F487396

General Info

Members Datasets Scaffolds Average Seq Length
981 396 1962 360

Family's Representative Sequence

Representative Sequence 3300036712|Ga0316584_0051912|Ga0316584_0051912_381_1607
Length 408
Sequence MSMPRTFTQDPPVASVAQSSTTPRPDARGAFRRTLDSISDAISLTDPYTVPTRHWHRLEDGRLQCDACPRACKLREGQRGVCFVRGRIDDQVVLTSYGRSSGYCIDPIEKKPLNHFLPGTSVLSFGTAGCNLACRFCQNWDISKSKEVDRLADAAPPDGIASAALELGCASVAFTYNDPVIFVEYAVDTALACRDVGVRTVAVSAGYATDATRRELYSAVDAANIDLKGFTEDFYRHVAMGQLEPVLDTLRYIRHETDTWLEITTLLIPGMNDGDEELHELATWIRTELGPDVPLHFSAFHPDYKMRDVPPTPPATLTRARRIALDEGLQHVYTGNVHDREGDTTTCTECGTAVIERDWYELKGWHLTGDGRCRSCGAPLSGVFDGPPGEWGAKRVPVELRTGKARRR

Samples

Sample ID Description Type Environment
1 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
115 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
116 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
174 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
175 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
176 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
183 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
184 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
185 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
186 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
187 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
188 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
189 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
190 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
191 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
192 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
193 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
194 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
195 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
196 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
197 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
198 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
199 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
200 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
201 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
202 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
203 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
204 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
205 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
206 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
207 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
208 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
209 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
210 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
211 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
212 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
213 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
214 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
215 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
216 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
217 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
218 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
219 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
220 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
221 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
222 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
224 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
230 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
231 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
232 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
233 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
234 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
235 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
236 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
237 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
238 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
239 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
240 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
241 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
242 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
243 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
245 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
246 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
247 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
248 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
249 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
250 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
251 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
252 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
253 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
254 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
255 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
256 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
257 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
258 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
259 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
260 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
261 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
262 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
263 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
264 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
265 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
266 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
267 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
268 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
269 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
270 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
271 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
272 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
273 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
274 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
275 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
276 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
277 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
278 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
279 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
280 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
281 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
282 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
283 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
284 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
285 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
286 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
287 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
288 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
289 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
290 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
291 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
292 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
293 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
294 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
295 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
296 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
297 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
298 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
299 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
300 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
301 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
302 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
303 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
304 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
305 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
306 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
307 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
308 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
309 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
310 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
311 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
312 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
313 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
314 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
315 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
316 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
317 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
318 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
319 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
320 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
321 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
322 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
338 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
339 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
340 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
341 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
342 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
343 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
344 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
345 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
346 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
347 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
348 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
349 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
350 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
351 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
352 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
353 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
356 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
357 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
358 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
359 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
360 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
361 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
362 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
363 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
364 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
365 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
366 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
367 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
368 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
369 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
370 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
371 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
