F487385
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 981 | 354 | 1962 | 222 |
Family's Representative Sequence
| Representative Sequence | 3300005614|Ga0068856_100570634|Ga0068856_1005706342 |
| Length | 228 |
| Sequence | MSFGDVATQGDEGLGPLSDRLSLGVAARLSRYLQVLTQARKMGKETISSQELSEYTHVNSTQIRRDLSGFGKFGKRGVGYNVDSLVSQIRKILRTSGQHNIALFGAGHLGKAIASSDIFADHGFRVVAIFDKDESKIGQPVGPDGKPGRLTVRAYDELERVVEEEDIVVGVLAVPTEAAQGVADDLVEAGVKIIFNYSEALLQVPPDVTVHTSSPAVDLLYALYFYLT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 114 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 117 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 118 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 119 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 120 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 180 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 181 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 183 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 184 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 185 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 186 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 187 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 188 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 189 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 190 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 191 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 192 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 193 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 194 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 195 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 196 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 197 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 198 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 199 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 200 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 201 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 202 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 203 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 204 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 206 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 207 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 208 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 209 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 210 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 211 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 212 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 213 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 214 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 215 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 217 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 218 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 219 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 220 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 221 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 222 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 223 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 224 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 225 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 226 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 227 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 228 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 229 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 230 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 280 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 281 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 282 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 283 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 284 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 285 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 288 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 289 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 290 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 291 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 292 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 293 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 294 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 295 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 296 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 297 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 298 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 332 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 333 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 334 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 335 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 349 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 350 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 351 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 353 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.18 |
| Metatranscriptomes | 0.82 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.77 |
| Nodule | 0 |
| Rhizoplane | 7.85 |
| Rhizosphere | 84.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068856_100570634 | 3300005614 | Bacteria | 1153 |
| 2 | JGI25406J46586_10016690 | 3300003203 | Bacteria | 3055 |
| 3 | JGI25406J46586_10024118 | 3300003203 | Bacteria | 2391 |
| 4 | JGI25406J46586_10093582 | 3300003203 | Bacteria | 904 |
| 5 | JGI25404J52841_10000683 | 3300003659 | Bacteria | 5213 |
| 6 | Ga0070676_10193080 | 3300005328 | Bacteria | 1331 |
| 7 | Ga0070683_100010350 | 3300005329 | Bacteria | 8022 |
| 8 | Ga0070683_100060010 | 3300005329 | Bacteria | 3534 |
| 9 | Ga0070683_100067114 | 3300005329 | Bacteria | 3341 |
| 10 | Ga0070683_100084877 | 3300005329 | Bacteria | 2967 |
| 11 | Ga0070683_100097989 | 3300005329 | Bacteria | 2759 |
| 12 | Ga0070683_100156344 | 3300005329 | Bacteria | 2162 |
| 13 | Ga0068869_100410381 | 3300005334 | Bacteria | 1116 |
| 14 | Ga0070666_10007128 | 3300005335 | Bacteria | 6894 |
| 15 | Ga0070666_10073982 | 3300005335 | Bacteria | 2321 |
| 16 | Ga0070680_100003170 | 3300005336 | Bacteria | 12221 |
| 17 | Ga0070682_100000011 | 3300005337 | Bacteria | 266253 |
| 18 | Ga0070682_100032630 | 3300005337 | Bacteria | 3160 |
| 19 | Ga0070682_100415997 | 3300005337 | Bacteria | 1020 |
| 20 | Ga0068868_100002102 | 3300005338 | Bacteria | 13721 |
| 21 | Ga0068868_100047180 | 3300005338 | Bacteria | 3374 |
| 22 | Ga0068868_100053845 | 3300005338 | Bacteria | 3170 |
| 23 | Ga0070660_100003333 | 3300005339 | Bacteria | 11037 |
| 24 | Ga0070660_100010096 | 3300005339 | Bacteria | 6662 |
| 25 | Ga0070660_100090148 | 3300005339 | Bacteria | 2417 |
| 26 | Ga0070660_100423437 | 3300005339 | Bacteria | 1103 |
| 27 | Ga0070691_10001522 | 3300005341 | Bacteria | 9956 |
| 28 | Ga0070691_10289807 | 3300005341 | Bacteria | 891 |
| 29 | Ga0070687_100008980 | 3300005343 | Bacteria | 4259 |
| 30 | Ga0070687_100022504 | 3300005343 | Bacteria | 2981 |
| 31 | Ga0070661_100000608 | 3300005344 | Bacteria | 26695 |
| 32 | Ga0070661_100002581 | 3300005344 | Bacteria | 12422 |
| 33 | Ga0070692_10019701 | 3300005345 | Bacteria | 3260 |
| 34 | Ga0070692_10060242 | 3300005345 | Bacteria | 1997 |
| 35 | Ga0070692_10070628 | 3300005345 | Bacteria | 1860 |
| 36 | Ga0070692_10134513 | 3300005345 | Bacteria | 1393 |
| 37 | Ga0070692_10392599 | 3300005345 | Bacteria | 874 |
| 38 | Ga0070668_100146141 | 3300005347 | Bacteria | 1909 |
| 39 | Ga0070668_100358678 | 3300005347 | Bacteria | 1235 |
| 40 | Ga0070668_100441202 | 3300005347 | Bacteria | 1117 |
| 41 | Ga0070669_100029617 | 3300005353 | Bacteria | 3947 |
| 42 | Ga0070669_100411270 | 3300005353 | Bacteria | 1109 |
| 43 | Ga0070675_100456436 | 3300005354 | Bacteria | 1147 |
| 44 | Ga0070674_100002829 | 3300005356 | Bacteria | 9595 |
| 45 | Ga0070674_100118950 | 3300005356 | Bacteria | 1953 |
| 46 | Ga0070674_100137602 | 3300005356 | Bacteria | 1829 |
| 47 | Ga0070673_100327147 | 3300005364 | Bacteria | 1355 |
| 48 | Ga0070688_100000412 | 3300005365 | Bacteria | 21692 |
| 49 | Ga0070688_100006189 | 3300005365 | Bacteria | 6371 |
| 50 | Ga0070659_100001553 | 3300005366 | Bacteria | 16555 |
| 51 | Ga0070659_100005891 | 3300005366 | Bacteria | 8829 |
| 52 | Ga0070659_100084199 | 3300005366 | Bacteria | 2543 |
| 53 | Ga0070659_100465064 | 3300005366 | Bacteria | 1074 |
| 54 | Ga0070667_100001123 | 3300005367 | Bacteria | 24412 |
| 55 | Ga0070667_100027661 | 3300005367 | Bacteria | 4718 |
| 56 | Ga0070667_100189425 | 3300005367 | Bacteria | 1822 |
| 57 | Ga0070703_10101489 | 3300005406 | Bacteria | 1015 |
| 58 | Ga0070714_100009599 | 3300005435 | Bacteria | 7614 |
| 59 | Ga0070713_100000748 | 3300005436 | Bacteria | 20840 |
| 60 | Ga0070710_10000003 | 3300005437 | Bacteria | 277772 |
| 61 | Ga0070710_10018955 | 3300005437 | Bacteria | 3549 |
| 62 | Ga0070701_10067133 | 3300005438 | Bacteria | 1908 |
| 63 | Ga0070701_10170918 | 3300005438 | Bacteria | 1266 |
| 64 | Ga0070711_100098467 | 3300005439 | Bacteria | 2123 |
| 65 | Ga0070711_100233383 | 3300005439 | Bacteria | 1435 |
| 66 | Ga0070700_100005606 | 3300005441 | Bacteria | 6654 |
| 67 | Ga0070700_100700038 | 3300005441 | Bacteria | 805 |
| 68 | Ga0070694_100062560 | 3300005444 | Bacteria | 2543 |
| 69 | Ga0070694_100114229 | 3300005444 | Bacteria | 1928 |
| 70 | Ga0070708_100111260 | 3300005445 | Bacteria | 2517 |
| 71 | Ga0070663_100003311 | 3300005455 | Bacteria | 9283 |
| 72 | Ga0070663_100024789 | 3300005455 | Bacteria | 4042 |
| 73 | Ga0070678_100015490 | 3300005456 | Bacteria | 4850 |
| 74 | Ga0070662_100008116 | 3300005457 | Bacteria | 6838 |
| 75 | Ga0070681_10295499 | 3300005458 | Bacteria | 1530 |
| 76 | Ga0070681_10442066 | 3300005458 | Bacteria | 1212 |
| 77 | Ga0068867_100034931 | 3300005459 | Bacteria | 3645 |
| 78 | Ga0068867_100169983 | 3300005459 | Bacteria | 1726 |
| 79 | Ga0068867_100192142 | 3300005459 | Bacteria | 1630 |
| 80 | Ga0068867_100435461 | 3300005459 | Bacteria | 1114 |
| 81 | Ga0070685_10000013 | 3300005466 | Bacteria | 120875 |
| 82 | Ga0070685_10021496 | 3300005466 | Bacteria | 3508 |
| 83 | Ga0070685_10038474 | 3300005466 | Bacteria | 2713 |
| 84 | Ga0070699_100376540 | 3300005518 | Bacteria | 1281 |
| 85 | Ga0070679_100001029 | 3300005530 | Bacteria | 24321 |
| 86 | Ga0070679_100162619 | 3300005530 | Bacteria | 2206 |
| 87 | Ga0070679_100554876 | 3300005530 | Bacteria | 1092 |
| 88 | Ga0070684_100039175 | 3300005535 | Bacteria | 4075 |
| 89 | Ga0070684_100054415 | 3300005535 | Bacteria | 3487 |
| 90 | Ga0070684_100095814 | 3300005535 | Bacteria | 2645 |
| 91 | Ga0070684_100155667 | 3300005535 | Bacteria | 2072 |
| 92 | Ga0070684_100236213 | 3300005535 | Bacteria | 1669 |
| 93 | Ga0070672_100000083 | 3300005543 | Bacteria | 44812 |
| 94 | Ga0070672_100003260 | 3300005543 | Bacteria | 10504 |
| 95 | Ga0070686_100067757 | 3300005544 | Bacteria | 2326 |
| 96 | Ga0070695_100054567 | 3300005545 | Bacteria | 2573 |
| 97 | Ga0070696_100120309 | 3300005546 | Bacteria | 1900 |
| 98 | Ga0070693_100216811 | 3300005547 | Bacteria | 1252 |
| 99 | Ga0070665_100002416 | 3300005548 | Bacteria | 20602 |
| 100 | Ga0070665_100008538 | 3300005548 | Bacteria | 10364 |
| 101 | Ga0070704_100140893 | 3300005549 | Bacteria | 1882 |
| 102 | Ga0068855_100298342 | 3300005563 | Bacteria | 1785 |
| 103 | Ga0068855_100965777 | 3300005563 | Bacteria | 897 |
| 104 | Ga0070664_100079691 | 3300005564 | Bacteria | 2820 |
| 105 | Ga0070664_100380390 | 3300005564 | Bacteria | 1288 |
| 106 | Ga0068857_100054614 | 3300005577 | Bacteria | 3545 |
| 107 | Ga0068857_100288782 | 3300005577 | Bacteria | 1510 |
| 108 | Ga0068854_100000363 | 3300005578 | Bacteria | 29001 |
| 109 | Ga0068854_100009396 | 3300005578 | Bacteria | 6314 |
| 110 | Ga0068854_100513687 | 3300005578 | Bacteria | 1011 |
| 111 | Ga0068856_100000237 | 3300005614 | Bacteria | 59854 |
| 112 | Ga0068856_100009300 | 3300005614 | Bacteria | 9547 |
| 113 | Ga0068856_100239258 | 3300005614 | Bacteria | 1831 |
| 114 | Ga0068856_100390401 | 3300005614 | Bacteria | 1411 |
| 115 | Ga0070702_100181826 | 3300005615 | Bacteria | 1376 |
| 116 | Ga0070702_100200104 | 3300005615 | Bacteria | 1322 |
| 117 | Ga0068852_100000002 | 3300005616 | Bacteria | 268221 |
| 118 | Ga0068852_100024619 | 3300005616 | Bacteria | 4868 |
| 119 | Ga0068852_100040878 | 3300005616 | Bacteria | 3916 |
