F487398

General Info

Members Datasets Scaffolds Average Seq Length
981 444 1963 103

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_1182555|Ga0436361_1182555_100_483
Length 127
Sequence MPAQGVLSVSRTRFPHTPVTMDSFYKYHVFFCLNQRDPGADRPSCANCNAQAMQEYAKKRVKQLGLAGPGQVHINKAGCLDRCEEGPAVVVYPEGTWYTYIDESDIDEIVVSHLQNGQVVERLKIDR

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
99 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
125 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
130 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
132 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
133 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
135 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
198 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
213 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
214 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
215 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
216 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
217 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
218 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
219 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
220 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
221 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
222 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
223 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
224 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
225 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
226 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
227 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
228 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
229 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
230 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
231 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
232 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
234 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
235 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
236 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
237 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
238 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
239 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
241 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
242 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
243 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
244 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
245 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
246 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
247 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
248 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
249 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
250 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
251 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
252 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
253 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
254 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
255 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
256 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
257 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
258 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
259 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
260 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
261 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
262 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
263 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
264 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
265 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
266 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
267 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
268 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
269 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
270 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
271 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
272 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
273 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
274 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
275 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
276 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
277 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
278 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
279 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
280 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
281 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
282 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
283 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
284 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
285 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
286 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
287 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
288 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
289 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
290 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
291 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
292 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
293 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
294 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
295 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
296 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
297 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
298 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
299 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
300 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
301 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
302 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
303 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
304 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
305 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
306 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
307 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
308 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
309 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
310 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
311 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
312 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
313 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
314 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
315 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
316 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
317 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
318 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
319 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
320 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
321 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
322 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
323 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
324 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
325 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
326 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
327 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
328 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
329 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
330 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
331 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
332 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
333 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
334 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
335 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
336 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
337 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
338 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
339 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
340 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
341 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
342 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
343 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
344 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
345 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
346 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
347 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
348 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
349 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
350 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
351 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
352 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
353 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
354 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