372 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
373 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
374 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
375 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
376 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
377 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
378 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
379 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
380 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
381 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
382 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
383 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
384 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
385 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
386 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
387 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
388 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
389 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
390 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
391 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
392 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
393 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
394 639633007 Azoarcus olearius BH72 Isolate Unclassified
395 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
396 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.74
Metatranscriptomes 1.94
Isolates 1.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.98
Nodule 0.31
Rhizoplane 3.16
Rhizosphere 89.4
Stem 0
Stem Tuber 0
Unclassified 0.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316584_0051912 3300036712 Bacteria 3067
2 JGI24737J22298_10045099 3300001990 Bacteria 1347
3 Ga0065704_10023400 3300005289 Bacteria 1292
4 Ga0070658_10197034 3300005327 Bacteria 1698
5 Ga0070690_100003762 3300005330 Bacteria 8357
6 Ga0070690_100016631 3300005330 Bacteria 4410
7 Ga0070670_100000906 3300005331 Bacteria 23327
8 Ga0070670_100103701 3300005331 Bacteria 2450
9 Ga0068869_100019821 3300005334 Bacteria 4604
10 Ga0070666_10012915 3300005335 Bacteria 5283
11 Ga0070666_10015924 3300005335 Bacteria 4803
12 Ga0070666_10059296 3300005335 Bacteria 2589
13 Ga0070666_10167900 3300005335 Bacteria 1536
14 Ga0070680_100050702 3300005336 Bacteria 3386
15 Ga0070682_100208499 3300005337 Bacteria 1383
16 Ga0068868_100005274 3300005338 Bacteria 9076
17 Ga0068868_100008755 3300005338 Bacteria 7248
18 Ga0068868_100037456 3300005338 Bacteria 3760
19 Ga0068868_100259904 3300005338 Bacteria 1464
20 Ga0070689_100018529 3300005340 Bacteria 5131
21 Ga0070689_100035455 3300005340 Bacteria 3812
22 Ga0070689_100114910 3300005340 Bacteria 2145
23 Ga0070687_100059885 3300005343 Bacteria 2007
24 Ga0070661_100038443 3300005344 Bacteria 3484
25 Ga0070668_100026038 3300005347 Bacteria 4435
26 Ga0070668_100102974 3300005347 Bacteria 2264
27 Ga0070675_100022870 3300005354 Bacteria 4994
28 Ga0070675_100088001 3300005354 Bacteria 2598
29 Ga0070675_100116322 3300005354 Bacteria 2268
30 Ga0070671_100004118 3300005355 Bacteria 11479
31 Ga0070671_100051657 3300005355 Bacteria 3419
32 Ga0070674_100025779 3300005356 Bacteria 3831
33 Ga0070673_100001712 3300005364 Bacteria 13029
34 Ga0070673_100003842 3300005364 Bacteria 9429
35 Ga0070673_100009342 3300005364 Bacteria 6578
36 Ga0070673_100379440 3300005364 Bacteria 1260
37 Ga0070688_100077108 3300005365 Bacteria 2146
38 Ga0070688_100200257 3300005365 Bacteria 1397
39 Ga0070667_100006711 3300005367 Bacteria 9563
40 Ga0070667_100035568 3300005367 Bacteria 4173
41 Ga0070667_100058417 3300005367 Bacteria 3261
42 Ga0070667_100071936 3300005367 Bacteria 2946
43 Ga0070709_10008556 3300005434 Bacteria 5626
44 Ga0070714_100033710 3300005435 Bacteria 4283
45 Ga0070713_100072739 3300005436 Bacteria 2908
46 Ga0070713_100352038 3300005436 Bacteria 1367
47 Ga0070710_10010324 3300005437 Bacteria 4585
48 Ga0070701_10038979 3300005438 Bacteria 2408
49 Ga0070711_100030051 3300005439 Bacteria 3593
50 Ga0070711_100170391 3300005439 Bacteria 1659
51 Ga0070705_100042851 3300005440 Bacteria 2590
52 Ga0070705_100233589 3300005440 Bacteria 1281
53 Ga0070694_100069093 3300005444 Bacteria 2429
54 Ga0070708_100140108 3300005445 Bacteria 2242
55 Ga0070708_100236149 3300005445 Bacteria 1716
56 Ga0070678_100008843 3300005456 Bacteria 6059
57 Ga0070678_100124015 3300005456 Bacteria 2042
58 Ga0070678_100358334 3300005456 Bacteria 1256
59 Ga0070706_100001257 3300005467 Bacteria 27123
60 Ga0070706_100002535 3300005467 Bacteria 18359
61 Ga0070706_100081595 3300005467 Bacteria 2995
62 Ga0070706_100145555 3300005467 Bacteria 2213
63 Ga0070707_100000894 3300005468 Bacteria 29609
64 Ga0070707_100085014 3300005468 Bacteria 3057
65 Ga0070698_100000184 3300005471 Bacteria 59150
66 Ga0070698_100004413 3300005471 Bacteria 15458
67 Ga0070698_100052734 3300005471 Bacteria 4136
68 Ga0070698_100082635 3300005471 Bacteria 3204
69 Ga0070698_100150048 3300005471 Bacteria 2279
70 Ga0070699_100003946 3300005518 Bacteria 13108
71 Ga0070699_100056021 3300005518 Bacteria 3413
72 Ga0070699_100064086 3300005518 Bacteria 3188
73 Ga0070679_100059313 3300005530 Bacteria 3814
74 Ga0070684_100001343 3300005535 Bacteria 17625
75 Ga0070684_100017800 3300005535 Bacteria 5839
76 Ga0070697_100005132 3300005536 Bacteria 10054
77 Ga0070697_100005266 3300005536 Bacteria 9930
78 Ga0068853_100040312 3300005539 Bacteria 3984
79 Ga0070672_100015346 3300005543 Bacteria 5453
80 Ga0070672_100037176 3300005543 Bacteria 3713
81 Ga0070672_100266043 3300005543 Bacteria 1447
82 Ga0070686_100044824 3300005544 Bacteria 2783
83 Ga0070696_100122438 3300005546 Bacteria 1884
84 Ga0070696_100127814 3300005546 Bacteria 1846
85 Ga0070693_100130154 3300005547 Bacteria 1572
86 Ga0070665_100018756 3300005548 Bacteria 6936
87 Ga0070665_100200703 3300005548 Bacteria 1995
88 Ga0070704_100041606 3300005549 Bacteria 3173
89 Ga0068855_100180773 3300005563 Bacteria 2384
90 Ga0068855_100341268 3300005563 Bacteria 1651
91 Ga0070664_100009003 3300005564 Bacteria 8098
92 Ga0070664_100071054 3300005564 Bacteria 2982
93 Ga0068857_100060931 3300005577 Bacteria 3352
94 Ga0068857_100182360 3300005577 Bacteria 1910
95 Ga0068854_100000811 3300005578 Bacteria 18633
96 Ga0068856_100002001 3300005614 Bacteria 21258
97 Ga0068852_100059006 3300005616 Bacteria 3326
98 Ga0068852_100169442 3300005616 Bacteria 2046
99 Ga0068852_100296397 3300005616 Bacteria 1564
100 Ga0068859_100009071 3300005617 Bacteria 10045
101 Ga0068859_100026232 3300005617 Bacteria 5843
102 Ga0068859_100031928 3300005617 Bacteria 5290
103 Ga0068859_100037140 3300005617 Bacteria 4889
104 Ga0068864_100000454 3300005618 Bacteria 35430
105 Ga0068864_100007705 3300005618 Bacteria 8868
106 Ga0068864_100027866 3300005618 Bacteria 4774
107 Ga0068864_100094021 3300005618 Bacteria 2649
108 Ga0068864_100097581 3300005618 Bacteria 2602
109 Ga0068864_100147429 3300005618 Bacteria 2129
110 Ga0068866_10005950 3300005718 Bacteria 5072
111 Ga0068861_100000999 3300005719 Bacteria 17236
112 Ga0068851_10097773 3300005834 Bacteria 1554
113 Ga0068863_100006585 3300005841 Bacteria 11398
114 Ga0068863_100015249 3300005841 Bacteria 7386
115 Ga0068863_100017884 3300005841 Bacteria 6783
116 Ga0068863_100022286 3300005841 Bacteria 6047
117 Ga0068863_100035396 3300005841 Bacteria 4756
118 Ga0068863_100058924 3300005841 Bacteria 3633
119 Ga0068863_100133724 3300005841 Bacteria 2369
120 Ga0068863_100195689 3300005841 Bacteria 1943
121 Ga0068858_100006836 3300005842 Bacteria 11094
122 Ga0068858_100016977 3300005842 Bacteria 6834
123 Ga0068858_100024873 3300005842 Bacteria 5575
124 Ga0068858_100069538 3300005842 Bacteria 3264
125 Ga0068858_100143421 3300005842 Bacteria 2243
126 Ga0068858_100201339 3300005842 Bacteria 1883
127 Ga0068860_100034823 3300005843 Bacteria 4831
128 Ga0068860_100043091 3300005843 Bacteria 4307
129 Ga0068860_100058487 3300005843 Bacteria 3664
130 Ga0068862_100005314 3300005844 Bacteria 10787
131 Ga0081455_10003202 3300005937 Bacteria 18959
132 Ga0081540_1048859 3300005983 Bacteria 2115
133 Ga0081539_10008545 3300005985 Bacteria 8867
134 Ga0075363_100121062 3300006048 Bacteria 1462
135 Ga0075364_10019238 3300006051 Bacteria 4284
136 Ga0075364_10070891 3300006051 Bacteria 2295
137 Ga0075364_10088545 3300006051 Bacteria 2053
138 Ga0070715_10009397 3300006163 Bacteria 3445
139 Ga0070716_100013161 3300006173 Bacteria 4212
140 Ga0070716_100038886 3300006173 Bacteria 2637
141 Ga0070716_100079043 3300006173 Bacteria 1958
142 Ga0070712_100012125 3300006175 Bacteria 5477
143 Ga0070712_100025793 3300006175 Bacteria 3910
144 Ga0070712_100048686 3300006175 Bacteria 2939
145 Ga0070712_100104622 3300006175 Bacteria 2101
146 Ga0075362_10007555 3300006177 Bacteria 4123
147 Ga0075362_10086060 3300006177 Bacteria 1454
148 Ga0075367_10003884 3300006178 Bacteria 7204
149 Ga0075367_10039449 3300006178 Bacteria 2753
150 Ga0075369_10004717 3300006186 Bacteria 5057
151 Ga0075369_10006202 3300006186 Bacteria 4515
152 Ga0075369_10006503 3300006186 Bacteria 4418
153 Ga0075366_10014391 3300006195 Bacteria 4517
154 Ga0075366_10084976 3300006195 Bacteria 1892
155 Ga0097621_100046220 3300006237 Bacteria 3521
156 Ga0097621_100068809 3300006237 Bacteria 2921
157 Ga0097621_100287769 3300006237 Bacteria 1448
158 Ga0075370_10000095 3300006353 Bacteria 27417
159 Ga0075370_10000217 3300006353 Bacteria 20447
160 Ga0075370_10059631 3300006353 Bacteria 2172
161 Ga0068871_100027149 3300006358 Bacteria 4474
162 Ga0068871_100070561 3300006358 Bacteria 2871
163 Ga0075428_100006684 3300006844 Bacteria 12828
164 Ga0075428_100006866 3300006844 Bacteria 12647
165 Ga0075430_100001621 3300006846 Bacteria 18391
166 Ga0075430_100034817 3300006846 Bacteria 4275
167 Ga0075430_100036653 3300006846 Bacteria 4158
168 Ga0075430_100051641 3300006846 Bacteria 3465
169 Ga0075430_100060607 3300006846 Bacteria 3180
170 Ga0075430_100124382 3300006846 Bacteria 2150
171 Ga0075431_100001412 3300006847 Bacteria 22043
172 Ga0075431_100004791 3300006847 Bacteria 13309
173 Ga0075431_100012454 3300006847 Bacteria 8585
174 Ga0075431_100022895 3300006847 Bacteria 6387
175 Ga0075431_100036103 3300006847 Bacteria 5091
176 Ga0075431_100044859 3300006847 Bacteria 4559
177 Ga0075433_10279863 3300006852 Bacteria 1478
178 Ga0075434_100000169 3300006871 Bacteria 41864
179 Ga0075434_100154873 3300006871 Bacteria 2311
180 Ga0075434_100292146 3300006871 Bacteria 1650
181 Ga0075429_100003183 3300006880 Bacteria 13955
182 Ga0075429_100011021 3300006880 Bacteria 7822
183 Ga0075429_100021021 3300006880 Bacteria 5662
184 Ga0075429_100021207 3300006880 Bacteria 5633
