 3300005719 Bacteria 1927
193 Ga0068851_10001779 3300005834 Bacteria 9419
194 Ga0068851_10282455 3300005834 Bacteria 950
195 Ga0068851_10496774 3300005834 Unclassified 731
196 Ga0068851_10760419 3300005834 Bacteria 600
197 Ga0068863_100007773 3300005841 Bacteria 10484
198 Ga0068863_100284740 3300005841 Bacteria 1602
199 Ga0068863_100634073 3300005841 Bacteria 1059
200 Ga0068863_102027272 3300005841 Unclassified 585
201 Ga0068858_100001071 3300005842 Bacteria 28302
202 Ga0068858_100197393 3300005842 Bacteria 1902
203 Ga0068858_100492381 3300005842 Bacteria 1184
204 Ga0068860_100000006 3300005843 Bacteria 461966
205 Ga0068860_100010347 3300005843 Bacteria 9226
206 Ga0068860_100018512 3300005843 Bacteria 6774
207 Ga0068860_100020538 3300005843 Bacteria 6397
208 Ga0068860_100025063 3300005843 Bacteria 5757
209 Ga0068860_100707528 3300005843 Unclassified 1017
210 Ga0070716_100646257 3300006173 Bacteria 801
211 Ga0075366_10005129 3300006195 Bacteria 7086
212 Ga0075366_10030731 3300006195 Bacteria 3158
213 Ga0075366_10038226 3300006195 Bacteria 2834
214 Ga0075366_10048318 3300006195 Bacteria 2523
215 Ga0075366_10149478 3300006195 Bacteria 1414
216 Ga0075366_10292118 3300006195 Bacteria 997
217 Ga0097621_100000212 3300006237 Bacteria 38270
218 Ga0097621_100001189 3300006237 Bacteria 18047
219 Ga0097621_100006360 3300006237 Bacteria 8380
220 Ga0097621_100143411 3300006237 Bacteria 2043
221 Ga0097621_100833739 3300006237 Unclassified 856
222 Ga0075370_10493931 3300006353 Unclassified 738
223 Ga0068871_100000720 3300006358 Bacteria 22413
224 Ga0068871_100002202 3300006358 Bacteria 13246
225 Ga0068871_100004872 3300006358 Bacteria 9375
226 Ga0068871_100014855 3300006358 Bacteria 5817
227 Ga0068871_100254546 3300006358 Unclassified 1530
228 Ga0068871_101276026 3300006358 Bacteria 690
229 Ga0068865_100000112 3300006881 Bacteria 41532
230 Ga0068865_100034450 3300006881 Bacteria 3397
231 Ga0068865_100869884 3300006881 Bacteria 782
232 Ga0097620_100009589 3300006931 Bacteria 9777
233 Ga0097620_100067889 3300006931 Bacteria 3601
234 Ga0097620_100100795 3300006931 Bacteria 2944
235 Ga0097620_100735476 3300006931 Bacteria 1076
236 Ga0105251_10164099 3300009011 Bacteria 1001
237 Ga0105240_10000155 3300009093 Bacteria 140485
238 Ga0105240_10001144 3300009093 Bacteria 46441
239 Ga0105240_10002687 3300009093 Bacteria 28319
240 Ga0105240_10005022 3300009093 Bacteria 19855
241 Ga0105240_10014688 3300009093 Bacteria 10685
242 Ga0105240_10029329 3300009093 Bacteria 7171
243 Ga0105240_10034681 3300009093 Bacteria 6507
244 Ga0105240_10036495 3300009093 Bacteria 6322
245 Ga0105240_10043386 3300009093 Bacteria 5723
246 Ga0105240_10082059 3300009093 Bacteria 3960
247 Ga0105240_10082254 3300009093 Bacteria 3955
248 Ga0105240_10104381 3300009093 Bacteria 3442
249 Ga0105240_10282755 3300009093 Unclassified 1905
250 Ga0105240_10315411 3300009093 Bacteria 1784
251 Ga0105240_10406339 3300009093 Bacteria 1533
252 Ga0105240_10502764 3300009093 Bacteria 1347
253 Ga0105240_10529364 3300009093 Bacteria 1307
254 Ga0105240_10549317 3300009093 Bacteria 1278
255 Ga0105240_10664159 3300009093 Bacteria 1141
256 Ga0105240_10747832 3300009093 Bacteria 1063
257 Ga0111539_10150124 3300009094 Bacteria 2728
258 Ga0105245_10403857 3300009098 Bacteria 1366
259 Ga0105247_10499798 3300009101 Bacteria 886
260 Ga0114129_10002084 3300009147 Bacteria 27490
261 Ga0105241_10000113 3300009174 Bacteria 58135
262 Ga0105241_10000898 3300009174 Bacteria 22475
263 Ga0105241_10005212 3300009174 Bacteria 9597
264 Ga0105241_10011777 3300009174 Bacteria 6423
265 Ga0105241_10055333 3300009174 Bacteria 3039
266 Ga0105241_10097786 3300009174 Bacteria 2328
267 Ga0105241_10098405 3300009174 Bacteria 2321
268 Ga0105241_10201956 3300009174 Bacteria 1661
269 Ga0105241_10475108 3300009174 Bacteria 1110
270 Ga0105241_11461584 3300009174 Bacteria 656
271 Ga0105242_10070451 3300009176 Bacteria 2899
272 Ga0105242_10213586 3300009176 Bacteria 1721
273 Ga0105242_10967642 3300009176 Bacteria 856
274 Ga0105248_10047599 3300009177 Unclassified 4809
275 Ga0105248_10053635 3300009177 Bacteria 4524
276 Ga0105248_10515153 3300009177 Unclassified 1349
277 Ga0105237_10000061 3300009545 Bacteria 146107
278 Ga0105237_10000417 3300009545 Bacteria 60658
279 Ga0105237_10008194 3300009545 Bacteria 11352
280 Ga0105237_10019539 3300009545 Bacteria 6997
281 Ga0105237_10022631 3300009545 Bacteria 6446
282 Ga0105237_10023025 3300009545 Bacteria 6388
283 Ga0105237_10034436 3300009545 Bacteria 5128
284 Ga0105237_10059196 3300009545 Bacteria 3832
285 Ga0105237_10059700 3300009545 Bacteria 3815
286 Ga0105237_10086203 3300009545 Bacteria 3130
287 Ga0105237_10103854 3300009545 Bacteria 2834
288 Ga0105237_10110815 3300009545 Bacteria 2736
289 Ga0105237_10164797 3300009545 Bacteria 2215
290 Ga0105237_10215180 3300009545 Bacteria 1921
291 Ga0105237_10264828 3300009545 Bacteria 1722
292 Ga0105237_10510398 3300009545 Bacteria 1209
293 Ga0105237_10584713 3300009545 Bacteria 1123
294 Ga0105237_10634795 3300009545 Bacteria 1075
295 Ga0105237_10935885 3300009545 Bacteria 873
296 Ga0105237_11085971 3300009545 Unclassified 807
297 Ga0105237_11240726 3300009545 Bacteria 752
298 Ga0105238_10010861 3300009551 Bacteria 9153
299 Ga0105238_10035276 3300009551 Bacteria 5085
300 Ga0105238_10036611 3300009551 Bacteria 4990
301 Ga0105238_10102453 3300009551 Bacteria 2844
302 Ga0105238_10187538 3300009551 Bacteria 2044
303 Ga0105238_10829446 3300009551 Bacteria 941
304 Ga0105238_10931642 3300009551 Bacteria 888
305 Ga0105238_11043513 3300009551 Bacteria 839
306 Ga0105238_11323562 3300009551 Bacteria 747
307 Ga0105249_10003698 3300009553 Bacteria 13192
308 Ga0105249_10011368 3300009553 Bacteria 7817
309 Ga0105249_10239036 3300009553 Unclassified 1795
310 Ga0105249_10286645 3300009553 Bacteria 1647
311 Ga0105239_10000010 3300010375 Bacteria 341545
312 Ga0105239_10000415 3300010375 Bacteria 62156
313 Ga0105239_10000482 3300010375 Bacteria 58131
314 Ga0105239_10005902 3300010375 Bacteria 14267
315 Ga0105239_10006393 3300010375 Bacteria 13684
316 Ga0105239_10006733 3300010375 Bacteria 13275
317 Ga0105239_10029427 3300010375 Bacteria 6038
318 Ga0105239_10030646 3300010375 Bacteria 5916
319 Ga0105239_10041699 3300010375 Bacteria 5029
320 Ga0105239_10131094 3300010375 Bacteria 2789
321 Ga0105239_10290659 3300010375 Bacteria 1840
322 Ga0105239_10355436 3300010375 Bacteria 1654
323 Ga0105239_10398910 3300010375 Bacteria 1557
324 Ga0105239_10438445 3300010375 Bacteria 1481
325 Ga0105239_11389818 3300010375 Bacteria 810
326 Ga0105246_10033878 3300011119 Bacteria 3398
327 Ga0105246_10062211 3300011119 Bacteria 2600
328 Ga0105246_10698507 3300011119 Bacteria 889
329 Ga0105246_10931799 3300011119 Unclassified 781
330 Ga0105246_11962903 3300011119 Bacteria 564
331 Ga0157373_10001922 3300013100 Bacteria 15789
332 Ga0157373_10006674 3300013100 Bacteria 8597
333 Ga0157373_10122746 3300013100 Bacteria 1826
334 Ga0157373_10152466 3300013100 Bacteria 1626
335 Ga0157373_10162996 3300013100 Bacteria 1569
336 Ga0157373_10243602 3300013100 Bacteria 1271
337 Ga0157373_10500493 3300013100 Bacteria 878
338 Ga0157371_10001534 3300013102 Bacteria 23793
339 Ga0157371_10002382 3300013102 Bacteria 17982
340 Ga0157371_10002977 3300013102 Bacteria 15723
341 Ga0157371_10003511 3300013102 Bacteria 14162
342 Ga0157371_10003728 3300013102 Bacteria 13656
343 Ga0157371_10019675 3300013102 Bacteria 4973
344 Ga0157371_10021366 3300013102 Bacteria 4752
345 Ga0157371_10022801 3300013102 Bacteria 4580
346 Ga0157371_10023229 3300013102 Bacteria 4534
347 Ga0157371_10034836 3300013102 Bacteria 3610
348 Ga0157371_10048660 3300013102 Bacteria 3014
349 Ga0157371_10048801 3300013102 Bacteria 3009
350 Ga0157371_10072843 3300013102 Bacteria 2433
351 Ga0157371_10082546 3300013102 Bacteria 2276
352 Ga0157371_10175078 3300013102 Bacteria 1534
353 Ga0157371_10214733 3300013102 Bacteria 1381
354 Ga0157371_10232895 3300013102 Bacteria 1324