355 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
356 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
357 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
358 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
359 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
360 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
361 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
362 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
363 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
364 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
365 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
366 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
378 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
379 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
380 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
381 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
382 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
383 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
384 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
385 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
386 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
387 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
388 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
389 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
390 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
391 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
392 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
393 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
394 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
395 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
396 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
397 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
398 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
399 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
400 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
401 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
404 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
405 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
406 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
407 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
408 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
409 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
410 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
411 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
412 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
413 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
414 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
415 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
416 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
417 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
418 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
419 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
420 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
424 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
425 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
426 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
427 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
428 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
429 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
430 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
431 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
432 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
433 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
434 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
435 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
436 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
437 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
438 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
439 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
440 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
441 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
442 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
443 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
444 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.45
Metatranscriptomes 0.41
Isolates 2.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.94
Nodule 0.92
Rhizoplane 1.94
Rhizosphere 92.66
Stem 0
Stem Tuber 0
Unclassified 3.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_1182555 3300039447 Bacteria 934
2 JGI24739J22299_10090089 3300001989 Bacteria 934
3 JGI24737J22298_10235586 3300001990 Bacteria 540
4 JGI25156J39149_1052173 3300002705 Bacteria 534
5 rootH1_10054400 3300003316 Bacteria 2871
6 rootL2_10349020 3300003322 Bacteria 1136
7 rootH1_10132885 3300003316 Bacteria 1512
8 rootH1_10132885 3300003323 Bacteria 4122
9 Ga0055527_1002500 3300003760 Bacteria 3093
10 Ga0055535_1004905 3300003761 Bacteria 3093
11 Ga0055542_1035846 3300003762 Bacteria 608
12 Ga0055529_1026361 3300003763 Bacteria 717
13 Ga0055526_1000149 3300003771 Bacteria 61682
14 Ga0065707_10603957 3300005295 Bacteria 688
15 Ga0070658_10065736 3300005327 Bacteria 2961
16 Ga0070676_10001435 3300005328 Bacteria 12035
17 Ga0070676_10247279 3300005328 Bacteria 1189
18 Ga0070676_10321729 3300005328 Bacteria 1055
19 Ga0070676_10331220 3300005328 Bacteria 1041
20 Ga0070683_100069027 3300005329 Bacteria 3294
21 Ga0070690_100776109 3300005330 Bacteria 742
22 Ga0070670_100003563 3300005331 Bacteria 12943
23 Ga0070670_100010188 3300005331 Bacteria 8021
24 Ga0070670_100039316 3300005331 Bacteria 4068
25 Ga0070670_100136031 3300005331 Bacteria 2124
26 Ga0070670_100261144 3300005331 Bacteria 1510
27 Ga0070670_100332215 3300005331 Bacteria 1333
28 Ga0070670_100750698 3300005331 Unclassified 879
29 Ga0070677_10000343 3300005333 Bacteria 16239
30 Ga0068869_100009083 3300005334 Bacteria 6441
31 Ga0068869_100039879 3300005334 Bacteria 3355
32 Ga0068869_101066159 3300005334 Bacteria 706
33 Ga0070666_10530612 3300005335 Unclassified 855
34 Ga0070680_100047758 3300005336 Bacteria 3486
35 Ga0070682_101119016 3300005337 Bacteria 660
36 Ga0068868_100015555 3300005338 Bacteria 5630
37 Ga0068868_100205658 3300005338 Bacteria 1643
38 Ga0068868_101003437 3300005338 Bacteria 764
39 Ga0070689_100044203 3300005340 Bacteria 3426
40 Ga0070689_100233871 3300005340 Bacteria 1511
41 Ga0070689_100372085 3300005340 Bacteria 1202
42 Ga0070689_100494696 3300005340 Bacteria 1047
43 Ga0070689_100797461 3300005340 Unclassified 830
44 Ga0070687_100105981 3300005343 Bacteria 1583
45 Ga0070661_101770516 3300005344 Bacteria 524
46 Ga0070692_10007318 3300005345 Bacteria 4859
47 Ga0070692_10042581 3300005345 Bacteria 2332
48 Ga0070692_10050336 3300005345 Bacteria 2163
49 Ga0070692_10378737 3300005345 Bacteria 887
50 Ga0070668_100006797 3300005347 Bacteria 8481
51 Ga0070668_100010955 3300005347 Bacteria 6747
52 Ga0070668_100025704 3300005347 Bacteria 4466
53 Ga0070668_100027239 3300005347 Bacteria 4339
54 Ga0070668_100110179 3300005347 Bacteria 2190
55 Ga0070668_100259447 3300005347 Bacteria 1445
56 Ga0070668_100274145 3300005347 Bacteria 1407
57 Ga0070668_100638347 3300005347 Bacteria 935
58 Ga0070668_101861703 3300005347 Bacteria 554
59 Ga0070669_100002973 3300005353 Bacteria 12215
60 Ga0070669_100021805 3300005353 Bacteria 4580
61 Ga0070669_100251345 3300005353 Bacteria 1408
62 Ga0070675_100003678 3300005354 Bacteria 11653
63 Ga0070675_100012472 3300005354 Bacteria 6659
64 Ga0070675_100024736 3300005354 Bacteria 4809
65 Ga0070675_100027916 3300005354 Bacteria 4538
66 Ga0070675_100029547 3300005354 Bacteria 4422
67 Ga0070675_100283993 3300005354 Bacteria 1455
68 Ga0070671_100000272 3300005355 Bacteria 34885
69 Ga0070671_100008199 3300005355 Bacteria 8360
70 Ga0070671_100270159 3300005355 Bacteria 1445
71 Ga0070671_102058122 3300005355 Unclassified 508
72 Ga0070674_100005249 3300005356 Bacteria 7458
73 Ga0070674_100034622 3300005356 Bacteria 3375
74 Ga0070674_101500840 3300005356 Unclassified 606
75 Ga0070673_100001140 3300005364 Bacteria 15254
76 Ga0070673_100026294 3300005364 Bacteria 4297
77 Ga0070673_100072629 3300005364 Bacteria 2767
78 Ga0070673_100121931 3300005364 Unclassified 2176
79 Ga0070688_100354713 3300005365 Bacteria 1075
80 Ga0070688_101516301 3300005365 Bacteria 546
81 Ga0070659_100083041 3300005366 Bacteria 2560
82 Ga0070659_101152340 3300005366 Bacteria 684
83 Ga0070667_100052861 3300005367 Bacteria 3428
84 Ga0070667_100140760 3300005367 Bacteria 2113
85 Ga0070667_100634378 3300005367 Bacteria 986
86 Ga0070703_10044843 3300005406 Bacteria 1392
87 Ga0070714_102010201 3300005435 Bacteria 564
88 Ga0070713_100225309 3300005436 Bacteria 1702
89 Ga0070701_10121258 3300005438 Bacteria 1473
90 Ga0070701_10201152 3300005438 Bacteria 1178
91 Ga0070705_100016156 3300005440 Bacteria 3874
92 Ga0070705_100020022 3300005440 Bacteria 3532