| 120 | Ga0068852_100082269 | 3300005616 | Bacteria | 2861 |
| 121 | Ga0068859_100157443 | 3300005617 | Bacteria | 2349 |
| 122 | Ga0068864_100452702 | 3300005618 | Bacteria | 1228 |
| 123 | Ga0068864_100663128 | 3300005618 | Bacteria | 1017 |
| 124 | Ga0068861_100053123 | 3300005719 | Bacteria | 3082 |
| 125 | Ga0068861_100620966 | 3300005719 | Bacteria | 994 |
| 126 | Ga0068870_10041499 | 3300005840 | Bacteria | 2391 |
| 127 | Ga0068870_10491064 | 3300005840 | Bacteria | 817 |
| 128 | Ga0068863_100004075 | 3300005841 | Bacteria | 14433 |
| 129 | Ga0068858_100395358 | 3300005842 | Bacteria | 1327 |
| 130 | Ga0068860_100973465 | 3300005843 | Bacteria | 866 |
| 131 | Ga0068862_100005726 | 3300005844 | Bacteria | 10368 |
| 132 | Ga0068862_100029993 | 3300005844 | Bacteria | 4582 |
| 133 | Ga0081455_10017106 | 3300005937 | Bacteria | 6967 |
| 134 | Ga0081455_10020169 | 3300005937 | Bacteria | 6288 |
| 135 | Ga0081455_10031221 | 3300005937 | Bacteria | 4824 |
| 136 | Ga0081455_10043484 | 3300005937 | Bacteria | 3928 |
| 137 | Ga0081455_10043964 | 3300005937 | Bacteria | 3902 |
| 138 | Ga0081455_10080638 | 3300005937 | Bacteria | 2667 |
| 139 | Ga0081538_10003251 | 3300005981 | Bacteria | 15441 |
| 140 | Ga0081538_10009166 | 3300005981 | Bacteria | 8300 |
| 141 | Ga0081538_10062422 | 3300005981 | Bacteria | 2125 |
| 142 | Ga0081540_1013620 | 3300005983 | Bacteria | 5273 |
| 143 | Ga0081540_1079946 | 3300005983 | Bacteria | 1476 |
| 144 | Ga0081539_10000030 | 3300005985 | Bacteria | 317236 |
| 145 | Ga0081539_10002871 | 3300005985 | Bacteria | 22885 |
| 146 | Ga0081539_10011497 | 3300005985 | Bacteria | 6990 |
| 147 | Ga0081539_10014196 | 3300005985 | Bacteria | 5914 |
| 148 | Ga0081539_10133858 | 3300005985 | Bacteria | 1214 |
| 149 | Ga0070717_10180495 | 3300006028 | Bacteria | 1840 |
| 150 | Ga0075365_10002720 | 3300006038 | Bacteria | 8812 |
| 151 | Ga0075365_10102993 | 3300006038 | Bacteria | 1956 |
| 152 | Ga0075365_10272462 | 3300006038 | Bacteria | 1190 |
| 153 | Ga0075365_10285642 | 3300006038 | Bacteria | 1161 |
| 154 | Ga0075363_100025789 | 3300006048 | Bacteria | 3002 |
| 155 | Ga0075363_100032813 | 3300006048 | Bacteria | 2699 |
| 156 | Ga0075363_100039390 | 3300006048 | Bacteria | 2487 |
| 157 | Ga0075364_10030750 | 3300006051 | Bacteria | 3448 |
| 158 | Ga0075364_10059882 | 3300006051 | Bacteria | 2497 |
| 159 | Ga0075364_10131945 | 3300006051 | Bacteria | 1677 |
| 160 | Ga0075364_10190214 | 3300006051 | Bacteria | 1390 |
| 161 | Ga0070716_100235862 | 3300006173 | Bacteria | 1238 |
| 162 | Ga0070712_100004387 | 3300006175 | Bacteria | 8711 |
| 163 | Ga0070712_100006281 | 3300006175 | Bacteria | 7361 |
| 164 | Ga0075367_10055292 | 3300006178 | Bacteria | 2355 |
| 165 | Ga0075367_10094885 | 3300006178 | Bacteria | 1819 |
| 166 | Ga0075367_10096803 | 3300006178 | Bacteria | 1800 |
| 167 | Ga0075367_10287234 | 3300006178 | Bacteria | 1034 |
| 168 | Ga0068871_100521572 | 3300006358 | Unclassified | 1073 |
| 169 | Ga0075428_100011196 | 3300006844 | Bacteria | 9982 |
| 170 | Ga0075428_100036234 | 3300006844 | Bacteria | 5434 |
| 171 | Ga0075430_100138828 | 3300006846 | Bacteria | 2024 |
| 172 | Ga0075430_100183724 | 3300006846 | Bacteria | 1739 |
| 173 | Ga0075431_100027415 | 3300006847 | Bacteria | 5844 |
| 174 | Ga0075431_100049326 | 3300006847 | Bacteria | 4341 |
| 175 | Ga0075433_10491497 | 3300006852 | Bacteria | 1081 |
| 176 | Ga0075434_100296759 | 3300006871 | Bacteria | 1636 |
| 177 | Ga0075434_100336755 | 3300006871 | Bacteria | 1529 |
| 178 | Ga0075434_100479837 | 3300006871 | Bacteria | 1264 |
| 179 | Ga0075434_100590724 | 3300006871 | Bacteria | 1130 |
| 180 | Ga0075429_100036300 | 3300006880 | Bacteria | 4286 |
| 181 | Ga0075429_100792570 | 3300006880 | Bacteria | 830 |
| 182 | Ga0068865_100000134 | 3300006881 | Bacteria | 38568 |
| 183 | Ga0068865_100083041 | 3300006881 | Bacteria | 2305 |
| 184 | Ga0068865_100138818 | 3300006881 | Bacteria | 1830 |
| 185 | Ga0068865_100291114 | 3300006881 | Bacteria | 1303 |
| 186 | Ga0075436_100335548 | 3300006914 | Bacteria | 1088 |
| 187 | Ga0097620_100157439 | 3300006931 | Bacteria | 2349 |
| 188 | Ga0075435_100066716 | 3300007076 | Bacteria | 2928 |
| 189 | Ga0075435_100298856 | 3300007076 | Bacteria | 1377 |
| 190 | Ga0105240_10020705 | 3300009093 | Bacteria | 8764 |
| 191 | Ga0105240_10119159 | 3300009093 | Bacteria | 3180 |
| 192 | Ga0105240_10399294 | 3300009093 | Bacteria | 1549 |
| 193 | Ga0111539_10035312 | 3300009094 | Bacteria | 6054 |
| 194 | Ga0111539_10039780 | 3300009094 | Bacteria | 5664 |
| 195 | Ga0111539_10065832 | 3300009094 | Bacteria | 4281 |
| 196 | Ga0111539_10091834 | 3300009094 | Bacteria | 3567 |
| 197 | Ga0111539_10331327 | 3300009094 | Bacteria | 1772 |
| 198 | Ga0111539_10479169 | 3300009094 | Bacteria | 1449 |
| 199 | Ga0105245_10000026 | 3300009098 | Bacteria | 163660 |
| 200 | Ga0105245_10023658 | 3300009098 | Bacteria | 5392 |
| 201 | Ga0105245_10065489 | 3300009098 | Bacteria | 3286 |
| 202 | Ga0105245_10065662 | 3300009098 | Bacteria | 3282 |
| 203 | Ga0105245_10088633 | 3300009098 | Bacteria | 2842 |
| 204 | Ga0105245_10180055 | 3300009098 | Bacteria | 2019 |
| 205 | Ga0105245_10414615 | 3300009098 | Bacteria | 1349 |
| 206 | Ga0105247_10002124 | 3300009101 | Bacteria | 13709 |
| 207 | Ga0114129_10035834 | 3300009147 | Bacteria | 7007 |
| 208 | Ga0114129_10136554 | 3300009147 | Bacteria | 3365 |
| 209 | Ga0114129_10244858 | 3300009147 | Bacteria | 2409 |
| 210 | Ga0114129_10470282 | 3300009147 | Bacteria | 1646 |
| 211 | Ga0114129_10938352 | 3300009147 | Bacteria | 1094 |
| 212 | Ga0114129_10953063 | 3300009147 | Bacteria | 1084 |
| 213 | Ga0105243_10036077 | 3300009148 | Bacteria | 3835 |
| 214 | Ga0105243_10044052 | 3300009148 | Bacteria | 3499 |
| 215 | Ga0105243_10053227 | 3300009148 | Bacteria | 3210 |
| 216 | Ga0105243_10063528 | 3300009148 | Bacteria | 2959 |
| 217 | Ga0105243_10193080 | 3300009148 | Bacteria | 1780 |
| 218 | Ga0105243_10797589 | 3300009148 | Bacteria | 930 |
| 219 | Ga0105242_10000062 | 3300009176 | Bacteria | 74936 |
| 220 | Ga0105248_10000020 | 3300009177 | Bacteria | 284637 |
| 221 | Ga0105248_10068464 | 3300009177 | Bacteria | 3985 |
| 222 | Ga0105248_10648336 | 3300009177 | Bacteria | 1191 |
| 223 | Ga0105237_10133151 | 3300009545 | Bacteria | 2481 |
| 224 | Ga0105238_10003730 | 3300009551 | Bacteria | 15155 |
| 225 | Ga0105238_10202704 | 3300009551 | Bacteria | 1960 |
| 226 | Ga0105238_10386673 | 3300009551 | Bacteria | 1391 |
| 227 | Ga0105249_10019687 | 3300009553 | Bacteria | 6024 |
| 228 | Ga0105249_10039393 | 3300009553 | Bacteria | 4291 |
| 229 | Ga0105249_10094765 | 3300009553 | Bacteria | 2798 |
| 230 | Ga0105249_10278589 | 3300009553 | Bacteria | 1669 |
| 231 | Ga0105249_10324159 | 3300009553 | Bacteria | 1552 |
| 232 | Ga0105249_10363740 | 3300009553 | Bacteria | 1469 |
| 233 | Ga0105249_10492397 | 3300009553 | Bacteria | 1270 |
| 234 | Ga0105249_10754560 | 3300009553 | Bacteria | 1035 |
| 235 | Ga0105239_10063494 | 3300010375 | Bacteria | 4055 |
| 236 | Ga0105239_10126200 | 3300010375 | Bacteria | 2844 |
| 237 | Ga0105239_10211851 | 3300010375 | Bacteria | 2172 |
| 238 | Ga0105239_10217936 | 3300010375 | Bacteria | 2140 |
| 239 | Ga0105239_10259171 | 3300010375 | Bacteria | 1954 |
| 240 | Ga0105246_10013066 | 3300011119 | Bacteria | 5195 |
| 241 | Ga0105246_10027127 | 3300011119 | Bacteria | 3750 |
| 242 | Ga0105246_10036801 | 3300011119 | Bacteria | 3281 |
| 243 | Ga0105246_10089923 | 3300011119 | Bacteria | 2210 |
| 244 | Ga0105246_10447001 | 3300011119 | Bacteria | 1085 |
| 245 | Ga0157371_10023708 | 3300013102 | Bacteria | 4486 |
| 246 | Ga0157371_10150083 | 3300013102 | Bacteria | 1662 |
| 247 | Ga0157370_10003031 | 3300013104 | Bacteria | 19936 |
| 248 | Ga0157370_10075806 | 3300013104 | Bacteria | 3170 |
| 249 | Ga0157369_10000014 | 3300013105 | Bacteria | 266411 |
| 250 | Ga0157369_10014378 | 3300013105 | Bacteria | 8937 |
| 251 | Ga0157374_10198580 | 3300013296 | Bacteria | 1963 |
| 252 | Ga0157374_10307421 | 3300013296 | Bacteria | 1569 |
| 253 | Ga0157374_10482118 | 3300013296 | Bacteria | 1243 |
| 254 | Ga0157378_10032991 | 3300013297 | Bacteria | 4576 |
| 255 | Ga0163162_10235651 | 3300013306 | Bacteria | 1961 |
| 256 | Ga0163162_10243962 | 3300013306 | Bacteria | 1928 |
| 257 | Ga0163162_10558146 | 3300013306 | Bacteria | 1273 |
| 258 | Ga0157372_10000060 | 3300013307 | Bacteria | 122372 |
| 259 | Ga0157372_10031735 | 3300013307 | Bacteria | 5786 |
| 260 | Ga0157372_10310252 | 3300013307 | Bacteria | 1836 |
| 261 | Ga0157372_10777257 | 3300013307 | Bacteria | 1113 |
| 262 | Ga0157375_10004333 | 3300013308 | Bacteria | 12321 |
| 263 | Ga0157375_10048375 | 3300013308 | Bacteria | 4160 |
| 264 | Ga0157375_10088796 | 3300013308 | Bacteria | 3146 |
| 265 | Ga0157375_10488479 | 3300013308 | Bacteria | 1396 |
| 266 | Ga0157375_11888349 | 3300013308 | Bacteria | 709 |
| 267 | Ga0157380_10000183 | 3300014326 | Bacteria | 36263 |
| 268 | Ga0157380_10099609 | 3300014326 | Bacteria | 2417 |
| 269 | Ga0157380_10652359 | 3300014326 | Bacteria | 1050 |
| 270 | Ga0182008_10209451 | 3300014497 | Unclassified | 994 |
| 271 | Ga0157377_10005590 | 3300014745 | Bacteria | 5921 |
| 272 | Ga0157377_10270228 | 3300014745 | Bacteria | 1110 |
| 273 | Ga0157377_10311583 | 3300014745 | Bacteria | 1043 |
| 274 | Ga0157379_10102525 | 3300014968 | Bacteria | 2568 |
| 275 | Ga0157379_10174121 | 3300014968 | Bacteria | 1943 |
| 276 | Ga0157379_10213520 | 3300014968 | Bacteria | 1747 |
| 277 | Ga0157376_10496720 | 3300014969 | Bacteria | 1198 |
| 278 | Ga0157376_10628719 | 3300014969 | Bacteria | 1071 |
| 279 | Ga0197907_11014959 | 3300020069 | Bacteria | 767 |
| 280 | Ga0206356_10330832 | 3300020070 | Bacteria | 1457 |
| 281 | Ga0206356_11279823 | 3300020070 | Bacteria | 1167 |
| 282 | Ga0206355_1165500 | 3300020076 | Bacteria | 842 |
| 283 | Ga0206354_10766443 | 3300020081 | Bacteria | 1400 |
| 284 | Ga0206353_10515505 | 3300020082 | Bacteria | 2033 |
| 285 | Ga0154015_1536340 | 3300020610 | Bacteria | 1030 |
| 286 | Ga0213874_10001218 | 3300021377 | Bacteria | 5284 |
| 287 | Ga0213874_10006023 | 3300021377 | Bacteria | 2852 |
| 288 | Ga0213876_10002937 | 3300021384 | Bacteria | 9876 |
| 289 | Ga0213876_10012752 | 3300021384 | Bacteria | 4469 |
| 290 | Ga0213876_10044855 | 3300021384 | Bacteria | 2337 |
| 291 | Ga0213875_10006352 | 3300021388 | Bacteria | 6220 |
| 292 | Ga0213875_10010871 | 3300021388 | Bacteria | 4550 |
| 293 | Ga0213875_10093116 | 3300021388 | Bacteria | 1405 |
| 294 | Ga0213875_10127422 | 3300021388 | Bacteria | 1190 |
| 295 | Ga0213875_10261015 | 3300021388 | Bacteria | 817 |
| 296 | Ga0224712_10105634 | 3300022467 | Bacteria | 1201 |
| 297 | Ga0207692_10000002 | 3300025898 | Bacteria | 453100 |
| 298 | Ga0207692_10000008 | 3300025898 | Bacteria | 183372 |
| 299 | Ga0207710_10000997 | 3300025900 | Bacteria | 14813 |
| 300 | Ga0207710_10196573 | 3300025900 | Unclassified | 995 |
| 301 | Ga0207688_10003930 | 3300025901 | Bacteria | 8101 |
| 302 | Ga0207688_10067922 | 3300025901 | Bacteria | 2018 |
| 303 | Ga0207688_10088984 | 3300025901 | Bacteria | 1771 |
| 304 | Ga0207680_10000567 | 3300025903 | Bacteria | 17482 |
| 305 | Ga0207680_10003842 | 3300025903 | Bacteria | 7074 |
| 306 | Ga0207647_10345716 | 3300025904 | Unclassified | 842 |
| 307 | Ga0207645_10134031 | 3300025907 | Bacteria | 1613 |
| 308 | Ga0207643_10019743 | 3300025908 | Bacteria | 3694 |
| 309 | Ga0207643_10026507 | 3300025908 | Bacteria | 3209 |
| 310 | Ga0207643_10032911 | 3300025908 | Bacteria | 2899 |
| 311 | Ga0207643_10315093 | 3300025908 | Bacteria | 976 |
| 312 | Ga0207705_10204821 | 3300025909 | Bacteria | 1495 |
| 313 | Ga0207705_10261494 | 3300025909 | Bacteria | 1321 |
| 314 | Ga0207705_10377641 | 3300025909 | Bacteria | 1094 |
| 315 | Ga0207707_10062659 | 3300025912 | Bacteria | 3236 |
| 316 | Ga0207707_10094369 | 3300025912 | Bacteria | 2614 |
| 317 | Ga0207707_10266657 | 3300025912 | Bacteria | 1485 |
| 318 | Ga0207695_10170501 | 3300025913 | Bacteria | 2102 |
| 319 | Ga0207671_10256816 | 3300025914 | Bacteria | 1375 |
| 320 | Ga0207693_10015036 | 3300025915 | Bacteria | 6213 |
| 321 | Ga0207693_10044533 | 3300025915 | Bacteria | 3488 |
| 322 | Ga0207663_10119552 | 3300025916 | Bacteria | 1802 |
| 323 | Ga0207660_10010892 | 3300025917 | Bacteria | 5912 |
| 324 | Ga0207662_10012720 | 3300025918 | Bacteria | 4691 |
| 325 | Ga0207662_10047889 | 3300025918 | Bacteria | 2532 |