355 Ga0157371_10237493 3300013102 Bacteria 1311
356 Ga0157370_10001056 3300013104 Bacteria 34670
357 Ga0157370_10003729 3300013104 Bacteria 17809
358 Ga0157370_10008499 3300013104 Bacteria 11073
359 Ga0157370_10062863 3300013104 Bacteria 3520
360 Ga0157370_10081716 3300013104 Bacteria 3040
361 Ga0157370_10086945 3300013104 Bacteria 2936
362 Ga0157370_10094169 3300013104 Bacteria 2811
363 Ga0157370_10105509 3300013104 Bacteria 2637
364 Ga0157370_10121749 3300013104 Bacteria 2436
365 Ga0157370_10186900 3300013104 Bacteria 1923
366 Ga0157370_10218843 3300013104 Unclassified 1764
367 Ga0157370_10229378 3300013104 Bacteria 1719
368 Ga0157370_10268545 3300013104 Bacteria 1576
369 Ga0157370_10336255 3300013104 Bacteria 1392
370 Ga0157370_10363049 3300013104 Bacteria 1334
371 Ga0157370_10422889 3300013104 Bacteria 1226
372 Ga0157370_10501567 3300013104 Bacteria 1114
373 Ga0157369_10000853 3300013105 Bacteria 38843
374 Ga0157369_10011149 3300013105 Bacteria 10218
375 Ga0157369_10016348 3300013105 Bacteria 8350
376 Ga0157369_10080482 3300013105 Bacteria 3488
377 Ga0157369_10120997 3300013105 Bacteria 2778
378 Ga0157369_10210665 3300013105 Bacteria 2037
379 Ga0157369_10265309 3300013105 Bacteria 1790
380 Ga0157369_10369743 3300013105 Bacteria 1488
381 Ga0157369_11811351 3300013105 Unclassified 620
382 Ga0157369_12021259 3300013105 Bacteria 585
383 Ga0157374_10000408 3300013296 Bacteria 38980
384 Ga0157374_10000618 3300013296 Bacteria 31268
385 Ga0157374_10009788 3300013296 Bacteria 8233
386 Ga0157374_10041703 3300013296 Bacteria 4231
387 Ga0157374_10059021 3300013296 Bacteria 3586
388 Ga0157374_10164510 3300013296 Bacteria 2162
389 Ga0157374_10477610 3300013296 Unclassified 1250
390 Ga0157374_10585923 3300013296 Bacteria 1125
391 Ga0157374_10588861 3300013296 Bacteria 1122
392 Ga0157374_11219675 3300013296 Bacteria 774
393 Ga0157374_12242791 3300013296 Bacteria 573
394 Ga0157378_10072207 3300013297 Bacteria 3101
395 Ga0157378_10077124 3300013297 Bacteria 3004
396 Ga0157378_10120809 3300013297 Bacteria 2415
397 Ga0157378_10147983 3300013297 Bacteria 2186
398 Ga0157378_10317568 3300013297 Unclassified 1512
399 Ga0157378_10580165 3300013297 Bacteria 1130
400 Ga0157378_11453243 3300013297 Bacteria 729
401 Ga0163162_10000040 3300013306 Bacteria 133855
402 Ga0163162_10001209 3300013306 Bacteria 24116
403 Ga0163162_10001777 3300013306 Bacteria 20207
404 Ga0163162_10002037 3300013306 Bacteria 19017
405 Ga0163162_10002657 3300013306 Bacteria 16942
406 Ga0163162_10054155 3300013306 Bacteria 4035
407 Ga0163162_10093304 3300013306 Bacteria 3095
408 Ga0163162_10250454 3300013306 Unclassified 1903
409 Ga0163162_10503489 3300013306 Unclassified 1341
410 Ga0163162_10650697 3300013306 Bacteria 1178
411 Ga0163162_12323449 3300013306 Unclassified 616
412 Ga0157372_10000011 3300013307 Bacteria 277202
413 Ga0157372_10000491 3300013307 Bacteria 43650
414 Ga0157372_10000743 3300013307 Bacteria 35537
415 Ga0157372_10013303 3300013307 Bacteria 8782
416 Ga0157372_10022186 3300013307 Bacteria 6868
417 Ga0157372_10022799 3300013307 Bacteria 6778
418 Ga0157372_10023113 3300013307 Bacteria 6737
419 Ga0157372_10026508 3300013307 Bacteria 6306
420 Ga0157372_10027365 3300013307 Bacteria 6208
421 Ga0157372_10028841 3300013307 Bacteria 6058
422 Ga0157372_10068044 3300013307 Bacteria 4004
423 Ga0157372_10096034 3300013307 Bacteria 3377
424 Ga0157372_10126998 3300013307 Bacteria 2932
425 Ga0157372_10155883 3300013307 Bacteria 2638
426 Ga0157372_10158258 3300013307 Bacteria 2617
427 Ga0157372_10163110 3300013307 Bacteria 2576
428 Ga0157372_10194104 3300013307 Bacteria 2352
429 Ga0157372_10247929 3300013307 Unclassified 2067
430 Ga0157372_10273431 3300013307 Bacteria 1963
431 Ga0157372_10379938 3300013307 Bacteria 1646
432 Ga0157372_10383313 3300013307 Bacteria 1638
433 Ga0157372_10411411 3300013307 Bacteria 1576
434 Ga0157372_10470354 3300013307 Bacteria 1465
435 Ga0157372_10488169 3300013307 Unclassified 1436
436 Ga0157372_10504147 3300013307 Bacteria 1411
437 Ga0157372_10639285 3300013307 Unclassified 1239
438 Ga0157372_10642061 3300013307 Bacteria 1236
439 Ga0157372_10756841 3300013307 Bacteria 1129
440 Ga0157372_11056316 3300013307 Unclassified 940
441 Ga0157372_11194029 3300013307 Bacteria 879
442 Ga0157372_11746619 3300013307 Bacteria 716
443 Ga0157372_12277419 3300013307 Bacteria 622
444 Ga0157375_10005786 3300013308 Bacteria 10756
445 Ga0157375_10358647 3300013308 Bacteria 1624
446 Ga0157375_10680630 3300013308 Bacteria 1183
447 Ga0157375_11605296 3300013308 Unclassified 769
448 Ga0163163_10000110 3300014325 Bacteria 87033
449 Ga0163163_10000141 3300014325 Bacteria 74842
450 Ga0163163_10624401 3300014325 Bacteria 1141
451 Ga0157380_10017302 3300014326 Bacteria 5334
452 Ga0157380_10027950 3300014326 Bacteria 4296
453 Ga0157377_10859473 3300014745 Unclassified 674
454 Ga0157379_10000173 3300014968 Bacteria 48672
455 Ga0157379_10111532 3300014968 Unclassified 2457
456 Ga0157379_10128901 3300014968 Bacteria 2276
457 Ga0157379_11149748 3300014968 Bacteria 745
458 Ga0157376_10000161 3300014969 Bacteria 46915
459 Ga0157376_10038978 3300014969 Bacteria 3870
460 Ga0157376_10071207 3300014969 Bacteria 2954
461 Ga0157376_10112971 3300014969 Bacteria 2394
462 Ga0157376_10128605 3300014969 Bacteria 2257
463 Ga0157376_10130015 3300014969 Unclassified 2245
464 Ga0157376_10215878 3300014969 Bacteria 1774
465 Ga0182007_10061606 3300015262 Bacteria 1230
466 Ga0163161_10025549 3300017792 Bacteria 4180
467 Ga0163161_10055069 3300017792 Bacteria 2887
468 Ga0163161_10417795 3300017792 Bacteria 1078
469 Ga0209258_118393 3300025242 Bacteria 754
470 Ga0209646_1000003 3300025246 Bacteria 1160860
471 Ga0209646_1004846 3300025246 Bacteria 2412
472 Ga0209026_1000354 3300025250 Bacteria 43355
473 Ga0209758_1010470 3300025297 Bacteria 5543
474 Ga0207426_1000187 3300025302 Bacteria 153809
475 Ga0207656_10000689 3300025321 Bacteria 11059
476 Ga0207656_10325344 3300025321 Unclassified 764
477 Ga0207656_10372948 3300025321 Bacteria 715
478 Ga0207642_10875472 3300025899 Bacteria 574
479 Ga0207680_10025199 3300025903 Bacteria 3278
480 Ga0207680_10026610 3300025903 Bacteria 3209
481 Ga0207647_10027144 3300025904 Bacteria 3736
482 Ga0207647_10152937 3300025904 Bacteria 1348
483 Ga0207645_10002633 3300025907 Bacteria 13991
484 Ga0207705_10038378 3300025909 Unclassified 3429
485 Ga0207705_10045442 3300025909 Bacteria 3156
486 Ga0207705_10085977 3300025909 Bacteria 2298
487 Ga0207705_10138589 3300025909 Bacteria 1815
488 Ga0207705_10141615 3300025909 Bacteria 1796
489 Ga0207705_10458448 3300025909 Unclassified 989
490 Ga0207654_10000461 3300025911 Bacteria 23222
491 Ga0207654_10075484 3300025911 Bacteria 2015
492 Ga0207654_10327240 3300025911 Bacteria 1049
493 Ga0207707_10000189 3300025912 Bacteria 65118
494 Ga0207707_10019690 3300025912 Bacteria 5891
495 Ga0207707_10454074 3300025912 Bacteria 1096
496 Ga0207707_10684626 3300025912 Bacteria 862
497 Ga0207707_10878749 3300025912 Bacteria 742
498 Ga0207707_11038884 3300025912 Unclassified 671
499 Ga0207695_10000043 3300025913 Bacteria 444585
500 Ga0207695_10000165 3300025913 Bacteria 195908
501 Ga0207695_10000245 3300025913 Bacteria 141090
502 Ga0207695_10018911 3300025913 Bacteria 7947
503 Ga0207695_10022033 3300025913 Bacteria 7249
504 Ga0207695_10045636 3300025913 Bacteria 4650
505 Ga0207695_10132246 3300025913 Bacteria 2452
506 Ga0207695_10343294 3300025913 Bacteria 1381
507 Ga0207695_10471786 3300025913 Bacteria 1137
508 Ga0207695_10514895 3300025913 Bacteria 1078
509 Ga0207695_10917415 3300025913 Bacteria 755
510 Ga0207671_10001487 3300025914 Bacteria 27036
511 Ga0207671_10003937 3300025914 Bacteria 14476
512 Ga0207671_10021318 3300025914 Bacteria 4917
513 Ga0207671_10054170 3300025914 Bacteria 2972
514 Ga0207671_10157562 3300025914 Bacteria 1757
515 Ga0207671_10880713 3300025914 Unclassified 708
516 Ga0207671_10894361 3300025914 Bacteria 702
517 Ga0207671_11059949 3300025914 Bacteria 638