185 Ga0075429_100055692 3300006880 Bacteria 3441
186 Ga0075429_100262313 3300006880 Bacteria 1513
187 Ga0075436_100001151 3300006914 Bacteria 17888
188 Ga0075436_100005331 3300006914 Bacteria 8843
189 Ga0075436_100017896 3300006914 Bacteria 4852
190 Ga0075436_100128363 3300006914 Bacteria 1777
191 Ga0097620_100009071 3300006931 Bacteria 10045
192 Ga0097620_100026232 3300006931 Bacteria 5843
193 Ga0097620_100031930 3300006931 Bacteria 5290
194 Ga0097620_100037141 3300006931 Bacteria 4889
195 Ga0075435_100047868 3300007076 Bacteria 3433
196 Ga0075435_100084665 3300007076 Bacteria 2609
197 Ga0075435_100107345 3300007076 Bacteria 2319
198 Ga0075435_100123978 3300007076 Bacteria 2158
199 Ga0099794_10047087 3300007265 Bacteria 2067
200 Ga0105240_10005185 3300009093 Bacteria 19495
201 Ga0105240_10072097 3300009093 Bacteria 4270
202 Ga0111539_10004683 3300009094 Bacteria 17879
203 Ga0111539_10007501 3300009094 Bacteria 13961
204 Ga0111539_10026978 3300009094 Bacteria 7016
205 Ga0111539_10061639 3300009094 Bacteria 4443
206 Ga0111539_10189021 3300009094 Bacteria 2404
207 Ga0114129_10002520 3300009147 Bacteria 25430
208 Ga0114129_10011944 3300009147 Bacteria 12350
209 Ga0114129_10101509 3300009147 Bacteria 3980
210 Ga0114129_10218778 3300009147 Bacteria 2571
211 Ga0114129_10689061 3300009147 Bacteria 1314
212 Ga0105243_10049333 3300009148 Bacteria 3321
213 Ga0105243_10150858 3300009148 Bacteria 1994
214 Ga0105241_10030868 3300009174 Bacteria 4008
215 Ga0105241_10170098 3300009174 Bacteria 1799
216 Ga0105242_10000556 3300009176 Bacteria 29534
217 Ga0105242_10013676 3300009176 Bacteria 6277
218 Ga0105242_10032170 3300009176 Bacteria 4193
219 Ga0105242_10429715 3300009176 Bacteria 1240
220 Ga0105248_10004265 3300009177 Bacteria 15822
221 Ga0105248_10021930 3300009177 Bacteria 7078
222 Ga0105248_10057746 3300009177 Bacteria 4356
223 Ga0105237_10067738 3300009545 Bacteria 3564
224 Ga0105238_10109045 3300009551 Bacteria 2750
225 Ga0105238_10150330 3300009551 Bacteria 2304
226 Ga0105238_10323716 3300009551 Bacteria 1528
227 Ga0105249_10032592 3300009553 Bacteria 4715
228 Ga0105249_10268067 3300009553 Bacteria 1700
229 Ga0105249_10318352 3300009553 Bacteria 1566
230 Ga0099796_10004563 3300010159 Bacteria 3368
231 Ga0105239_10068834 3300010375 Bacteria 3890
232 Ga0105246_10031036 3300011119 Bacteria 3534
233 Ga0157371_10053128 3300013102 Bacteria 2877
234 Ga0157369_10004712 3300013105 Bacteria 16035
235 Ga0157369_10081506 3300013105 Bacteria 3463
236 Ga0157374_10080020 3300013296 Bacteria 3098
237 Ga0157374_10193419 3300013296 Bacteria 1990
238 Ga0157378_10045534 3300013297 Bacteria 3898
239 Ga0163162_10070559 3300013306 Bacteria 3545
240 Ga0163162_10070988 3300013306 Bacteria 3535
241 Ga0163162_10079555 3300013306 Bacteria 3344
242 Ga0157372_10078996 3300013307 Bacteria 3719
243 Ga0157375_10013194 3300013308 Bacteria 7346
244 Ga0157375_10059690 3300013308 Bacteria 3780
245 Ga0157375_10201206 3300013308 Bacteria 2148
246 Ga0157375_10701421 3300013308 Bacteria 1166
247 Ga0163163_10003827 3300014325 Bacteria 12814
248 Ga0163163_10005343 3300014325 Bacteria 11091
249 Ga0163163_10027044 3300014325 Bacteria 5490
250 Ga0163163_10053206 3300014325 Bacteria 3996
251 Ga0157380_10036512 3300014326 Bacteria 3802
252 Ga0182008_10124102 3300014497 Bacteria 1285
253 Ga0157379_10019806 3300014968 Bacteria 5947
254 Ga0157379_10050438 3300014968 Bacteria 3715
255 Ga0157376_10008551 3300014969 Bacteria 7394
256 Ga0157376_10086833 3300014969 Bacteria 2698
257 Ga0157376_10155165 3300014969 Bacteria 2069
258 Ga0163161_10012730 3300017792 Bacteria 5843
259 Ga0206356_10062693 3300020070 Bacteria 3078
260 Ga0206354_10232206 3300020081 Bacteria 1507
261 Ga0213872_10003092 3300021361 Bacteria 9370
262 Ga0213872_10006459 3300021361 Bacteria 5875
263 Ga0213872_10010099 3300021361 Bacteria 4502
264 Ga0213872_10031585 3300021361 Bacteria 2427
265 Ga0213875_10053763 3300021388 Bacteria 1886
266 Ga0224712_10034708 3300022467 Bacteria 1857
267 Ga0209051_1007653 3300025303 Bacteria 5872
268 Ga0207697_10093198 3300025315 Bacteria 1278
269 Ga0207656_10017568 3300025321 Bacteria 2804
270 Ga0207692_10000821 3300025898 Bacteria 11129
271 Ga0207642_10022428 3300025899 Bacteria 2504
272 Ga0207710_10067668 3300025900 Bacteria 1632
273 Ga0207680_10034895 3300025903 Bacteria 2882
274 Ga0207680_10061511 3300025903 Bacteria 2290
275 Ga0207647_10017480 3300025904 Bacteria 4875
276 Ga0207699_10000151 3300025906 Bacteria 44631
277 Ga0207699_10011935 3300025906 Bacteria 4404
278 Ga0207699_10131904 3300025906 Bacteria 1631
279 Ga0207645_10001558 3300025907 Bacteria 18754
280 Ga0207645_10083453 3300025907 Bacteria 2049
281 Ga0207643_10018803 3300025908 Bacteria 3784
282 Ga0207705_10030469 3300025909 Bacteria 3850
283 Ga0207705_10168879 3300025909 Bacteria 1646
284 Ga0207684_10000134 3300025910 Bacteria 133720
285 Ga0207684_10000153 3300025910 Bacteria 120731
286 Ga0207684_10005110 3300025910 Bacteria 12227
287 Ga0207684_10025168 3300025910 Bacteria 5073
288 Ga0207684_10060147 3300025910 Bacteria 3227
289 Ga0207684_10133160 3300025910 Bacteria 2134
290 Ga0207684_10163487 3300025910 Bacteria 1917
291 Ga0207695_10003421 3300025913 Bacteria 22392
292 Ga0207671_10087941 3300025914 Bacteria 2337
293 Ga0207693_10000339 3300025915 Bacteria 43073
294 Ga0207693_10005268 3300025915 Bacteria 10817
295 Ga0207693_10008424 3300025915 Bacteria 8435
296 Ga0207693_10077500 3300025915 Bacteria 2603
297 Ga0207693_10102696 3300025915 Bacteria 2242
298 Ga0207663_10008722 3300025916 Bacteria 5323
299 Ga0207649_10135705 3300025920 Bacteria 1677
300 Ga0207652_10037227 3300025921 Bacteria 4118
301 Ga0207652_10055534 3300025921 Bacteria 3407
302 Ga0207646_10031090 3300025922 Bacteria 4835
303 Ga0207646_10046974 3300025922 Bacteria 3873
304 Ga0207646_10210693 3300025922 Bacteria 1755
305 Ga0207646_10263531 3300025922 Bacteria 1557
306 Ga0207646_10274886 3300025922 Bacteria 1522
307 Ga0207681_10032686 3300025923 Bacteria 3407
308 Ga0207694_10084709 3300025924 Bacteria 2493
309 Ga0207650_10009835 3300025925 Bacteria 6543
310 Ga0207650_10164840 3300025925 Bacteria 1758
311 Ga0207659_10009066 3300025926 Bacteria 6207
312 Ga0207659_10033180 3300025926 Bacteria 3551
313 Ga0207659_10063037 3300025926 Bacteria 2678
314 Ga0207659_10068924 3300025926 Bacteria 2574
315 Ga0207659_10128564 3300025926 Bacteria 1952
316 Ga0207700_10036243 3300025928 Bacteria 3560
317 Ga0207700_10207154 3300025928 Bacteria 1656
318 Ga0207664_10030030 3300025929 Bacteria 4148
319 Ga0207644_10002988 3300025931 Bacteria 10877
320 Ga0207644_10118587 3300025931 Bacteria 2011
321 Ga0207644_10167608 3300025931 Bacteria 1712
322 Ga0207706_10059836 3300025933 Bacteria 3354
323 Ga0207686_10012098 3300025934 Bacteria 4741
324 Ga0207686_10070681 3300025934 Bacteria 2244
325 Ga0207709_10001097 3300025935 Bacteria 19856
326 Ga0207709_10082455 3300025935 Bacteria 2077
327 Ga0207670_10033137 3300025936 Bacteria 3327
328 Ga0207669_10022364 3300025937 Bacteria 3358
329 Ga0207669_10028685 3300025937 Bacteria 3065
330 Ga0207704_10017772 3300025938 Bacteria 3696
331 Ga0207704_10022467 3300025938 Bacteria 3380
332 Ga0207704_10248962 3300025938 Bacteria 1333
333 Ga0207665_10025087 3300025939 Bacteria 3932
334 Ga0207665_10039861 3300025939 Bacteria 3133
335 Ga0207665_10075120 3300025939 Bacteria 2314
336 Ga0207691_10003386 3300025940 Bacteria 15512
337 Ga0207691_10033473 3300025940 Bacteria 4784
338 Ga0207691_10050596 3300025940 Bacteria 3803
339 Ga0207691_10164614 3300025940 Bacteria 1944
340 Ga0207711_10022199 3300025941 Bacteria 5307
341 Ga0207711_10042672 3300025941 Bacteria 3865
342 Ga0207711_10046873 3300025941 Bacteria 3693
343 Ga0207689_10005582 3300025942 Bacteria 11215
344 Ga0207689_10108736 3300025942 Bacteria 2278
345 Ga0207661_10003175 3300025944 Bacteria 11398
346 Ga0207661_10022528 3300025944 Bacteria 4746
347 Ga0207667_10040008 3300025949 Bacteria 4992
348 Ga0207651_10245389 3300025960 Bacteria 1462
349 Ga0207712_10004066 3300025961 Bacteria 9233
350 Ga0207712_10058347 3300025961 Bacteria 2727
351 Ga0207712_10256241 3300025961 Bacteria 1417
352 Ga0207668_10038600 3300025972 Bacteria 3207
353 Ga0207668_10075469 3300025972 Bacteria 2424
354 Ga0207668_10196507 3300025972 Bacteria 1603
355 Ga0207640_10042307 3300025981 Bacteria 2904
356 Ga0207658_10016527 3300025986 Bacteria 5077
357 Ga0207658_10047951 3300025986 Bacteria 3129
358 Ga0207658_10069955 3300025986 Bacteria 2654
359 Ga0207677_10019840 3300026023 Bacteria 4069
360 Ga0207677_10114545 3300026023 Bacteria 2015
361 Ga0207703_10002940 3300026035 Bacteria 14483
362 Ga0207703_10007109 3300026035 Bacteria 8907
363 Ga0207703_10017641 3300026035 Bacteria 5572
364 Ga0207703_10031865 3300026035 Bacteria 4171
365 Ga0207703_10086518 3300026035 Bacteria 2626
366 Ga0207703_10210043 3300026035 Bacteria 1735
367 Ga0207639_10130399 3300026041 Bacteria 2080
368 Ga0207678_10145263 3300026067 Bacteria 2025
369 Ga0207708_10176533 3300026075 Bacteria 1694
370 Ga0207708_10182595 3300026075 Bacteria 1666
371 Ga0207702_10004539 3300026078 Bacteria 12304
372 Ga0207702_10006429 3300026078 Bacteria 10137
373 Ga0207702_10292486 3300026078 Bacteria 1544
374 Ga0207641_10009773 3300026088 Bacteria 7897
375 Ga0207641_10028713 3300026088 Bacteria 4598
376 Ga0207641_10112973 3300026088 Bacteria 2411
377 Ga0207641_10117525 3300026088 Bacteria 2368
378 Ga0207641_10168231 3300026088 Bacteria 1998
379 Ga0207641_10264418 3300026088 Bacteria 1612
380 Ga0207641_10279328 3300026088 Bacteria 1570
381 Ga0207641_10418787 3300026088 Bacteria 1289
382 Ga0207676_10002093 3300026095 Bacteria 14451
383 Ga0207676_10016118 3300026095 Bacteria 5406
384 Ga0207676_10252730 3300026095 Bacteria 1587
385 Ga0207676_10312085 3300026095 Bacteria 1440
386 Ga0207674_10081080 3300026116 Bacteria 3247
387 Ga0207674_10094112 3300026116 Bacteria 2983
388 Ga0207674_10299291 3300026116 Bacteria 1558
389 Ga0207674_10510885 3300026116 Bacteria 1161
390 Ga0207675_100120783 3300026118 Bacteria 2479
391 Ga0207675_100206696 3300026118 Bacteria 1887
392 Ga0207675_100263509 3300026118 Bacteria 1671
393 Ga0207683_10008362 3300026121 Bacteria 8848
394 Ga0207683_10077444 3300026121 Bacteria 2945
395 Ga0207683_10086582 3300026121 Bacteria 2785
396 Ga0207683_10140919 3300026121 Bacteria 2173
397 Ga0207683_10349453 3300026121 Bacteria 1357
398 Ga0207698_10050739 3300026142 Bacteria 3167
399 Ga0207698_10289916 3300026142 Bacteria 1518
400 Ga0207698_10330060 3300026142 Bacteria 1432
401 Ga0209389_1000009 3300027296 Bacteria 226873
402 Ga0209489_100050 3300027361 Bacteria 154669
403 Ga0209700_100016 3300027363 Bacteria 252567