| 326 | Ga0207662_10306115 | 3300025918 | Bacteria | 1058 |
| 327 | Ga0207657_10000668 | 3300025919 | Bacteria | 36536 |
| 328 | Ga0207657_10041139 | 3300025919 | Bacteria | 4088 |
| 329 | Ga0207657_10202570 | 3300025919 | Bacteria | 1596 |
| 330 | Ga0207649_10000003 | 3300025920 | Bacteria | 388908 |
| 331 | Ga0207649_10010605 | 3300025920 | Bacteria | 5067 |
| 332 | Ga0207649_10060286 | 3300025920 | Bacteria | 2384 |
| 333 | Ga0207652_10000971 | 3300025921 | Bacteria | 26782 |
| 334 | Ga0207652_10117953 | 3300025921 | Bacteria | 2358 |
| 335 | Ga0207681_10004863 | 3300025923 | Bacteria | 8254 |
| 336 | Ga0207681_10180178 | 3300025923 | Bacteria | 1609 |
| 337 | Ga0207681_10238025 | 3300025923 | Bacteria | 1416 |
| 338 | Ga0207694_10001456 | 3300025924 | Bacteria | 20275 |
| 339 | Ga0207694_10247341 | 3300025924 | Bacteria | 1458 |
| 340 | Ga0207694_10325029 | 3300025924 | Bacteria | 1270 |
| 341 | Ga0207650_10691799 | 3300025925 | Bacteria | 861 |
| 342 | Ga0207659_10066313 | 3300025926 | Bacteria | 2619 |
| 343 | Ga0207659_10566714 | 3300025926 | Bacteria | 966 |
| 344 | Ga0207687_10000017 | 3300025927 | Bacteria | 237310 |
| 345 | Ga0207687_10041869 | 3300025927 | Bacteria | 3148 |
| 346 | Ga0207687_10050055 | 3300025927 | Bacteria | 2907 |
| 347 | Ga0207687_10684697 | 3300025927 | Unclassified | 869 |
| 348 | Ga0207700_10000003 | 3300025928 | Bacteria | 500797 |
| 349 | Ga0207664_10002648 | 3300025929 | Bacteria | 11865 |
| 350 | Ga0207664_10074670 | 3300025929 | Bacteria | 2740 |
| 351 | Ga0207644_10366412 | 3300025931 | Bacteria | 1173 |
| 352 | Ga0207690_10000095 | 3300025932 | Bacteria | 73025 |
| 353 | Ga0207690_10012400 | 3300025932 | Bacteria | 5097 |
| 354 | Ga0207690_10112309 | 3300025932 | Bacteria | 1965 |
| 355 | Ga0207690_10255479 | 3300025932 | Bacteria | 1356 |
| 356 | Ga0207690_10334941 | 3300025932 | Bacteria | 1193 |
| 357 | Ga0207706_10053097 | 3300025933 | Bacteria | 3578 |
| 358 | Ga0207706_10112105 | 3300025933 | Bacteria | 2400 |
| 359 | Ga0207686_10000149 | 3300025934 | Bacteria | 53704 |
| 360 | Ga0207686_10143772 | 3300025934 | Bacteria | 1652 |
| 361 | Ga0207709_10023210 | 3300025935 | Bacteria | 3528 |
| 362 | Ga0207709_10088516 | 3300025935 | Bacteria | 2016 |
| 363 | Ga0207709_10263592 | 3300025935 | Bacteria | 1265 |
| 364 | Ga0207709_10346259 | 3300025935 | Bacteria | 1120 |
| 365 | Ga0207670_10010569 | 3300025936 | Bacteria | 5325 |
| 366 | Ga0207670_10758582 | 3300025936 | Bacteria | 806 |
| 367 | Ga0207669_10028930 | 3300025937 | Bacteria | 3056 |
| 368 | Ga0207669_10041930 | 3300025937 | Bacteria | 2668 |
| 369 | Ga0207669_10046786 | 3300025937 | Bacteria | 2559 |
| 370 | Ga0207704_10000110 | 3300025938 | Bacteria | 45277 |
| 371 | Ga0207704_10044011 | 3300025938 | Bacteria | 2641 |
| 372 | Ga0207704_10426021 | 3300025938 | Bacteria | 1053 |
| 373 | Ga0207691_10000641 | 3300025940 | Bacteria | 34560 |
| 374 | Ga0207691_10172129 | 3300025940 | Bacteria | 1896 |
| 375 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 376 | Ga0207711_10229765 | 3300025941 | Bacteria | 1699 |
| 377 | Ga0207689_10009047 | 3300025942 | Bacteria | 8625 |
| 378 | Ga0207689_10067484 | 3300025942 | Bacteria | 2939 |
| 379 | Ga0207661_10000867 | 3300025944 | Bacteria | 19843 |
| 380 | Ga0207661_10011021 | 3300025944 | Bacteria | 6533 |
| 381 | Ga0207661_10019205 | 3300025944 | Bacteria | 5091 |
| 382 | Ga0207661_10067998 | 3300025944 | Bacteria | 2899 |
| 383 | Ga0207661_10130764 | 3300025944 | Bacteria | 2150 |
| 384 | Ga0207661_10198737 | 3300025944 | Bacteria | 1761 |
| 385 | Ga0207661_10243480 | 3300025944 | Bacteria | 1596 |
| 386 | Ga0207661_10642485 | 3300025944 | Bacteria | 975 |
| 387 | Ga0207679_10125499 | 3300025945 | Bacteria | 2050 |
| 388 | Ga0207651_10470913 | 3300025960 | Bacteria | 1081 |
| 389 | Ga0207712_10001187 | 3300025961 | Bacteria | 18020 |
| 390 | Ga0207712_10018821 | 3300025961 | Bacteria | 4502 |
| 391 | Ga0207712_10194404 | 3300025961 | Bacteria | 1604 |
| 392 | Ga0207712_10300160 | 3300025961 | Bacteria | 1318 |
| 393 | Ga0207712_10520617 | 3300025961 | Bacteria | 1019 |
| 394 | Ga0207668_10009378 | 3300025972 | Bacteria | 5863 |
| 395 | Ga0207668_10048831 | 3300025972 | Bacteria | 2906 |
| 396 | Ga0207668_10119288 | 3300025972 | Bacteria | 1994 |
| 397 | Ga0207668_10201874 | 3300025972 | Bacteria | 1584 |
| 398 | Ga0207668_10540061 | 3300025972 | Bacteria | 1008 |
| 399 | Ga0207640_10000110 | 3300025981 | Bacteria | 61907 |
| 400 | Ga0207640_10023834 | 3300025981 | Bacteria | 3684 |
| 401 | Ga0207640_10305227 | 3300025981 | Bacteria | 1261 |
| 402 | Ga0207658_10000724 | 3300025986 | Bacteria | 28537 |
| 403 | Ga0207658_10025487 | 3300025986 | Bacteria | 4141 |
| 404 | Ga0207658_10090085 | 3300025986 | Bacteria | 2376 |
| 405 | Ga0207677_10000362 | 3300026023 | Bacteria | 31866 |
| 406 | Ga0207677_10031402 | 3300026023 | Bacteria | 3401 |
| 407 | Ga0207677_10067595 | 3300026023 | Bacteria | 2504 |
| 408 | Ga0207677_10326065 | 3300026023 | Bacteria | 1278 |
| 409 | Ga0207677_10606435 | 3300026023 | Unclassified | 961 |
| 410 | Ga0207703_10149392 | 3300026035 | Bacteria | 2036 |
| 411 | Ga0207703_10150236 | 3300026035 | Bacteria | 2030 |
| 412 | Ga0207703_10361804 | 3300026035 | Bacteria | 1338 |
| 413 | Ga0207703_10774924 | 3300026035 | Bacteria | 915 |
| 414 | Ga0207678_10002999 | 3300026067 | Bacteria | 15265 |
| 415 | Ga0207678_10182971 | 3300026067 | Bacteria | 1790 |
| 416 | Ga0207708_10004323 | 3300026075 | Bacteria | 10462 |
| 417 | Ga0207708_10031234 | 3300026075 | Bacteria | 4042 |
| 418 | Ga0207708_10178134 | 3300026075 | Bacteria | 1687 |
| 419 | Ga0207702_10000251 | 3300026078 | Bacteria | 62222 |
| 420 | Ga0207702_10046903 | 3300026078 | Bacteria | 3639 |
| 421 | Ga0207702_10442326 | 3300026078 | Bacteria | 1260 |
| 422 | Ga0207641_10003132 | 3300026088 | Bacteria | 14859 |
| 423 | Ga0207641_10038572 | 3300026088 | Bacteria | 3994 |
| 424 | Ga0207641_10316849 | 3300026088 | Bacteria | 1478 |
| 425 | Ga0207641_10599614 | 3300026088 | Bacteria | 1078 |
| 426 | Ga0207648_10044759 | 3300026089 | Bacteria | 3884 |
| 427 | Ga0207648_10081652 | 3300026089 | Bacteria | 2819 |
| 428 | Ga0207648_10148797 | 3300026089 | Bacteria | 2066 |
| 429 | Ga0207674_10064491 | 3300026116 | Bacteria | 3695 |
| 430 | Ga0207674_10264070 | 3300026116 | Bacteria | 1669 |
| 431 | Ga0207674_10313100 | 3300026116 | Bacteria | 1519 |
| 432 | Ga0207674_10687739 | 3300026116 | Bacteria | 988 |
| 433 | Ga0207675_100057122 | 3300026118 | Bacteria | 3641 |
| 434 | Ga0207675_100076567 | 3300026118 | Bacteria | 3133 |
| 435 | Ga0207675_100195907 | 3300026118 | Bacteria | 1939 |
| 436 | Ga0207675_100207229 | 3300026118 | Bacteria | 1884 |
| 437 | Ga0207675_100856040 | 3300026118 | Bacteria | 924 |
| 438 | Ga0207683_10058242 | 3300026121 | Bacteria | 3392 |
| 439 | Ga0207683_10085618 | 3300026121 | Bacteria | 2802 |
| 440 | Ga0207683_10118927 | 3300026121 | Bacteria | 2371 |
| 441 | Ga0207698_10000004 | 3300026142 | Bacteria | 313614 |
| 442 | Ga0207698_10090631 | 3300026142 | Bacteria | 2501 |
| 443 | Ga0207698_10146898 | 3300026142 | Bacteria | 2040 |
| 444 | Ga0207698_10304093 | 3300026142 | Bacteria | 1486 |
| 445 | Ga0207428_10022078 | 3300027907 | Bacteria | 5375 |
| 446 | Ga0207428_10049564 | 3300027907 | Bacteria | 3364 |
| 447 | Ga0207428_10102806 | 3300027907 | Bacteria | 2206 |
| 448 | Ga0268266_10000160 | 3300028379 | Bacteria | 125999 |
| 449 | Ga0268266_10002810 | 3300028379 | Bacteria | 18158 |
| 450 | Ga0268266_10158222 | 3300028379 | Bacteria | 2048 |
| 451 | Ga0268265_10004189 | 3300028380 | Bacteria | 10094 |
| 452 | Ga0268264_10056529 | 3300028381 | Bacteria | 3280 |
| 453 | Ga0265326_10000006 | 3300028558 | Bacteria | 233392 |
| 454 | Ga0265326_10058601 | 3300028558 | Bacteria | 1089 |
| 455 | Ga0265319_1000014 | 3300028563 | Bacteria | 177623 |
| 456 | Ga0265319_1001476 | 3300028563 | Bacteria | 14047 |
| 457 | Ga0265319_1001805 | 3300028563 | Bacteria | 12239 |
| 458 | Ga0265319_1023191 | 3300028563 | Bacteria | 2251 |
| 459 | Ga0265334_10000016 | 3300028573 | Bacteria | 147961 |
| 460 | Ga0265318_10024305 | 3300028577 | Bacteria | 2404 |
| 461 | Ga0265338_10000185 | 3300028800 | Bacteria | 116333 |
| 462 | Ga0265338_10002259 | 3300028800 | Bacteria | 29345 |
| 463 | Ga0265338_10035939 | 3300028800 | Bacteria | 4751 |
| 464 | Ga0265324_10000857 | 3300029957 | Bacteria | 19544 |
| 465 | Ga0265320_10010021 | 3300031240 | Bacteria | 5667 |
| 466 | Ga0265325_10057017 | 3300031241 | Bacteria | 1993 |
| 467 | Ga0307408_100347738 | 3300031548 | Bacteria | 1257 |
| 468 | Ga0265313_10084083 | 3300031595 | Bacteria | 1440 |
| 469 | Ga0316579_10165780 | 3300031691 | Bacteria | 1068 |
| 470 | Ga0316578_10171970 | 3300031728 | Bacteria | 1306 |
| 471 | Ga0316578_10220899 | 3300031728 | Bacteria | 1139 |
| 472 | Ga0307405_10007980 | 3300031731 | Bacteria | 5336 |
| 473 | Ga0307413_10349525 | 3300031824 | Bacteria | 1140 |
| 474 | Ga0307410_10180602 | 3300031852 | Bacteria | 1597 |
| 475 | Ga0307410_10260879 | 3300031852 | Bacteria | 1351 |
| 476 | Ga0307406_10033031 | 3300031901 | Bacteria | 3164 |
| 477 | Ga0307406_10064514 | 3300031901 | Bacteria | 2377 |
| 478 | Ga0307406_10156998 | 3300031901 | Bacteria | 1631 |
| 479 | Ga0307406_10233331 | 3300031901 | Bacteria | 1375 |
| 480 | Ga0307409_100003708 | 3300031995 | Bacteria | 8380 |
| 481 | Ga0307409_100079747 | 3300031995 | Bacteria | 2639 |
| 482 | Ga0307409_100220688 | 3300031995 | Bacteria | 1711 |
| 483 | Ga0307409_100419005 | 3300031995 | Unclassified | 1284 |
| 484 | Ga0307416_100042078 | 3300032002 | Bacteria | 3563 |
| 485 | Ga0307416_100074821 | 3300032002 | Bacteria | 2831 |
| 486 | Ga0307416_100261964 | 3300032002 | Bacteria | 1690 |
| 487 | Ga0307416_101165663 | 3300032002 | Bacteria | 876 |
| 488 | Ga0307414_10115450 | 3300032004 | Bacteria | 2053 |
| 489 | Ga0307414_10299717 | 3300032004 | Bacteria | 1359 |
| 490 | Ga0307414_10402485 | 3300032004 | Bacteria | 1189 |
| 491 | Ga0307411_10374809 | 3300032005 | Bacteria | 1168 |
| 492 | Ga0307415_100009154 | 3300032126 | Bacteria | 5530 |
| 493 | Ga0307415_100083090 | 3300032126 | Bacteria | 2293 |
| 494 | Ga0373952_0048671 | 3300035092 | Bacteria | 1003 |
| 495 | Ga0316574_0034661 | 3300035398 | Bacteria | 3079 |
| 496 | Ga0316574_0036845 | 3300035398 | Bacteria | 2996 |
| 497 | Ga0316574_0239422 | 3300035398 | Bacteria | 1160 |
| 498 | Ga0316574_0247639 | 3300035398 | Bacteria | 1139 |
| 499 | Ga0316582_0237805 | 3300036647 | Bacteria | 1247 |
| 500 | Ga0316582_0317589 | 3300036647 | Bacteria | 1071 |
| 501 | Ga0316584_0011063 | 3300036712 | Bacteria | 6325 |
| 502 | Ga0316584_0088967 | 3300036712 | Bacteria | 2312 |
| 503 | Ga0316584_0409003 | 3300036712 | Bacteria | 965 |
| 504 | Ga0373925_0307904 | 3300037068 | Bacteria | 1280 |
| 505 | Ga0395899_0025209 | 3300037312 | Bacteria | 4490 |
| 506 | Ga0395899_0048562 | 3300037312 | Bacteria | 3158 |
| 507 | Ga0395900_0005261 | 3300037418 | Bacteria | 13573 |
| 508 | Ga0395900_0011100 | 3300037418 | Bacteria | 9207 |
| 509 | Ga0395900_0012275 | 3300037418 | Bacteria | 8761 |
| 510 | Ga0395900_0024425 | 3300037418 | Bacteria | 6189 |
| 511 | Ga0395898_0003844 | 3300037466 | Bacteria | 16633 |
| 512 | Ga0395898_0012955 | 3300037466 | Bacteria | 8600 |
| 513 | Ga0395898_0014318 | 3300037466 | Bacteria | 8150 |
| 514 | Ga0395898_0162647 | 3300037466 | Bacteria | 2135 |
| 515 | Ga0395898_0429792 | 3300037466 | Bacteria | 1258 |
| 516 | Ga0395898_0562909 | 3300037466 | Bacteria | 1082 |
| 517 | Ga0395905_0004692 | 3300037471 | Bacteria | 14127 |
| 518 | Ga0395905_0011736 | 3300037471 | Bacteria | 8458 |
| 519 | Ga0395905_0081711 | 3300037471 | Bacteria | 3028 |
| 520 | Ga0436364_0331749 | 3300037853 | Bacteria | 8159 |
| 521 | Ga0436364_0617202 | 3300037853 | Bacteria | 29703 |
| 522 | Ga0436364_0705467 | 3300037853 | Bacteria | 5245 |
| 523 | Ga0436364_0958477 | 3300037853 | Bacteria | 6661 |
| 524 | Ga0436364_1189251 | 3300037853 | Bacteria | 10996 |
| 525 | Ga0436364_1213465 | 3300037853 | Bacteria | 1956 |
| 526 | Ga0436364_1415383 | 3300037853 | Bacteria | 4997 |
| 527 | Ga0395901_0009109 | 3300038443 | Bacteria | 10051 |
| 528 | Ga0395901_0011771 | 3300038443 | Bacteria | 8870 |
| 529 | Ga0395901_0026133 | 3300038443 | Bacteria | 5994 |
| 530 | Ga0395901_0026974 | 3300038443 | Bacteria | 5898 |
| 531 | Ga0395901_0098132 | 3300038443 | Bacteria | 3071 |