518 Ga0207660_10008768 3300025917 Bacteria 6536
519 Ga0207660_10089470 3300025917 Bacteria 2279
520 Ga0207657_10030828 3300025919 Bacteria 4861
521 Ga0207657_10117679 3300025919 Bacteria 2188
522 Ga0207649_10147263 3300025920 Bacteria 1618
523 Ga0207649_11470301 3300025920 Unclassified 539
524 Ga0207652_10000108 3300025921 Bacteria 90141
525 Ga0207652_10000488 3300025921 Bacteria 40566
526 Ga0207652_10000541 3300025921 Bacteria 38299
527 Ga0207652_10006784 3300025921 Bacteria 9232
528 Ga0207652_10302214 3300025921 Bacteria 1444
529 Ga0207652_10580575 3300025921 Unclassified 1006
530 Ga0207652_11022573 3300025921 Bacteria 725
531 Ga0207681_10333896 3300025923 Bacteria 1209
532 Ga0207694_10071132 3300025924 Bacteria 2718
533 Ga0207694_10361507 3300025924 Bacteria 1203
534 Ga0207650_10079343 3300025925 Bacteria 2486
535 Ga0207650_10124027 3300025925 Bacteria 2014
536 Ga0207650_10349277 3300025925 Bacteria 1216
537 Ga0207650_10409968 3300025925 Unclassified 1123
538 Ga0207650_10655848 3300025925 Bacteria 885
539 Ga0207659_10045959 3300025926 Bacteria 3081
540 Ga0207659_10279631 3300025926 Unclassified 1364
541 Ga0207659_10411885 3300025926 Bacteria 1132
542 Ga0207659_10761216 3300025926 Bacteria 831
543 Ga0207687_10277810 3300025927 Bacteria 1341
544 Ga0207664_10790997 3300025929 Bacteria 853
545 Ga0207644_10361149 3300025931 Bacteria 1181
546 Ga0207690_10052425 3300025932 Bacteria 2732
547 Ga0207690_10119304 3300025932 Bacteria 1913
548 Ga0207690_11118076 3300025932 Unclassified 657
549 Ga0207690_11407193 3300025932 Bacteria 583
550 Ga0207706_10011353 3300025933 Bacteria 8117
551 Ga0207686_10302721 3300025934 Unclassified 1188
552 Ga0207704_10011472 3300025938 Bacteria 4362
553 Ga0207704_10329890 3300025938 Bacteria 1180
554 Ga0207691_10000504 3300025940 Bacteria 38867
555 Ga0207691_10088931 3300025940 Bacteria 2770
556 Ga0207691_11166351 3300025940 Unclassified 639
557 Ga0207711_10088422 3300025941 Bacteria 2720
558 Ga0207689_11126832 3300025942 Bacteria 661
559 Ga0207661_10005276 3300025944 Bacteria 9098
560 Ga0207661_10120463 3300025944 Bacteria 2233
561 Ga0207661_10172657 3300025944 Bacteria 1883
562 Ga0207661_10302191 3300025944 Bacteria 1435
563 Ga0207679_10023361 3300025945 Bacteria 4227
564 Ga0207679_10042309 3300025945 Bacteria 3273
565 Ga0207667_10000440 3300025949 Bacteria 55666
566 Ga0207667_10000913 3300025949 Bacteria 37630
567 Ga0207667_10005535 3300025949 Bacteria 15417
568 Ga0207667_10026291 3300025949 Bacteria 6361
569 Ga0207667_10029218 3300025949 Bacteria 5980
570 Ga0207667_10076678 3300025949 Bacteria 3469
571 Ga0207667_10118271 3300025949 Bacteria 2731
572 Ga0207667_10208352 3300025949 Bacteria 2004
573 Ga0207667_10306641 3300025949 Unclassified 1622
574 Ga0207667_10635462 3300025949 Bacteria 1074
575 Ga0207651_10006216 3300025960 Bacteria 6220
576 Ga0207712_10185645 3300025961 Bacteria 1637
577 Ga0207712_10224263 3300025961 Bacteria 1504
578 Ga0207712_10398572 3300025961 Bacteria 1156
579 Ga0207668_10002658 3300025972 Bacteria 10461
580 Ga0207668_10968648 3300025972 Bacteria 759
581 Ga0207640_10011035 3300025981 Bacteria 5103
582 Ga0207640_10056140 3300025981 Bacteria 2583
583 Ga0207640_10056558 3300025981 Unclassified 2576
584 Ga0207640_10376113 3300025981 Bacteria 1149
585 Ga0207640_10574856 3300025981 Bacteria 950
586 Ga0207640_10577986 3300025981 Unclassified 948
587 Ga0207640_11103547 3300025981 Bacteria 702
588 Ga0207658_10005579 3300025986 Bacteria 8609
589 Ga0207658_11639447 3300025986 Bacteria 588
590 Ga0207677_10005078 3300026023 Bacteria 7113
591 Ga0207677_10068348 3300026023 Bacteria 2493
592 Ga0207677_10748268 3300026023 Bacteria 871
593 Ga0207677_10770476 3300026023 Bacteria 859
594 Ga0207703_11514825 3300026035 Bacteria 645
595 Ga0207639_10002969 3300026041 Bacteria 11409
596 Ga0207639_10024472 3300026041 Bacteria 4370
597 Ga0207639_10027754 3300026041 Bacteria 4127
598 Ga0207639_10057585 3300026041 Bacteria 2985
599 Ga0207639_10059783 3300026041 Bacteria 2938
600 Ga0207639_10066611 3300026041 Bacteria 2800
601 Ga0207639_10135570 3300026041 Bacteria 2044
602 Ga0207639_10287741 3300026041 Bacteria 1448
603 Ga0207639_10314621 3300026041 Bacteria 1388
604 Ga0207639_10431171 3300026041 Bacteria 1194
605 Ga0207639_10888374 3300026041 Bacteria 833
606 Ga0207639_10998902 3300026041 Bacteria 784
607 Ga0207639_11121637 3300026041 Bacteria 738
608 Ga0207639_11142419 3300026041 Unclassified 731
609 Ga0207678_10051627 3300026067 Bacteria 3550
610 Ga0207678_10230755 3300026067 Bacteria 1585
611 Ga0207702_10000196 3300026078 Bacteria 71703
612 Ga0207702_10310831 3300026078 Bacteria 1498
613 Ga0207702_10348991 3300026078 Bacteria 1415
614 Ga0207702_10454063 3300026078 Bacteria 1244
615 Ga0207702_10511677 3300026078 Bacteria 1171
616 Ga0207702_10530628 3300026078 Bacteria 1150
617 Ga0207702_10704480 3300026078 Bacteria 995
618 Ga0207641_10009580 3300026088 Bacteria 7981
619 Ga0207641_10233320 3300026088 Bacteria 1711
620 Ga0207641_10767029 3300026088 Bacteria 953
621 Ga0207641_11010939 3300026088 Bacteria 828
622 Ga0207648_10016152 3300026089 Bacteria 6835
623 Ga0207648_10146611 3300026089 Bacteria 2082
624 Ga0207648_11108245 3300026089 Bacteria 742
625 Ga0207648_11475912 3300026089 Bacteria 639
626 Ga0207676_10003314 3300026095 Bacteria 11431
627 Ga0207676_10527722 3300026095 Bacteria 1125
628 Ga0207674_10004216 3300026116 Bacteria 17351
629 Ga0207674_10064985 3300026116 Unclassified 3679
630 Ga0207674_10075665 3300026116 Bacteria 3376
631 Ga0207674_10166256 3300026116 Bacteria 2160
632 Ga0207674_10571067 3300026116 Unclassified 1092
633 Ga0207674_10885068 3300026116 Bacteria 861
634 Ga0207674_11598521 3300026116 Bacteria 620
635 Ga0207675_100314802 3300026118 Bacteria 1527
636 Ga0207683_10821794 3300026121 Unclassified 863
637 Ga0207698_10006493 3300026142 Bacteria 7301
638 Ga0207698_10013137 3300026142 Bacteria 5451
639 Ga0207698_10015088 3300026142 Bacteria 5163
640 Ga0207698_10039245 3300026142 Bacteria 3506
641 Ga0207698_10125756 3300026142 Bacteria 2180
642 Ga0207698_10166241 3300026142 Unclassified 1936
643 Ga0207698_10258120 3300026142 Bacteria 1599
644 Ga0207698_10459509 3300026142 Bacteria 1231
645 Ga0207698_10543750 3300026142 Bacteria 1137
646 Ga0207698_10717569 3300026142 Bacteria 996
647 Ga0207698_10819015 3300026142 Unclassified 934
648 Ga0209974_10218506 3300027876 Bacteria 709
649 Ga0268266_10000149 3300028379 Bacteria 134809
650 Ga0268266_10001023 3300028379 Bacteria 35230
651 Ga0268265_11818903 3300028380 Unclassified 616
652 Ga0268264_10000064 3300028381 Bacteria 301274
653 Ga0268264_10003688 3300028381 Bacteria 13141
654 Ga0268264_10006580 3300028381 Bacteria 9783
655 Ga0268264_10007122 3300028381 Bacteria 9374
656 Ga0268264_10010089 3300028381 Bacteria 7819
657 Ga0268264_10949680 3300028381 Bacteria 865
658 Ga0268264_11061143 3300028381 Bacteria 818
659 Ga0307517_10005503 3300028786 Bacteria 19046
660 Ga0307517_10152802 3300028786 Bacteria 1578
661 Ga0307517_10159858 3300028786 Bacteria 1516
662 Ga0307515_10000001 3300028794 Bacteria 4259510
663 Ga0307511_10000138 3300030521 Bacteria 67742
664 Ga0307512_10133321 3300030522 Bacteria 1549
665 Ga0265328_10000178 3300031239 Bacteria 29493
666 Ga0265331_10192826 3300031250 Bacteria 919
667 Ga0265327_10006475 3300031251 Bacteria 9351
668 Ga0265327_10117858 3300031251 Bacteria 1262
669 Ga0307513_10191568 3300031456 Bacteria 1896
670 Ga0307513_10353112 3300031456 Bacteria 1217
671 Ga0307513_10475104 3300031456 Bacteria 971
672 Ga0307509_10069660 3300031507 Bacteria 3676
673 Ga0307509_10097887 3300031507 Bacteria 2981
674 Ga0307408_100459300 3300031548 Unclassified 1106
675 Ga0307516_10001145 3300031730 Bacteria 37050
676 Ga0307516_10359410 3300031730 Bacteria 1121
677 Ga0307405_10378338 3300031731 Unclassified 1101
678 Ga0307405_10466476 3300031731 Unclassified 1005
679 Ga0307413_10017191 3300031824 Bacteria 3761
680 Ga0307410_10107562 3300031852 Unclassified 2012