404 Ga0209588_1017423 3300027671 Bacteria 2227
405 Ga0209971_1014086 3300027682 Bacteria 1895
406 Ga0207428_10003201 3300027907 Bacteria 16012
407 Ga0207428_10007187 3300027907 Bacteria 10183
408 Ga0268266_10003141 3300028379 Bacteria 16781
409 Ga0268266_10268139 3300028379 Bacteria 1584
410 Ga0268265_10322968 3300028380 Bacteria 1399
411 Ga0268264_10020456 3300028381 Bacteria 5407
412 Ga0268264_10049630 3300028381 Bacteria 3492
413 Ga0268264_10123801 3300028381 Bacteria 2282
414 Ga0268264_10133742 3300028381 Bacteria 2202
415 Ga0268264_10198865 3300028381 Bacteria 1832
416 Ga0265326_10001417 3300028558 Bacteria 8438
417 Ga0265319_1020910 3300028563 Bacteria 2413
418 Ga0265334_10002860 3300028573 Bacteria 7923
419 Ga0265318_10001480 3300028577 Bacteria 13734
420 Ga0265323_10001736 3300028653 Bacteria 10343
421 Ga0265323_10003438 3300028653 Bacteria 6992
422 Ga0265322_10004818 3300028654 Bacteria 3999
423 Ga0307515_10094760 3300028794 Bacteria 3683
424 Ga0265338_10000109 3300028800 Bacteria 152826
425 Ga0265338_10011920 3300028800 Bacteria 9977
426 Ga0265338_10038273 3300028800 Bacteria 4548
427 Ga0265324_10000433 3300029957 Bacteria 29760
428 Ga0265324_10000439 3300029957 Bacteria 29542
429 Ga0265330_10001505 3300031235 Bacteria 13469
430 Ga0265330_10002670 3300031235 Bacteria 9635
431 Ga0265330_10008907 3300031235 Bacteria 4794
432 Ga0265332_10000083 3300031238 Bacteria 83040
433 Ga0265332_10049485 3300031238 Bacteria 1807
434 Ga0265328_10000106 3300031239 Bacteria 39805
435 Ga0265328_10003916 3300031239 Bacteria 6549
436 Ga0265320_10009006 3300031240 Bacteria 6052
437 Ga0265320_10039726 3300031240 Bacteria 2350
438 Ga0265325_10008650 3300031241 Bacteria 5995
439 Ga0265325_10010738 3300031241 Bacteria 5285
440 Ga0265325_10015153 3300031241 Bacteria 4342
441 Ga0265325_10030002 3300031241 Bacteria 2919
442 Ga0265329_10003360 3300031242 Bacteria 6990
443 Ga0265329_10039753 3300031242 Bacteria 1511
444 Ga0265340_10001827 3300031247 Bacteria 12172
445 Ga0265331_10000093 3300031250 Bacteria 123060
446 Ga0265331_10000636 3300031250 Bacteria 30412
447 Ga0265331_10005379 3300031250 Bacteria 7741
448 Ga0265331_10010080 3300031250 Bacteria 5249
449 Ga0265331_10031913 3300031250 Bacteria 2615
450 Ga0265327_10000988 3300031251 Bacteria 40530
451 Ga0265327_10001720 3300031251 Bacteria 25945
452 Ga0265327_10001881 3300031251 Bacteria 24292
453 Ga0265327_10013236 3300031251 Bacteria 5493
454 Ga0265327_10028521 3300031251 Bacteria 3191
455 Ga0265327_10037426 3300031251 Bacteria 2656
456 Ga0265316_10000508 3300031344 Bacteria 43878
457 Ga0265316_10004367 3300031344 Bacteria 14099
458 Ga0265316_10012659 3300031344 Bacteria 7551
459 Ga0265316_10014135 3300031344 Bacteria 7043
460 Ga0265316_10031788 3300031344 Bacteria 4313
461 Ga0265316_10051541 3300031344 Bacteria 3232
462 Ga0265313_10000061 3300031595 Bacteria 107220
463 Ga0316575_10000910 3300031665 Bacteria 9077
464 Ga0316575_10004040 3300031665 Bacteria 5139
465 Ga0316575_10025877 3300031665 Bacteria 2278
466 Ga0316575_10035570 3300031665 Bacteria 1959
467 Ga0316575_10040223 3300031665 Bacteria 1847
468 Ga0316579_10004781 3300031691 Bacteria 5411
469 Ga0265314_10000136 3300031711 Bacteria 109906
470 Ga0265314_10000447 3300031711 Bacteria 55167
471 Ga0265314_10001998 3300031711 Bacteria 21636
472 Ga0265314_10002346 3300031711 Bacteria 19541
473 Ga0265314_10031660 3300031711 Bacteria 3901
474 Ga0265314_10071918 3300031711 Bacteria 2312
475 Ga0265342_10012919 3300031712 Bacteria 5629
476 Ga0316576_10000185 3300031727 Bacteria 26067
477 Ga0316576_10000775 3300031727 Bacteria 15974
478 Ga0316576_10003197 3300031727 Bacteria 9547
479 Ga0316576_10009926 3300031727 Bacteria 6163
480 Ga0316576_10019045 3300031727 Bacteria 4697
481 Ga0316576_10020319 3300031727 Bacteria 4568
482 Ga0316576_10022521 3300031727 Bacteria 4377
483 Ga0316576_10035413 3300031727 Bacteria 3562
484 Ga0316576_10035928 3300031727 Bacteria 3541
485 Ga0316576_10040935 3300031727 Bacteria 3332
486 Ga0316576_10048043 3300031727 Bacteria 3093
487 Ga0316576_10068814 3300031727 Bacteria 2609
488 Ga0316576_10070115 3300031727 Bacteria 2585
489 Ga0316576_10075746 3300031727 Bacteria 2489
490 Ga0316576_10077327 3300031727 Bacteria 2464
491 Ga0316576_10100367 3300031727 Bacteria 2163
492 Ga0316576_10104085 3300031727 Bacteria 2124
493 Ga0316576_10106068 3300031727 Bacteria 2103
494 Ga0316576_10167757 3300031727 Bacteria 1657
495 Ga0316578_10000009 3300031728 Bacteria 44952
496 Ga0316578_10001054 3300031728 Bacteria 10639
497 Ga0316578_10009518 3300031728 Bacteria 4999
498 Ga0316578_10010545 3300031728 Bacteria 4801
499 Ga0316578_10014151 3300031728 Bacteria 4253
500 Ga0316578_10014267 3300031728 Bacteria 4238
501 Ga0316578_10015033 3300031728 Bacteria 4152
502 Ga0316578_10015408 3300031728 Bacteria 4110
503 Ga0316578_10031100 3300031728 Bacteria 3039
504 Ga0316578_10035608 3300031728 Bacteria 2862
505 Ga0316578_10036047 3300031728 Bacteria 2846
506 Ga0316578_10038031 3300031728 Bacteria 2773
507 Ga0316578_10073172 3300031728 Bacteria 2031
508 Ga0316578_10173251 3300031728 Bacteria 1300
509 Ga0307516_10010810 3300031730 Bacteria 9987
510 Ga0307405_10082564 3300031731 Bacteria 2104
511 Ga0307405_10125312 3300031731 Bacteria 1765
512 Ga0316577_10002145 3300031733 Bacteria 9653
513 Ga0316577_10046875 3300031733 Bacteria 2413
514 Ga0316577_10072529 3300031733 Bacteria 1922
515 Ga0316577_10083601 3300031733 Bacteria 1785
516 Ga0316577_10129019 3300031733 Bacteria 1422
517 Ga0307413_10007356 3300031824 Bacteria 5108
518 Ga0307413_10098219 3300031824 Bacteria 1927
519 Ga0307413_10215345 3300031824 Bacteria 1398
520 Ga0307410_10073541 3300031852 Bacteria 2377
521 Ga0307406_10309963 3300031901 Bacteria 1216
522 Ga0307407_10036396 3300031903 Bacteria 2712
523 Ga0307407_10053359 3300031903 Bacteria 2326
524 Ga0307407_10091684 3300031903 Bacteria 1864
525 Ga0307407_10221988 3300031903 Bacteria 1278
526 Ga0307409_100004292 3300031995 Bacteria 7974
527 Ga0307409_100023190 3300031995 Bacteria 4294
528 Ga0307409_100124196 3300031995 Bacteria 2192
529 Ga0307409_100132326 3300031995 Bacteria 2134
530 Ga0307409_100134882 3300031995 Bacteria 2116
531 Ga0307409_100484803 3300031995 Bacteria 1200
532 Ga0307416_100001236 3300032002 Bacteria 13784
533 Ga0307416_100028930 3300032002 Bacteria 4130
534 Ga0307416_100048452 3300032002 Bacteria 3371
535 Ga0307416_100089060 3300032002 Bacteria 2641
536 Ga0307416_100165575 3300032002 Bacteria 2050
537 Ga0307416_100268724 3300032002 Bacteria 1672
538 Ga0307416_100497365 3300032002 Bacteria 1283
539 Ga0307411_10002945 3300032005 Bacteria 7728
540 Ga0307411_10081513 3300032005 Bacteria 2228
541 Ga0307411_10104615 3300032005 Bacteria 2011
542 Ga0307415_100003696 3300032126 Bacteria 7830
543 Ga0307415_100042383 3300032126 Bacteria 3029
544 Ga0307415_100258218 3300032126 Bacteria 1420
545 Ga0316583_10015714 3300032133 Bacteria 2725
546 Ga0316585_10008848 3300032137 Bacteria 2925
547 Ga0316585_10033923 3300032137 Bacteria 1611
548 Ga0316585_10050710 3300032137 Bacteria 1332
549 Ga0316580_10000523 3300032139 Bacteria 8884
550 Ga0316580_10006681 3300032139 Bacteria 3410
551 Ga0316580_10014380 3300032139 Bacteria 2417
552 Ga0316580_10020582 3300032139 Bacteria 2033
553 Ga0316593_10001400 3300032168 Bacteria 5297
554 Ga0316593_10005726 3300032168 Bacteria 3306
555 Ga0316593_10008151 3300032168 Bacteria 2909
556 Ga0316593_10021162 3300032168 Bacteria 2031
557 Ga0316593_10021597 3300032168 Bacteria 2014
558 Ga0307507_10022327 3300033179 Bacteria 6998
559 Ga0316592_1001415 3300033524 Bacteria 3847
560 Ga0316586_1004449 3300033527 Bacteria 1915
561 Ga0316588_1004450 3300033528 Bacteria 2655
562 Ga0316588_1005395 3300033528 Bacteria 2487
563 Ga0316588_1007960 3300033528 Bacteria 2168
564 Ga0316588_1017806 3300033528 Bacteria 1586
565 Ga0316587_1001928 3300033529 Bacteria 2680
566 Ga0316587_1014958 3300033529 Bacteria 1284
567 Ga0316587_1018704 3300033529 Bacteria 1168
568 Ga0316596_1013240 3300033541 Bacteria 2035
569 Ga0316596_1014493 3300033541 Bacteria 1955
570 Ga0373926_0005213 3300035083 Bacteria 4278
571 Ga0373934_0002111 3300035086 Bacteria 7290
572 Ga0373954_0000284 3300035118 Bacteria 18310
573 Ga0373956_0000996 3300035119 Bacteria 11720
574 Ga0373956_0139692 3300035119 Bacteria 1137
575 Ga0373955_0066479 3300035172 Bacteria 2004
576 Ga0316574_0001201 3300035398 Bacteria 12021
577 Ga0316574_0002122 3300035398 Bacteria 9833
578 Ga0316574_0003293 3300035398 Bacteria 8303
579 Ga0316574_0003902 3300035398 Bacteria 7750
580 Ga0316574_0003963 3300035398 Bacteria 7707
581 Ga0316574_0007850 3300035398 Bacteria 5882
582 Ga0316574_0012529 3300035398 Bacteria 4852
583 Ga0316574_0013379 3300035398 Bacteria 4715
584 Ga0316574_0017743 3300035398 Bacteria 4172
585 Ga0316574_0042760 3300035398 Bacteria 2797
586 Ga0316574_0055240 3300035398 Bacteria 2482
587 Ga0316574_0064009 3300035398 Bacteria 2313
588 Ga0316574_0064475 3300035398 Bacteria 2305
589 Ga0316574_0096268 3300035398 Bacteria 1891
590 Ga0316574_0111736 3300035398 Bacteria 1752
591 Ga0316574_0135563 3300035398 Bacteria 1585
592 Ga0316574_0154653 3300035398 Bacteria 1478
593 Ga0316574_0158357 3300035398 Bacteria 1459
594 Ga0316574_0161734 3300035398 Bacteria 1442
595 Ga0373924_0002671 3300035410 Bacteria 6013
596 Ga0373924_0038118 3300035410 Bacteria 1959
597 Ga0373931_0046143 3300035691 Bacteria 2303
598 Ga0373935_0003679 3300035692 Bacteria 8944
599 Ga0373935_0034934 3300035692 Bacteria 3135
600 Ga0373935_0153412 3300035692 Bacteria 1565
601 Ga0373927_0028535 3300035695 Bacteria 3641
602 Ga0373927_0040395 3300035695 Bacteria 3026
603 Ga0373933_0009642 3300035724 Bacteria 5276
604 Ga0373933_0155183 3300035724 Bacteria 1451
605 Ga0373947_0000740 3300035725 Bacteria 19574
606 Ga0373937_0079023 3300036401 Bacteria 3040
607 Ga0373937_0130992 3300036401 Bacteria 2342
608 Ga0373937_0147931 3300036401 Bacteria 2199
609 Ga0373937_0308532 3300036401 Bacteria 1496
610 Ga0316582_0018517 3300036647 Bacteria 4055
611 Ga0316582_0042542 3300036647 Unclassified 2846
612 Ga0316582_0044199 3300036647 Bacteria 2799
613 Ga0316582_0046563 3300036647 Bacteria 2735
614 Ga0316582_0051069 3300036647 Bacteria 2622
615 Ga0316582_0055054 3300036647 Bacteria 2534
616 Ga0316582_0055368 3300036647 Bacteria 2528
617 Ga0316582_0059869 3300036647 Bacteria 2440
618 Ga0316582_0101088 3300036647 Bacteria 1910
619 Ga0316582_0316630 3300036647 Bacteria 1072
620 Ga0316584_0001897 3300036712 Bacteria 13001
621 Ga0316584_0013099 3300036712 Bacteria 5862
622 Ga0316584_0013283 3300036712 Bacteria 5826
623 Ga0316584_0014220 3300036712 Bacteria 5660
624 Ga0316584_0016020 3300036712 Bacteria 5369