| 532 | Ga0436365_0106957 | 3300039437 | Bacteria | 1729 |
| 533 | Ga0436365_0177810 | 3300039437 | Bacteria | 13192 |
| 534 | Ga0436365_0727969 | 3300039437 | Bacteria | 2185 |
| 535 | Ga0436365_0779249 | 3300039437 | Bacteria | 4472 |
| 536 | Ga0436365_0781116 | 3300039437 | Bacteria | 1018 |
| 537 | Ga0436365_1292969 | 3300039437 | Bacteria | 3583 |
| 538 | Ga0436361_0092386 | 3300039447 | Bacteria | 1669 |
| 539 | Ga0436363_0398706 | 3300039450 | Bacteria | 6825 |
| 540 | Ga0436363_0528757 | 3300039450 | Bacteria | 16264 |
| 541 | Ga0436363_0528901 | 3300039450 | Bacteria | 2112 |
| 542 | Ga0436363_1223536 | 3300039450 | Bacteria | 880 |
| 543 | Ga0436363_1314722 | 3300039450 | Bacteria | 1803 |
| 544 | Ga0436362_0088107 | 3300039453 | Bacteria | 1419 |
| 545 | Ga0436362_0380046 | 3300039453 | Bacteria | 1457 |
| 546 | Ga0451807_1436441 | 3300041486 | Bacteria | 1297 |
| 547 | Ga0451833_1325735 | 3300041491 | Bacteria | 1536 |
| 548 | Ga0451845_0642532 | 3300041501 | Bacteria | 1005 |
| 549 | Ga0451853_2790041 | 3300041512 | Bacteria | 2545 |
| 550 | Ga0439458_0074643 | 3300042157 | Bacteria | 860 |
| 551 | Ga0466965_0198578 | 3300044683 | Bacteria | 1063 |
| 552 | Ga0466963_0090760 | 3300044694 | Bacteria | 2080 |
| 553 | Ga0466964_0075157 | 3300044706 | Bacteria | 1438 |
| 554 | Ga0466964_0190264 | 3300044706 | Bacteria | 979 |
| 555 | Ga0466964_0264334 | 3300044706 | Bacteria | 854 |
| 556 | Ga0466970_0288267 | 3300044765 | Bacteria | 924 |
| 557 | Ga0466957_0140376 | 3300044842 | Bacteria | 1556 |
| 558 | Ga0466960_0233099 | 3300044901 | Bacteria | 1017 |
| 559 | Ga0466960_0311808 | 3300044901 | Bacteria | 889 |
| 560 | Ga0466959_0031637 | 3300045049 | Bacteria | 3915 |
| 561 | Ga0466959_0151467 | 3300045049 | Bacteria | 1635 |
| 562 | Ga0451576_1202442 | 3300045051 | Bacteria | 791 |
| 563 | Ga0466958_0003412 | 3300045836 | Bacteria | 8247 |
| 564 | Ga0466967_0000006 | 3300045976 | Bacteria | 144065 |
| 565 | Ga0466967_0025758 | 3300045976 | Bacteria | 4854 |
| 566 | Ga0466967_0033198 | 3300045976 | Bacteria | 4367 |
| 567 | Ga0466967_0098799 | 3300045976 | Bacteria | 2665 |
| 568 | Ga0466967_0203670 | 3300045976 | Bacteria | 1875 |
| 569 | Ga0466967_0223778 | 3300045976 | Bacteria | 1789 |
| 570 | Ga0466967_0254414 | 3300045976 | Bacteria | 1679 |
| 571 | Ga0466967_0383849 | 3300045976 | Bacteria | 1364 |
| 572 | Ga0495592_0178378 | 3300046454 | Bacteria | 1449 |
| 573 | Ga0495591_049615 | 3300046458 | Unclassified | 1153 |
| 574 | Ga0495629_0001657 | 3300046459 | Bacteria | 17477 |
| 575 | Ga0495629_0010304 | 3300046459 | Bacteria | 6809 |
| 576 | Ga0495629_0011760 | 3300046459 | Bacteria | 6351 |
| 577 | Ga0495641_0031754 | 3300046461 | Bacteria | 2520 |
| 578 | Ga0495639_0073971 | 3300046475 | Bacteria | 1578 |
| 579 | Ga0495662_0002954 | 3300046476 | Bacteria | 8583 |
| 580 | Ga0495664_0095723 | 3300046477 | Bacteria | 1787 |
| 581 | Ga0495594_0000006 | 3300046499 | Bacteria | 167901 |
| 582 | Ga0495594_0086134 | 3300046499 | Bacteria | 1758 |
| 583 | Ga0495596_0065218 | 3300046500 | Bacteria | 1416 |
| 584 | Ga0495606_0000463 | 3300046507 | Bacteria | 66752 |
| 585 | Ga0495608_0000007 | 3300046511 | Bacteria | 313495 |
| 586 | Ga0495628_0008170 | 3300046516 | Bacteria | 9000 |
| 587 | Ga0495630_0000060 | 3300046517 | Bacteria | 90021 |
| 588 | Ga0495630_0287435 | 3300046517 | Bacteria | 1256 |
| 589 | Ga0495631_0060419 | 3300046518 | Bacteria | 1644 |
| 590 | Ga0495631_0160828 | 3300046518 | Bacteria | 964 |
| 591 | Ga0495637_0150411 | 3300046520 | Bacteria | 878 |
| 592 | Ga0495644_0018492 | 3300046523 | Bacteria | 2663 |
| 593 | Ga0495652_0000010 | 3300046529 | Bacteria | 261584 |
| 594 | Ga0495640_0467464 | 3300046533 | Bacteria | 769 |
| 595 | Ga0495586_0006455 | 3300046535 | Bacteria | 6264 |
| 596 | Ga0495587_0008274 | 3300046536 | Bacteria | 6696 |
| 597 | Ga0495597_0139174 | 3300046542 | Unclassified | 1002 |
| 598 | Ga0495597_0225586 | 3300046542 | Bacteria | 743 |
| 599 | Ga0495622_0000297 | 3300046557 | Bacteria | 37460 |
| 600 | Ga0495656_0092300 | 3300046615 | Bacteria | 1386 |
| 601 | Ga0495656_0199672 | 3300046615 | Bacteria | 992 |
| 602 | Ga0495611_0023073 | 3300046648 | Bacteria | 2697 |
| 603 | Ga0495625_0000032 | 3300046660 | Bacteria | 233135 |
| 604 | Ga0495625_0136445 | 3300046660 | Bacteria | 1658 |
| 605 | Ga0495659_0100871 | 3300046664 | Bacteria | 1118 |
| 606 | Ga0495588_0001071 | 3300046674 | Bacteria | 11845 |
| 607 | Ga0495657_0000001 | 3300046675 | Bacteria | 445641 |
| 608 | Ga0495623_0093003 | 3300046679 | Bacteria | 1847 |
| 609 | Ga0495647_0000023 | 3300046681 | Bacteria | 67025 |
| 610 | Ga0495647_0000063 | 3300046681 | Bacteria | 26932 |
| 611 | Ga0495647_0149616 | 3300046681 | Unclassified | 1000 |
| 612 | Ga0495658_0005120 | 3300046683 | Bacteria | 6446 |
| 613 | Ga0495613_0000032 | 3300046689 | Bacteria | 139806 |
| 614 | Ga0495613_0237764 | 3300046689 | Bacteria | 1274 |
| 615 | Ga0495624_0000071 | 3300046690 | Bacteria | 65995 |
| 616 | Ga0495624_0000243 | 3300046690 | Bacteria | 42818 |
| 617 | Ga0495660_0126950 | 3300046810 | Bacteria | 1284 |
| 618 | Ga0495604_0000095 | 3300047317 | Bacteria | 75922 |
| 619 | Ga0495604_0001215 | 3300047317 | Bacteria | 21186 |
| 620 | Ga0495604_0056433 | 3300047317 | Bacteria | 3023 |
| 621 | Ga0495674_0000010 | 3300047319 | Bacteria | 285794 |
| 622 | Ga0495672_0050029 | 3300047320 | Bacteria | 2471 |
| 623 | Ga0495676_0005715 | 3300047321 | Bacteria | 11405 |
| 624 | Ga0495676_0014346 | 3300047321 | Bacteria | 7091 |
| 625 | Ga0495676_0147533 | 3300047321 | Bacteria | 1678 |
| 626 | Ga0495680_0000472 | 3300047322 | Bacteria | 45335 |
| 627 | Ga0495675_0000017 | 3300047444 | Bacteria | 123394 |
| 628 | Ga0495677_0122582 | 3300047445 | Bacteria | 992 |
| 629 | Ga0495673_0194890 | 3300047469 | Bacteria | 761 |
| 630 | Ga0495681_0184329 | 3300047470 | Bacteria | 856 |
| 631 | Ga0495686_0060036 | 3300047472 | Bacteria | 2365 |
| 632 | Ga0495593_0057792 | 3300047673 | Bacteria | 2036 |
| 633 | Ga0495602_0000007 | 3300048088 | Bacteria | 273212 |
| 634 | Ga0495602_0015818 | 3300048088 | Bacteria | 7599 |
| 635 | Ga0495602_0031280 | 3300048088 | Bacteria | 5035 |
| 636 | Ga0495614_0106317 | 3300048089 | Unclassified | 1230 |
| 637 | Ga0496100_0000001 | 3300048903 | Bacteria | 530179 |
| 638 | Ga0496101_0000004 | 3300048904 | Bacteria | 331599 |
| 639 | Ga0496101_0108039 | 3300048904 | Bacteria | 2091 |
| 640 | Ga0496101_0184445 | 3300048904 | Bacteria | 1608 |
| 641 | Ga0496101_0248782 | 3300048904 | Bacteria | 1385 |
| 642 | Ga0496102_0000374 | 3300048905 | Bacteria | 53726 |
| 643 | Ga0496102_0003605 | 3300048905 | Bacteria | 13112 |
| 644 | Ga0496102_0003858 | 3300048905 | Bacteria | 12693 |
| 645 | Ga0496102_0101042 | 3300048905 | Bacteria | 2679 |
| 646 | Ga0496102_0344079 | 3300048905 | Bacteria | 1404 |
| 647 | Ga0496103_0000057 | 3300048906 | Bacteria | 142223 |
| 648 | Ga0496103_0005375 | 3300048906 | Bacteria | 7673 |
| 649 | Ga0496103_0054987 | 3300048906 | Bacteria | 2468 |
| 650 | Ga0496103_0405480 | 3300048906 | Bacteria | 876 |
| 651 | Ga0496104_0000866 | 3300048907 | Bacteria | 26077 |
| 652 | Ga0496104_0102917 | 3300048907 | Bacteria | 2735 |
| 653 | Ga0496104_0247204 | 3300048907 | Bacteria | 1697 |
| 654 | Ga0496104_0379280 | 3300048907 | Bacteria | 1326 |
| 655 | Ga0496105_0000059 | 3300048908 | Bacteria | 86884 |
| 656 | Ga0496105_0014879 | 3300048908 | Bacteria | 6194 |
| 657 | Ga0496105_0025418 | 3300048908 | Bacteria | 4820 |
| 658 | Ga0496105_0034930 | 3300048908 | Bacteria | 4137 |
| 659 | Ga0496106_0000091 | 3300048909 | Bacteria | 71361 |
| 660 | Ga0496106_0003128 | 3300048909 | Bacteria | 12352 |
| 661 | Ga0496106_0007998 | 3300048909 | Bacteria | 7813 |
| 662 | Ga0496106_0106174 | 3300048909 | Bacteria | 2183 |
| 663 | Ga0496106_0157685 | 3300048909 | Bacteria | 1793 |
| 664 | Ga0496106_0193559 | 3300048909 | Bacteria | 1617 |
| 665 | Ga0496107_0000005 | 3300048910 | Bacteria | 281747 |
| 666 | Ga0496107_0001554 | 3300048910 | Bacteria | 14250 |
| 667 | Ga0496107_0040860 | 3300048910 | Bacteria | 3330 |
| 668 | Ga0496107_0145941 | 3300048910 | Bacteria | 1749 |
| 669 | Ga0496107_0326085 | 3300048910 | Bacteria | 1143 |
| 670 | Ga0496108_0000026 | 3300048911 | Bacteria | 172399 |
| 671 | Ga0496108_0021333 | 3300048911 | Bacteria | 5323 |
| 672 | Ga0496108_0044042 | 3300048911 | Bacteria | 3727 |
| 673 | Ga0496108_0052259 | 3300048911 | Bacteria | 3423 |
| 674 | Ga0496108_0227657 | 3300048911 | Bacteria | 1621 |
| 675 | Ga0496109_0000012 | 3300048912 | Bacteria | 229699 |
| 676 | Ga0496109_0000056 | 3300048912 | Bacteria | 120835 |
| 677 | Ga0496109_0019035 | 3300048912 | Bacteria | 6047 |
| 678 | Ga0496109_0043559 | 3300048912 | Bacteria | 4068 |
| 679 | Ga0496109_0163666 | 3300048912 | Bacteria | 2085 |
| 680 | Ga0496109_0442013 | 3300048912 | Bacteria | 1228 |
| 681 | Ga0496109_0700483 | 3300048912 | Bacteria | 950 |
| 682 | Ga0496109_0718779 | 3300048912 | Bacteria | 936 |
| 683 | Ga0496109_0847956 | 3300048912 | Bacteria | 852 |
| 684 | Ga0496110_0000750 | 3300048913 | Bacteria | 22419 |
| 685 | Ga0496110_0013308 | 3300048913 | Bacteria | 6797 |
| 686 | Ga0496110_0024241 | 3300048913 | Bacteria | 5168 |
| 687 | Ga0496110_0025888 | 3300048913 | Bacteria | 5016 |
| 688 | Ga0496110_0131774 | 3300048913 | Bacteria | 2258 |
| 689 | Ga0496110_0149637 | 3300048913 | Bacteria | 2113 |
| 690 | Ga0496110_0228312 | 3300048913 | Bacteria | 1693 |
| 691 | Ga0496110_0777962 | 3300048913 | Bacteria | 861 |
| 692 | Ga0496111_0000047 | 3300048914 | Bacteria | 47782 |
| 693 | Ga0496111_0014714 | 3300048914 | Bacteria | 5352 |
| 694 | Ga0496111_0021708 | 3300048914 | Bacteria | 4485 |
| 695 | Ga0496111_0085039 | 3300048914 | Bacteria | 2313 |
| 696 | Ga0496111_0340725 | 3300048914 | Bacteria | 1110 |
| 697 | Ga0496111_0573715 | 3300048914 | Bacteria | 827 |
| 698 | Ga0496112_0000566 | 3300048915 | Bacteria | 25425 |
| 699 | Ga0496112_0024418 | 3300048915 | Bacteria | 5787 |
| 700 | Ga0496112_0100424 | 3300048915 | Bacteria | 2863 |
| 701 | Ga0496112_0337198 | 3300048915 | Bacteria | 1451 |
| 702 | Ga0496112_0349553 | 3300048915 | Bacteria | 1421 |
| 703 | Ga0496112_0843915 | 3300048915 | Bacteria | 840 |
| 704 | Ga0496113_0000037 | 3300048916 | Bacteria | 56610 |
| 705 | Ga0496113_0043777 | 3300048916 | Bacteria | 3314 |
| 706 | Ga0496113_0119335 | 3300048916 | Bacteria | 2061 |
| 707 | Ga0496114_0000056 | 3300048917 | Bacteria | 95692 |
| 708 | Ga0496114_0002095 | 3300048917 | Bacteria | 15172 |
| 709 | Ga0496114_0012163 | 3300048917 | Bacteria | 6887 |
| 710 | Ga0496115_0000492 | 3300048918 | Bacteria | 31184 |
| 711 | Ga0496115_0000525 | 3300048918 | Bacteria | 29761 |
| 712 | Ga0496115_0026344 | 3300048918 | Bacteria | 4537 |
| 713 | Ga0496118_0003022 | 3300048921 | Bacteria | 21720 |
| 714 | Ga0496118_0094527 | 3300048921 | Bacteria | 2044 |
| 715 | Ga0496119_0029910 | 3300048922 | Bacteria | 3682 |
| 716 | Ga0496121_0012098 | 3300048924 | Bacteria | 9482 |
| 717 | Ga0496124_0246661 | 3300048927 | Bacteria | 1324 |
| 718 | Ga0496124_0349338 | 3300048927 | Bacteria | 1047 |
| 719 | Ga0496125_0235201 | 3300048928 | Bacteria | 1168 |
| 720 | Ga0501031_0000305 | 3300049568 | Bacteria | 28106 |
| 721 | Ga0501031_0013515 | 3300049568 | Bacteria | 5320 |
| 722 | Ga0501031_0016427 | 3300049568 | Bacteria | 4807 |
| 723 | Ga0501031_0142217 | 3300049568 | Bacteria | 1568 |
| 724 | Ga0501031_0230772 | 3300049568 | Bacteria | 1204 |
| 725 | Ga0501032_0000875 | 3300049569 | Bacteria | 24430 |
| 726 | Ga0501032_0002052 | 3300049569 | Bacteria | 15916 |
| 727 | Ga0501032_0088360 | 3300049569 | Bacteria | 2057 |
| 728 | Ga0501032_0200598 | 3300049569 | Bacteria | 1302 |
| 729 | Ga0501032_0227925 | 3300049569 | Bacteria | 1212 |
| 730 | Ga0501033_0000657 | 3300049570 | Bacteria | 31993 |
| 731 | Ga0501033_0000751 | 3300049570 | Bacteria | 29835 |
| 732 | Ga0501033_0076765 | 3300049570 | Bacteria | 2452 |
| 733 | Ga0501033_0125312 | 3300049570 | Bacteria | 1863 |
| 734 | Ga0501034_0002274 | 3300049571 | Bacteria | 23567 |
| 735 | Ga0501034_0004506 | 3300049571 | Bacteria | 15488 |
| 736 | Ga0501034_0013074 | 3300049571 | Bacteria | 8554 |
| 737 | Ga0501034_0018286 | 3300049571 | Bacteria | 7189 |
| 738 | Ga0501034_0036749 | 3300049571 | Bacteria | 4960 |
| 739 | Ga0501034_0102130 | 3300049571 | Bacteria | 2861 |
| 740 | Ga0501036_0001123 | 3300049572 | Bacteria | 20344 |