681 Ga0307410_10749031 3300031852 Bacteria 827
682 Ga0307406_10059138 3300031901 Bacteria 2466
683 Ga0307407_10133542 3300031903 Unclassified 1591
684 Ga0307412_10360837 3300031911 Bacteria 1170
685 Ga0307412_10518966 3300031911 Bacteria 995
686 Ga0307409_100187413 3300031995 Bacteria 1838
687 Ga0307416_100220455 3300032002 Unclassified 1818
688 Ga0307411_10576888 3300032005 Unclassified 964
689 Ga0307411_10684159 3300032005 Bacteria 892
690 Ga0307415_100080628 3300032126 Unclassified 2322
691 Ga0307510_10000079 3300033180 Bacteria 73286
692 Ga0373945_0145253 3300035116 Bacteria 959
693 Ga0373953_0281453 3300035117 Bacteria 725
694 Ga0373935_0814793 3300035692 Unclassified 690
695 Ga0373927_0066611 3300035695 Bacteria 2330
696 Ga0373933_0578245 3300035724 Bacteria 737
697 Ga0373937_0409249 3300036401 Bacteria 1287
698 Ga0373937_0932126 3300036401 Bacteria 817
699 Ga0373925_1437866 3300037068 Unclassified 565
700 Ga0395899_0003463 3300037312 Bacteria 12509
701 Ga0395899_0009069 3300037312 Bacteria 7646
702 Ga0395899_0096340 3300037312 Bacteria 2139
703 Ga0395899_0371871 3300037312 Bacteria 951
704 Ga0395899_0726682 3300037312 Bacteria 620
705 Ga0395900_0014175 3300037418 Bacteria 8140
706 Ga0395900_0022808 3300037418 Bacteria 6404
707 Ga0395900_0071784 3300037418 Bacteria 3559
708 Ga0395900_0206909 3300037418 Bacteria 1983
709 Ga0395900_0252503 3300037418 Bacteria 1764
710 Ga0395900_0524837 3300037418 Bacteria 1131
711 Ga0395900_0853988 3300037418 Bacteria 836
712 Ga0395898_0006358 3300037466 Bacteria 12617
713 Ga0395898_0051146 3300037466 Bacteria 4041
714 Ga0395898_0065837 3300037466 Bacteria 3513
715 Ga0395898_0086973 3300037466 Unclassified 3011
716 Ga0395898_0839248 3300037466 Bacteria 858
717 Ga0395905_0012427 3300037471 Bacteria 8195
718 Ga0395905_0092339 3300037471 Bacteria 2839
719 Ga0395905_0098529 3300037471 Bacteria 2745
720 Ga0395905_0330809 3300037471 Bacteria 1414
721 Ga0395905_1105057 3300037471 Bacteria 696
722 Ga0395901_0005285 3300038443 Bacteria 13046
723 Ga0395901_0007090 3300038443 Bacteria 11330
724 Ga0395901_0208681 3300038443 Bacteria 2045
725 Ga0395901_0228237 3300038443 Bacteria 1944
726 Ga0395901_0261342 3300038443 Bacteria 1802
727 Ga0395901_0272795 3300038443 Bacteria 1759
728 Ga0400489_65840 3300039093 Bacteria 109575
729 Ga0439439_0008781 3300041406 Bacteria 2392
730 Ga0439439_0098972 3300041406 Bacteria 802
731 Ga0439466_0130768 3300041411 Bacteria 773
732 Ga0439465_0021806 3300041413 Bacteria 2011
733 Ga0451791_0054266 3300041451 Bacteria 576
734 Ga0451797_0773780 3300041453 Bacteria 645
735 Ga0451800_0408194 3300041459 Bacteria 1201
736 Ga0451804_0480600 3300041463 Bacteria 569
737 Ga0451839_1376007 3300041496 Bacteria 771
738 Ga0451853_1710672 3300041512 Bacteria 714
739 Ga0439433_0045135 3300041999 Unclassified 1031
740 Ga0439445_0204515 3300042004 Unclassified 584
741 Ga0439449_0006193 3300042007 Bacteria 4573
742 Ga0439449_0023388 3300042007 Bacteria 2311
743 Ga0439449_0129548 3300042007 Bacteria 937
744 Ga0439457_002491 3300042014 Bacteria 5244
745 Ga0439457_003703 3300042014 Bacteria 4118
746 Ga0439457_063908 3300042014 Bacteria 835
747 Ga0439462_0112443 3300042015 Bacteria 754
748 Ga0439434_0069067 3300042435 Bacteria 1111
749 Ga0451577_0751752 3300042876 Unclassified 882
750 Ga0466969_0000137 3300044656 Bacteria 39423
751 Ga0466972_0000022 3300044658 Bacteria 193802
752 Ga0466972_0000092 3300044658 Bacteria 80656
753 Ga0466972_0032139 3300044658 Bacteria 2578
754 Ga0466972_0316773 3300044658 Bacteria 729
755 Ga0466965_0019968 3300044683 Bacteria 3218
756 Ga0466966_0000099 3300044684 Bacteria 53474
757 Ga0466966_0770624 3300044684 Unclassified 580
758 Ga0466966_0889819 3300044684 Bacteria 537
759 Ga0466961_0070712 3300044693 Bacteria 2215
760 Ga0466964_0153667 3300044706 Bacteria 1069
761 Ga0453684_0055495 3300044712 Bacteria 5150
762 Ga0466968_0082961 3300044735 Unclassified 1411
763 Ga0466970_0000532 3300044765 Bacteria 18635
764 Ga0466970_0174417 3300044765 Bacteria 1192
765 Ga0466970_0258952 3300044765 Bacteria 976
766 Ga0466957_0000466 3300044842 Bacteria 20090
767 Ga0466957_0004991 3300044842 Bacteria 7424
768 Ga0466960_0166591 3300044901 Bacteria 1187
769 Ga0466959_0000168 3300045049 Bacteria 43448
770 Ga0466959_0005279 3300045049 Bacteria 8826
771 Ga0451576_0391922 3300045051 Unclassified 1456
772 Ga0495629_0076785 3300046459 Bacteria 2332
773 Ga0495638_0063666 3300046460 Bacteria 2273
774 Ga0495638_0175877 3300046460 Bacteria 1225
775 Ga0495638_0240024 3300046460 Bacteria 1004
776 Ga0495638_0290966 3300046460 Bacteria 884
777 Ga0495651_0591747 3300046462 Bacteria 701
778 Ga0495580_0359711 3300046472 Unclassified 985
779 Ga0495606_0025229 3300046507 Bacteria 4262
780 Ga0495630_0265099 3300046517 Bacteria 1312
781 Ga0495630_0358162 3300046517 Unclassified 1117
782 Ga0495632_0514253 3300046519 Bacteria 515
783 Ga0495643_0198624 3300046522 Bacteria 964
784 Ga0495648_0002037 3300046524 Bacteria 19167
785 Ga0495586_0115541 3300046535 Bacteria 1496
786 Ga0495645_0328102 3300046543 Unclassified 992
787 Ga0495633_0147540 3300046558 Bacteria 1087
788 Ga0495668_0000154 3300046616 Bacteria 104449
789 Ga0495668_0000677 3300046616 Bacteria 41080
790 Ga0495668_0015303 3300046616 Bacteria 4484
791 Ga0495611_0000332 3300046648 Bacteria 30928
792 Ga0495611_0078841 3300046648 Bacteria 1512
793 Ga0495625_0052916 3300046660 Unclassified 2906
794 Ga0495647_0025952 3300046681 Bacteria 2144
795 Ga0495658_0187101 3300046683 Bacteria 1286
796 Ga0495649_0353854 3300046694 Bacteria 742
797 Ga0495600_0711016 3300046809 Bacteria 604
798 Ga0495604_0957620 3300047317 Bacteria 532
799 Ga0495674_0057744 3300047319 Unclassified 3396
800 Ga0495672_0018373 3300047320 Bacteria 4645
801 Ga0495672_0059736 3300047320 Bacteria 2205
802 Ga0495672_0320735 3300047320 Bacteria 728
803 Ga0495680_0172064 3300047322 Unclassified 1568
804 Ga0495687_000158 3300047443 Bacteria 103129
805 Ga0495686_0000039 3300047472 Bacteria 304821
806 Ga0496107_0767771 3300048910 Unclassified 707
807 Ga0496109_0059916 3300048912 Bacteria 3478
808 Ga0496110_0451990 3300048913 Bacteria 1171
809 Ga0501290_001874 3300049513 Bacteria 2782
810 Ga0501296_047512 3300049519 Unclassified 621
811 Ga0501297_001523 3300049520 Bacteria 2144
812 Ga0501298_000658 3300049521 Bacteria 4774
813 Ga0501303_016736 3300049526 Bacteria 745
814 Ga0501031_0622664 3300049568 Bacteria 694
815 Ga0501032_0023384 3300049569 Bacteria 4271
816 Ga0501032_0238516 3300049569 Bacteria 1182
817 Ga0501032_0257147 3300049569 Bacteria 1133
818 Ga0501033_0059991 3300049570 Bacteria 2808
819 Ga0501033_0213880 3300049570 Bacteria 1374
820 Ga0501033_0388736 3300049570 Bacteria 974
821 Ga0501033_0459996 3300049570 Bacteria 883
822 Ga0501033_0705414 3300049570 Bacteria 686
823 Ga0501034_0000017 3300049571 Bacteria 285938
824 Ga0501034_0028132 3300049571 Bacteria 5718
825 Ga0501034_0132885 3300049571 Bacteria 2471
826 Ga0501034_0196888 3300049571 Bacteria 1974
827 Ga0501034_0313961 3300049571 Bacteria 1501
828 Ga0501034_0797795 3300049571 Bacteria 837
829 Ga0501036_0065446 3300049572 Bacteria 3077
830 Ga0501036_0440885 3300049572 Bacteria 1085
831 Ga0501037_0014175 3300049573 Bacteria 5869
832 Ga0501037_0242565 3300049573 Bacteria 1263
833 Ga0501038_0129016 3300049574 Bacteria 2078
834 Ga0501038_0320067 3300049574 Bacteria 1214
835 Ga0501039_0119485 3300049575 Bacteria 2065
836 Ga0501039_0222623 3300049575 Bacteria 1483
837 Ga0501043_0046149 3300049579 Bacteria 3426
838 Ga0501043_0055913 3300049579 Bacteria 3100
839 Ga0501043_0099720 3300049579 Bacteria 2283
840 Ga0501046_0038760 3300049580 Bacteria 3822
841 Ga0501046_0274617 3300049580 Bacteria 1236
842 Ga0501046_0863469 3300049580 Bacteria 632
843 Ga0501047_0030221 3300049581 Bacteria 5224
844 Ga0501047_0033592 3300049581 Bacteria 4951
845 Ga0501047_0058284 3300049581 Bacteria 3731
846 Ga0501047_0080375 3300049581 Bacteria 3133