93 Ga0070705_100036344 3300005440 Bacteria 2769
94 Ga0070705_100115744 3300005440 Bacteria 1722
95 Ga0070700_100001031 3300005441 Bacteria 13767
96 Ga0070700_100268752 3300005441 Bacteria 1231
97 Ga0070700_100285341 3300005441 Unclassified 1199
98 Ga0070700_100306351 3300005441 Bacteria 1161
99 Ga0070700_100365933 3300005441 Bacteria 1073
100 Ga0070694_100028846 3300005444 Bacteria 3615
101 Ga0070694_100040671 3300005444 Bacteria 3099
102 Ga0070694_100067401 3300005444 Bacteria 2457
103 Ga0070694_100502819 3300005444 Bacteria 965
104 Ga0070694_100809555 3300005444 Bacteria 769
105 Ga0070663_100001918 3300005455 Bacteria 11608
106 Ga0070663_100027027 3300005455 Bacteria 3892
107 Ga0070678_100085002 3300005456 Bacteria 2410
108 Ga0070678_100098340 3300005456 Bacteria 2262
109 Ga0070678_100184096 3300005456 Bacteria 1712
110 Ga0070678_101195126 3300005456 Bacteria 705
111 Ga0070662_100014326 3300005457 Bacteria 5295
112 Ga0070662_100374375 3300005457 Bacteria 1171
113 Ga0070662_101068537 3300005457 Bacteria 692
114 Ga0070681_10004336 3300005458 Bacteria 13482
115 Ga0070681_10232956 3300005458 Bacteria 1756
116 Ga0070681_10685450 3300005458 Bacteria 940
117 Ga0068867_100002138 3300005459 Bacteria 13877
118 Ga0068867_100012234 3300005459 Bacteria 6065
119 Ga0068867_100083659 3300005459 Bacteria 2409
120 Ga0068867_100119410 3300005459 Bacteria 2035
121 Ga0068867_100484352 3300005459 Bacteria 1060
122 Ga0068867_100653289 3300005459 Bacteria 923
123 Ga0070685_10191559 3300005466 Bacteria 1323
124 Ga0070706_100169581 3300005467 Bacteria 2038
125 Ga0070707_100796182 3300005468 Bacteria 909
126 Ga0070698_100271956 3300005471 Bacteria 1626
127 Ga0070698_100702411 3300005471 Bacteria 953
128 Ga0070698_100770047 3300005471 Bacteria 906
129 Ga0070699_101378827 3300005518 Bacteria 647
130 Ga0070679_100449119 3300005530 Bacteria 1234
131 Ga0070679_100778638 3300005530 Bacteria 900
132 Ga0070679_101976911 3300005530 Bacteria 532
133 Ga0070684_100848038 3300005535 Bacteria 855
134 Ga0070697_100033084 3300005536 Bacteria 4163
135 Ga0068853_100004289 3300005539 Bacteria 11022
136 Ga0068853_100388817 3300005539 Bacteria 1304
137 Ga0068853_101408921 3300005539 Bacteria 674
138 Ga0070672_100054860 3300005543 Bacteria 3121
139 Ga0070672_100088452 3300005543 Bacteria 2494
140 Ga0070672_100143722 3300005543 Bacteria 1970
141 Ga0070672_100250812 3300005543 Bacteria 1491
142 Ga0070672_100258234 3300005543 Unclassified 1469
143 Ga0070672_100514592 3300005543 Bacteria 1036
144 Ga0070672_100580341 3300005543 Bacteria 975
145 Ga0070672_101403050 3300005543 Bacteria 625
146 Ga0070672_101659165 3300005543 Bacteria 574
147 Ga0070686_100073813 3300005544 Bacteria 2240
148 Ga0070686_100643806 3300005544 Unclassified 840
149 Ga0070695_100000362 3300005545 Bacteria 23307
150 Ga0070695_100041788 3300005545 Bacteria 2908
151 Ga0070695_100200820 3300005545 Bacteria 1425
152 Ga0070695_100334984 3300005545 Bacteria 1129
153 Ga0070695_100394208 3300005545 Bacteria 1048
154 Ga0070695_100634511 3300005545 Bacteria 842
155 Ga0070696_100000505 3300005546 Bacteria 24609
156 Ga0070696_100053479 3300005546 Bacteria 2811
157 Ga0070696_100161151 3300005546 Bacteria 1653
158 Ga0070696_100196947 3300005546 Bacteria 1502
159 Ga0070696_100421529 3300005546 Bacteria 1048
160 Ga0070696_101117185 3300005546 Bacteria 663
161 Ga0070696_102012307 3300005546 Bacteria 502
162 Ga0070693_100140515 3300005547 Bacteria 1520
163 Ga0070693_100578294 3300005547 Bacteria 808
164 Ga0070693_100595189 3300005547 Bacteria 798
165 Ga0070693_101221868 3300005547 Bacteria 578
166 Ga0070665_100142453 3300005548 Bacteria 2400
167 Ga0070665_100142944 3300005548 Bacteria 2396
168 Ga0070665_100172776 3300005548 Bacteria 2162
169 Ga0070665_100504639 3300005548 Bacteria 1221
170 Ga0070665_100648163 3300005548 Bacteria 1069
171 Ga0070665_100832906 3300005548 Unclassified 936
172 Ga0070704_100016021 3300005549 Bacteria 4726
173 Ga0070704_101142662 3300005549 Bacteria 709
174 Ga0070704_102207376 3300005549 Bacteria 512
175 Ga0068855_100511907 3300005563 Bacteria 1303
176 Ga0068855_101961287 3300005563 Bacteria 592
177 Ga0068855_102032307 3300005563 Bacteria 580
178 Ga0070664_100036137 3300005564 Bacteria 4150
179 Ga0070664_100439196 3300005564 Bacteria 1197
180 Ga0070664_100987814 3300005564 Bacteria 791
181 Ga0068857_100978731 3300005577 Bacteria 814
182 Ga0068857_101698472 3300005577 Unclassified 617
183 Ga0068854_100084706 3300005578 Bacteria 2346