| 741 | Ga0501036_0004153 | 3300049572 | Bacteria | 11654 |
| 742 | Ga0501036_0050867 | 3300049572 | Bacteria | 3508 |
| 743 | Ga0501036_0067455 | 3300049572 | Bacteria | 3027 |
| 744 | Ga0501036_0277164 | 3300049572 | Bacteria | 1403 |
| 745 | Ga0501036_0315288 | 3300049572 | Bacteria | 1307 |
| 746 | Ga0501036_0451605 | 3300049572 | Bacteria | 1071 |
| 747 | Ga0501037_0000381 | 3300049573 | Bacteria | 36906 |
| 748 | Ga0501037_0001504 | 3300049573 | Bacteria | 17049 |
| 749 | Ga0501037_0009636 | 3300049573 | Bacteria | 7086 |
| 750 | Ga0501037_0178857 | 3300049573 | Bacteria | 1506 |
| 751 | Ga0501038_0000435 | 3300049574 | Bacteria | 36389 |
| 752 | Ga0501038_0001755 | 3300049574 | Bacteria | 20151 |
| 753 | Ga0501038_0029383 | 3300049574 | Bacteria | 4871 |
| 754 | Ga0501038_0037985 | 3300049574 | Bacteria | 4218 |
| 755 | Ga0501038_0163135 | 3300049574 | Bacteria | 1809 |
| 756 | Ga0501038_0175033 | 3300049574 | Bacteria | 1735 |
| 757 | Ga0501039_0002736 | 3300049575 | Bacteria | 13140 |
| 758 | Ga0501039_0018043 | 3300049575 | Bacteria | 5413 |
| 759 | Ga0501039_0027287 | 3300049575 | Bacteria | 4391 |
| 760 | Ga0501039_0079359 | 3300049575 | Bacteria | 2553 |
| 761 | Ga0501039_0113125 | 3300049575 | Bacteria | 2123 |
| 762 | Ga0501039_0159886 | 3300049575 | Bacteria | 1770 |
| 763 | Ga0501040_0000991 | 3300049576 | Bacteria | 17960 |
| 764 | Ga0501040_0002636 | 3300049576 | Bacteria | 11573 |
| 765 | Ga0501040_0021430 | 3300049576 | Bacteria | 4317 |
| 766 | Ga0501040_0030698 | 3300049576 | Bacteria | 3631 |
| 767 | Ga0501040_0051429 | 3300049576 | Bacteria | 2818 |
| 768 | Ga0501040_0203595 | 3300049576 | Bacteria | 1406 |
| 769 | Ga0501040_0217203 | 3300049576 | Bacteria | 1360 |
| 770 | Ga0501041_0000643 | 3300049577 | Bacteria | 18283 |
| 771 | Ga0501041_0003244 | 3300049577 | Bacteria | 9355 |
| 772 | Ga0501041_0036724 | 3300049577 | Bacteria | 2968 |
| 773 | Ga0501041_0056037 | 3300049577 | Bacteria | 2407 |
| 774 | Ga0501041_0100730 | 3300049577 | Bacteria | 1788 |
| 775 | Ga0501042_0000488 | 3300049578 | Bacteria | 20567 |
| 776 | Ga0501042_0089543 | 3300049578 | Bacteria | 2208 |
| 777 | Ga0501042_0096583 | 3300049578 | Bacteria | 2123 |
| 778 | Ga0501042_0210577 | 3300049578 | Bacteria | 1402 |
| 779 | Ga0501042_0237657 | 3300049578 | Bacteria | 1314 |
| 780 | Ga0501042_0256373 | 3300049578 | Bacteria | 1262 |
| 781 | Ga0501043_0000284 | 3300049579 | Bacteria | 45754 |
| 782 | Ga0501043_0001524 | 3300049579 | Bacteria | 20232 |
| 783 | Ga0501043_0056439 | 3300049579 | Bacteria | 3084 |
| 784 | Ga0501046_0000876 | 3300049580 | Bacteria | 29256 |
| 785 | Ga0501046_0005323 | 3300049580 | Bacteria | 11507 |
| 786 | Ga0501046_0008757 | 3300049580 | Bacteria | 8791 |
| 787 | Ga0501046_0078227 | 3300049580 | Bacteria | 2559 |
| 788 | Ga0501046_0403514 | 3300049580 | Bacteria | 987 |
| 789 | Ga0501047_0000733 | 3300049581 | Bacteria | 34156 |
| 790 | Ga0501047_0001290 | 3300049581 | Bacteria | 24727 |
| 791 | Ga0501047_0001383 | 3300049581 | Bacteria | 23822 |
| 792 | Ga0501047_0012283 | 3300049581 | Bacteria | 8106 |
| 793 | Ga0501047_0124523 | 3300049581 | Bacteria | 2458 |
| 794 | Ga0501048_0000668 | 3300049582 | Bacteria | 24832 |
| 795 | Ga0501048_0000728 | 3300049582 | Bacteria | 24116 |
| 796 | Ga0501048_0046367 | 3300049582 | Bacteria | 3103 |
| 797 | Ga0501048_0353181 | 3300049582 | Bacteria | 1048 |
| 798 | Ga0501067_0006751 | 3300049583 | Bacteria | 6366 |
| 799 | Ga0501067_0009628 | 3300049583 | Bacteria | 5351 |
| 800 | Ga0501068_0000266 | 3300049584 | Bacteria | 25796 |
| 801 | Ga0501068_0014453 | 3300049584 | Bacteria | 4513 |
| 802 | Ga0501068_0044585 | 3300049584 | Bacteria | 2670 |
| 803 | Ga0501068_0081924 | 3300049584 | Bacteria | 1981 |
| 804 | Ga0501068_0219618 | 3300049584 | Bacteria | 1208 |
| 805 | Ga0501068_0282557 | 3300049584 | Bacteria | 1061 |
| 806 | Ga0501069_0009662 | 3300049585 | Bacteria | 5097 |
| 807 | Ga0501069_0033038 | 3300049585 | Bacteria | 2848 |
| 808 | Ga0501069_0243303 | 3300049585 | Bacteria | 1048 |
| 809 | Ga0501070_0000368 | 3300049586 | Bacteria | 41043 |
| 810 | Ga0501070_0002030 | 3300049586 | Bacteria | 17801 |
| 811 | Ga0501070_0009917 | 3300049586 | Bacteria | 8052 |
| 812 | Ga0501070_0019884 | 3300049586 | Bacteria | 5631 |
| 813 | Ga0501070_0052227 | 3300049586 | Bacteria | 3392 |
| 814 | Ga0501070_0208776 | 3300049586 | Bacteria | 1603 |
| 815 | Ga0501071_0001154 | 3300049587 | Bacteria | 14791 |
| 816 | Ga0501071_0012325 | 3300049587 | Bacteria | 5796 |
| 817 | Ga0501071_0036984 | 3300049587 | Bacteria | 3483 |
| 818 | Ga0501071_0045602 | 3300049587 | Bacteria | 3147 |
| 819 | Ga0501071_0165006 | 3300049587 | Bacteria | 1657 |
| 820 | Ga0501071_0220811 | 3300049587 | Bacteria | 1426 |
| 821 | Ga0501071_0297073 | 3300049587 | Bacteria | 1224 |
| 822 | Ga0501071_0605959 | 3300049587 | Bacteria | 842 |
| 823 | Ga0501072_0009852 | 3300049588 | Bacteria | 7266 |
| 824 | Ga0501072_0075671 | 3300049588 | Bacteria | 2663 |
| 825 | Ga0501072_0081624 | 3300049588 | Bacteria | 2563 |
| 826 | Ga0501072_0189083 | 3300049588 | Bacteria | 1642 |
| 827 | Ga0501072_0268558 | 3300049588 | Bacteria | 1357 |
| 828 | Ga0501073_0001604 | 3300049589 | Bacteria | 16747 |
| 829 | Ga0501073_0031765 | 3300049589 | Bacteria | 3767 |
| 830 | Ga0501073_0059295 | 3300049589 | Bacteria | 2674 |
| 831 | Ga0501074_0004583 | 3300049590 | Bacteria | 9900 |
| 832 | Ga0501074_0019950 | 3300049590 | Bacteria | 4870 |
| 833 | Ga0501074_0028865 | 3300049590 | Bacteria | 4019 |
| 834 | Ga0501074_0041335 | 3300049590 | Bacteria | 3338 |
| 835 | Ga0501074_0191288 | 3300049590 | Bacteria | 1459 |
| 836 | Ga0501074_0404486 | 3300049590 | Bacteria | 968 |
| 837 | Ga0501075_0002103 | 3300049591 | Bacteria | 13176 |
| 838 | Ga0501075_0009065 | 3300049591 | Bacteria | 6947 |
| 839 | Ga0501075_0027547 | 3300049591 | Bacteria | 4189 |
| 840 | Ga0501075_0093561 | 3300049591 | Bacteria | 2282 |
| 841 | Ga0501075_0125864 | 3300049591 | Bacteria | 1951 |
| 842 | Ga0501075_0162339 | 3300049591 | Bacteria | 1705 |
| 843 | Ga0501075_0180714 | 3300049591 | Bacteria | 1609 |
| 844 | Ga0501075_0260907 | 3300049591 | Bacteria | 1321 |
| 845 | Ga0501075_0735057 | 3300049591 | Bacteria | 751 |
| 846 | Ga0501076_0002177 | 3300049592 | Bacteria | 13442 |
| 847 | Ga0501076_0009619 | 3300049592 | Bacteria | 7141 |
| 848 | Ga0501076_0042573 | 3300049592 | Bacteria | 3576 |
| 849 | Ga0501076_0067931 | 3300049592 | Bacteria | 2847 |
| 850 | Ga0501076_0217811 | 3300049592 | Bacteria | 1560 |
| 851 | Ga0501076_0231936 | 3300049592 | Bacteria | 1509 |
| 852 | Ga0501076_0363803 | 3300049592 | Bacteria | 1188 |
| 853 | Ga0501076_0496075 | 3300049592 | Unclassified | 1006 |
| 854 | Ga0501077_0000718 | 3300049593 | Bacteria | 20025 |
| 855 | Ga0501077_0008282 | 3300049593 | Bacteria | 6428 |
| 856 | Ga0501077_0092548 | 3300049593 | Bacteria | 1916 |
| 857 | Ga0501079_0001817 | 3300049741 | Bacteria | 15262 |
| 858 | Ga0501079_0010603 | 3300049741 | Bacteria | 7012 |
| 859 | Ga0501079_0016771 | 3300049741 | Bacteria | 5594 |
| 860 | Ga0501079_0034325 | 3300049741 | Bacteria | 3904 |
| 861 | Ga0501079_0137731 | 3300049741 | Bacteria | 1901 |
| 862 | Ga0501079_0280469 | 3300049741 | Bacteria | 1303 |
| 863 | Ga0501079_0493495 | 3300049741 | Bacteria | 962 |
| 864 | Ga0501080_0000450 | 3300049742 | Bacteria | 31992 |
| 865 | Ga0501080_0018997 | 3300049742 | Bacteria | 6365 |
| 866 | Ga0501080_0023737 | 3300049742 | Bacteria | 5682 |
| 867 | Ga0501080_0229180 | 3300049742 | Bacteria | 1698 |
| 868 | Ga0501080_0630404 | 3300049742 | Bacteria | 950 |
| 869 | Ga0501081_0000447 | 3300049743 | Bacteria | 22828 |
| 870 | Ga0501081_0001529 | 3300049743 | Bacteria | 14201 |
| 871 | Ga0501081_0018374 | 3300049743 | Bacteria | 4643 |
| 872 | Ga0501081_0024749 | 3300049743 | Bacteria | 4033 |
| 873 | Ga0501081_0039168 | 3300049743 | Bacteria | 3243 |
| 874 | Ga0501081_0039384 | 3300049743 | Bacteria | 3234 |
| 875 | Ga0501081_0120304 | 3300049743 | Bacteria | 1870 |
| 876 | Ga0501083_0000832 | 3300049744 | Bacteria | 20278 |
| 877 | Ga0501083_0001240 | 3300049744 | Bacteria | 17307 |
| 878 | Ga0501083_0022817 | 3300049744 | Bacteria | 4342 |
| 879 | Ga0501083_0029279 | 3300049744 | Bacteria | 3789 |
| 880 | Ga0501083_0051292 | 3300049744 | Bacteria | 2774 |
| 881 | Ga0501083_0344599 | 3300049744 | Bacteria | 969 |
| 882 | Ga0501035_0000224 | 3300049822 | Bacteria | 67316 |
| 883 | Ga0501035_0005550 | 3300049822 | Bacteria | 11917 |
| 884 | Ga0501035_0070141 | 3300049822 | Bacteria | 3105 |
| 885 | Ga0501035_0074161 | 3300049822 | Bacteria | 3011 |
| 886 | Ga0501035_0383589 | 3300049822 | Bacteria | 1172 |
| 887 | Ga0501035_0489223 | 3300049822 | Bacteria | 1014 |
| 888 | Ga0501044_0000542 | 3300049823 | Bacteria | 45924 |
| 889 | Ga0501044_0013996 | 3300049823 | Bacteria | 8666 |
| 890 | Ga0501044_0172182 | 3300049823 | Bacteria | 2135 |
| 891 | Ga0501044_0247732 | 3300049823 | Bacteria | 1724 |
| 892 | Ga0501045_0002012 | 3300049824 | Bacteria | 13738 |
| 893 | Ga0501045_0020000 | 3300049824 | Bacteria | 4779 |
| 894 | Ga0501045_0024162 | 3300049824 | Bacteria | 4362 |
| 895 | Ga0501045_0036078 | 3300049824 | Bacteria | 3590 |
| 896 | Ga0501045_0074710 | 3300049824 | Bacteria | 2496 |
| 897 | Ga0501045_0080708 | 3300049824 | Bacteria | 2398 |
| 898 | Ga0501045_0138183 | 3300049824 | Bacteria | 1812 |
| 899 | Ga0501045_0431468 | 3300049824 | Bacteria | 980 |
| 900 | Ga0501045_0536396 | 3300049824 | Bacteria | 868 |
| 901 | nmdc:mga03n38_116055_c1 | 3300050490 | Bacteria | 1310 |
| 902 | nmdc:mga03n38_3855_c1 | 3300050490 | Bacteria | 4877 |
| 903 | nmdc:mga03n38_77042_c1 | 3300050490 | Bacteria | 1557 |
| 904 | nmdc:mga03n38_90975_c1 | 3300050490 | Bacteria | 1453 |
| 905 | nmdc:mga00v17_119704_c1 | 3300050491 | Bacteria | 1675 |
| 906 | nmdc:mga00v17_156154_c1 | 3300050491 | Bacteria | 1467 |
| 907 | nmdc:mga00v17_4571_c1 | 3300050491 | Bacteria | 7212 |
| 908 | nmdc:mga00v17_4752_c1 | 3300050491 | Bacteria | 7105 |
| 909 | nmdc:mga00v17_540529_c1 | 3300050491 | Bacteria | 754 |
| 910 | nmdc:mga00v17_69415_c1 | 3300050491 | Bacteria | 2181 |
| 911 | nmdc:mga0yw44_127344_c1 | 3300050492 | Bacteria | 1646 |
| 912 | nmdc:mga0yw44_2099_c2 | 3300050492 | Bacteria | 7695 |
| 913 | nmdc:mga0yw44_246207_c1 | 3300050492 | Bacteria | 1189 |
| 914 | nmdc:mga0yw44_2545_c1 | 3300050492 | Bacteria | 7823 |
| 915 | nmdc:mga0yw44_303447_c1 | 3300050492 | Bacteria | 1070 |
| 916 | nmdc:mga0yw44_313270_c1 | 3300050492 | Bacteria | 1053 |
| 917 | nmdc:mga06z11_135914_c1 | 3300050494 | Bacteria | 1385 |
| 918 | nmdc:mga06z11_62113_c1 | 3300050494 | Bacteria | 1950 |
| 919 | nmdc:mga06z11_88050_c1 | 3300050494 | Bacteria | 1680 |
| 920 | nmdc:mga05p37_112994_c1 | 3300050507 | Bacteria | 3340 |
| 921 | nmdc:mga05p37_197008_c1 | 3300050507 | Bacteria | 2442 |
| 922 | nmdc:mga05p37_49034_c1 | 3300050507 | Bacteria | 5193 |
| 923 | nmdc:mga09592_20979_c1 | 3300050508 | Bacteria | 5379 |
| 924 | nmdc:mga0qj67_408917_c1 | 3300050509 | Bacteria | 1095 |
| 925 | nmdc:mga06r32_130309_c1 | 3300050510 | Bacteria | 2487 |
| 926 | nmdc:mga06r32_54388_c1 | 3300050510 | Bacteria | 3839 |
| 927 | nmdc:mga06r32_939857_c1 | 3300050510 | Bacteria | 819 |
| 928 | nmdc:mga08y16_112562_c1 | 3300050511 | Bacteria | 2833 |
| 929 | nmdc:mga08y16_192744_c1 | 3300050511 | Bacteria | 2113 |
| 930 | nmdc:mga08y16_21595_c1 | 3300050511 | Bacteria | 6797 |
| 931 | nmdc:mga08y16_26508_c1 | 3300050511 | Bacteria | 6109 |
| 932 | nmdc:mga08y16_44728_c1 | 3300050511 | Bacteria | 4640 |
| 933 | nmdc:mga08y16_456630_c1 | 3300050511 | Bacteria | 1302 |
| 934 | nmdc:mga08y16_650476_c1 | 3300050511 | Bacteria | 1058 |
| 935 | nmdc:mga08y16_795117_c1 | 3300050511 | Bacteria | 939 |
| 936 | nmdc:mga08y16_8266_c1 | 3300050511 | Bacteria | 10890 |
| 937 | nmdc:mga0n895_135688_c1 | 3300050512 | Bacteria | 2487 |
| 938 | nmdc:mga0n895_15654_c1 | 3300050512 | Bacteria | 6926 |
| 939 | nmdc:mga0n895_49392_c1 | 3300050512 | Bacteria | 4121 |
| 940 | nmdc:mga0rr50_169680_c1 | 3300050513 | Bacteria | 1777 |
| 941 | nmdc:mga0rr50_315438_c1 | 3300050513 | Bacteria | 1310 |
| 942 | nmdc:mga0rr50_906209_c1 | 3300050513 | Bacteria | 752 |
| 943 | nmdc:mga08x19_605138_c1 | 3300050514 | Bacteria | 777 |
| 944 | nmdc:mga0a205_226331_c1 | 3300050515 | Bacteria | 1755 |
| 945 | nmdc:mga0a205_34695_c1 | 3300050515 | Bacteria | 4841 |
| 946 | nmdc:mga0a205_502112_c1 | 3300050515 | Bacteria | 1070 |