625 Ga0316584_0016776 3300036712 Bacteria 5254
626 Ga0316584_0029909 3300036712 Bacteria 4022
627 Ga0316584_0035379 3300036712 Bacteria 3705
628 Ga0316584_0048622 3300036712 Bacteria 3169
629 Ga0316584_0060909 3300036712 Bacteria 2827
630 Ga0316584_0065573 3300036712 Bacteria 2720
631 Ga0316584_0087928 3300036712 Bacteria 2326
632 Ga0316584_0090466 3300036712 Bacteria 2291
633 Ga0316584_0100478 3300036712 Bacteria 2166
634 Ga0316584_0174556 3300036712 Bacteria 1592
635 Ga0316584_0198278 3300036712 Bacteria 1482
636 Ga0316584_0268650 3300036712 Bacteria 1242
637 Ga0373925_0013087 3300037068 Bacteria 6006
638 Ga0373925_0014962 3300037068 Bacteria 5609
639 Ga0373925_0025412 3300037068 Bacteria 4326
640 Ga0373925_0062685 3300037068 Bacteria 2796
641 Ga0395899_0117861 3300037312 Bacteria 1904
642 Ga0395900_0061724 3300037418 Bacteria 3853
643 Ga0395898_0121693 3300037466 Bacteria 2500
644 Ga0395898_0232976 3300037466 Bacteria 1756
645 Ga0395905_0000090 3300037471 Bacteria 152117
646 Ga0395905_0027816 3300037471 Bacteria 5331
647 Ga0395905_0042860 3300037471 Bacteria 4246
648 Ga0395905_0050933 3300037471 Bacteria 3878
649 Ga0395905_0133205 3300037471 Bacteria 2337
650 Ga0395905_0142817 3300037471 Bacteria 2252
651 Ga0395905_0195530 3300037471 Bacteria 1896
652 Ga0316581_0015139 3300037588 Bacteria 2200
653 Ga0436364_0410612 3300037853 Bacteria 5972
654 Ga0436364_1086943 3300037853 Bacteria 2961
655 Ga0395901_0001398 3300038443 Bacteria 25218
656 Ga0395901_0024823 3300038443 Bacteria 6152
657 Ga0400490_50633 3300038726 Bacteria 48494
658 Ga0400491_16945 3300038727 Bacteria 5211
659 Ga0400488_53777 3300038741 Bacteria 2885
660 Ga0400483_027323 3300039062 Bacteria 4433
661 Ga0400483_061984 3300039062 Bacteria 5747
662 Ga0400483_063435 3300039062 Bacteria 25413
663 Ga0400483_075120 3300039062 Bacteria 14732
664 Ga0400483_142661 3300039062 Bacteria 5275
665 Ga0400483_163069 3300039062 Bacteria 15145
666 Ga0400483_166407 3300039062 Bacteria 1694
667 Ga0400483_189406 3300039062 Bacteria 6677
668 Ga0400483_212256 3300039062 Bacteria 21400
669 Ga0400483_274218 3300039062 Bacteria 4101
670 Ga0400487_18541 3300039110 Bacteria 14059
671 Ga0400487_20179 3300039110 Bacteria 60838
672 Ga0436365_0391497 3300039437 Bacteria 3038
673 Ga0436365_1362540 3300039437 Bacteria 3066
674 Ga0436361_0162216 3300039447 Bacteria 10644
675 Ga0436361_0408050 3300039447 Bacteria 13949
676 Ga0436361_0687968 3300039447 Bacteria 7055
677 Ga0436361_0950210 3300039447 Bacteria 3736
678 Ga0436361_0976615 3300039447 Bacteria 1634
679 Ga0436361_0995760 3300039447 Bacteria 3068
680 Ga0436361_1012027 3300039447 Bacteria 2074
681 Ga0436361_1218959 3300039447 Bacteria 6548
682 Ga0436362_0536411 3300039453 Bacteria 2073
683 Ga0439439_0004069 3300041406 Bacteria 3268
684 Ga0439466_0035089 3300041411 Bacteria 1697
685 Ga0439431_0009831 3300041997 Bacteria 2163
686 Ga0439431_0014286 3300041997 Bacteria 1840
687 Ga0439441_007345 3300042001 Bacteria 1772
688 Ga0439445_0011025 3300042004 Bacteria 2148
689 Ga0439432_009430 3300042006 Bacteria 3404
690 Ga0439449_0002444 3300042007 Bacteria 7263
691 Ga0439462_0015414 3300042015 Bacteria 1970
692 Ga0450906_004112 3300042145 Bacteria 3078
693 Ga0439446_0021158 3300042156 Bacteria 1837
694 Ga0439434_0006109 3300042435 Bacteria 3512
695 Ga0451577_0001417 3300042876 Bacteria 31981
696 Ga0451577_0003021 3300042876 Bacteria 19154
697 Ga0451577_0023295 3300042876 Bacteria 5647
698 Ga0451577_0035928 3300042876 Bacteria 4463
699 Ga0451577_0093041 3300042876 Bacteria 2692
700 Ga0451577_0188976 3300042876 Bacteria 1858
701 Ga0453683_0001483 3300044673 Bacteria 20077
702 Ga0453683_0002876 3300044673 Bacteria 13025
703 Ga0453683_0008630 3300044673 Bacteria 6834
704 Ga0453683_0067817 3300044673 Bacteria 2230
705 Ga0466965_0035114 3300044683 Bacteria 2455
706 Ga0466966_0149487 3300044684 Bacteria 1425
707 Ga0453684_0000006 3300044712 Bacteria 1364191
708 Ga0453684_0000027 3300044712 Bacteria 778857
709 Ga0453684_0000029 3300044712 Bacteria 757969
710 Ga0453684_0000847 3300044712 Bacteria 103142
711 Ga0453684_0000969 3300044712 Bacteria 94503
712 Ga0453684_0002999 3300044712 Bacteria 39284
713 Ga0453684_0009614 3300044712 Bacteria 16861
714 Ga0453684_0016369 3300044712 Bacteria 11604
715 Ga0453684_0020712 3300044712 Bacteria 9896
716 Ga0453684_0054458 3300044712 Bacteria 5210
717 Ga0453684_0080090 3300044712 Bacteria 4080
718 Ga0453684_0082591 3300044712 Bacteria 4002
719 Ga0453684_0085048 3300044712 Bacteria 3932
720 Ga0453684_0154167 3300044712 Bacteria 2726
721 Ga0453684_0273625 3300044712 Bacteria 1928
722 Ga0453684_0344330 3300044712 Bacteria 1682
723 Ga0466957_0045844 3300044842 Bacteria 2652
724 Ga0466960_0023445 3300044901 Bacteria 2771
725 Ga0466960_0049913 3300044901 Bacteria 2016
726 Ga0451576_0000029 3300045051 Bacteria 404449
727 Ga0451576_0000219 3300045051 Bacteria 141949
728 Ga0451576_0000483 3300045051 Bacteria 88050
729 Ga0451576_0002900 3300045051 Bacteria 24470
730 Ga0451576_0004162 3300045051 Bacteria 19049
731 Ga0451576_0004755 3300045051 Bacteria 17429
732 Ga0451576_0005937 3300045051 Bacteria 15127
733 Ga0451576_0021596 3300045051 Bacteria 6995
734 Ga0451576_0038947 3300045051 Bacteria 5031
735 Ga0451576_0040519 3300045051 Bacteria 4929
736 Ga0451576_0101011 3300045051 Bacteria 2999
737 Ga0451576_0139185 3300045051 Bacteria 2532
738 Ga0466967_0326688 3300045976 Bacteria 1480
739 Ga0495592_0082814 3300046454 Bacteria 2318
740 Ga0495590_0001807 3300046457 Bacteria 9062
741 Ga0495641_0016725 3300046461 Bacteria 3853
742 Ga0495651_0003692 3300046462 Bacteria 11727
743 Ga0495580_0000277 3300046472 Bacteria 41482
744 Ga0495580_0022054 3300046472 Bacteria 4692
745 Ga0495662_0005209 3300046476 Bacteria 6518
746 Ga0495608_0011389 3300046511 Bacteria 6189
747 Ga0495608_0021836 3300046511 Bacteria 4390
748 Ga0495608_0147857 3300046511 Bacteria 1498
749 Ga0495618_0048665 3300046514 Bacteria 2676
750 Ga0495628_0013619 3300046516 Bacteria 6837
751 Ga0495663_0029949 3300046525 Bacteria 1610
752 Ga0495666_0120431 3300046526 Bacteria 1229
753 Ga0495665_0014376 3300046531 Bacteria 4270
754 Ga0495586_0011145 3300046535 Bacteria 4777
755 Ga0495621_0010777 3300046539 Bacteria 2809
756 Ga0495597_0041970 3300046542 Bacteria 2041
757 Ga0495667_0002820 3300046559 Bacteria 11609
758 Ga0495656_0000108 3300046615 Bacteria 33050
759 Ga0495634_0134521 3300046642 Bacteria 1573
760 Ga0495635_0033171 3300046663 Bacteria 3581
761 Ga0495657_0002668 3300046675 Bacteria 14912
762 Ga0495657_0089781 3300046675 Bacteria 1973
763 Ga0495646_0095193 3300046680 Bacteria 1714
764 Ga0495647_0003619 3300046681 Bacteria 4958
765 Ga0495647_0010396 3300046681 Bacteria 3168
766 Ga0495647_0070205 3300046681 Bacteria 1401
767 Ga0495658_0048513 3300046683 Bacteria 2394
768 Ga0495658_0193574 3300046683 Bacteria 1265
769 Ga0495600_0133935 3300046809 Bacteria 1610
770 Ga0495604_0100946 3300047317 Bacteria 2120
771 Ga0495636_0089846 3300047318 Bacteria 1332
772 Ga0495687_000500 3300047443 Bacteria 47248
773 Ga0495675_0182716 3300047444 Bacteria 1283
774 Ga0495684_0036162 3300047471 Bacteria 3787
775 Ga0495684_0036614 3300047471 Bacteria 3761
776 Ga0495684_0049532 3300047471 Bacteria 3209
777 Ga0495684_0216699 3300047471 Bacteria 1405
778 Ga0496100_0119016 3300048903 Bacteria 1845
779 Ga0496100_0248520 3300048903 Bacteria 1315
780 Ga0496101_0002757 3300048904 Bacteria 10786
781 Ga0496101_0020182 3300048904 Bacteria 4557
782 Ga0496104_0069539 3300048907 Bacteria 3346
783 Ga0496104_0108391 3300048907 Bacteria 2662
784 Ga0496105_0003923 3300048908 Bacteria 11123
785 Ga0496105_0154328 3300048908 Bacteria 1886
786 Ga0496106_0013966 3300048909 Bacteria 5939
787 Ga0496108_0006306 3300048911 Bacteria 9613
788 Ga0496108_0027054 3300048911 Bacteria 4732
789 Ga0496108_0035004 3300048911 Bacteria 4173
790 Ga0496108_0094726 3300048911 Bacteria 2541
791 Ga0496108_0263247 3300048911 Bacteria 1501
792 Ga0496108_0411674 3300048911 Bacteria 1181
793 Ga0496109_0017015 3300048912 Bacteria 6363
794 Ga0496109_0038622 3300048912 Bacteria 4317
795 Ga0496109_0100982 3300048912 Bacteria 2677
796 Ga0496110_0020809 3300048913 Bacteria 5541
797 Ga0496110_0098626 3300048913 Bacteria 2619
798 Ga0496111_0064345 3300048914 Bacteria 2660
799 Ga0496112_0082650 3300048915 Bacteria 3176
800 Ga0496112_0128530 3300048915 Bacteria 2504
801 Ga0496112_0175868 3300048915 Bacteria 2105
802 Ga0496113_0020502 3300048916 Bacteria 4648
803 Ga0496113_0081507 3300048916 Bacteria 2480
804 Ga0496114_0000953 3300048917 Bacteria 21637
805 Ga0496114_0010629 3300048917 Bacteria 7323
806 Ga0496114_0037383 3300048917 Bacteria 4015
807 Ga0496115_0029355 3300048918 Bacteria 4319
808 Ga0496115_0055372 3300048918 Bacteria 3186
809 Ga0495682_0011325 3300049460 Bacteria 3434
810 Ga0501031_0000192 3300049568 Bacteria 34424
811 Ga0501031_0024609 3300049568 Bacteria 3924
812 Ga0501031_0058405 3300049568 Bacteria 2514
813 Ga0501031_0200781 3300049568 Bacteria 1301
814 Ga0501032_0009318 3300049569 Bacteria 7110
815 Ga0501032_0068724 3300049569 Bacteria 2364
816 Ga0501032_0115477 3300049569 Bacteria 1775
817 Ga0501033_0004357 3300049570 Bacteria 11345
818 Ga0501033_0005975 3300049570 Bacteria 9556
819 Ga0501034_0003674 3300049571 Bacteria 17345
820 Ga0501034_0003691 3300049571 Bacteria 17300
821 Ga0501034_0217159 3300049571 Bacteria 1866
822 Ga0501034_0396322 3300049571 Bacteria 1304
823 Ga0501034_0429352 3300049571 Bacteria 1241
824 Ga0501036_0037673 3300049572 Bacteria 4091
825 Ga0501036_0041567 3300049572 Bacteria 3889
826 Ga0501036_0247043 3300049572 Bacteria 1496
827 Ga0501036_0424112 3300049572 Bacteria 1109
828 Ga0501037_0004553 3300049573 Bacteria 10082
829 Ga0501037_0053143 3300049573 Bacteria 2963
830 Ga0501038_0015594 3300049574 Bacteria 6907
831 Ga0501039_0070352 3300049575 Bacteria 2718
832 Ga0501039_0131586 3300049575 Bacteria 1963
833 Ga0501039_0157073 3300049575 Bacteria 1787
834 Ga0501039_0263343 3300049575 Bacteria 1355
835 Ga0501040_0024604 3300049576 Bacteria 4042
836 Ga0501040_0067360 3300049576 Bacteria 2467
837 Ga0501041_0017992 3300049577 Bacteria 4206
838 Ga0501041_0111194 3300049577 Bacteria 1699
839 Ga0501042_0039246 3300049578 Bacteria 3364
840 Ga0501042_0061024 3300049578 Bacteria 2694
841 Ga0501043_0012886 3300049579 Bacteria 6536
842 Ga0501043_0076676 3300049579 Bacteria 2626
843 Ga0501046_0040269 3300049580 Bacteria 3735
844 Ga0501046_0048623 3300049580 Bacteria 3358
845 Ga0501046_0254064 3300049580 Bacteria 1293
846 Ga0501047_0018444 3300049581 Bacteria 6690
847 Ga0501047_0034783 3300049581 Bacteria 4865
848 Ga0501047_0074774 3300049581 Bacteria 3261
849 Ga0501048_0053638 3300049582 Bacteria 2866