184 Ga0068854_100366708 3300005578 Bacteria 1183
185 Ga0068854_100470663 3300005578 Bacteria 1053
186 Ga0068854_100484517 3300005578 Bacteria 1039
187 Ga0068856_100144536 3300005614 Bacteria 2386
188 Ga0068856_100338379 3300005614 Bacteria 1523
189 Ga0070702_100008243 3300005615 Bacteria 5036
190 Ga0070702_100138509 3300005615 Bacteria 1547
191 Ga0070702_100179160 3300005615 Bacteria 1385
192 Ga0070702_100348826 3300005615 Bacteria 1042
193 Ga0070702_100463840 3300005615 Bacteria 922
194 Ga0070702_100583979 3300005615 Bacteria 835
195 Ga0068852_100002156 3300005616 Bacteria 13522
196 Ga0068852_101755589 3300005616 Bacteria 643
197 Ga0068859_100024361 3300005617 Bacteria 6072
198 Ga0068859_100680431 3300005617 Bacteria 1120
199 Ga0068859_101040905 3300005617 Unclassified 899
200 Ga0068859_102056068 3300005617 Bacteria 631
201 Ga0068859_102283931 3300005617 Bacteria 597
202 Ga0068859_102341637 3300005617 Bacteria 589
203 Ga0068859_103146018 3300005617 Bacteria 503
204 Ga0068864_100034508 3300005618 Bacteria 4303
205 Ga0068864_100035655 3300005618 Bacteria 4236
206 Ga0068864_100062455 3300005618 Bacteria 3227
207 Ga0068864_100155302 3300005618 Bacteria 2076
208 Ga0068864_100176547 3300005618 Bacteria 1951
209 Ga0068864_101331595 3300005618 Bacteria 719
210 Ga0068866_10321836 3300005718 Bacteria 973
211 Ga0068866_10418662 3300005718 Bacteria 868
212 Ga0068861_100001104 3300005719 Bacteria 16728
213 Ga0068861_100086738 3300005719 Bacteria 2461
214 Ga0068861_100210631 3300005719 Bacteria 1637
215 Ga0068861_100242385 3300005719 Bacteria 1534
216 Ga0068861_100336369 3300005719 Bacteria 1320
217 Ga0068861_100715396 3300005719 Bacteria 932
218 Ga0068861_100793843 3300005719 Bacteria 888
219 Ga0068861_101379962 3300005719 Unclassified 688
220 Ga0068851_10001153 3300005834 Bacteria 11457
221 Ga0068851_10620193 3300005834 Bacteria 660
222 Ga0068851_10979707 3300005834 Bacteria 533
223 Ga0068870_10020819 3300005840 Bacteria 3200
224 Ga0068870_10058629 3300005840 Bacteria 2061
225 Ga0068870_10063872 3300005840 Bacteria 1987
226 Ga0068870_10072546 3300005840 Bacteria 1881
227 Ga0068870_10176719 3300005840 Bacteria 1278
228 Ga0068863_100019911 3300005841 Bacteria 6418
229 Ga0068863_100020923 3300005841 Bacteria 6248
230 Ga0068863_100037554 3300005841 Bacteria 4611
231 Ga0068863_100279781 3300005841 Bacteria 1616
232 Ga0068863_100577917 3300005841 Bacteria 1111
233 Ga0068858_100014384 3300005842 Bacteria 7460
234 Ga0068858_100820756 3300005842 Bacteria 908
235 Ga0068858_100908099 3300005842 Bacteria 861
236 Ga0068860_100074707 3300005843 Bacteria 3224
237 Ga0068860_100115727 3300005843 Bacteria 2564
238 Ga0068860_100626423 3300005843 Unclassified 1082
239 Ga0068860_100630676 3300005843 Bacteria 1079
240 Ga0068862_100001798 3300005844 Bacteria 19403
241 Ga0068862_100093345 3300005844 Bacteria 2624
242 Ga0068862_100169713 3300005844 Bacteria 1953
243 Ga0068862_100201451 3300005844 Bacteria 1795
244 Ga0068862_100418843 3300005844 Bacteria 1256
245 Ga0068862_100611945 3300005844 Bacteria 1047
246 Ga0068862_101069913 3300005844 Bacteria 800
247 Ga0070715_10714684 3300006163 Bacteria 600
248 Ga0070716_100247135 3300006173 Bacteria 1213
249 Ga0070716_100453044 3300006173 Bacteria 936
250 Ga0075366_10567510 3300006195 Bacteria 703
251 Ga0075366_10867145 3300006195 Bacteria 562
252 Ga0097621_100013711 3300006237 Bacteria 6051
253 Ga0097621_100014830 3300006237 Bacteria 5845
254 Ga0097621_100116903 3300006237 Bacteria 2259
255 Ga0097621_101322934 3300006237 Bacteria 681
256 Ga0068871_100028272 3300006358 Bacteria 4395
257 Ga0068871_100444041 3300006358 Bacteria 1162
258 Ga0068871_100647272 3300006358 Bacteria 965
259 Ga0068871_100964219 3300006358 Bacteria 793
260 Ga0068871_100994484 3300006358 Bacteria 781
261 Ga0068871_101823323 3300006358 Bacteria 578
262 Ga0075428_100139214 3300006844 Bacteria 2638
263 Ga0075428_100782575 3300006844 Bacteria 1014
264 Ga0075428_101258707 3300006844 Bacteria 779
265 Ga0075430_100003340 3300006846 Bacteria 13437
266 Ga0075430_100626827 3300006846 Bacteria 887
267 Ga0075430_101410397 3300006846 Bacteria 572
268 Ga0075430_101444695 3300006846 Bacteria 565
269 Ga0075431_100146664 3300006847 Bacteria 2432
270 Ga0075431_100752966 3300006847 Bacteria 949
271 Ga0075433_10231742 3300006852 Bacteria 1640
272 Ga0075433_10255444 3300006852 Bacteria 1554
273 Ga0075434_100100901 3300006871 Bacteria 2892
274 Ga0075434_100697291 3300006871 Bacteria 1033
275 Ga0075434_102366301 3300006871 Bacteria 533