| 947 | Ga0495601_0000099 | 3300053077 | Bacteria | 47704 |
| 948 | Ga0495601_0051336 | 3300053077 | Bacteria | 2603 |
| 949 | Ga0495601_0058587 | 3300053077 | Bacteria | 2441 |
| 950 | Ga0495601_0354245 | 3300053077 | Bacteria | 954 |
| 951 | Ga0495655_0000005 | 3300053083 | Bacteria | 257472 |
| 952 | Ga0495655_0014976 | 3300053083 | Bacteria | 1638 |
| 953 | Ga0495595_0000002 | 3300053084 | Bacteria | 445641 |
| 954 | Ga0495595_0004716 | 3300053084 | Bacteria | 5485 |
| 955 | Ga0495619_0000082 | 3300053085 | Bacteria | 71788 |
| 956 | Ga0495619_0000183 | 3300053085 | Bacteria | 46388 |
| 957 | Ga0500566_0122243 | 3300053094 | Bacteria | 1402 |
| 958 | Ga0500628_000001 | 3300053129 | Bacteria | 564074 |
| 959 | Ga0500616_0094135 | 3300053153 | Bacteria | 1477 |
| 960 | Ga0501084_0005829 | 3300054114 | Bacteria | 10139 |
| 961 | Ga0501084_0008367 | 3300054114 | Bacteria | 8541 |
| 962 | Ga0501084_0039649 | 3300054114 | Bacteria | 3939 |
| 963 | Ga0501084_0196102 | 3300054114 | Bacteria | 1704 |
| 964 | Ga0501084_0280800 | 3300054114 | Bacteria | 1406 |
| 965 | Ga0501084_0325952 | 3300054114 | Bacteria | 1297 |
| 966 | Ga0501084_0479418 | 3300054114 | Bacteria | 1051 |
| 967 | Ga0590075_030078 | 3300059424 | Bacteria | 1375 |
| 968 | Ga0501082_0005700 | 3300060353 | Bacteria | 10806 |
| 969 | Ga0501082_0009351 | 3300060353 | Bacteria | 8448 |
| 970 | Ga0501082_0022636 | 3300060353 | Bacteria | 5412 |
| 971 | Ga0501082_0045283 | 3300060353 | Bacteria | 3794 |
| 972 | Ga0501082_0065390 | 3300060353 | Bacteria | 3132 |
| 973 | Ga0501082_0112830 | 3300060353 | Bacteria | 2354 |
| 974 | Ga0501082_1011316 | 3300060353 | Bacteria | 727 |
| 975 | Ga0530510_0002903 | 3300061734 | Bacteria | 11747 |
| 976 | Ga0530510_0012875 | 3300061734 | Bacteria | 5881 |
| 977 | Ga0530510_0034536 | 3300061734 | Bacteria | 3644 |
| 978 | Ga0530510_0132113 | 3300061734 | Unclassified | 1837 |
| 979 | Ga0530510_0266378 | 3300061734 | Bacteria | 1278 |
| 980 | Ga0530510_0444044 | 3300061734 | Bacteria | 980 |
| 981 | Ga0530510_0754293 | 3300061734 | Bacteria | 742 |
| 982 | Ga0068856_100570634 | |||
| 983 | JGI25406J46586_10016690 | |||
| 984 | JGI25406J46586_10024118 | |||
| 985 | JGI25406J46586_10093582 | |||
| 986 | JGI25404J52841_10000683 | |||
| 987 | Ga0070676_10193080 | |||
| 988 | Ga0070683_100010350 | |||
| 989 | Ga0070683_100060010 | |||
| 990 | Ga0070683_100067114 | |||
| 991 | Ga0070683_100084877 | |||
| 992 | Ga0070683_100097989 | |||
| 993 | Ga0070683_100156344 | |||
| 994 | Ga0068869_100410381 | |||
| 995 | Ga0070666_10007128 | |||
| 996 | Ga0070666_10073982 | |||
| 997 | Ga0070680_100003170 | |||
| 998 | Ga0070682_100000011 | |||
| 999 | Ga0070682_100032630 | |||
| 1000 | Ga0070682_100415997 | |||
| 1001 | Ga0068868_100002102 | |||
| 1002 | Ga0068868_100047180 | |||
| 1003 | Ga0068868_100053845 | |||
| 1004 | Ga0070660_100003333 | |||
| 1005 | Ga0070660_100010096 | |||
| 1006 | Ga0070660_100090148 | |||
| 1007 | Ga0070660_100423437 | |||
| 1008 | Ga0070691_10001522 | |||
| 1009 | Ga0070691_10289807 | |||
| 1010 | Ga0070687_100008980 | |||
| 1011 | Ga0070687_100022504 | |||
| 1012 | Ga0070661_100000608 | |||
| 1013 | Ga0070661_100002581 | |||
| 1014 | Ga0070692_10019701 | |||
| 1015 | Ga0070692_10060242 | |||
| 1016 | Ga0070692_10070628 | |||
| 1017 | Ga0070692_10134513 | |||
| 1018 | Ga0070692_10392599 | |||
| 1019 | Ga0070668_100146141 | |||
| 1020 | Ga0070668_100358678 | |||
| 1021 | Ga0070668_100441202 | |||
| 1022 | Ga0070669_100029617 | |||
| 1023 | Ga0070669_100411270 | |||
| 1024 | Ga0070675_100456436 | |||
| 1025 | Ga0070674_100002829 | |||
| 1026 | Ga0070674_100118950 | |||
| 1027 | Ga0070674_100137602 | |||
| 1028 | Ga0070673_100327147 | |||
| 1029 | Ga0070688_100000412 | |||
| 1030 | Ga0070688_100006189 | |||
| 1031 | Ga0070659_100001553 | |||
| 1032 | Ga0070659_100005891 | |||
| 1033 | Ga0070659_100084199 | |||
| 1034 | Ga0070659_100465064 | |||
| 1035 | Ga0070667_100001123 | |||
| 1036 | Ga0070667_100027661 | |||
| 1037 | Ga0070667_100189425 | |||
| 1038 | Ga0070703_10101489 | |||
| 1039 | Ga0070714_100009599 | |||
| 1040 | Ga0070713_100000748 | |||
| 1041 | Ga0070710_10000003 | |||
| 1042 | Ga0070710_10018955 | |||
| 1043 | Ga0070701_10067133 | |||
| 1044 | Ga0070701_10170918 | |||
| 1045 | Ga0070711_100098467 | |||
| 1046 | Ga0070711_100233383 | |||
| 1047 | Ga0070700_100005606 | |||
| 1048 | Ga0070700_100700038 | |||
| 1049 | Ga0070694_100062560 | |||
| 1050 | Ga0070694_100114229 | |||
| 1051 | Ga0070708_100111260 | |||
| 1052 | Ga0070663_100003311 | |||
| 1053 | Ga0070663_100024789 | |||
| 1054 | Ga0070678_100015490 | |||
| 1055 | Ga0070662_100008116 | |||
| 1056 | Ga0070681_10295499 | |||
| 1057 | Ga0070681_10442066 | |||
| 1058 | Ga0068867_100034931 | |||
| 1059 | Ga0068867_100169983 | |||
| 1060 | Ga0068867_100192142 | |||
| 1061 | Ga0068867_100435461 | |||
| 1062 | Ga0070685_10000013 | |||
| 1063 | Ga0070685_10021496 | |||
| 1064 | Ga0070685_10038474 | |||
| 1065 | Ga0070699_100376540 | |||
| 1066 | Ga0070679_100001029 | |||
| 1067 | Ga0070679_100162619 | |||
| 1068 | Ga0070679_100554876 | |||
| 1069 | Ga0070684_100039175 | |||
| 1070 | Ga0070684_100054415 | |||
| 1071 | Ga0070684_100095814 | |||
| 1072 | Ga0070684_100155667 | |||
| 1073 | Ga0070684_100236213 | |||
| 1074 | Ga0070672_100000083 | |||
| 1075 | Ga0070672_100003260 | |||
| 1076 | Ga0070686_100067757 | |||
| 1077 | Ga0070695_100054567 | |||
| 1078 | Ga0070696_100120309 | |||
| 1079 | Ga0070693_100216811 | |||
| 1080 | Ga0070665_100002416 | |||
| 1081 | Ga0070665_100008538 | |||
| 1082 | Ga0070704_100140893 | |||
| 1083 | Ga0068855_100298342 | |||
| 1084 | Ga0068855_100965777 | |||
| 1085 | Ga0070664_100079691 | |||
| 1086 | Ga0070664_100380390 | |||
| 1087 | Ga0068857_100054614 | |||
| 1088 | Ga0068857_100288782 | |||
| 1089 | Ga0068854_100000363 | |||
| 1090 | Ga0068854_100009396 | |||
| 1091 | Ga0068854_100513687 | |||
| 1092 | Ga0068856_100000237 | |||
| 1093 | Ga0068856_100009300 | |||
| 1094 | Ga0068856_100239258 | |||
| 1095 | Ga0068856_100390401 | |||
| 1096 | Ga0070702_100181826 | |||
| 1097 | Ga0070702_100200104 | |||
| 1098 | Ga0068852_100000002 | |||
| 1099 | Ga0068852_100024619 | |||
| 1100 | Ga0068852_100040878 | |||
| 1101 | Ga0068852_100082269 | |||
| 1102 | Ga0068859_100157443 | |||
| 1103 | Ga0068864_100452702 | |||
| 1104 | Ga0068864_100663128 | |||
| 1105 | Ga0068861_100053123 | |||
| 1106 | Ga0068861_100620966 | |||
| 1107 | Ga0068870_10041499 | |||
| 1108 | Ga0068870_10491064 | |||
| 1109 | Ga0068863_100004075 | |||
| 1110 | Ga0068858_100395358 | |||
| 1111 | Ga0068860_100973465 | |||
| 1112 | Ga0068862_100005726 | |||
| 1113 | Ga0068862_100029993 | |||
| 1114 | Ga0081455_10017106 | |||
| 1115 | Ga0081455_10020169 | |||
| 1116 | Ga0081455_10031221 | |||
| 1117 | Ga0081455_10043484 | |||
| 1118 | Ga0081455_10043964 | |||
| 1119 | Ga0081455_10080638 | |||
| 1120 | Ga0081538_10003251 | |||
| 1121 | Ga0081538_10009166 | |||
| 1122 | Ga0081538_10062422 | |||
| 1123 | Ga0081540_1013620 | |||
| 1124 | Ga0081540_1079946 | |||
| 1125 | Ga0081539_10000030 | |||
| 1126 | Ga0081539_10002871 | |||
| 1127 | Ga0081539_10011497 | |||
| 1128 | Ga0081539_10014196 | |||
| 1129 | Ga0081539_10133858 | |||
| 1130 | Ga0070717_10180495 | |||
| 1131 | Ga0075365_10002720 | |||
| 1132 | Ga0075365_10102993 | |||
| 1133 | Ga0075365_10272462 | |||
| 1134 | Ga0075365_10285642 | |||
| 1135 | Ga0075363_100025789 | |||
| 1136 | Ga0075363_100032813 | |||
| 1137 | Ga0075363_100039390 | |||
| 1138 | Ga0075364_10030750 | |||
| 1139 | Ga0075364_10059882 | |||
| 1140 | Ga0075364_10131945 | |||
| 1141 | Ga0075364_10190214 | |||
| 1142 | Ga0070716_100235862 | |||
| 1143 | Ga0070712_100004387 | |||
| 1144 | Ga0070712_100006281 | |||
| 1145 | Ga0075367_10055292 | |||
| 1146 | Ga0075367_10094885 | |||
| 1147 | Ga0075367_10096803 | |||
| 1148 | Ga0075367_10287234 | |||
| 1149 | Ga0068871_100521572 | |||
| 1150 | Ga0075428_100011196 | |||
| 1151 | Ga0075428_100036234 | |||
| 1152 | Ga0075430_100138828 | |||
| 1153 | Ga0075430_100183724 | |||
| 1154 | Ga0075431_100027415 | |||
| 1155 | Ga0075431_100049326 | |||
| 1156 | Ga0075433_10491497 | |||
| 1157 | Ga0075434_100296759 | |||
| 1158 | Ga0075434_100336755 | |||
| 1159 | Ga0075434_100479837 | |||
| 1160 | Ga0075434_100590724 | |||
| 1161 | Ga0075429_100036300 | |||
| 1162 | Ga0075429_100792570 | |||
| 1163 | Ga0068865_100000134 | |||
| 1164 | Ga0068865_100083041 | |||
| 1165 | Ga0068865_100138818 | |||
| 1166 | Ga0068865_100291114 | |||
| 1167 | Ga0075436_100335548 | |||
| 1168 | Ga0097620_100157439 | |||
| 1169 | Ga0075435_100066716 | |||
| 1170 | Ga0075435_100298856 | |||
| 1171 | Ga0105240_10020705 | |||
| 1172 | Ga0105240_10119159 | |||
| 1173 | Ga0105240_10399294 | |||
| 1174 | Ga0111539_10035312 | |||
| 1175 | Ga0111539_10039780 | |||
| 1176 | Ga0111539_10065832 | |||
| 1177 | Ga0111539_10091834 | |||
| 1178 | Ga0111539_10331327 | |||
| 1179 | Ga0111539_10479169 | |||
| 1180 | Ga0105245_10000026 | |||
| 1181 | Ga0105245_10023658 | |||
| 1182 | Ga0105245_10065489 | |||
| 1183 | Ga0105245_10065662 | |||
| 1184 | Ga0105245_10088633 | |||
| 1185 | Ga0105245_10180055 | |||
| 1186 | Ga0105245_10414615 | |||
| 1187 | Ga0105247_10002124 | |||
| 1188 | Ga0114129_10035834 | |||
| 1189 | Ga0114129_10136554 | |||
| 1190 | Ga0114129_10244858 | |||
| 1191 | Ga0114129_10470282 | |||
| 1192 | Ga0114129_10938352 | |||
| 1193 | Ga0114129_10953063 | |||
| 1194 | Ga0105243_10036077 | |||
| 1195 | Ga0105243_10044052 | |||
| 1196 | Ga0105243_10053227 | |||
| 1197 | Ga0105243_10063528 | |||
| 1198 | Ga0105243_10193080 | |||
| 1199 | Ga0105243_10797589 | |||
| 1200 | Ga0105242_10000062 | |||
| 1201 | Ga0105248_10000020 | |||
| 1202 | Ga0105248_10068464 | |||
| 1203 | Ga0105248_10648336 | |||
| 1204 | Ga0105237_10133151 | |||
| 1205 | Ga0105238_10003730 | |||
| 1206 | Ga0105238_10202704 | |||
| 1207 | Ga0105238_10386673 | |||
| 1208 | Ga0105249_10019687 | |||
| 1209 | Ga0105249_10039393 | |||
| 1210 | Ga0105249_10094765 | |||
| 1211 | Ga0105249_10278589 | |||
| 1212 | Ga0105249_10324159 | |||
| 1213 | Ga0105249_10363740 | |||
| 1214 | Ga0105249_10492397 | |||
| 1215 | Ga0105249_10754560 | |||
| 1216 | Ga0105239_10063494 | |||
| 1217 | Ga0105239_10126200 | |||
| 1218 | Ga0105239_10211851 | |||
| 1219 | Ga0105239_10217936 | |||
| 1220 | Ga0105239_10259171 | |||
| 1221 | Ga0105246_10013066 | |||
| 1222 | Ga0105246_10027127 | |||
| 1223 | Ga0105246_10036801 | |||
| 1224 | Ga0105246_10089923 | |||
| 1225 | Ga0105246_10447001 | |||
| 1226 | Ga0157371_10023708 | |||
| 1227 | Ga0157371_10150083 | |||
| 1228 | Ga0157370_10003031 | |||
| 1229 | Ga0157370_10075806 | |||
| 1230 | Ga0157369_10000014 | |||
| 1231 | Ga0157369_10014378 | |||
| 1232 | Ga0157374_10198580 | |||
| 1233 | Ga0157374_10307421 | |||
| 1234 | Ga0157374_10482118 | |||
| 1235 | Ga0157378_10032991 | |||
| 1236 | Ga0163162_10235651 | |||
| 1237 | Ga0163162_10243962 | |||
| 1238 | Ga0163162_10558146 | |||
| 1239 | Ga0157372_10000060 | |||
| 1240 | Ga0157372_10031735 | |||
| 1241 | Ga0157372_10310252 | |||
| 1242 | Ga0157372_10777257 | |||
| 1243 | Ga0157375_10004333 | |||
| 1244 | Ga0157375_10048375 | |||
| 1245 | Ga0157375_10088796 | |||
| 1246 | Ga0157375_10488479 | |||
| 1247 | Ga0157375_11888349 | |||
| 1248 | Ga0157380_10000183 | |||
| 1249 | Ga0157380_10099609 | |||
| 1250 | Ga0157380_10652359 | |||
| 1251 | Ga0182008_10209451 | |||
| 1252 | Ga0157377_10005590 | |||
| 1253 | Ga0157377_10270228 | |||
| 1254 | Ga0157377_10311583 | |||
| 1255 | Ga0157379_10102525 | |||
| 1256 | Ga0157379_10174121 | |||
| 1257 | Ga0157379_10213520 | |||
| 1258 | Ga0157376_10496720 | |||
| 1259 | Ga0157376_10628719 | |||
| 1260 | Ga0197907_11014959 | |||
| 1261 | Ga0206356_10330832 | |||
| 1262 | Ga0206356_11279823 | |||
| 1263 | Ga0206355_1165500 | |||
| 1264 | Ga0206354_10766443 | |||
| 1265 | Ga0206353_10515505 | |||
| 1266 | Ga0154015_1536340 | |||
| 1267 | Ga0213874_10001218 | |||
| 1268 | Ga0213874_10006023 | |||
| 1269 | Ga0213876_10002937 | |||
| 1270 | Ga0213876_10012752 | |||
| 1271 | Ga0213876_10044855 | |||
| 1272 | Ga0213875_10006352 | |||
| 1273 | Ga0213875_10010871 | |||
| 1274 | Ga0213875_10093116 | |||
| 1275 | Ga0213875_10127422 | |||
| 1276 | Ga0213875_10261015 | |||
| 1277 | Ga0224712_10105634 | |||
| 1278 | Ga0207692_10000002 | |||
| 1279 | Ga0207692_10000008 | |||
| 1280 | Ga0207710_10000997 | |||
| 1281 | Ga0207710_10196573 | |||