847 Ga0501047_0219648 3300049581 Bacteria 1757
848 Ga0501047_0459782 3300049581 Bacteria 1102
849 Ga0501068_0296085 3300049584 Bacteria 1035
850 Ga0501069_0008721 3300049585 Bacteria 5340
851 Ga0501070_0015045 3300049586 Bacteria 6511
852 Ga0501070_0190520 3300049586 Bacteria 1686
853 Ga0501070_0282817 3300049586 Bacteria 1353
854 Ga0501071_0334070 3300049587 Bacteria 1152
855 Ga0501073_0057263 3300049589 Bacteria 2725
856 Ga0501074_0082207 3300049590 Bacteria 2310
857 Ga0501198_000777 3300049649 Bacteria 3979
858 Ga0501198_001784 3300049649 Bacteria 2841
859 Ga0501201_013587 3300049651 Bacteria 818
860 Ga0501202_001001 3300049652 Bacteria 4371
861 Ga0501202_006139 3300049652 Bacteria 2144
862 Ga0501202_029099 3300049652 Bacteria 1144
863 Ga0501202_030359 3300049652 Bacteria 1124
864 Ga0501202_072408 3300049652 Bacteria 797
865 Ga0501206_006929 3300049653 Bacteria 1479
866 Ga0501207_009759 3300049654 Bacteria 1406
867 Ga0501209_208440 3300049656 Bacteria 603
868 Ga0501216_016161 3300049660 Bacteria 1264
869 Ga0501217_001447 3300049661 Bacteria 4450
870 Ga0501217_030240 3300049661 Bacteria 1328
871 Ga0501217_080562 3300049661 Bacteria 900
872 Ga0501222_001059 3300049662 Bacteria 3892
873 Ga0501222_013996 3300049662 Bacteria 1057
874 Ga0501223_001511 3300049663 Bacteria 5368
875 Ga0501223_003075 3300049663 Bacteria 3645
876 Ga0501223_013336 3300049663 Bacteria 1638
877 Ga0501223_140393 3300049663 Bacteria 520
878 Ga0501228_017431 3300049666 Bacteria 784
879 Ga0501233_002077 3300049668 Bacteria 3493
880 Ga0501233_068635 3300049668 Unclassified 894
881 Ga0501235_001131 3300049669 Bacteria 5594
882 Ga0501235_043301 3300049669 Unclassified 1033
883 Ga0501235_071188 3300049669 Unclassified 823
884 Ga0501236_094090 3300049670 Unclassified 579
885 Ga0501238_045298 3300049671 Unclassified 653
886 Ga0501240_001076 3300049673 Bacteria 2539
887 Ga0501240_001307 3300049673 Bacteria 2389
888 Ga0501242_000055 3300049674 Bacteria 7020
889 Ga0501242_012656 3300049674 Bacteria 1029
890 Ga0501243_000076 3300049675 Bacteria 9930
891 Ga0501251_003567 3300049681 Unclassified 1563
892 Ga0501252_008652 3300049682 Bacteria 1173
893 Ga0501253_005555 3300049683 Bacteria 1661
894 Ga0501253_041367 3300049683 Unclassified 930
895 Ga0501253_112155 3300049683 Bacteria 651
896 Ga0501256_027286 3300049685 Unclassified 628
897 Ga0501257_003176 3300049686 Bacteria 3503
898 Ga0501257_050221 3300049686 Bacteria 1039
899 Ga0501257_057675 3300049686 Bacteria 977
900 Ga0501259_000372 3300049688 Bacteria 7050
901 Ga0501261_000749 3300049690 Bacteria 4039
902 Ga0501219_000125 3300049703 Bacteria 13450
903 Ga0501221_000930 3300049704 Bacteria 4798
904 Ga0501221_012115 3300049704 Bacteria 1564
905 Ga0501225_0002496 3300049705 Bacteria 5692
906 Ga0501225_0008265 3300049705 Bacteria 2993
907 Ga0501225_0021845 3300049705 Bacteria 1766
908 Ga0501234_001139 3300049707 Bacteria 4200
909 Ga0501234_004250 3300049707 Bacteria 2247
910 Ga0501245_002798 3300049708 Bacteria 2344
911 Ga0501245_055874 3300049708 Unclassified 710
912 Ga0501079_0161539 3300049741 Bacteria 1747
913 Ga0501080_0137358 3300049742 Bacteria 2261
914 Ga0501083_0710872 3300049744 Bacteria 653
915 Ga0501241_076992 3300049758 Bacteria 689
916 Ga0501263_002383 3300049760 Bacteria 1908
917 Ga0501264_035675 3300049761 Bacteria 591
918 Ga0501268_003833 3300049765 Bacteria 2084
919 Ga0501268_024368 3300049765 Bacteria 1057
920 Ga0501268_035098 3300049765 Bacteria 924
921 Ga0501273_002795 3300049770 Bacteria 1805
922 Ga0501280_013972 3300049776 Bacteria 1139
923 Ga0501283_001578 3300049779 Bacteria 2959
924 Ga0501035_0059951 3300049822 Bacteria 3389
925 Ga0501035_0134106 3300049822 Bacteria 2157
926 Ga0501035_0425957 3300049822 Bacteria 1101
927 Ga0501035_0855139 3300049822 Bacteria 723
928 Ga0501044_0019152 3300049823 Bacteria 7327
929 Ga0501044_0103134 3300049823 Bacteria 2867
930 Ga0501044_0155291 3300049823 Bacteria 2268
931 Ga0501044_0467521 3300049823 Bacteria 1166
932 Ga0501044_1008850 3300049823 Unclassified 704
933 Ga0501212_001332 3300049851 Bacteria 2763
934 Ga0501284_00045 3300050005 Bacteria 48266
935 nmdc:mga0k408_117051_c1 3300050493 Bacteria 1577
936 nmdc:mga0k408_165544_c1 3300050493 Bacteria 1317
937 nmdc:mga0k408_28006_c1 3300050493 Bacteria 3202
938 nmdc:mga0k408_43685_c1 3300050493 Bacteria 2583
939 nmdc:mga0k408_680723_c1 3300050493 Bacteria 603
940 nmdc:mga07m45_66317_c1 3300050496 Bacteria 2050
941 nmdc:mga05p37_8699_c1 3300050507 Bacteria 11994
942 nmdc:mga08y16_195457_c1 3300050511 Bacteria 2097
943 Ga0495619_0292841 3300053085 Unclassified 1128
944 Ga0500578_0001189 3300053086 Bacteria 27522
945 Ga0500578_0100816 3300053086 Bacteria 1827
946 Ga0500578_0301507 3300053086 Bacteria 950
947 Ga0500644_0028545 3300053088 Bacteria 1746
948 Ga0500646_0025903 3300053090 Bacteria 1587
949 Ga0500583_0000018 3300053092 Bacteria 138148
950 Ga0500583_0000832 3300053092 Bacteria 8881
951 Ga0500583_0100582 3300053092 Bacteria 1416
952 Ga0500651_0302033 3300053093 Bacteria 918
953 Ga0500650_0282150 3300053098 Bacteria 738
954 Ga0500556_0015828 3300053104 Unclassified 2335
955 Ga0500556_0276711 3300053104 Bacteria 658
956 Ga0500642_0001731 3300053130 Bacteria 6295
957 Ga0500642_0006130 3300053130 Bacteria 3936
958 Ga0500642_0203315 3300053130 Bacteria 921
959 Ga0500652_002787 3300053131 Bacteria 5278
960 Ga0500655_028713 3300053133 Bacteria 1066
961 Ga0500573_0268649 3300053140 Bacteria 869
962 Ga0500585_232892 3300053144 Bacteria 595
963 Ga0500588_0051786 3300053146 Bacteria 1283
964 Ga0500588_0099851 3300053146 Bacteria 999
965 Ga0500589_001565 3300053147 Bacteria 6952
966 Ga0500604_0002215 3300053151 Bacteria 5334
967 Ga0500616_0000717 3300053153 Bacteria 38423
968 Ga0500622_0000923 3300053156 Bacteria 24952
969 Ga0500622_0138997 3300053156 Bacteria 1160
970 Ga0500639_058587 3300053163 Bacteria 1990
971 Ga0500636_0212292 3300053177 Bacteria 1015
972 Ga0500636_0218806 3300053177 Bacteria 994
973 Ga0500637_0050147 3300053178 Bacteria 2377
974 Ga0500637_0136328 3300053178 Bacteria 1422
975 Ga0500611_000907 3300053727 Bacteria 3099
976 Ga0501082_0127383 3300060353 Bacteria 2208
977 Ga0466962_0011225 3300061719 Bacteria 4314
978 Ga0466962_0120109 3300061719 Bacteria 1268
979 Ga0466962_0175920 3300061719 Bacteria 1043
980 Ga0466962_0239857 3300061719 Bacteria 890
981 2819588819 2818991444 Bacteria 6968812
982 8003156241 8003151029 Bacteria 8187759
983 Ga0068857_100959104
984 JGI24735J21928_10019377
985 JGI25154J39366_1000022
986 JGI25154J39366_1011189
987 JGI25157J39369_1006168
988 JGI25164J39214_1002738
989 JGI25165J46597_1000420
990 JGI25153J46596_10001856
991 rootH1_10022033
992 rootH2_10004606
993 rootH2_10121353
994 rootL2_10058208
995 rootL2_10233169
996 rootH1_10009287
997 rootH1_10016880
998 rootH1_10043452
999 rootH1_10255498
1000 JGI25160J50197_1032470
1001 Ga0058862_12364578
1002 Ga0065165_1037858
1003 Ga0065714_10072714
1004 Ga0065714_10113882
1005 Ga0065714_10195570
1006 Ga0065712_10021823
1007 Ga0065712_10086969
1008 Ga0070658_10013959
1009 Ga0070658_10033505
1010 Ga0070658_10092240
1011 Ga0070658_10208454
1012 Ga0070658_10284307
1013 Ga0070676_10000376
1014 Ga0070676_10001044
1015 Ga0070676_10323634
1016 Ga0070683_100007784
1017 Ga0070683_100152116
1018 Ga0070670_100097287
1019 Ga0070670_100375913
1020 Ga0070670_100608849
1021 Ga0070677_10029340
1022 Ga0068869_100077215
1023 Ga0070666_10000201
1024 Ga0070680_100001133
1025 Ga0070680_100017878
1026 Ga0070680_100087905
1027 Ga0070680_100099554
1028 Ga0070680_100111009
1029 Ga0070680_100700175
1030 Ga0070682_100000060
1031 Ga0068868_100046531
1032 Ga0068868_100057225
1033 Ga0068868_100150522
1034 Ga0068868_101024500
1035 Ga0070660_100015165
1036 Ga0070660_100020897
1037 Ga0070660_100042666
1038 Ga0070660_100103452
1039 Ga0070660_100476623
1040 Ga0070660_100542241
1041 Ga0070660_100619685
1042 Ga0070691_10113522
1043 Ga0070691_10129750
1044 Ga0070661_100233976
1045 Ga0070692_10452620