850 Ga0501048_0149792 3300049582 Bacteria 1650
851 Ga0501048_0156413 3300049582 Bacteria 1612
852 Ga0501068_0001460 3300049584 Bacteria 12572
853 Ga0501068_0039776 3300049584 Bacteria 2820
854 Ga0501069_0014398 3300049585 Bacteria 4229
855 Ga0501069_0039046 3300049585 Bacteria 2622
856 Ga0501070_0003217 3300049586 Bacteria 14206
857 Ga0501070_0017006 3300049586 Bacteria 6102
858 Ga0501070_0046091 3300049586 Bacteria 3625
859 Ga0501071_0047415 3300049587 Bacteria 3087
860 Ga0501071_0098342 3300049587 Bacteria 2155
861 Ga0501072_0015168 3300049588 Bacteria 5908
862 Ga0501072_0188160 3300049588 Bacteria 1647
863 Ga0501073_0007822 3300049589 Bacteria 7937
864 Ga0501073_0010531 3300049589 Bacteria 6772
865 Ga0501073_0054843 3300049589 Bacteria 2790
866 Ga0501074_0013206 3300049590 Bacteria 6006
867 Ga0501074_0052250 3300049590 Bacteria 2950
868 Ga0501074_0063148 3300049590 Bacteria 2668
869 Ga0501074_0098935 3300049590 Bacteria 2088
870 Ga0501075_0038883 3300049591 Bacteria 3558
871 Ga0501076_0004696 3300049592 Bacteria 9744
872 Ga0501076_0011413 3300049592 Bacteria 6616
873 Ga0501076_0124670 3300049592 Bacteria 2087
874 Ga0501076_0128297 3300049592 Bacteria 2056
875 Ga0501077_0017709 3300049593 Bacteria 4500
876 Ga0501217_000641 3300049661 Bacteria 5900
877 Ga0501227_000165 3300049665 Bacteria 12660
878 Ga0501079_0020121 3300049741 Bacteria 5100
879 Ga0501079_0037957 3300049741 Bacteria 3715
880 Ga0501079_0040238 3300049741 Bacteria 3605
881 Ga0501079_0104952 3300049741 Bacteria 2192
882 Ga0501080_0000758 3300049742 Bacteria 26165
883 Ga0501080_0002718 3300049742 Bacteria 15506
884 Ga0501080_0011298 3300049742 Bacteria 8172
885 Ga0501080_0161903 3300049742 Bacteria 2066
886 Ga0501081_0034320 3300049743 Bacteria 3451
887 Ga0501083_0005573 3300049744 Bacteria 8919
888 Ga0501083_0063940 3300049744 Bacteria 2453
889 Ga0501035_0007596 3300049822 Bacteria 10128
890 Ga0501035_0017135 3300049822 Bacteria 6675
891 Ga0501035_0017319 3300049822 Bacteria 6645
892 Ga0501044_0000176 3300049823 Bacteria 79132
893 Ga0501044_0004147 3300049823 Bacteria 16277
894 Ga0501044_0411864 3300049823 Bacteria 1263
895 Ga0501045_0013593 3300049824 Bacteria 5752
896 nmdc:mga03683_65265_c1 3300050489 Bacteria 1546
897 nmdc:mga03683_8691_c1 3300050489 Bacteria 3580
898 nmdc:mga00v17_115499_c1 3300050491 Bacteria 1706
899 nmdc:mga00v17_24569_c1 3300050491 Bacteria 3496
900 nmdc:mga00v17_28697_c1 3300050491 Bacteria 3261
901 nmdc:mga00v17_35818_c1 3300050491 Bacteria 2956
902 nmdc:mga0yw44_26981_c1 3300050492 Bacteria 3285
903 nmdc:mga0k408_142757_c1 3300050493 Bacteria 1425
904 nmdc:mga0k408_20984_c1 3300050493 Bacteria 3666
905 nmdc:mga06z11_32407_c1 3300050494 Bacteria 2548
906 nmdc:mga07m45_13215_c1 3300050496 Bacteria 4376
907 nmdc:mga07m45_197_c1 3300050496 Bacteria 23906
908 nmdc:mga07m45_750_c1 3300050496 Bacteria 13883
909 nmdc:mga07m45_8392_c1 3300050496 Bacteria 5308
910 nmdc:mga05p37_22826_c1 3300050507 Bacteria 7588
911 nmdc:mga05p37_33910_c1 3300050507 Bacteria 3077
912 nmdc:mga05p37_43553_c1 3300050507 Bacteria 5522
913 nmdc:mga05p37_86_c1 3300050507 Bacteria 81974
914 nmdc:mga09592_12091_c1 3300050508 Bacteria 7025
915 nmdc:mga09592_160573_c1 3300050508 Bacteria 1941
916 nmdc:mga09592_25_c1 3300050508 Bacteria 44492
917 nmdc:mga09592_36377_c1 3300050508 Bacteria 4123
918 nmdc:mga09592_4214_c1 3300050508 Bacteria 11615
919 nmdc:mga09592_4372_c1 3300050508 Bacteria 11425
920 nmdc:mga09592_92882_c1 3300050508 Bacteria 2579
921 nmdc:mga0qj67_164_c1 3300050509 Bacteria 44665
922 nmdc:mga0qj67_33698_c1 3300050509 Bacteria 3997
923 nmdc:mga0qj67_46733_c1 3300050509 Bacteria 3418
924 nmdc:mga0qj67_58216_c1 3300050509 Bacteria 3064
925 nmdc:mga06r32_15043_c1 3300050510 Bacteria 7025
926 nmdc:mga06r32_19661_c1 3300050510 Bacteria 6203
927 nmdc:mga06r32_21156_c1 3300050510 Bacteria 6003
928 nmdc:mga06r32_281_c1 3300050510 Bacteria 42391
929 nmdc:mga06r32_35827_c1 3300050510 Bacteria 4683
930 nmdc:mga06r32_65612_c1 3300050510 Bacteria 3502
931 nmdc:mga08y16_148070_c1 3300050511 Bacteria 2440
932 nmdc:mga08y16_18553_c1 3300050511 Bacteria 7330
933 nmdc:mga08y16_224_c1 3300050511 Bacteria 50738
934 nmdc:mga08y16_310337_c1 3300050511 Bacteria 1624
935 nmdc:mga08y16_63609_c1 3300050511 Bacteria 3853
936 nmdc:mga08y16_8480_c1 3300050511 Bacteria 10765
937 nmdc:mga0n895_282058_c1 3300050512 Bacteria 1684
938 nmdc:mga0n895_359974_c1 3300050512 Bacteria 1473
939 nmdc:mga0n895_953_c1 3300050512 Bacteria 20945
940 nmdc:mga0rr50_1829_c1 3300050513 Bacteria 11766
941 nmdc:mga0rr50_242298_c1 3300050513 Bacteria 1495
942 nmdc:mga08x19_1633_c1 3300050514 Bacteria 13880
943 nmdc:mga08x19_19247_c1 3300050514 Bacteria 4187
944 nmdc:mga08x19_5264_c1 3300050514 Bacteria 7656
945 nmdc:mga0a205_119779_c1 3300050515 Bacteria 2531
946 nmdc:mga0a205_2323_c1 3300050515 Bacteria 16775
947 nmdc:mga0sz30_5227_c1 3300050516 Bacteria 4750
948 Ga0495601_0004731 3300053077 Bacteria 7891
949 Ga0495601_0026304 3300053077 Bacteria 3592
950 Ga0495601_0129279 3300053077 Bacteria 1644
951 Ga0500610_0105139 3300053079 Bacteria 1457
952 Ga0495595_0012737 3300053084 Bacteria 3542
953 Ga0495619_0011047 3300053085 Bacteria 5680
954 Ga0495619_0039034 3300053085 Bacteria 3099
955 Ga0495619_0059212 3300053085 Bacteria 2544
956 Ga0500583_0035724 3300053092 Bacteria 2220
957 Ga0500617_057641 3300053124 Bacteria 1724
958 Ga0500568_0016243 3300053139 Bacteria 3315
959 Ga0500622_0001264 3300053156 Bacteria 20628
960 Ga0500622_0004749 3300053156 Bacteria 8372
961 Ga0500637_0010271 3300053178 Bacteria 4796
962 Ga0501084_0158522 3300054114 Bacteria 1909
963 Ga0501082_0016725 3300060353 Bacteria 6317
964 Ga0501082_0085013 3300060353 Bacteria 2728
965 Ga0501082_0469107 3300060353 Bacteria 1100
966 Ga0530510_0005818 3300061734 Bacteria 8542
967 Ga0530510_0019992 3300061734 Bacteria 4759
968 Ga0530510_0123926 3300061734 Bacteria 1899
969 2523384828 2523231044 Bacteria 6434991
970 2574433167 2574179768 Bacteria 4907129
971 2623501357 2622736605 Bacteria 4992138
972 2847938030 2847930680 Bacteria 9342022
973 2861527149 2861520306 Bacteria 8348283
974 2879084423 2879083081 Bacteria 8587928
975 2885195591 2885192300 Bacteria 5882526
976 2885410015 2885409591 Bacteria 9235467
977 2891634610 2891633521 Bacteria 4602265
978 2901312026 2901300506 Bacteria 8463898
979 639786823 639633007 Bacteria 4376040
980 8001524625 8001522603 Bacteria 4726425
981 8056056662 8056054917 Bacteria 5736694
982 Ga0316584_0051912
983 JGI24737J22298_10045099
984 Ga0065704_10023400
985 Ga0070658_10197034
986 Ga0070690_100003762
987 Ga0070690_100016631
988 Ga0070670_100000906
989 Ga0070670_100103701
990 Ga0068869_100019821
991 Ga0070666_10012915
992 Ga0070666_10015924
993 Ga0070666_10059296
994 Ga0070666_10167900
995 Ga0070680_100050702
996 Ga0070682_100208499
997 Ga0068868_100005274
998 Ga0068868_100008755
999 Ga0068868_100037456
1000 Ga0068868_100259904
1001 Ga0070689_100018529
1002 Ga0070689_100035455
1003 Ga0070689_100114910
1004 Ga0070687_100059885
1005 Ga0070661_100038443
1006 Ga0070668_100026038
1007 Ga0070668_100102974
1008 Ga0070675_100022870
1009 Ga0070675_100088001
1010 Ga0070675_100116322
1011 Ga0070671_100004118
1012 Ga0070671_100051657
1013 Ga0070674_100025779
1014 Ga0070673_100001712
1015 Ga0070673_100003842
1016 Ga0070673_100009342
1017 Ga0070673_100379440
1018 Ga0070688_100077108
1019 Ga0070688_100200257
1020 Ga0070667_100006711
1021 Ga0070667_100035568
1022 Ga0070667_100058417
1023 Ga0070667_100071936
1024 Ga0070709_10008556
1025 Ga0070714_100033710
1026 Ga0070713_100072739
1027 Ga0070713_100352038
1028 Ga0070710_10010324
1029 Ga0070701_10038979
1030 Ga0070711_100030051
1031 Ga0070711_100170391
1032 Ga0070705_100042851
1033 Ga0070705_100233589
1034 Ga0070694_100069093
1035 Ga0070708_100140108
1036 Ga0070708_100236149
1037 Ga0070678_100008843
1038 Ga0070678_100124015
1039 Ga0070678_100358334
1040 Ga0070706_100001257
1041 Ga0070706_100002535
1042 Ga0070706_100081595
1043 Ga0070706_100145555
1044 Ga0070707_100000894
1045 Ga0070707_100085014
1046 Ga0070698_100000184
1047 Ga0070698_100004413
1048 Ga0070698_100052734
1049 Ga0070698_100082635
1050 Ga0070698_100150048
1051 Ga0070699_100003946
1052 Ga0070699_100056021
1053 Ga0070699_100064086
1054 Ga0070679_100059313
1055 Ga0070684_100001343
1056 Ga0070684_100017800
1057 Ga0070697_100005132
1058 Ga0070697_100005266
1059 Ga0068853_100040312
1060 Ga0070672_100015346
1061 Ga0070672_100037176
1062 Ga0070672_100266043
1063 Ga0070686_100044824
1064 Ga0070696_100122438
1065 Ga0070696_100127814
1066 Ga0070693_100130154
1067 Ga0070665_100018756
1068 Ga0070665_100200703
1069 Ga0070704_100041606
1070 Ga0068855_100180773
1071 Ga0068855_100341268
1072 Ga0070664_100009003
1073 Ga0070664_100071054
1074 Ga0068857_100060931
1075 Ga0068857_100182360
1076 Ga0068854_100000811
1077 Ga0068856_100002001
1078 Ga0068852_100059006
1079 Ga0068852_100169442
1080 Ga0068852_100296397
1081 Ga0068859_100009071
1082 Ga0068859_100026232
1083 Ga0068859_100031928
1084 Ga0068859_100037140
1085 Ga0068864_100000454
1086 Ga0068864_100007705
1087 Ga0068864_100027866
1088 Ga0068864_100094021
1089 Ga0068864_100097581
1090 Ga0068864_100147429
1091 Ga0068866_10005950
1092 Ga0068861_100000999
1093 Ga0068851_10097773
1094 Ga0068863_100006585
1095 Ga0068863_100015249
1096 Ga0068863_100017884
1097 Ga0068863_100022286
1098 Ga0068863_100035396
1099 Ga0068863_100058924
1100 Ga0068863_100133724
1101 Ga0068863_100195689
1102 Ga0068858_100006836
1103 Ga0068858_100016977
1104 Ga0068858_100024873
1105 Ga0068858_100069538
1106 Ga0068858_100143421
1107 Ga0068858_100201339
1108 Ga0068860_100034823
1109 Ga0068860_100043091
1110 Ga0068860_100058487
1111 Ga0068862_100005314
1112 Ga0081455_10003202
1113 Ga0081540_1048859
1114 Ga0081539_10008545
1115 Ga0075363_100121062
1116 Ga0075364_10019238
1117 Ga0075364_10070891
1118 Ga0075364_10088545
1119 Ga0070715_10009397
1120 Ga0070716_100013161
1121 Ga0070716_100038886
1122 Ga0070716_100079043
1123 Ga0070712_100012125
1124 Ga0070712_100025793
1125 Ga0070712_100048686
1126 Ga0070712_100104622
1127 Ga0075362_10007555
1128 Ga0075362_10086060
1129 Ga0075367_10003884
1130 Ga0075367_10039449
1131 Ga0075369_10004717
1132 Ga0075369_10006202
1133 Ga0075369_10006503
1134 Ga0075366_10014391
1135 Ga0075366_10084976
1136 Ga0097621_100046220
1137 Ga0097621_100068809
1138 Ga0097621_100287769
1139 Ga0075370_10000095
1140 Ga0075370_10000217
1141 Ga0075370_10059631
1142 Ga0068871_100027149
1143 Ga0068871_100070561
1144 Ga0075428_100006684
1145 Ga0075428_100006866
1146 Ga0075430_100001621
1147 Ga0075430_100034817
1148 Ga0075430_100036653
1149 Ga0075430_100051641