| 1282 | Ga0207688_10003930 | |||
| 1283 | Ga0207688_10067922 | |||
| 1284 | Ga0207688_10088984 | |||
| 1285 | Ga0207680_10000567 | |||
| 1286 | Ga0207680_10003842 | |||
| 1287 | Ga0207647_10345716 | |||
| 1288 | Ga0207645_10134031 | |||
| 1289 | Ga0207643_10019743 | |||
| 1290 | Ga0207643_10026507 | |||
| 1291 | Ga0207643_10032911 | |||
| 1292 | Ga0207643_10315093 | |||
| 1293 | Ga0207705_10204821 | |||
| 1294 | Ga0207705_10261494 | |||
| 1295 | Ga0207705_10377641 | |||
| 1296 | Ga0207707_10062659 | |||
| 1297 | Ga0207707_10094369 | |||
| 1298 | Ga0207707_10266657 | |||
| 1299 | Ga0207695_10170501 | |||
| 1300 | Ga0207671_10256816 | |||
| 1301 | Ga0207693_10015036 | |||
| 1302 | Ga0207693_10044533 | |||
| 1303 | Ga0207663_10119552 | |||
| 1304 | Ga0207660_10010892 | |||
| 1305 | Ga0207662_10012720 | |||
| 1306 | Ga0207662_10047889 | |||
| 1307 | Ga0207662_10306115 | |||
| 1308 | Ga0207657_10000668 | |||
| 1309 | Ga0207657_10041139 | |||
| 1310 | Ga0207657_10202570 | |||
| 1311 | Ga0207649_10000003 | |||
| 1312 | Ga0207649_10010605 | |||
| 1313 | Ga0207649_10060286 | |||
| 1314 | Ga0207652_10000971 | |||
| 1315 | Ga0207652_10117953 | |||
| 1316 | Ga0207681_10004863 | |||
| 1317 | Ga0207681_10180178 | |||
| 1318 | Ga0207681_10238025 | |||
| 1319 | Ga0207694_10001456 | |||
| 1320 | Ga0207694_10247341 | |||
| 1321 | Ga0207694_10325029 | |||
| 1322 | Ga0207650_10691799 | |||
| 1323 | Ga0207659_10066313 | |||
| 1324 | Ga0207659_10566714 | |||
| 1325 | Ga0207687_10000017 | |||
| 1326 | Ga0207687_10041869 | |||
| 1327 | Ga0207687_10050055 | |||
| 1328 | Ga0207687_10684697 | |||
| 1329 | Ga0207700_10000003 | |||
| 1330 | Ga0207664_10002648 | |||
| 1331 | Ga0207664_10074670 | |||
| 1332 | Ga0207644_10366412 | |||
| 1333 | Ga0207690_10000095 | |||
| 1334 | Ga0207690_10012400 | |||
| 1335 | Ga0207690_10112309 | |||
| 1336 | Ga0207690_10255479 | |||
| 1337 | Ga0207690_10334941 | |||
| 1338 | Ga0207706_10053097 | |||
| 1339 | Ga0207706_10112105 | |||
| 1340 | Ga0207686_10000149 | |||
| 1341 | Ga0207686_10143772 | |||
| 1342 | Ga0207709_10023210 | |||
| 1343 | Ga0207709_10088516 | |||
| 1344 | Ga0207709_10263592 | |||
| 1345 | Ga0207709_10346259 | |||
| 1346 | Ga0207670_10010569 | |||
| 1347 | Ga0207670_10758582 | |||
| 1348 | Ga0207669_10028930 | |||
| 1349 | Ga0207669_10041930 | |||
| 1350 | Ga0207669_10046786 | |||
| 1351 | Ga0207704_10000110 | |||
| 1352 | Ga0207704_10044011 | |||
| 1353 | Ga0207704_10426021 | |||
| 1354 | Ga0207691_10000641 | |||
| 1355 | Ga0207691_10172129 | |||
| 1356 | Ga0207711_10000006 | |||
| 1357 | Ga0207711_10229765 | |||
| 1358 | Ga0207689_10009047 | |||
| 1359 | Ga0207689_10067484 | |||
| 1360 | Ga0207661_10000867 | |||
| 1361 | Ga0207661_10011021 | |||
| 1362 | Ga0207661_10019205 | |||
| 1363 | Ga0207661_10067998 | |||
| 1364 | Ga0207661_10130764 | |||
| 1365 | Ga0207661_10198737 | |||
| 1366 | Ga0207661_10243480 | |||
| 1367 | Ga0207661_10642485 | |||
| 1368 | Ga0207679_10125499 | |||
| 1369 | Ga0207651_10470913 | |||
| 1370 | Ga0207712_10001187 | |||
| 1371 | Ga0207712_10018821 | |||
| 1372 | Ga0207712_10194404 | |||
| 1373 | Ga0207712_10300160 | |||
| 1374 | Ga0207712_10520617 | |||
| 1375 | Ga0207668_10009378 | |||
| 1376 | Ga0207668_10048831 | |||
| 1377 | Ga0207668_10119288 | |||
| 1378 | Ga0207668_10201874 | |||
| 1379 | Ga0207668_10540061 | |||
| 1380 | Ga0207640_10000110 | |||
| 1381 | Ga0207640_10023834 | |||
| 1382 | Ga0207640_10305227 | |||
| 1383 | Ga0207658_10000724 | |||
| 1384 | Ga0207658_10025487 | |||
| 1385 | Ga0207658_10090085 | |||
| 1386 | Ga0207677_10000362 | |||
| 1387 | Ga0207677_10031402 | |||
| 1388 | Ga0207677_10067595 | |||
| 1389 | Ga0207677_10326065 | |||
| 1390 | Ga0207677_10606435 | |||
| 1391 | Ga0207703_10149392 | |||
| 1392 | Ga0207703_10150236 | |||
| 1393 | Ga0207703_10361804 | |||
| 1394 | Ga0207703_10774924 | |||
| 1395 | Ga0207678_10002999 | |||
| 1396 | Ga0207678_10182971 | |||
| 1397 | Ga0207708_10004323 | |||
| 1398 | Ga0207708_10031234 | |||
| 1399 | Ga0207708_10178134 | |||
| 1400 | Ga0207702_10000251 | |||
| 1401 | Ga0207702_10046903 | |||
| 1402 | Ga0207702_10442326 | |||
| 1403 | Ga0207641_10003132 | |||
| 1404 | Ga0207641_10038572 | |||
| 1405 | Ga0207641_10316849 | |||
| 1406 | Ga0207641_10599614 | |||
| 1407 | Ga0207648_10044759 | |||
| 1408 | Ga0207648_10081652 | |||
| 1409 | Ga0207648_10148797 | |||
| 1410 | Ga0207674_10064491 | |||
| 1411 | Ga0207674_10264070 | |||
| 1412 | Ga0207674_10313100 | |||
| 1413 | Ga0207674_10687739 | |||
| 1414 | Ga0207675_100057122 | |||
| 1415 | Ga0207675_100076567 | |||
| 1416 | Ga0207675_100195907 | |||
| 1417 | Ga0207675_100207229 | |||
| 1418 | Ga0207675_100856040 | |||
| 1419 | Ga0207683_10058242 | |||
| 1420 | Ga0207683_10085618 | |||
| 1421 | Ga0207683_10118927 | |||
| 1422 | Ga0207698_10000004 | |||
| 1423 | Ga0207698_10090631 | |||
| 1424 | Ga0207698_10146898 | |||
| 1425 | Ga0207698_10304093 | |||
| 1426 | Ga0207428_10022078 | |||
| 1427 | Ga0207428_10049564 | |||
| 1428 | Ga0207428_10102806 | |||
| 1429 | Ga0268266_10000160 | |||
| 1430 | Ga0268266_10002810 | |||
| 1431 | Ga0268266_10158222 | |||
| 1432 | Ga0268265_10004189 | |||
| 1433 | Ga0268264_10056529 | |||
| 1434 | Ga0265326_10000006 | |||
| 1435 | Ga0265326_10058601 | |||
| 1436 | Ga0265319_1000014 | |||
| 1437 | Ga0265319_1001476 | |||
| 1438 | Ga0265319_1001805 | |||
| 1439 | Ga0265319_1023191 | |||
| 1440 | Ga0265334_10000016 | |||
| 1441 | Ga0265318_10024305 | |||
| 1442 | Ga0265338_10000185 | |||
| 1443 | Ga0265338_10002259 | |||
| 1444 | Ga0265338_10035939 | |||
| 1445 | Ga0265324_10000857 | |||
| 1446 | Ga0265320_10010021 | |||
| 1447 | Ga0265325_10057017 | |||
| 1448 | Ga0307408_100347738 | |||
| 1449 | Ga0265313_10084083 | |||
| 1450 | Ga0316579_10165780 | |||
| 1451 | Ga0316578_10171970 | |||
| 1452 | Ga0316578_10220899 | |||
| 1453 | Ga0307405_10007980 | |||
| 1454 | Ga0307413_10349525 | |||
| 1455 | Ga0307410_10180602 | |||
| 1456 | Ga0307410_10260879 | |||
| 1457 | Ga0307406_10033031 | |||
| 1458 | Ga0307406_10064514 | |||
| 1459 | Ga0307406_10156998 | |||
| 1460 | Ga0307406_10233331 | |||
| 1461 | Ga0307409_100003708 | |||
| 1462 | Ga0307409_100079747 | |||
| 1463 | Ga0307409_100220688 | |||
| 1464 | Ga0307409_100419005 | |||
| 1465 | Ga0307416_100042078 | |||
| 1466 | Ga0307416_100074821 | |||
| 1467 | Ga0307416_100261964 | |||
| 1468 | Ga0307416_101165663 | |||
| 1469 | Ga0307414_10115450 | |||
| 1470 | Ga0307414_10299717 | |||
| 1471 | Ga0307414_10402485 | |||
| 1472 | Ga0307411_10374809 | |||
| 1473 | Ga0307415_100009154 | |||
| 1474 | Ga0307415_100083090 | |||
| 1475 | Ga0373952_0048671 | |||
| 1476 | Ga0316574_0034661 | |||
| 1477 | Ga0316574_0036845 | |||
| 1478 | Ga0316574_0239422 | |||
| 1479 | Ga0316574_0247639 | |||
| 1480 | Ga0316582_0237805 | |||
| 1481 | Ga0316582_0317589 | |||
| 1482 | Ga0316584_0011063 | |||
| 1483 | Ga0316584_0088967 | |||
| 1484 | Ga0316584_0409003 | |||
| 1485 | Ga0373925_0307904 | |||
| 1486 | Ga0395899_0025209 | |||
| 1487 | Ga0395899_0048562 | |||
| 1488 | Ga0395900_0005261 | |||
| 1489 | Ga0395900_0011100 | |||
| 1490 | Ga0395900_0012275 | |||
| 1491 | Ga0395900_0024425 | |||
| 1492 | Ga0395898_0003844 | |||
| 1493 | Ga0395898_0012955 | |||
| 1494 | Ga0395898_0014318 | |||
| 1495 | Ga0395898_0162647 | |||
| 1496 | Ga0395898_0429792 | |||
| 1497 | Ga0395898_0562909 | |||
| 1498 | Ga0395905_0004692 | |||
| 1499 | Ga0395905_0011736 | |||
| 1500 | Ga0395905_0081711 | |||
| 1501 | Ga0436364_0331749 | |||
| 1502 | Ga0436364_0617202 | |||
| 1503 | Ga0436364_0705467 | |||
| 1504 | Ga0436364_0958477 | |||
| 1505 | Ga0436364_1189251 | |||
| 1506 | Ga0436364_1213465 | |||
| 1507 | Ga0436364_1415383 | |||
| 1508 | Ga0395901_0009109 | |||
| 1509 | Ga0395901_0011771 | |||
| 1510 | Ga0395901_0026133 | |||
| 1511 | Ga0395901_0026974 | |||
| 1512 | Ga0395901_0098132 | |||
| 1513 | Ga0436365_0106957 | |||
| 1514 | Ga0436365_0177810 | |||
| 1515 | Ga0436365_0727969 | |||
| 1516 | Ga0436365_0779249 | |||
| 1517 | Ga0436365_0781116 | |||
| 1518 | Ga0436365_1292969 | |||
| 1519 | Ga0436361_0092386 | |||
| 1520 | Ga0436363_0398706 | |||
| 1521 | Ga0436363_0528757 | |||
| 1522 | Ga0436363_0528901 | |||
| 1523 | Ga0436363_1223536 | |||
| 1524 | Ga0436363_1314722 | |||
| 1525 | Ga0436362_0088107 | |||
| 1526 | Ga0436362_0380046 | |||
| 1527 | Ga0451807_1436441 | |||
| 1528 | Ga0451833_1325735 | |||
| 1529 | Ga0451845_0642532 | |||
| 1530 | Ga0451853_2790041 | |||
| 1531 | Ga0439458_0074643 | |||
| 1532 | Ga0466965_0198578 | |||
| 1533 | Ga0466963_0090760 | |||
| 1534 | Ga0466964_0075157 | |||
| 1535 | Ga0466964_0190264 | |||
| 1536 | Ga0466964_0264334 | |||
| 1537 | Ga0466970_0288267 | |||
| 1538 | Ga0466957_0140376 | |||
| 1539 | Ga0466960_0233099 | |||
| 1540 | Ga0466960_0311808 | |||
| 1541 | Ga0466959_0031637 | |||
| 1542 | Ga0466959_0151467 | |||
| 1543 | Ga0451576_1202442 | |||
| 1544 | Ga0466958_0003412 | |||
| 1545 | Ga0466967_0000006 | |||
| 1546 | Ga0466967_0025758 | |||
| 1547 | Ga0466967_0033198 | |||
| 1548 | Ga0466967_0098799 | |||
| 1549 | Ga0466967_0203670 | |||
| 1550 | Ga0466967_0223778 | |||
| 1551 | Ga0466967_0254414 | |||
| 1552 | Ga0466967_0383849 | |||
| 1553 | Ga0495592_0178378 | |||
| 1554 | Ga0495591_049615 | |||
| 1555 | Ga0495629_0001657 | |||
| 1556 | Ga0495629_0010304 | |||
| 1557 | Ga0495629_0011760 | |||
| 1558 | Ga0495641_0031754 | |||
| 1559 | Ga0495639_0073971 | |||
| 1560 | Ga0495662_0002954 | |||
| 1561 | Ga0495664_0095723 | |||
| 1562 | Ga0495594_0000006 | |||
| 1563 | Ga0495594_0086134 | |||
| 1564 | Ga0495596_0065218 | |||
| 1565 | Ga0495606_0000463 | |||
| 1566 | Ga0495608_0000007 | |||
| 1567 | Ga0495628_0008170 | |||
| 1568 | Ga0495630_0000060 | |||
| 1569 | Ga0495630_0287435 | |||
| 1570 | Ga0495631_0060419 | |||
| 1571 | Ga0495631_0160828 | |||
| 1572 | Ga0495637_0150411 | |||
| 1573 | Ga0495644_0018492 | |||
| 1574 | Ga0495652_0000010 | |||
| 1575 | Ga0495640_0467464 | |||
| 1576 | Ga0495586_0006455 | |||
| 1577 | Ga0495587_0008274 | |||
| 1578 | Ga0495597_0139174 | |||
| 1579 | Ga0495597_0225586 | |||
| 1580 | Ga0495622_0000297 | |||
| 1581 | Ga0495656_0092300 | |||
| 1582 | Ga0495656_0199672 | |||
| 1583 | Ga0495611_0023073 | |||
| 1584 | Ga0495625_0000032 | |||
| 1585 | Ga0495625_0136445 | |||
| 1586 | Ga0495659_0100871 | |||
| 1587 | Ga0495588_0001071 | |||
| 1588 | Ga0495657_0000001 | |||
| 1589 | Ga0495623_0093003 | |||
| 1590 | Ga0495647_0000023 | |||
| 1591 | Ga0495647_0000063 | |||
| 1592 | Ga0495647_0149616 | |||
| 1593 | Ga0495658_0005120 | |||
| 1594 | Ga0495613_0000032 | |||
| 1595 | Ga0495613_0237764 | |||
| 1596 | Ga0495624_0000071 | |||
| 1597 | Ga0495624_0000243 | |||
| 1598 | Ga0495660_0126950 | |||
| 1599 | Ga0495604_0000095 | |||
| 1600 | Ga0495604_0001215 | |||
| 1601 | Ga0495604_0056433 | |||
| 1602 | Ga0495674_0000010 | |||
| 1603 | Ga0495672_0050029 | |||
| 1604 | Ga0495676_0005715 | |||
| 1605 | Ga0495676_0014346 | |||
| 1606 | Ga0495676_0147533 | |||
| 1607 | Ga0495680_0000472 | |||
| 1608 | Ga0495675_0000017 | |||
| 1609 | Ga0495677_0122582 | |||
| 1610 | Ga0495673_0194890 | |||
| 1611 | Ga0495681_0184329 | |||
| 1612 | Ga0495686_0060036 | |||
| 1613 | Ga0495593_0057792 | |||
| 1614 | Ga0495602_0000007 | |||
| 1615 | Ga0495602_0015818 | |||
| 1616 | Ga0495602_0031280 | |||
| 1617 | Ga0495614_0106317 | |||
| 1618 | Ga0496100_0000001 | |||
| 1619 | Ga0496101_0000004 | |||
| 1620 | Ga0496101_0108039 | |||
| 1621 | Ga0496101_0184445 | |||
| 1622 | Ga0496101_0248782 | |||
| 1623 | Ga0496102_0000374 | |||
| 1624 | Ga0496102_0003605 | |||
| 1625 | Ga0496102_0003858 | |||
| 1626 | Ga0496102_0101042 | |||
| 1627 | Ga0496102_0344079 | |||
| 1628 | Ga0496103_0000057 | |||
| 1629 | Ga0496103_0005375 | |||
| 1630 | Ga0496103_0054987 | |||
| 1631 | Ga0496103_0405480 | |||
| 1632 | Ga0496104_0000866 | |||
| 1633 | Ga0496104_0102917 | |||
| 1634 | Ga0496104_0247204 | |||
| 1635 | Ga0496104_0379280 | |||
| 1636 | Ga0496105_0000059 | |||
| 1637 | Ga0496105_0014879 | |||
| 1638 | Ga0496105_0025418 | |||
| 1639 | Ga0496105_0034930 | |||
| 1640 | Ga0496106_0000091 | |||
| 1641 | Ga0496106_0003128 | |||
| 1642 | Ga0496106_0007998 | |||
| 1643 | Ga0496106_0106174 | |||
| 1644 | Ga0496106_0157685 | |||
| 1645 | Ga0496106_0193559 | |||
| 1646 | Ga0496107_0000005 | |||
| 1647 | Ga0496107_0001554 | |||
| 1648 | Ga0496107_0040860 | |||
| 1649 | Ga0496107_0145941 | |||
| 1650 | Ga0496107_0326085 | |||