1046 Ga0070668_100000036
1047 Ga0070668_100802596
1048 Ga0070669_100149713
1049 Ga0070675_100011239
1050 Ga0070675_100027386
1051 Ga0070675_100095942
1052 Ga0070675_100159036
1053 Ga0070671_100208926
1054 Ga0070671_100673987
1055 Ga0070673_100002827
1056 Ga0070673_100500932
1057 Ga0070673_100630236
1058 Ga0070673_101309552
1059 Ga0070688_100204213
1060 Ga0070659_100001238
1061 Ga0070659_100001469
1062 Ga0070659_100013081
1063 Ga0070659_100013744
1064 Ga0070659_100167342
1065 Ga0070659_100240531
1066 Ga0070659_101181305
1067 Ga0070667_100000393
1068 Ga0070714_100933655
1069 Ga0070663_100046954
1070 Ga0070663_100616104
1071 Ga0070663_100808401
1072 Ga0070678_100295746
1073 Ga0070678_100811288
1074 Ga0070662_100000252
1075 Ga0070662_100008429
1076 Ga0070681_10003852
1077 Ga0070681_10006225
1078 Ga0070681_10068869
1079 Ga0070681_10082536
1080 Ga0070681_10167900
1081 Ga0070681_10314298
1082 Ga0070681_11518098
1083 Ga0068867_100001529
1084 Ga0068867_100033952
1085 Ga0068867_100052975
1086 Ga0068867_100174850
1087 Ga0068867_100616433
1088 Ga0070685_10293963
1089 Ga0070698_100051445
1090 Ga0070679_100003662
1091 Ga0070679_100014889
1092 Ga0070679_100042397
1093 Ga0070679_100154129
1094 Ga0070679_100174164
1095 Ga0070679_100215129
1096 Ga0070679_101572314
1097 Ga0070684_100001099
1098 Ga0070684_100022372
1099 Ga0070684_100037425
1100 Ga0068853_100001289
1101 Ga0068853_100005465
1102 Ga0068853_100007662
1103 Ga0068853_100022704
1104 Ga0068853_100059247
1105 Ga0068853_100158618
1106 Ga0068853_100227885
1107 Ga0068853_100235766
1108 Ga0068853_100381642
1109 Ga0068853_100693429
1110 Ga0068853_100962417
1111 Ga0070672_100002608
1112 Ga0070672_100082453
1113 Ga0070672_100084486
1114 Ga0070672_100106719
1115 Ga0070665_100000016
1116 Ga0070665_100001215
1117 Ga0068855_100000257
1118 Ga0068855_100003500
1119 Ga0068855_100007377
1120 Ga0068855_100015438
1121 Ga0068855_100082914
1122 Ga0068855_100084714
1123 Ga0068855_100090726
1124 Ga0068855_100117097
1125 Ga0068855_100141627
1126 Ga0068855_100146424
1127 Ga0068855_100270090
1128 Ga0068855_100354148
1129 Ga0068855_100356856
1130 Ga0068855_100444602
1131 Ga0070664_100081393
1132 Ga0070664_100124777
1133 Ga0070664_100439773
1134 Ga0068857_100002912
1135 Ga0068857_100061221
1136 Ga0068857_100074620
1137 Ga0068857_100290365
1138 Ga0068857_100684854
1139 Ga0068857_100816751
1140 Ga0068857_100873807
1141 Ga0068857_100936105
1142 Ga0068854_100044550
1143 Ga0068854_100120083
1144 Ga0068854_100200890
1145 Ga0068854_100323576
1146 Ga0068854_100872656
1147 Ga0068854_101944093
1148 Ga0068856_100005494
1149 Ga0068856_100013252
1150 Ga0068856_100023691
1151 Ga0068856_100138407
1152 Ga0068856_100200312
1153 Ga0068856_100513826
1154 Ga0068856_100571094
1155 Ga0068856_101012269
1156 Ga0068852_100003516
1157 Ga0068852_100004973
1158 Ga0068852_100013746
1159 Ga0068852_100034480
1160 Ga0068852_100053055
1161 Ga0068852_100156452
1162 Ga0068852_100215352
1163 Ga0068852_100250648
1164 Ga0068852_100582062
1165 Ga0068852_100594601
1166 Ga0068852_100618926
1167 Ga0068859_100067888
1168 Ga0068859_100100796
1169 Ga0068859_100735310
1170 Ga0068864_100002025
1171 Ga0068866_10064985
1172 Ga0068861_100022287
1173 Ga0068861_100147416
1174 Ga0068851_10001779
1175 Ga0068851_10282455
1176 Ga0068851_10496774
1177 Ga0068851_10760419
1178 Ga0068863_100007773
1179 Ga0068863_100284740
1180 Ga0068863_100634073
1181 Ga0068863_102027272
1182 Ga0068858_100001071
1183 Ga0068858_100197393
1184 Ga0068858_100492381
1185 Ga0068860_100000006
1186 Ga0068860_100010347
1187 Ga0068860_100018512
1188 Ga0068860_100020538
1189 Ga0068860_100025063
1190 Ga0068860_100707528
1191 Ga0070716_100646257
1192 Ga0075366_10005129
1193 Ga0075366_10030731
1194 Ga0075366_10038226
1195 Ga0075366_10048318
1196 Ga0075366_10149478
1197 Ga0075366_10292118
1198 Ga0097621_100000212
1199 Ga0097621_100001189
1200 Ga0097621_100006360
1201 Ga0097621_100143411
1202 Ga0097621_100833739
1203 Ga0075370_10493931
1204 Ga0068871_100000720
1205 Ga0068871_100002202
1206 Ga0068871_100004872
1207 Ga0068871_100014855
1208 Ga0068871_100254546
1209 Ga0068871_101276026
1210 Ga0068865_100000112
1211 Ga0068865_100034450
1212 Ga0068865_100869884
1213 Ga0097620_100009589
1214 Ga0097620_100067889
1215 Ga0097620_100100795
1216 Ga0097620_100735476
1217 Ga0105251_10164099
1218 Ga0105240_10000155
1219 Ga0105240_10001144
1220 Ga0105240_10002687
1221 Ga0105240_10005022
1222 Ga0105240_10014688
1223 Ga0105240_10029329
1224 Ga0105240_10034681
1225 Ga0105240_10036495
1226 Ga0105240_10043386
1227 Ga0105240_10082059
1228 Ga0105240_10082254
1229 Ga0105240_10104381
1230 Ga0105240_10282755
1231 Ga0105240_10315411
1232 Ga0105240_10406339
1233 Ga0105240_10502764
1234 Ga0105240_10529364
1235 Ga0105240_10549317
1236 Ga0105240_10664159
1237 Ga0105240_10747832
1238 Ga0111539_10150124
1239 Ga0105245_10403857
1240 Ga0105247_10499798
1241 Ga0114129_10002084
1242 Ga0105241_10000113
1243 Ga0105241_10000898
1244 Ga0105241_10005212
1245 Ga0105241_10011777
1246 Ga0105241_10055333
1247 Ga0105241_10097786
1248 Ga0105241_10098405
1249 Ga0105241_10201956
1250 Ga0105241_10475108
1251 Ga0105241_11461584
1252 Ga0105242_10070451
1253 Ga0105242_10213586
1254 Ga0105242_10967642
1255 Ga0105248_10047599
1256 Ga0105248_10053635
1257 Ga0105248_10515153
1258 Ga0105237_10000061
1259 Ga0105237_10000417
1260 Ga0105237_10008194
1261 Ga0105237_10019539
1262 Ga0105237_10022631
1263 Ga0105237_10023025
1264 Ga0105237_10034436
1265 Ga0105237_10059196
1266 Ga0105237_10059700
1267 Ga0105237_10086203
1268 Ga0105237_10103854
1269 Ga0105237_10110815
1270 Ga0105237_10164797
1271 Ga0105237_10215180
1272 Ga0105237_10264828
1273 Ga0105237_10510398
1274 Ga0105237_10584713
1275 Ga0105237_10634795
1276 Ga0105237_10935885
1277 Ga0105237_11085971
1278 Ga0105237_11240726
1279 Ga0105238_10010861
1280 Ga0105238_10035276
1281 Ga0105238_10036611
1282 Ga0105238_10102453
1283 Ga0105238_10187538
1284 Ga0105238_10829446
1285 Ga0105238_10931642
1286 Ga0105238_11043513
1287 Ga0105238_11323562
1288 Ga0105249_10003698
1289 Ga0105249_10011368
1290 Ga0105249_10239036
1291 Ga0105249_10286645
1292 Ga0105239_10000010
1293 Ga0105239_10000415
1294 Ga0105239_10000482
1295 Ga0105239_10005902
1296 Ga0105239_10006393
1297 Ga0105239_10006733
1298 Ga0105239_10029427
1299 Ga0105239_10030646
1300 Ga0105239_10041699
1301 Ga0105239_10131094
1302 Ga0105239_10290659
1303 Ga0105239_10355436
1304 Ga0105239_10398910
1305 Ga0105239_10438445
1306 Ga0105239_11389818
1307 Ga0105246_10033878
1308 Ga0105246_10062211
1309 Ga0105246_10698507
1310 Ga0105246_10931799
1311 Ga0105246_11962903
1312 Ga0157373_10001922
1313 Ga0157373_10006674
1314 Ga0157373_10122746
1315 Ga0157373_10152466
1316 Ga0157373_10162996
1317 Ga0157373_10243602
1318 Ga0157373_10500493
1319 Ga0157371_10001534
1320 Ga0157371_10002382
1321 Ga0157371_10002977
1322 Ga0157371_10003511
1323 Ga0157371_10003728
1324 Ga0157371_10019675
1325 Ga0157371_10021366
1326 Ga0157371_10022801
1327 Ga0157371_10023229
1328 Ga0157371_10034836
1329 Ga0157371_10048660
1330 Ga0157371_10048801
1331 Ga0157371_10072843
1332 Ga0157371_10082546
1333 Ga0157371_10175078
1334 Ga0157371_10214733
1335 Ga0157371_10232895
1336 Ga0157371_10237493
1337 Ga0157370_10001056
1338 Ga0157370_10003729
1339 Ga0157370_10008499
1340 Ga0157370_10062863
1341 Ga0157370_10081716
1342 Ga0157370_10086945
1343 Ga0157370_10094169
1344 Ga0157370_10105509
1345 Ga0157370_10121749
1346 Ga0157370_10186900
1347 Ga0157370_10218843
1348 Ga0157370_10229378
1349 Ga0157370_10268545
1350 Ga0157370_10336255
1351 Ga0157370_10363049
1352 Ga0157370_10422889
1353 Ga0157370_10501567
1354 Ga0157369_10000853
1355 Ga0157369_10011149
1356 Ga0157369_10016348
1357 Ga0157369_10080482
1358 Ga0157369_10120997
1359 Ga0157369_10210665
1360 Ga0157369_10265309
1361 Ga0157369_10369743
1362 Ga0157369_11811351
1363 Ga0157369_12021259
1364 Ga0157374_10000408
1365 Ga0157374_10000618
1366 Ga0157374_10009788
1367 Ga0157374_10041703