1150 Ga0075430_100060607
1151 Ga0075430_100124382
1152 Ga0075431_100001412
1153 Ga0075431_100004791
1154 Ga0075431_100012454
1155 Ga0075431_100022895
1156 Ga0075431_100036103
1157 Ga0075431_100044859
1158 Ga0075433_10279863
1159 Ga0075434_100000169
1160 Ga0075434_100154873
1161 Ga0075434_100292146
1162 Ga0075429_100003183
1163 Ga0075429_100011021
1164 Ga0075429_100021021
1165 Ga0075429_100021207
1166 Ga0075429_100055692
1167 Ga0075429_100262313
1168 Ga0075436_100001151
1169 Ga0075436_100005331
1170 Ga0075436_100017896
1171 Ga0075436_100128363
1172 Ga0097620_100009071
1173 Ga0097620_100026232
1174 Ga0097620_100031930
1175 Ga0097620_100037141
1176 Ga0075435_100047868
1177 Ga0075435_100084665
1178 Ga0075435_100107345
1179 Ga0075435_100123978
1180 Ga0099794_10047087
1181 Ga0105240_10005185
1182 Ga0105240_10072097
1183 Ga0111539_10004683
1184 Ga0111539_10007501
1185 Ga0111539_10026978
1186 Ga0111539_10061639
1187 Ga0111539_10189021
1188 Ga0114129_10002520
1189 Ga0114129_10011944
1190 Ga0114129_10101509
1191 Ga0114129_10218778
1192 Ga0114129_10689061
1193 Ga0105243_10049333
1194 Ga0105243_10150858
1195 Ga0105241_10030868
1196 Ga0105241_10170098
1197 Ga0105242_10000556
1198 Ga0105242_10013676
1199 Ga0105242_10032170
1200 Ga0105242_10429715
1201 Ga0105248_10004265
1202 Ga0105248_10021930
1203 Ga0105248_10057746
1204 Ga0105237_10067738
1205 Ga0105238_10109045
1206 Ga0105238_10150330
1207 Ga0105238_10323716
1208 Ga0105249_10032592
1209 Ga0105249_10268067
1210 Ga0105249_10318352
1211 Ga0099796_10004563
1212 Ga0105239_10068834
1213 Ga0105246_10031036
1214 Ga0157371_10053128
1215 Ga0157369_10004712
1216 Ga0157369_10081506
1217 Ga0157374_10080020
1218 Ga0157374_10193419
1219 Ga0157378_10045534
1220 Ga0163162_10070559
1221 Ga0163162_10070988
1222 Ga0163162_10079555
1223 Ga0157372_10078996
1224 Ga0157375_10013194
1225 Ga0157375_10059690
1226 Ga0157375_10201206
1227 Ga0157375_10701421
1228 Ga0163163_10003827
1229 Ga0163163_10005343
1230 Ga0163163_10027044
1231 Ga0163163_10053206
1232 Ga0157380_10036512
1233 Ga0182008_10124102
1234 Ga0157379_10019806
1235 Ga0157379_10050438
1236 Ga0157376_10008551
1237 Ga0157376_10086833
1238 Ga0157376_10155165
1239 Ga0163161_10012730
1240 Ga0206356_10062693
1241 Ga0206354_10232206
1242 Ga0213872_10003092
1243 Ga0213872_10006459
1244 Ga0213872_10010099
1245 Ga0213872_10031585
1246 Ga0213875_10053763
1247 Ga0224712_10034708
1248 Ga0209051_1007653
1249 Ga0207697_10093198
1250 Ga0207656_10017568
1251 Ga0207692_10000821
1252 Ga0207642_10022428
1253 Ga0207710_10067668
1254 Ga0207680_10034895
1255 Ga0207680_10061511
1256 Ga0207647_10017480
1257 Ga0207699_10000151
1258 Ga0207699_10011935
1259 Ga0207699_10131904
1260 Ga0207645_10001558
1261 Ga0207645_10083453
1262 Ga0207643_10018803
1263 Ga0207705_10030469
1264 Ga0207705_10168879
1265 Ga0207684_10000134
1266 Ga0207684_10000153
1267 Ga0207684_10005110
1268 Ga0207684_10025168
1269 Ga0207684_10060147
1270 Ga0207684_10133160
1271 Ga0207684_10163487
1272 Ga0207695_10003421
1273 Ga0207671_10087941
1274 Ga0207693_10000339
1275 Ga0207693_10005268
1276 Ga0207693_10008424
1277 Ga0207693_10077500
1278 Ga0207693_10102696
1279 Ga0207663_10008722
1280 Ga0207649_10135705
1281 Ga0207652_10037227
1282 Ga0207652_10055534
1283 Ga0207646_10031090
1284 Ga0207646_10046974
1285 Ga0207646_10210693
1286 Ga0207646_10263531
1287 Ga0207646_10274886
1288 Ga0207681_10032686
1289 Ga0207694_10084709
1290 Ga0207650_10009835
1291 Ga0207650_10164840
1292 Ga0207659_10009066
1293 Ga0207659_10033180
1294 Ga0207659_10063037
1295 Ga0207659_10068924
1296 Ga0207659_10128564
1297 Ga0207700_10036243
1298 Ga0207700_10207154
1299 Ga0207664_10030030
1300 Ga0207644_10002988
1301 Ga0207644_10118587
1302 Ga0207644_10167608
1303 Ga0207706_10059836
1304 Ga0207686_10012098
1305 Ga0207686_10070681
1306 Ga0207709_10001097
1307 Ga0207709_10082455
1308 Ga0207670_10033137
1309 Ga0207669_10022364
1310 Ga0207669_10028685
1311 Ga0207704_10017772
1312 Ga0207704_10022467
1313 Ga0207704_10248962
1314 Ga0207665_10025087
1315 Ga0207665_10039861
1316 Ga0207665_10075120
1317 Ga0207691_10003386
1318 Ga0207691_10033473
1319 Ga0207691_10050596
1320 Ga0207691_10164614
1321 Ga0207711_10022199
1322 Ga0207711_10042672
1323 Ga0207711_10046873
1324 Ga0207689_10005582
1325 Ga0207689_10108736
1326 Ga0207661_10003175
1327 Ga0207661_10022528
1328 Ga0207667_10040008
1329 Ga0207651_10245389
1330 Ga0207712_10004066
1331 Ga0207712_10058347
1332 Ga0207712_10256241
1333 Ga0207668_10038600
1334 Ga0207668_10075469
1335 Ga0207668_10196507
1336 Ga0207640_10042307
1337 Ga0207658_10016527
1338 Ga0207658_10047951
1339 Ga0207658_10069955
1340 Ga0207677_10019840
1341 Ga0207677_10114545
1342 Ga0207703_10002940
1343 Ga0207703_10007109
1344 Ga0207703_10017641
1345 Ga0207703_10031865
1346 Ga0207703_10086518
1347 Ga0207703_10210043
1348 Ga0207639_10130399
1349 Ga0207678_10145263
1350 Ga0207708_10176533
1351 Ga0207708_10182595
1352 Ga0207702_10004539
1353 Ga0207702_10006429
1354 Ga0207702_10292486
1355 Ga0207641_10009773
1356 Ga0207641_10028713
1357 Ga0207641_10112973
1358 Ga0207641_10117525
1359 Ga0207641_10168231
1360 Ga0207641_10264418
1361 Ga0207641_10279328
1362 Ga0207641_10418787
1363 Ga0207676_10002093
1364 Ga0207676_10016118
1365 Ga0207676_10252730
1366 Ga0207676_10312085
1367 Ga0207674_10081080
1368 Ga0207674_10094112
1369 Ga0207674_10299291
1370 Ga0207674_10510885
1371 Ga0207675_100120783
1372 Ga0207675_100206696
1373 Ga0207675_100263509
1374 Ga0207683_10008362
1375 Ga0207683_10077444
1376 Ga0207683_10086582
1377 Ga0207683_10140919
1378 Ga0207683_10349453
1379 Ga0207698_10050739
1380 Ga0207698_10289916
1381 Ga0207698_10330060
1382 Ga0209389_1000009
1383 Ga0209489_100050
1384 Ga0209700_100016
1385 Ga0209588_1017423
1386 Ga0209971_1014086
1387 Ga0207428_10003201
1388 Ga0207428_10007187
1389 Ga0268266_10003141
1390 Ga0268266_10268139
1391 Ga0268265_10322968
1392 Ga0268264_10020456
1393 Ga0268264_10049630
1394 Ga0268264_10123801
1395 Ga0268264_10133742
1396 Ga0268264_10198865
1397 Ga0265326_10001417
1398 Ga0265319_1020910
1399 Ga0265334_10002860
1400 Ga0265318_10001480
1401 Ga0265323_10001736
1402 Ga0265323_10003438
1403 Ga0265322_10004818
1404 Ga0307515_10094760
1405 Ga0265338_10000109
1406 Ga0265338_10011920
1407 Ga0265338_10038273
1408 Ga0265324_10000433
1409 Ga0265324_10000439
1410 Ga0265330_10001505
1411 Ga0265330_10002670
1412 Ga0265330_10008907
1413 Ga0265332_10000083
1414 Ga0265332_10049485
1415 Ga0265328_10000106
1416 Ga0265328_10003916
1417 Ga0265320_10009006
1418 Ga0265320_10039726
1419 Ga0265325_10008650
1420 Ga0265325_10010738
1421 Ga0265325_10015153
1422 Ga0265325_10030002
1423 Ga0265329_10003360
1424 Ga0265329_10039753
1425 Ga0265340_10001827
1426 Ga0265331_10000093
1427 Ga0265331_10000636
1428 Ga0265331_10005379
1429 Ga0265331_10010080
1430 Ga0265331_10031913
1431 Ga0265327_10000988
1432 Ga0265327_10001720
1433 Ga0265327_10001881
1434 Ga0265327_10013236
1435 Ga0265327_10028521
1436 Ga0265327_10037426
1437 Ga0265316_10000508
1438 Ga0265316_10004367
1439 Ga0265316_10012659
1440 Ga0265316_10014135
1441 Ga0265316_10031788
1442 Ga0265316_10051541
1443 Ga0265313_10000061
1444 Ga0316575_10000910
1445 Ga0316575_10004040
1446 Ga0316575_10025877
1447 Ga0316575_10035570
1448 Ga0316575_10040223
1449 Ga0316579_10004781
1450 Ga0265314_10000136
1451 Ga0265314_10000447
1452 Ga0265314_10001998
1453 Ga0265314_10002346
1454 Ga0265314_10031660
1455 Ga0265314_10071918
1456 Ga0265342_10012919
1457 Ga0316576_10000185
1458 Ga0316576_10000775
1459 Ga0316576_10003197
1460 Ga0316576_10009926
1461 Ga0316576_10019045
1462 Ga0316576_10020319
1463 Ga0316576_10022521
1464 Ga0316576_10035413
1465 Ga0316576_10035928
1466 Ga0316576_10040935
1467 Ga0316576_10048043
1468 Ga0316576_10068814
1469 Ga0316576_10070115
1470 Ga0316576_10075746
1471 Ga0316576_10077327
1472 Ga0316576_10100367
1473 Ga0316576_10104085
1474 Ga0316576_10106068
1475 Ga0316576_10167757
1476 Ga0316578_10000009
1477 Ga0316578_10001054
1478 Ga0316578_10009518
1479 Ga0316578_10010545
1480 Ga0316578_10014151
1481 Ga0316578_10014267
1482 Ga0316578_10015033
1483 Ga0316578_10015408
1484 Ga0316578_10031100
1485 Ga0316578_10035608
1486 Ga0316578_10036047
1487 Ga0316578_10038031
1488 Ga0316578_10073172
1489 Ga0316578_10173251
1490 Ga0307516_10010810
1491 Ga0307405_10082564
1492 Ga0307405_10125312
1493 Ga0316577_10002145
1494 Ga0316577_10046875
1495 Ga0316577_10072529
1496 Ga0316577_10083601
1497 Ga0316577_10129019
1498 Ga0307413_10007356
1499 Ga0307413_10098219
1500 Ga0307413_10215345
1501 Ga0307410_10073541
1502 Ga0307406_10309963
1503 Ga0307407_10036396
1504 Ga0307407_10053359
1505 Ga0307407_10091684
1506 Ga0307407_10221988
1507 Ga0307409_100004292
1508 Ga0307409_100023190
1509 Ga0307409_100124196
1510 Ga0307409_100132326
1511 Ga0307409_100134882
1512 Ga0307409_100484803
1513 Ga0307416_100001236
1514 Ga0307416_100028930
1515 Ga0307416_100048452
1516 Ga0307416_100089060
1517 Ga0307416_100165575
1518 Ga0307416_100268724
1519 Ga0307416_100497365
1520 Ga0307411_10002945
1521 Ga0307411_10081513
1522 Ga0307411_10104615
1523 Ga0307415_100003696
1524 Ga0307415_100042383
1525 Ga0307415_100258218
1526 Ga0316583_10015714
1527 Ga0316585_10008848
1528 Ga0316585_10033923
1529 Ga0316585_10050710
1530 Ga0316580_10000523
1531 Ga0316580_10006681
1532 Ga0316580_10014380
1533 Ga0316580_10020582
1534 Ga0316593_10001400
1535 Ga0316593_10005726
1536 Ga0316593_10008151
1537 Ga0316593_10021162
1538 Ga0316593_10021597
1539 Ga0307507_10022327
1540 Ga0316592_1001415
1541 Ga0316586_1004449
1542 Ga0316588_1004450
1543 Ga0316588_1005395
1544 Ga0316588_1007960
1545 Ga0316588_1017806
1546 Ga0316587_1001928
1547 Ga0316587_1014958
1548 Ga0316587_1018704
1549 Ga0316596_1013240
1550 Ga0316596_1014493
1551 Ga0373926_0005213
1552 Ga0373934_0002111
1553 Ga0373954_0000284
1554 Ga0373956_0000996
1555 Ga0373956_0139692
1556 Ga0373955_0066479
1557 Ga0316574_0001201
1558 Ga0316574_0002122
1559 Ga0316574_0003293
1560 Ga0316574_0003902
1561 Ga0316574_0003963
1562 Ga0316574_0007850
1563 Ga0316574_0012529
1564 Ga0316574_0013379
1565 Ga0316574_0017743
1566 Ga0316574_0042760
1567 Ga0316574_0055240
1568 Ga0316574_0064009
1569 Ga0316574_0064475
1570 Ga0316574_0096268
1571 Ga0316574_0111736
1572 Ga0316574_0135563
1573 Ga0316574_0154653
1574 Ga0316574_0158357
1575 Ga0316574_0161734
1576 Ga0373924_0002671
1577 Ga0373924_0038118
1578 Ga0373931_0046143
1579 Ga0373935_0003679
1580 Ga0373935_0034934
1581 Ga0373935_0153412
1582 Ga0373927_0028535
1583 Ga0373927_0040395
1584 Ga0373933_0009642
1585 Ga0373933_0155183
1586 Ga0373947_0000740
1587 Ga0373937_0079023
1588 Ga0373937_0130992
1589 Ga0373937_0147931
1590 Ga0373937_0308532
1591 Ga0316582_0018517