| 1651 | Ga0496108_0000026 | |||
| 1652 | Ga0496108_0021333 | |||
| 1653 | Ga0496108_0044042 | |||
| 1654 | Ga0496108_0052259 | |||
| 1655 | Ga0496108_0227657 | |||
| 1656 | Ga0496109_0000012 | |||
| 1657 | Ga0496109_0000056 | |||
| 1658 | Ga0496109_0019035 | |||
| 1659 | Ga0496109_0043559 | |||
| 1660 | Ga0496109_0163666 | |||
| 1661 | Ga0496109_0442013 | |||
| 1662 | Ga0496109_0700483 | |||
| 1663 | Ga0496109_0718779 | |||
| 1664 | Ga0496109_0847956 | |||
| 1665 | Ga0496110_0000750 | |||
| 1666 | Ga0496110_0013308 | |||
| 1667 | Ga0496110_0024241 | |||
| 1668 | Ga0496110_0025888 | |||
| 1669 | Ga0496110_0131774 | |||
| 1670 | Ga0496110_0149637 | |||
| 1671 | Ga0496110_0228312 | |||
| 1672 | Ga0496110_0777962 | |||
| 1673 | Ga0496111_0000047 | |||
| 1674 | Ga0496111_0014714 | |||
| 1675 | Ga0496111_0021708 | |||
| 1676 | Ga0496111_0085039 | |||
| 1677 | Ga0496111_0340725 | |||
| 1678 | Ga0496111_0573715 | |||
| 1679 | Ga0496112_0000566 | |||
| 1680 | Ga0496112_0024418 | |||
| 1681 | Ga0496112_0100424 | |||
| 1682 | Ga0496112_0337198 | |||
| 1683 | Ga0496112_0349553 | |||
| 1684 | Ga0496112_0843915 | |||
| 1685 | Ga0496113_0000037 | |||
| 1686 | Ga0496113_0043777 | |||
| 1687 | Ga0496113_0119335 | |||
| 1688 | Ga0496114_0000056 | |||
| 1689 | Ga0496114_0002095 | |||
| 1690 | Ga0496114_0012163 | |||
| 1691 | Ga0496115_0000492 | |||
| 1692 | Ga0496115_0000525 | |||
| 1693 | Ga0496115_0026344 | |||
| 1694 | Ga0496118_0003022 | |||
| 1695 | Ga0496118_0094527 | |||
| 1696 | Ga0496119_0029910 | |||
| 1697 | Ga0496121_0012098 | |||
| 1698 | Ga0496124_0246661 | |||
| 1699 | Ga0496124_0349338 | |||
| 1700 | Ga0496125_0235201 | |||
| 1701 | Ga0501031_0000305 | |||
| 1702 | Ga0501031_0013515 | |||
| 1703 | Ga0501031_0016427 | |||
| 1704 | Ga0501031_0142217 | |||
| 1705 | Ga0501031_0230772 | |||
| 1706 | Ga0501032_0000875 | |||
| 1707 | Ga0501032_0002052 | |||
| 1708 | Ga0501032_0088360 | |||
| 1709 | Ga0501032_0200598 | |||
| 1710 | Ga0501032_0227925 | |||
| 1711 | Ga0501033_0000657 | |||
| 1712 | Ga0501033_0000751 | |||
| 1713 | Ga0501033_0076765 | |||
| 1714 | Ga0501033_0125312 | |||
| 1715 | Ga0501034_0002274 | |||
| 1716 | Ga0501034_0004506 | |||
| 1717 | Ga0501034_0013074 | |||
| 1718 | Ga0501034_0018286 | |||
| 1719 | Ga0501034_0036749 | |||
| 1720 | Ga0501034_0102130 | |||
| 1721 | Ga0501036_0001123 | |||
| 1722 | Ga0501036_0004153 | |||
| 1723 | Ga0501036_0050867 | |||
| 1724 | Ga0501036_0067455 | |||
| 1725 | Ga0501036_0277164 | |||
| 1726 | Ga0501036_0315288 | |||
| 1727 | Ga0501036_0451605 | |||
| 1728 | Ga0501037_0000381 | |||
| 1729 | Ga0501037_0001504 | |||
| 1730 | Ga0501037_0009636 | |||
| 1731 | Ga0501037_0178857 | |||
| 1732 | Ga0501038_0000435 | |||
| 1733 | Ga0501038_0001755 | |||
| 1734 | Ga0501038_0029383 | |||
| 1735 | Ga0501038_0037985 | |||
| 1736 | Ga0501038_0163135 | |||
| 1737 | Ga0501038_0175033 | |||
| 1738 | Ga0501039_0002736 | |||
| 1739 | Ga0501039_0018043 | |||
| 1740 | Ga0501039_0027287 | |||
| 1741 | Ga0501039_0079359 | |||
| 1742 | Ga0501039_0113125 | |||
| 1743 | Ga0501039_0159886 | |||
| 1744 | Ga0501040_0000991 | |||
| 1745 | Ga0501040_0002636 | |||
| 1746 | Ga0501040_0021430 | |||
| 1747 | Ga0501040_0030698 | |||
| 1748 | Ga0501040_0051429 | |||
| 1749 | Ga0501040_0203595 | |||
| 1750 | Ga0501040_0217203 | |||
| 1751 | Ga0501041_0000643 | |||
| 1752 | Ga0501041_0003244 | |||
| 1753 | Ga0501041_0036724 | |||
| 1754 | Ga0501041_0056037 | |||
| 1755 | Ga0501041_0100730 | |||
| 1756 | Ga0501042_0000488 | |||
| 1757 | Ga0501042_0089543 | |||
| 1758 | Ga0501042_0096583 | |||
| 1759 | Ga0501042_0210577 | |||
| 1760 | Ga0501042_0237657 | |||
| 1761 | Ga0501042_0256373 | |||
| 1762 | Ga0501043_0000284 | |||
| 1763 | Ga0501043_0001524 | |||
| 1764 | Ga0501043_0056439 | |||
| 1765 | Ga0501046_0000876 | |||
| 1766 | Ga0501046_0005323 | |||
| 1767 | Ga0501046_0008757 | |||
| 1768 | Ga0501046_0078227 | |||
| 1769 | Ga0501046_0403514 | |||
| 1770 | Ga0501047_0000733 | |||
| 1771 | Ga0501047_0001290 | |||
| 1772 | Ga0501047_0001383 | |||
| 1773 | Ga0501047_0012283 | |||
| 1774 | Ga0501047_0124523 | |||
| 1775 | Ga0501048_0000668 | |||
| 1776 | Ga0501048_0000728 | |||
| 1777 | Ga0501048_0046367 | |||
| 1778 | Ga0501048_0353181 | |||
| 1779 | Ga0501067_0006751 | |||
| 1780 | Ga0501067_0009628 | |||
| 1781 | Ga0501068_0000266 | |||
| 1782 | Ga0501068_0014453 | |||
| 1783 | Ga0501068_0044585 | |||
| 1784 | Ga0501068_0081924 | |||
| 1785 | Ga0501068_0219618 | |||
| 1786 | Ga0501068_0282557 | |||
| 1787 | Ga0501069_0009662 | |||
| 1788 | Ga0501069_0033038 | |||
| 1789 | Ga0501069_0243303 | |||
| 1790 | Ga0501070_0000368 | |||
| 1791 | Ga0501070_0002030 | |||
| 1792 | Ga0501070_0009917 | |||
| 1793 | Ga0501070_0019884 | |||
| 1794 | Ga0501070_0052227 | |||
| 1795 | Ga0501070_0208776 | |||
| 1796 | Ga0501071_0001154 | |||
| 1797 | Ga0501071_0012325 | |||
| 1798 | Ga0501071_0036984 | |||
| 1799 | Ga0501071_0045602 | |||
| 1800 | Ga0501071_0165006 | |||
| 1801 | Ga0501071_0220811 | |||
| 1802 | Ga0501071_0297073 | |||
| 1803 | Ga0501071_0605959 | |||
| 1804 | Ga0501072_0009852 | |||
| 1805 | Ga0501072_0075671 | |||
| 1806 | Ga0501072_0081624 | |||
| 1807 | Ga0501072_0189083 | |||
| 1808 | Ga0501072_0268558 | |||
| 1809 | Ga0501073_0001604 | |||
| 1810 | Ga0501073_0031765 | |||
| 1811 | Ga0501073_0059295 | |||
| 1812 | Ga0501074_0004583 | |||
| 1813 | Ga0501074_0019950 | |||
| 1814 | Ga0501074_0028865 | |||
| 1815 | Ga0501074_0041335 | |||
| 1816 | Ga0501074_0191288 | |||
| 1817 | Ga0501074_0404486 | |||
| 1818 | Ga0501075_0002103 | |||
| 1819 | Ga0501075_0009065 | |||
| 1820 | Ga0501075_0027547 | |||
| 1821 | Ga0501075_0093561 | |||
| 1822 | Ga0501075_0125864 | |||
| 1823 | Ga0501075_0162339 | |||
| 1824 | Ga0501075_0180714 | |||
| 1825 | Ga0501075_0260907 | |||
| 1826 | Ga0501075_0735057 | |||
| 1827 | Ga0501076_0002177 | |||
| 1828 | Ga0501076_0009619 | |||
| 1829 | Ga0501076_0042573 | |||
| 1830 | Ga0501076_0067931 | |||
| 1831 | Ga0501076_0217811 | |||
| 1832 | Ga0501076_0231936 | |||
| 1833 | Ga0501076_0363803 | |||
| 1834 | Ga0501076_0496075 | |||
| 1835 | Ga0501077_0000718 | |||
| 1836 | Ga0501077_0008282 | |||
| 1837 | Ga0501077_0092548 | |||
| 1838 | Ga0501079_0001817 | |||
| 1839 | Ga0501079_0010603 | |||
| 1840 | Ga0501079_0016771 | |||
| 1841 | Ga0501079_0034325 | |||
| 1842 | Ga0501079_0137731 | |||
| 1843 | Ga0501079_0280469 | |||
| 1844 | Ga0501079_0493495 | |||
| 1845 | Ga0501080_0000450 | |||
| 1846 | Ga0501080_0018997 | |||
| 1847 | Ga0501080_0023737 | |||
| 1848 | Ga0501080_0229180 | |||
| 1849 | Ga0501080_0630404 | |||
| 1850 | Ga0501081_0000447 | |||
| 1851 | Ga0501081_0001529 | |||
| 1852 | Ga0501081_0018374 | |||
| 1853 | Ga0501081_0024749 | |||
| 1854 | Ga0501081_0039168 | |||
| 1855 | Ga0501081_0039384 | |||
| 1856 | Ga0501081_0120304 | |||
| 1857 | Ga0501083_0000832 | |||
| 1858 | Ga0501083_0001240 | |||
| 1859 | Ga0501083_0022817 | |||
| 1860 | Ga0501083_0029279 | |||
| 1861 | Ga0501083_0051292 | |||
| 1862 | Ga0501083_0344599 | |||
| 1863 | Ga0501035_0000224 | |||
| 1864 | Ga0501035_0005550 | |||
| 1865 | Ga0501035_0070141 | |||
| 1866 | Ga0501035_0074161 | |||
| 1867 | Ga0501035_0383589 | |||
| 1868 | Ga0501035_0489223 | |||
| 1869 | Ga0501044_0000542 | |||
| 1870 | Ga0501044_0013996 | |||
| 1871 | Ga0501044_0172182 | |||
| 1872 | Ga0501044_0247732 | |||
| 1873 | Ga0501045_0002012 | |||
| 1874 | Ga0501045_0020000 | |||
| 1875 | Ga0501045_0024162 | |||
| 1876 | Ga0501045_0036078 | |||
| 1877 | Ga0501045_0074710 | |||
| 1878 | Ga0501045_0080708 | |||
| 1879 | Ga0501045_0138183 | |||
| 1880 | Ga0501045_0431468 | |||
| 1881 | Ga0501045_0536396 | |||
| 1882 | nmdc:mga03n38_116055_c1 | |||
| 1883 | nmdc:mga03n38_3855_c1 | |||
| 1884 | nmdc:mga03n38_77042_c1 | |||
| 1885 | nmdc:mga03n38_90975_c1 | |||
| 1886 | nmdc:mga00v17_119704_c1 | |||
| 1887 | nmdc:mga00v17_156154_c1 | |||
| 1888 | nmdc:mga00v17_4571_c1 | |||
| 1889 | nmdc:mga00v17_4752_c1 | |||
| 1890 | nmdc:mga00v17_540529_c1 | |||
| 1891 | nmdc:mga00v17_69415_c1 | |||
| 1892 | nmdc:mga0yw44_127344_c1 | |||
| 1893 | nmdc:mga0yw44_2099_c2 | |||
| 1894 | nmdc:mga0yw44_246207_c1 | |||
| 1895 | nmdc:mga0yw44_2545_c1 | |||
| 1896 | nmdc:mga0yw44_303447_c1 | |||
| 1897 | nmdc:mga0yw44_313270_c1 | |||
| 1898 | nmdc:mga06z11_135914_c1 | |||
| 1899 | nmdc:mga06z11_62113_c1 | |||
| 1900 | nmdc:mga06z11_88050_c1 | |||
| 1901 | nmdc:mga05p37_112994_c1 | |||
| 1902 | nmdc:mga05p37_197008_c1 | |||
| 1903 | nmdc:mga05p37_49034_c1 | |||
| 1904 | nmdc:mga09592_20979_c1 | |||
| 1905 | nmdc:mga0qj67_408917_c1 | |||
| 1906 | nmdc:mga06r32_130309_c1 | |||
| 1907 | nmdc:mga06r32_54388_c1 | |||
| 1908 | nmdc:mga06r32_939857_c1 | |||
| 1909 | nmdc:mga08y16_112562_c1 | |||
| 1910 | nmdc:mga08y16_192744_c1 | |||
| 1911 | nmdc:mga08y16_21595_c1 | |||
| 1912 | nmdc:mga08y16_26508_c1 | |||
| 1913 | nmdc:mga08y16_44728_c1 | |||
| 1914 | nmdc:mga08y16_456630_c1 | |||
| 1915 | nmdc:mga08y16_650476_c1 | |||
| 1916 | nmdc:mga08y16_795117_c1 | |||
| 1917 | nmdc:mga08y16_8266_c1 | |||
| 1918 | nmdc:mga0n895_135688_c1 | |||
| 1919 | nmdc:mga0n895_15654_c1 | |||
| 1920 | nmdc:mga0n895_49392_c1 | |||
| 1921 | nmdc:mga0rr50_169680_c1 | |||
| 1922 | nmdc:mga0rr50_315438_c1 | |||
| 1923 | nmdc:mga0rr50_906209_c1 | |||
| 1924 | nmdc:mga08x19_605138_c1 | |||
| 1925 | nmdc:mga0a205_226331_c1 | |||
| 1926 | nmdc:mga0a205_34695_c1 | |||
| 1927 | nmdc:mga0a205_502112_c1 | |||
| 1928 | Ga0495601_0000099 | |||
| 1929 | Ga0495601_0051336 | |||
| 1930 | Ga0495601_0058587 | |||
| 1931 | Ga0495601_0354245 | |||
| 1932 | Ga0495655_0000005 | |||
| 1933 | Ga0495655_0014976 | |||
| 1934 | Ga0495595_0000002 | |||
| 1935 | Ga0495595_0004716 | |||
| 1936 | Ga0495619_0000082 | |||
| 1937 | Ga0495619_0000183 | |||
| 1938 | Ga0500566_0122243 | |||
| 1939 | Ga0500628_000001 | |||
| 1940 | Ga0500616_0094135 | |||
| 1941 | Ga0501084_0005829 | |||
| 1942 | Ga0501084_0008367 | |||
| 1943 | Ga0501084_0039649 | |||
| 1944 | Ga0501084_0196102 | |||
| 1945 | Ga0501084_0280800 | |||
| 1946 | Ga0501084_0325952 | |||
| 1947 | Ga0501084_0479418 | |||
| 1948 | Ga0590075_030078 | |||
| 1949 | Ga0501082_0005700 | |||
| 1950 | Ga0501082_0009351 | |||
| 1951 | Ga0501082_0022636 | |||
| 1952 | Ga0501082_0045283 | |||
| 1953 | Ga0501082_0065390 | |||
| 1954 | Ga0501082_0112830 | |||
| 1955 | Ga0501082_1011316 | |||
| 1956 | Ga0530510_0002903 | |||
| 1957 | Ga0530510_0012875 | |||
| 1958 | Ga0530510_0034536 | |||
| 1959 | Ga0530510_0132113 | |||
| 1960 | Ga0530510_0266378 | |||
| 1961 | Ga0530510_0444044 | |||
| 1962 | Ga0530510_0754293 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3nkl-assembly1.cif.gz_A | crystal structure of udp-d-quinovosamine 4-dehydrogenase from vibrio fischeri | 0.868 | 92 | 182 |
| 2nu7-assembly1.cif.gz_A | c123as mutant of e. coli succinyl-coa synthetase | 0.8178 | 91 | 183 |
| 2nua-assembly1.cif.gz_A | c123av mutant of e. coli succinyl-coa synthetase | 0.8176 | 91 | 190 |
| 2nu8-assembly1.cif.gz_A | c123at mutant of e. coli succinyl-coa synthetase | 0.8149 | 91 | 190 |
| 2yv1-assembly1.cif.gz_A | crystal structure of succinyl-coa synthetase alpha chain from methanocaldococcus jannaschii dsm 2661 | 0.8133 | 90 | 183 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5zz6C01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9433 | 14 | 83 | 1.10.10.10 |
| 1xcbG01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9139 | 16 | 84 | 1.10.10.10 |
| 1r72G01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9087 | 16 | 84 | 1.10.10.10 |
| 1xcbF01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9087 | 15 | 84 | 1.10.10.10 |
| 5zz6C01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9046 | 14 | 83 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6G3WQR0-F1-model_v4 | Redox-sensing transcriptional repressor Rex | 0.9637 | 92 | 199 |
GO:0003677
GO:0005737 GO:0045892 GO:0051775 |
| AF-A0A6G3WQR0-F1-model_v4 | Redox-sensing transcriptional repressor Rex | 0.8769 | 92 | 199 |
GO:0003677
GO:0005737 GO:0045892 GO:0051775 |
| AF-A0A2W6BA31-F1-model_v4 | Redox-sensing transcriptional repressor Rex | 0.8713 | 96 | 214 |
GO:0003677
GO:0005737 GO:0045892 GO:0051775 |
| AF-A0A7C1VTW9-F1-model_v4 | Redox-sensing transcriptional repressor Rex | 0.8663 | 93 | 213 |
GO:0003677
GO:0005737 GO:0045892 GO:0051775 |
| AF-A0A6J4KCR0-F1-model_v4 | Redox-sensing transcriptional repressor Rex | 0.8611 | 92 | 214 |
GO:0003677
GO:0005737 GO:0045892 GO:0051775 |