1368 Ga0157374_10059021
1369 Ga0157374_10164510
1370 Ga0157374_10477610
1371 Ga0157374_10585923
1372 Ga0157374_10588861
1373 Ga0157374_11219675
1374 Ga0157374_12242791
1375 Ga0157378_10072207
1376 Ga0157378_10077124
1377 Ga0157378_10120809
1378 Ga0157378_10147983
1379 Ga0157378_10317568
1380 Ga0157378_10580165
1381 Ga0157378_11453243
1382 Ga0163162_10000040
1383 Ga0163162_10001209
1384 Ga0163162_10001777
1385 Ga0163162_10002037
1386 Ga0163162_10002657
1387 Ga0163162_10054155
1388 Ga0163162_10093304
1389 Ga0163162_10250454
1390 Ga0163162_10503489
1391 Ga0163162_10650697
1392 Ga0163162_12323449
1393 Ga0157372_10000011
1394 Ga0157372_10000491
1395 Ga0157372_10000743
1396 Ga0157372_10013303
1397 Ga0157372_10022186
1398 Ga0157372_10022799
1399 Ga0157372_10023113
1400 Ga0157372_10026508
1401 Ga0157372_10027365
1402 Ga0157372_10028841
1403 Ga0157372_10068044
1404 Ga0157372_10096034
1405 Ga0157372_10126998
1406 Ga0157372_10155883
1407 Ga0157372_10158258
1408 Ga0157372_10163110
1409 Ga0157372_10194104
1410 Ga0157372_10247929
1411 Ga0157372_10273431
1412 Ga0157372_10379938
1413 Ga0157372_10383313
1414 Ga0157372_10411411
1415 Ga0157372_10470354
1416 Ga0157372_10488169
1417 Ga0157372_10504147
1418 Ga0157372_10639285
1419 Ga0157372_10642061
1420 Ga0157372_10756841
1421 Ga0157372_11056316
1422 Ga0157372_11194029
1423 Ga0157372_11746619
1424 Ga0157372_12277419
1425 Ga0157375_10005786
1426 Ga0157375_10358647
1427 Ga0157375_10680630
1428 Ga0157375_11605296
1429 Ga0163163_10000110
1430 Ga0163163_10000141
1431 Ga0163163_10624401
1432 Ga0157380_10017302
1433 Ga0157380_10027950
1434 Ga0157377_10859473
1435 Ga0157379_10000173
1436 Ga0157379_10111532
1437 Ga0157379_10128901
1438 Ga0157379_11149748
1439 Ga0157376_10000161
1440 Ga0157376_10038978
1441 Ga0157376_10071207
1442 Ga0157376_10112971
1443 Ga0157376_10128605
1444 Ga0157376_10130015
1445 Ga0157376_10215878
1446 Ga0182007_10061606
1447 Ga0163161_10025549
1448 Ga0163161_10055069
1449 Ga0163161_10417795
1450 Ga0209258_118393
1451 Ga0209646_1000003
1452 Ga0209646_1004846
1453 Ga0209026_1000354
1454 Ga0209758_1010470
1455 Ga0207426_1000187
1456 Ga0207656_10000689
1457 Ga0207656_10325344
1458 Ga0207656_10372948
1459 Ga0207642_10875472
1460 Ga0207680_10025199
1461 Ga0207680_10026610
1462 Ga0207647_10027144
1463 Ga0207647_10152937
1464 Ga0207645_10002633
1465 Ga0207705_10038378
1466 Ga0207705_10045442
1467 Ga0207705_10085977
1468 Ga0207705_10138589
1469 Ga0207705_10141615
1470 Ga0207705_10458448
1471 Ga0207654_10000461
1472 Ga0207654_10075484
1473 Ga0207654_10327240
1474 Ga0207707_10000189
1475 Ga0207707_10019690
1476 Ga0207707_10454074
1477 Ga0207707_10684626
1478 Ga0207707_10878749
1479 Ga0207707_11038884
1480 Ga0207695_10000043
1481 Ga0207695_10000165
1482 Ga0207695_10000245
1483 Ga0207695_10018911
1484 Ga0207695_10022033
1485 Ga0207695_10045636
1486 Ga0207695_10132246
1487 Ga0207695_10343294
1488 Ga0207695_10471786
1489 Ga0207695_10514895
1490 Ga0207695_10917415
1491 Ga0207671_10001487
1492 Ga0207671_10003937
1493 Ga0207671_10021318
1494 Ga0207671_10054170
1495 Ga0207671_10157562
1496 Ga0207671_10880713
1497 Ga0207671_10894361
1498 Ga0207671_11059949
1499 Ga0207660_10008768
1500 Ga0207660_10089470
1501 Ga0207657_10030828
1502 Ga0207657_10117679
1503 Ga0207649_10147263
1504 Ga0207649_11470301
1505 Ga0207652_10000108
1506 Ga0207652_10000488
1507 Ga0207652_10000541
1508 Ga0207652_10006784
1509 Ga0207652_10302214
1510 Ga0207652_10580575
1511 Ga0207652_11022573
1512 Ga0207681_10333896
1513 Ga0207694_10071132
1514 Ga0207694_10361507
1515 Ga0207650_10079343
1516 Ga0207650_10124027
1517 Ga0207650_10349277
1518 Ga0207650_10409968
1519 Ga0207650_10655848
1520 Ga0207659_10045959
1521 Ga0207659_10279631
1522 Ga0207659_10411885
1523 Ga0207659_10761216
1524 Ga0207687_10277810
1525 Ga0207664_10790997
1526 Ga0207644_10361149
1527 Ga0207690_10052425
1528 Ga0207690_10119304
1529 Ga0207690_11118076
1530 Ga0207690_11407193
1531 Ga0207706_10011353
1532 Ga0207686_10302721
1533 Ga0207704_10011472
1534 Ga0207704_10329890
1535 Ga0207691_10000504
1536 Ga0207691_10088931
1537 Ga0207691_11166351
1538 Ga0207711_10088422
1539 Ga0207689_11126832
1540 Ga0207661_10005276
1541 Ga0207661_10120463
1542 Ga0207661_10172657
1543 Ga0207661_10302191
1544 Ga0207679_10023361
1545 Ga0207679_10042309
1546 Ga0207667_10000440
1547 Ga0207667_10000913
1548 Ga0207667_10005535
1549 Ga0207667_10026291
1550 Ga0207667_10029218
1551 Ga0207667_10076678
1552 Ga0207667_10118271
1553 Ga0207667_10208352
1554 Ga0207667_10306641
1555 Ga0207667_10635462
1556 Ga0207651_10006216
1557 Ga0207712_10185645
1558 Ga0207712_10224263
1559 Ga0207712_10398572
1560 Ga0207668_10002658
1561 Ga0207668_10968648
1562 Ga0207640_10011035
1563 Ga0207640_10056140
1564 Ga0207640_10056558
1565 Ga0207640_10376113
1566 Ga0207640_10574856
1567 Ga0207640_10577986
1568 Ga0207640_11103547
1569 Ga0207658_10005579
1570 Ga0207658_11639447
1571 Ga0207677_10005078
1572 Ga0207677_10068348
1573 Ga0207677_10748268
1574 Ga0207677_10770476
1575 Ga0207703_11514825
1576 Ga0207639_10002969
1577 Ga0207639_10024472
1578 Ga0207639_10027754
1579 Ga0207639_10057585
1580 Ga0207639_10059783
1581 Ga0207639_10066611
1582 Ga0207639_10135570
1583 Ga0207639_10287741
1584 Ga0207639_10314621
1585 Ga0207639_10431171
1586 Ga0207639_10888374
1587 Ga0207639_10998902
1588 Ga0207639_11121637
1589 Ga0207639_11142419
1590 Ga0207678_10051627
1591 Ga0207678_10230755
1592 Ga0207702_10000196
1593 Ga0207702_10310831
1594 Ga0207702_10348991
1595 Ga0207702_10454063
1596 Ga0207702_10511677
1597 Ga0207702_10530628
1598 Ga0207702_10704480
1599 Ga0207641_10009580
1600 Ga0207641_10233320
1601 Ga0207641_10767029
1602 Ga0207641_11010939
1603 Ga0207648_10016152
1604 Ga0207648_10146611
1605 Ga0207648_11108245
1606 Ga0207648_11475912
1607 Ga0207676_10003314
1608 Ga0207676_10527722
1609 Ga0207674_10004216
1610 Ga0207674_10064985
1611 Ga0207674_10075665
1612 Ga0207674_10166256
1613 Ga0207674_10571067
1614 Ga0207674_10885068
1615 Ga0207674_11598521
1616 Ga0207675_100314802
1617 Ga0207683_10821794
1618 Ga0207698_10006493
1619 Ga0207698_10013137
1620 Ga0207698_10015088
1621 Ga0207698_10039245
1622 Ga0207698_10125756
1623 Ga0207698_10166241
1624 Ga0207698_10258120
1625 Ga0207698_10459509
1626 Ga0207698_10543750
1627 Ga0207698_10717569
1628 Ga0207698_10819015
1629 Ga0209974_10218506
1630 Ga0268266_10000149
1631 Ga0268266_10001023
1632 Ga0268265_11818903
1633 Ga0268264_10000064
1634 Ga0268264_10003688
1635 Ga0268264_10006580
1636 Ga0268264_10007122
1637 Ga0268264_10010089
1638 Ga0268264_10949680
1639 Ga0268264_11061143
1640 Ga0307517_10005503
1641 Ga0307517_10152802
1642 Ga0307517_10159858
1643 Ga0307515_10000001
1644 Ga0307511_10000138
1645 Ga0307512_10133321
1646 Ga0265328_10000178
1647 Ga0265331_10192826
1648 Ga0265327_10006475
1649 Ga0265327_10117858
1650 Ga0307513_10191568
1651 Ga0307513_10353112
1652 Ga0307513_10475104
1653 Ga0307509_10069660
1654 Ga0307509_10097887
1655 Ga0307408_100459300
1656 Ga0307516_10001145
1657 Ga0307516_10359410
1658 Ga0307405_10378338
1659 Ga0307405_10466476
1660 Ga0307413_10017191
1661 Ga0307410_10107562
1662 Ga0307410_10749031
1663 Ga0307406_10059138
1664 Ga0307407_10133542
1665 Ga0307412_10360837
1666 Ga0307412_10518966
1667 Ga0307409_100187413
1668 Ga0307416_100220455
1669 Ga0307411_10576888
1670 Ga0307411_10684159
1671 Ga0307415_100080628
1672 Ga0307510_10000079
1673 Ga0373945_0145253
1674 Ga0373953_0281453
1675 Ga0373935_0814793
1676 Ga0373927_0066611
1677 Ga0373933_0578245
1678 Ga0373937_0409249
1679 Ga0373937_0932126
1680 Ga0373925_1437866
1681 Ga0395899_0003463
1682 Ga0395899_0009069
1683 Ga0395899_0096340
1684 Ga0395899_0371871
1685 Ga0395899_0726682
1686 Ga0395900_0014175
1687 Ga0395900_0022808
1688 Ga0395900_0071784
1689 Ga0395900_0206909
1690 Ga0395900_0252503
1691 Ga0395900_0524837
1692 Ga0395900_0853988
1693 Ga0395898_0006358
1694 Ga0395898_0051146
1695 Ga0395898_0065837
1696 Ga0395898_0086973
1697 Ga0395898_0839248