1592 Ga0316582_0042542
1593 Ga0316582_0044199
1594 Ga0316582_0046563
1595 Ga0316582_0051069
1596 Ga0316582_0055054
1597 Ga0316582_0055368
1598 Ga0316582_0059869
1599 Ga0316582_0101088
1600 Ga0316582_0316630
1601 Ga0316584_0001897
1602 Ga0316584_0013099
1603 Ga0316584_0013283
1604 Ga0316584_0014220
1605 Ga0316584_0016020
1606 Ga0316584_0016776
1607 Ga0316584_0029909
1608 Ga0316584_0035379
1609 Ga0316584_0048622
1610 Ga0316584_0060909
1611 Ga0316584_0065573
1612 Ga0316584_0087928
1613 Ga0316584_0090466
1614 Ga0316584_0100478
1615 Ga0316584_0174556
1616 Ga0316584_0198278
1617 Ga0316584_0268650
1618 Ga0373925_0013087
1619 Ga0373925_0014962
1620 Ga0373925_0025412
1621 Ga0373925_0062685
1622 Ga0395899_0117861
1623 Ga0395900_0061724
1624 Ga0395898_0121693
1625 Ga0395898_0232976
1626 Ga0395905_0000090
1627 Ga0395905_0027816
1628 Ga0395905_0042860
1629 Ga0395905_0050933
1630 Ga0395905_0133205
1631 Ga0395905_0142817
1632 Ga0395905_0195530
1633 Ga0316581_0015139
1634 Ga0436364_0410612
1635 Ga0436364_1086943
1636 Ga0395901_0001398
1637 Ga0395901_0024823
1638 Ga0400490_50633
1639 Ga0400491_16945
1640 Ga0400488_53777
1641 Ga0400483_027323
1642 Ga0400483_061984
1643 Ga0400483_063435
1644 Ga0400483_075120
1645 Ga0400483_142661
1646 Ga0400483_163069
1647 Ga0400483_166407
1648 Ga0400483_189406
1649 Ga0400483_212256
1650 Ga0400483_274218
1651 Ga0400487_18541
1652 Ga0400487_20179
1653 Ga0436365_0391497
1654 Ga0436365_1362540
1655 Ga0436361_0162216
1656 Ga0436361_0408050
1657 Ga0436361_0687968
1658 Ga0436361_0950210
1659 Ga0436361_0976615
1660 Ga0436361_0995760
1661 Ga0436361_1012027
1662 Ga0436361_1218959
1663 Ga0436362_0536411
1664 Ga0439439_0004069
1665 Ga0439466_0035089
1666 Ga0439431_0009831
1667 Ga0439431_0014286
1668 Ga0439441_007345
1669 Ga0439445_0011025
1670 Ga0439432_009430
1671 Ga0439449_0002444
1672 Ga0439462_0015414
1673 Ga0450906_004112
1674 Ga0439446_0021158
1675 Ga0439434_0006109
1676 Ga0451577_0001417
1677 Ga0451577_0003021
1678 Ga0451577_0023295
1679 Ga0451577_0035928
1680 Ga0451577_0093041
1681 Ga0451577_0188976
1682 Ga0453683_0001483
1683 Ga0453683_0002876
1684 Ga0453683_0008630
1685 Ga0453683_0067817
1686 Ga0466965_0035114
1687 Ga0466966_0149487
1688 Ga0453684_0000006
1689 Ga0453684_0000027
1690 Ga0453684_0000029
1691 Ga0453684_0000847
1692 Ga0453684_0000969
1693 Ga0453684_0002999
1694 Ga0453684_0009614
1695 Ga0453684_0016369
1696 Ga0453684_0020712
1697 Ga0453684_0054458
1698 Ga0453684_0080090
1699 Ga0453684_0082591
1700 Ga0453684_0085048
1701 Ga0453684_0154167
1702 Ga0453684_0273625
1703 Ga0453684_0344330
1704 Ga0466957_0045844
1705 Ga0466960_0023445
1706 Ga0466960_0049913
1707 Ga0451576_0000029
1708 Ga0451576_0000219
1709 Ga0451576_0000483
1710 Ga0451576_0002900
1711 Ga0451576_0004162
1712 Ga0451576_0004755
1713 Ga0451576_0005937
1714 Ga0451576_0021596
1715 Ga0451576_0038947
1716 Ga0451576_0040519
1717 Ga0451576_0101011
1718 Ga0451576_0139185
1719 Ga0466967_0326688
1720 Ga0495592_0082814
1721 Ga0495590_0001807
1722 Ga0495641_0016725
1723 Ga0495651_0003692
1724 Ga0495580_0000277
1725 Ga0495580_0022054
1726 Ga0495662_0005209
1727 Ga0495608_0011389
1728 Ga0495608_0021836
1729 Ga0495608_0147857
1730 Ga0495618_0048665
1731 Ga0495628_0013619
1732 Ga0495663_0029949
1733 Ga0495666_0120431
1734 Ga0495665_0014376
1735 Ga0495586_0011145
1736 Ga0495621_0010777
1737 Ga0495597_0041970
1738 Ga0495667_0002820
1739 Ga0495656_0000108
1740 Ga0495634_0134521
1741 Ga0495635_0033171
1742 Ga0495657_0002668
1743 Ga0495657_0089781
1744 Ga0495646_0095193
1745 Ga0495647_0003619
1746 Ga0495647_0010396
1747 Ga0495647_0070205
1748 Ga0495658_0048513
1749 Ga0495658_0193574
1750 Ga0495600_0133935
1751 Ga0495604_0100946
1752 Ga0495636_0089846
1753 Ga0495687_000500
1754 Ga0495675_0182716
1755 Ga0495684_0036162
1756 Ga0495684_0036614
1757 Ga0495684_0049532
1758 Ga0495684_0216699
1759 Ga0496100_0119016
1760 Ga0496100_0248520
1761 Ga0496101_0002757
1762 Ga0496101_0020182
1763 Ga0496104_0069539
1764 Ga0496104_0108391
1765 Ga0496105_0003923
1766 Ga0496105_0154328
1767 Ga0496106_0013966
1768 Ga0496108_0006306
1769 Ga0496108_0027054
1770 Ga0496108_0035004
1771 Ga0496108_0094726
1772 Ga0496108_0263247
1773 Ga0496108_0411674
1774 Ga0496109_0017015
1775 Ga0496109_0038622
1776 Ga0496109_0100982
1777 Ga0496110_0020809
1778 Ga0496110_0098626
1779 Ga0496111_0064345
1780 Ga0496112_0082650
1781 Ga0496112_0128530
1782 Ga0496112_0175868
1783 Ga0496113_0020502
1784 Ga0496113_0081507
1785 Ga0496114_0000953
1786 Ga0496114_0010629
1787 Ga0496114_0037383
1788 Ga0496115_0029355
1789 Ga0496115_0055372
1790 Ga0495682_0011325
1791 Ga0501031_0000192
1792 Ga0501031_0024609
1793 Ga0501031_0058405
1794 Ga0501031_0200781
1795 Ga0501032_0009318
1796 Ga0501032_0068724
1797 Ga0501032_0115477
1798 Ga0501033_0004357
1799 Ga0501033_0005975
1800 Ga0501034_0003674
1801 Ga0501034_0003691
1802 Ga0501034_0217159
1803 Ga0501034_0396322
1804 Ga0501034_0429352
1805 Ga0501036_0037673
1806 Ga0501036_0041567
1807 Ga0501036_0247043
1808 Ga0501036_0424112
1809 Ga0501037_0004553
1810 Ga0501037_0053143
1811 Ga0501038_0015594
1812 Ga0501039_0070352
1813 Ga0501039_0131586
1814 Ga0501039_0157073
1815 Ga0501039_0263343
1816 Ga0501040_0024604
1817 Ga0501040_0067360
1818 Ga0501041_0017992
1819 Ga0501041_0111194
1820 Ga0501042_0039246
1821 Ga0501042_0061024
1822 Ga0501043_0012886
1823 Ga0501043_0076676
1824 Ga0501046_0040269
1825 Ga0501046_0048623
1826 Ga0501046_0254064
1827 Ga0501047_0018444
1828 Ga0501047_0034783
1829 Ga0501047_0074774
1830 Ga0501048_0053638
1831 Ga0501048_0149792
1832 Ga0501048_0156413
1833 Ga0501068_0001460
1834 Ga0501068_0039776
1835 Ga0501069_0014398
1836 Ga0501069_0039046
1837 Ga0501070_0003217
1838 Ga0501070_0017006
1839 Ga0501070_0046091
1840 Ga0501071_0047415
1841 Ga0501071_0098342
1842 Ga0501072_0015168
1843 Ga0501072_0188160
1844 Ga0501073_0007822
1845 Ga0501073_0010531
1846 Ga0501073_0054843
1847 Ga0501074_0013206
1848 Ga0501074_0052250
1849 Ga0501074_0063148
1850 Ga0501074_0098935
1851 Ga0501075_0038883
1852 Ga0501076_0004696
1853 Ga0501076_0011413
1854 Ga0501076_0124670
1855 Ga0501076_0128297
1856 Ga0501077_0017709
1857 Ga0501217_000641
1858 Ga0501227_000165
1859 Ga0501079_0020121
1860 Ga0501079_0037957
1861 Ga0501079_0040238
1862 Ga0501079_0104952
1863 Ga0501080_0000758
1864 Ga0501080_0002718
1865 Ga0501080_0011298
1866 Ga0501080_0161903
1867 Ga0501081_0034320
1868 Ga0501083_0005573
1869 Ga0501083_0063940
1870 Ga0501035_0007596
1871 Ga0501035_0017135
1872 Ga0501035_0017319
1873 Ga0501044_0000176
1874 Ga0501044_0004147
1875 Ga0501044_0411864
1876 Ga0501045_0013593
1877 nmdc:mga03683_65265_c1
1878 nmdc:mga03683_8691_c1
1879 nmdc:mga00v17_115499_c1
1880 nmdc:mga00v17_24569_c1
1881 nmdc:mga00v17_28697_c1
1882 nmdc:mga00v17_35818_c1
1883 nmdc:mga0yw44_26981_c1
1884 nmdc:mga0k408_142757_c1
1885 nmdc:mga0k408_20984_c1
1886 nmdc:mga06z11_32407_c1
1887 nmdc:mga07m45_13215_c1
1888 nmdc:mga07m45_197_c1
1889 nmdc:mga07m45_750_c1
1890 nmdc:mga07m45_8392_c1
1891 nmdc:mga05p37_22826_c1
1892 nmdc:mga05p37_33910_c1
1893 nmdc:mga05p37_43553_c1
1894 nmdc:mga05p37_86_c1
1895 nmdc:mga09592_12091_c1
1896 nmdc:mga09592_160573_c1
1897 nmdc:mga09592_25_c1
1898 nmdc:mga09592_36377_c1
1899 nmdc:mga09592_4214_c1
1900 nmdc:mga09592_4372_c1
1901 nmdc:mga09592_92882_c1
1902 nmdc:mga0qj67_164_c1
1903 nmdc:mga0qj67_33698_c1
1904 nmdc:mga0qj67_46733_c1
1905 nmdc:mga0qj67_58216_c1
1906 nmdc:mga06r32_15043_c1
1907 nmdc:mga06r32_19661_c1
1908 nmdc:mga06r32_21156_c1
1909 nmdc:mga06r32_281_c1
1910 nmdc:mga06r32_35827_c1
1911 nmdc:mga06r32_65612_c1
1912 nmdc:mga08y16_148070_c1
1913 nmdc:mga08y16_18553_c1
1914 nmdc:mga08y16_224_c1
1915 nmdc:mga08y16_310337_c1
1916 nmdc:mga08y16_63609_c1
1917 nmdc:mga08y16_8480_c1
1918 nmdc:mga0n895_282058_c1
1919 nmdc:mga0n895_359974_c1
1920 nmdc:mga0n895_953_c1
1921 nmdc:mga0rr50_1829_c1
1922 nmdc:mga0rr50_242298_c1
1923 nmdc:mga08x19_1633_c1
1924 nmdc:mga08x19_19247_c1
1925 nmdc:mga08x19_5264_c1
1926 nmdc:mga0a205_119779_c1
1927 nmdc:mga0a205_2323_c1
1928 nmdc:mga0sz30_5227_c1
1929 Ga0495601_0004731
1930 Ga0495601_0026304
1931 Ga0495601_0129279
1932 Ga0500610_0105139
1933 Ga0495595_0012737
1934 Ga0495619_0011047
1935 Ga0495619_0039034
1936 Ga0495619_0059212
1937 Ga0500583_0035724
1938 Ga0500617_057641
1939 Ga0500568_0016243
1940 Ga0500622_0001264
1941 Ga0500622_0004749
1942 Ga0500637_0010271
1943 Ga0501084_0158522
1944 Ga0501082_0016725
1945 Ga0501082_0085013
1946 Ga0501082_0469107
1947 Ga0530510_0005818
1948 Ga0530510_0019992
1949 Ga0530510_0123926
1950 2523384828
1951 2574433167
1952 2623501357
1953 2847938030
1954 2861527149
1955 2879084423
1956 2885195591
1957 2885410015
1958 2891634610
1959 2901312026
1960 639786823
1961 8001524625
1962 8056056662

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

125

282

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3can-assembly1.cif.gz_A-2 crystal structure of a domain of pyruvate-formate lyase-activating enzyme from bacteroides vulgatus atcc 8482 0.8849 130 294
8fsi-assembly1.cif.gz_A the structure of a crystallizable variant of e. coli pyruvate formate-lyase activating enzyme bound to sam 0.8676 77 291
3can-assembly1.cif.gz_A-2 crystal structure of a domain of pyruvate-formate lyase-activating enzyme from bacteroides vulgatus atcc 8482 0.8646 130 294
3cb8-assembly1.cif.gz_A 4fe-4s-pyruvate formate-lyase activating enzyme in complex with adomet and a peptide substrate 0.8103 56 291
2yx6-assembly3.cif.gz_D-3 crystal structure of ph0822 0.7989 115 158
ID Description Score Start End Superfamily
af_P95188_67_289_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 1.001 69 290 3.20.20.70
af_P95188_67_289_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9918 69 290 3.20.20.70
af_Q58218_60_281_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9666 67 291 3.20.20.70
af_Q58218_60_281_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9581 67 291 3.20.20.70
3canA00 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;pyruvate-formate lyase- activating enzyme 0.8832 130 294 3.80.30.10
ID Description Score Start End GO Terms
AF-A0A1G9MQY4-F1-model_v4 Pyruvate formate lyase activating enzyme 0.9986 1 359 GO:0016829
GO:0046872
GO:0051539
AF-A0A2V6ZC46-F1-model_v4 AmmeMemoRadiSam system radical SAM enzyme 0.9971 7 311 GO:0003824
GO:0046872
GO:0051539
AF-A0A4U0GWB2-F1-model_v4 AmmeMemoRadiSam system radical SAM enzyme 0.9965 3 359 GO:0003824
GO:0046872
GO:0051539
AF-A0A3D3JJK7-F1-model_v4 AmmeMemoRadiSam system radical SAM enzyme 0.9954 7 275 GO:0003824
GO:0046872
GO:0051539
AF-A0A2D6TX55-F1-model_v4 MEMO1 family protein CL561_13240 0.9945 2 359 GO:0003824
GO:0046872
GO:0051539

Map