1698 Ga0395905_0012427
1699 Ga0395905_0092339
1700 Ga0395905_0098529
1701 Ga0395905_0330809
1702 Ga0395905_1105057
1703 Ga0395901_0005285
1704 Ga0395901_0007090
1705 Ga0395901_0208681
1706 Ga0395901_0228237
1707 Ga0395901_0261342
1708 Ga0395901_0272795
1709 Ga0400489_65840
1710 Ga0439439_0008781
1711 Ga0439439_0098972
1712 Ga0439466_0130768
1713 Ga0439465_0021806
1714 Ga0451791_0054266
1715 Ga0451797_0773780
1716 Ga0451800_0408194
1717 Ga0451804_0480600
1718 Ga0451839_1376007
1719 Ga0451853_1710672
1720 Ga0439433_0045135
1721 Ga0439445_0204515
1722 Ga0439449_0006193
1723 Ga0439449_0023388
1724 Ga0439449_0129548
1725 Ga0439457_002491
1726 Ga0439457_003703
1727 Ga0439457_063908
1728 Ga0439462_0112443
1729 Ga0439434_0069067
1730 Ga0451577_0751752
1731 Ga0466969_0000137
1732 Ga0466972_0000022
1733 Ga0466972_0000092
1734 Ga0466972_0032139
1735 Ga0466972_0316773
1736 Ga0466965_0019968
1737 Ga0466966_0000099
1738 Ga0466966_0770624
1739 Ga0466966_0889819
1740 Ga0466961_0070712
1741 Ga0466964_0153667
1742 Ga0453684_0055495
1743 Ga0466968_0082961
1744 Ga0466970_0000532
1745 Ga0466970_0174417
1746 Ga0466970_0258952
1747 Ga0466957_0000466
1748 Ga0466957_0004991
1749 Ga0466960_0166591
1750 Ga0466959_0000168
1751 Ga0466959_0005279
1752 Ga0451576_0391922
1753 Ga0495629_0076785
1754 Ga0495638_0063666
1755 Ga0495638_0175877
1756 Ga0495638_0240024
1757 Ga0495638_0290966
1758 Ga0495651_0591747
1759 Ga0495580_0359711
1760 Ga0495606_0025229
1761 Ga0495630_0265099
1762 Ga0495630_0358162
1763 Ga0495632_0514253
1764 Ga0495643_0198624
1765 Ga0495648_0002037
1766 Ga0495586_0115541
1767 Ga0495645_0328102
1768 Ga0495633_0147540
1769 Ga0495668_0000154
1770 Ga0495668_0000677
1771 Ga0495668_0015303
1772 Ga0495611_0000332
1773 Ga0495611_0078841
1774 Ga0495625_0052916
1775 Ga0495647_0025952
1776 Ga0495658_0187101
1777 Ga0495649_0353854
1778 Ga0495600_0711016
1779 Ga0495604_0957620
1780 Ga0495674_0057744
1781 Ga0495672_0018373
1782 Ga0495672_0059736
1783 Ga0495672_0320735
1784 Ga0495680_0172064
1785 Ga0495687_000158
1786 Ga0495686_0000039
1787 Ga0496107_0767771
1788 Ga0496109_0059916
1789 Ga0496110_0451990
1790 Ga0501290_001874
1791 Ga0501296_047512
1792 Ga0501297_001523
1793 Ga0501298_000658
1794 Ga0501303_016736
1795 Ga0501031_0622664
1796 Ga0501032_0023384
1797 Ga0501032_0238516
1798 Ga0501032_0257147
1799 Ga0501033_0059991
1800 Ga0501033_0213880
1801 Ga0501033_0388736
1802 Ga0501033_0459996
1803 Ga0501033_0705414
1804 Ga0501034_0000017
1805 Ga0501034_0028132
1806 Ga0501034_0132885
1807 Ga0501034_0196888
1808 Ga0501034_0313961
1809 Ga0501034_0797795
1810 Ga0501036_0065446
1811 Ga0501036_0440885
1812 Ga0501037_0014175
1813 Ga0501037_0242565
1814 Ga0501038_0129016
1815 Ga0501038_0320067
1816 Ga0501039_0119485
1817 Ga0501039_0222623
1818 Ga0501043_0046149
1819 Ga0501043_0055913
1820 Ga0501043_0099720
1821 Ga0501046_0038760
1822 Ga0501046_0274617
1823 Ga0501046_0863469
1824 Ga0501047_0030221
1825 Ga0501047_0033592
1826 Ga0501047_0058284
1827 Ga0501047_0080375
1828 Ga0501047_0219648
1829 Ga0501047_0459782
1830 Ga0501068_0296085
1831 Ga0501069_0008721
1832 Ga0501070_0015045
1833 Ga0501070_0190520
1834 Ga0501070_0282817
1835 Ga0501071_0334070
1836 Ga0501073_0057263
1837 Ga0501074_0082207
1838 Ga0501198_000777
1839 Ga0501198_001784
1840 Ga0501201_013587
1841 Ga0501202_001001
1842 Ga0501202_006139
1843 Ga0501202_029099
1844 Ga0501202_030359
1845 Ga0501202_072408
1846 Ga0501206_006929
1847 Ga0501207_009759
1848 Ga0501209_208440
1849 Ga0501216_016161
1850 Ga0501217_001447
1851 Ga0501217_030240
1852 Ga0501217_080562
1853 Ga0501222_001059
1854 Ga0501222_013996
1855 Ga0501223_001511
1856 Ga0501223_003075
1857 Ga0501223_013336
1858 Ga0501223_140393
1859 Ga0501228_017431
1860 Ga0501233_002077
1861 Ga0501233_068635
1862 Ga0501235_001131
1863 Ga0501235_043301
1864 Ga0501235_071188
1865 Ga0501236_094090
1866 Ga0501238_045298
1867 Ga0501240_001076
1868 Ga0501240_001307
1869 Ga0501242_000055
1870 Ga0501242_012656
1871 Ga0501243_000076
1872 Ga0501251_003567
1873 Ga0501252_008652
1874 Ga0501253_005555
1875 Ga0501253_041367
1876 Ga0501253_112155
1877 Ga0501256_027286
1878 Ga0501257_003176
1879 Ga0501257_050221
1880 Ga0501257_057675
1881 Ga0501259_000372
1882 Ga0501261_000749
1883 Ga0501219_000125
1884 Ga0501221_000930
1885 Ga0501221_012115
1886 Ga0501225_0002496
1887 Ga0501225_0008265
1888 Ga0501225_0021845
1889 Ga0501234_001139
1890 Ga0501234_004250
1891 Ga0501245_002798
1892 Ga0501245_055874
1893 Ga0501079_0161539
1894 Ga0501080_0137358
1895 Ga0501083_0710872
1896 Ga0501241_076992
1897 Ga0501263_002383
1898 Ga0501264_035675
1899 Ga0501268_003833
1900 Ga0501268_024368
1901 Ga0501268_035098
1902 Ga0501273_002795
1903 Ga0501280_013972
1904 Ga0501283_001578
1905 Ga0501035_0059951
1906 Ga0501035_0134106
1907 Ga0501035_0425957
1908 Ga0501035_0855139
1909 Ga0501044_0019152
1910 Ga0501044_0103134
1911 Ga0501044_0155291
1912 Ga0501044_0467521
1913 Ga0501044_1008850
1914 Ga0501212_001332
1915 Ga0501284_00045
1916 nmdc:mga0k408_117051_c1
1917 nmdc:mga0k408_165544_c1
1918 nmdc:mga0k408_28006_c1
1919 nmdc:mga0k408_43685_c1
1920 nmdc:mga0k408_680723_c1
1921 nmdc:mga07m45_66317_c1
1922 nmdc:mga05p37_8699_c1
1923 nmdc:mga08y16_195457_c1
1924 Ga0495619_0292841
1925 Ga0500578_0001189
1926 Ga0500578_0100816
1927 Ga0500578_0301507
1928 Ga0500644_0028545
1929 Ga0500646_0025903
1930 Ga0500583_0000018
1931 Ga0500583_0000832
1932 Ga0500583_0100582
1933 Ga0500651_0302033
1934 Ga0500650_0282150
1935 Ga0500556_0015828
1936 Ga0500556_0276711
1937 Ga0500642_0001731
1938 Ga0500642_0006130
1939 Ga0500642_0203315
1940 Ga0500652_002787
1941 Ga0500655_028713
1942 Ga0500573_0268649
1943 Ga0500585_232892
1944 Ga0500588_0051786
1945 Ga0500588_0099851
1946 Ga0500589_001565
1947 Ga0500604_0002215
1948 Ga0500616_0000717
1949 Ga0500622_0000923
1950 Ga0500622_0138997
1951 Ga0500639_058587
1952 Ga0500636_0212292
1953 Ga0500636_0218806
1954 Ga0500637_0050147
1955 Ga0500637_0136328
1956 Ga0500611_000907
1957 Ga0501082_0127383
1958 Ga0466962_0011225
1959 Ga0466962_0120109
1960 Ga0466962_0175920
1961 Ga0466962_0239857
1962 2819588819
1963 8003156241

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

33

162

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6g6v-assembly1.cif.gz_A phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 4-(2-carboxybenzoyl)-2-nitrobenzoic acid at 1.9a resolution. 0.9632 1 151
6qmi-assembly1.cif.gz_A phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 3-(1h-indol-1-yl)propanoic acid at 1.7a resolution. 0.9624 1 151
3otw-assembly1.cif.gz_F structural and functional studies of helicobacter pylori wild-type and mutated proteins phosphopantetheine adenylyltransferase 0.9548 2 152
5h16-assembly1.cif.gz_D crystal structure of the complex of phosphopantetheine adenylyltransferase from acinetobacter baumannii with citrate at 2.3 a resolution. 0.9547 1 151
6b7b-assembly1.cif.gz_A crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 5-methoxy-2-methyl-1h-indole 0.9546 2 152
ID Description Score Start End Superfamily
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9624 1 151 3.40.50.620
3nd7D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9538 2 153 3.40.50.620
3nbkD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9464 1 151 3.40.50.620
4f3rC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9405 1 153 3.40.50.620
5ts2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9353 1 152 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A1Z9EZB5-F1-model_v4 deleted 0.9889 2 152
AF-A0A520CJY5-F1-model_v4 Pantetheine-phosphate adenylyltransferase (EC 2.7.7.3) 0.9876 1 136 GO:0004595
GO:0005737
GO:0015937
AF-A0A7X8FMF0-F1-model_v4 deleted 0.9862 1 148
AF-A0A7C7FMZ9-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9859 2 148 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A2A5FK01-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9854 1 153 GO:0004595
GO:0005524
GO:0005737
GO:0015937

Map