276 Ga0075429_100003041 3300006880 Bacteria 14216
277 Ga0068865_100026154 3300006881 Unclassified 3845
278 Ga0068865_100028722 3300006881 Bacteria 3683
279 Ga0068865_100032078 3300006881 Bacteria 3507
280 Ga0075436_100005116 3300006914 Bacteria 9027
281 Ga0075436_100008567 3300006914 Bacteria 6989
282 Ga0075436_100014985 3300006914 Bacteria 5315
283 Ga0075436_100023095 3300006914 Bacteria 4271
284 Ga0075436_100027380 3300006914 Bacteria 3923
285 Ga0097620_100024361 3300006931 Bacteria 6072
286 Ga0097620_100680472 3300006931 Bacteria 1120
287 Ga0097620_101040940 3300006931 Unclassified 899
288 Ga0097620_102055846 3300006931 Bacteria 631
289 Ga0097620_102283865 3300006931 Bacteria 597
290 Ga0097620_102342153 3300006931 Bacteria 589
291 Ga0097620_103143761 3300006931 Bacteria 503
292 Ga0075435_100048639 3300007076 Bacteria 3407
293 Ga0075435_100153380 3300007076 Bacteria 1938
294 Ga0075435_100441910 3300007076 Bacteria 1121
295 Ga0075435_100500327 3300007076 Bacteria 1051
296 Ga0075435_101044791 3300007076 Bacteria 714
297 Ga0075435_101235768 3300007076 Bacteria 654
298 Ga0099794_10192190 3300007265 Bacteria 1044
299 Ga0105244_10001943 3300009036 Bacteria 16050
300 Ga0111539_10068982 3300009094 Bacteria 4175
301 Ga0111539_10169101 3300009094 Bacteria 2554
302 Ga0111539_10207000 3300009094 Bacteria 2287
303 Ga0111539_10241710 3300009094 Bacteria 2102
304 Ga0111539_10764449 3300009094 Bacteria 1124
305 Ga0111539_11322971 3300009094 Bacteria 836
306 Ga0111539_11333324 3300009094 Bacteria 833
307 Ga0111539_12071521 3300009094 Bacteria 660
308 Ga0105245_10024073 3300009098 Bacteria 5346
309 Ga0105245_10024841 3300009098 Bacteria 5265
310 Ga0105245_10439406 3300009098 Bacteria 1311
311 Ga0105245_10536860 3300009098 Bacteria 1190
312 Ga0105245_11322382 3300009098 Bacteria 770
313 Ga0105245_12026452 3300009098 Bacteria 629
314 Ga0105247_10005196 3300009101 Bacteria 8231
315 Ga0105247_10777281 3300009101 Bacteria 728
316 Ga0114129_10281193 3300009147 Bacteria 2223
317 Ga0114129_11355901 3300009147 Bacteria 879
318 Ga0114129_12654672 3300009147 Bacteria 597
319 Ga0105243_10002425 3300009148 Bacteria 15590
320 Ga0105243_10171534 3300009148 Bacteria 1879
321 Ga0105241_10742711 3300009174 Bacteria 899
322 Ga0105241_11874651 3300009174 Bacteria 587
323 Ga0105242_10006248 3300009176 Bacteria 9176
324 Ga0105242_10196669 3300009176 Bacteria 1788
325 Ga0105242_10305091 3300009176 Bacteria 1454
326 Ga0105242_10429105 3300009176 Bacteria 1240
327 Ga0105248_10000992 3300009177 Bacteria 31434
328 Ga0105248_10088473 3300009177 Bacteria 3486
329 Ga0105248_10341517 3300009177 Bacteria 1686
330 Ga0105248_10681694 3300009177 Bacteria 1159
331 Ga0105237_10016087 3300009545 Bacteria 7781
332 Ga0105238_10957048 3300009551 Bacteria 876
333 Ga0105249_10049127 3300009553 Bacteria 3847
334 Ga0105249_11819985 3300009553 Bacteria 682
335 Ga0105239_10377220 3300010375 Bacteria 1603
336 Ga0105239_10450025 3300010375 Unclassified 1461
337 Ga0105239_10605315 3300010375 Bacteria 1250
338 Ga0105246_10034593 3300011119 Unclassified 3369
339 Ga0105246_10723807 3300011119 Bacteria 875
340 Ga0157371_11556417 3300013102 Bacteria 517
341 Ga0157374_10072086 3300013296 Unclassified 3258
342 Ga0157374_10163480 3300013296 Bacteria 2169
343 Ga0157374_10180513 3300013296 Bacteria 2061
344 Ga0157378_10211669 3300013297 Bacteria 1838
345 Ga0157378_11127728 3300013297 Unclassified 822
346 Ga0157378_11562892 3300013297 Bacteria 705
347 Ga0157378_11805173 3300013297 Bacteria 660
348 Ga0163162_10020397 3300013306 Bacteria 6512
349 Ga0163162_10176898 3300013306 Bacteria 2259
350 Ga0163162_10189891 3300013306 Bacteria 2182
351 Ga0163162_10286935 3300013306 Unclassified 1778
352 Ga0163162_10580090 3300013306 Bacteria 1248
353 Ga0163162_11387607 3300013306 Bacteria 799
354 Ga0163162_12037595 3300013306 Unclassified 658
355 Ga0157372_10338033 3300013307 Bacteria 1754
356 Ga0157375_10012622 3300013308 Bacteria 7497
357 Ga0157375_10045551 3300013308 Bacteria 4270
358 Ga0157375_10057193 3300013308 Bacteria 3854
359 Ga0157375_10101514 3300013308 Bacteria 2960
360 Ga0157375_10531471 3300013308 Bacteria 1339
361 Ga0157375_10826088 3300013308 Bacteria 1074
362 Ga0157375_11653512 3300013308 Bacteria 758
363 Ga0157375_12394512 3300013308 Bacteria 630
364 Ga0163163_10039634 3300014325 Bacteria 4599
365 Ga0163163_10052788 3300014325 Bacteria 4011
366 Ga0163163_10101835 3300014325 Bacteria 2894
367 Ga0163163_10946256 3300014325 Bacteria 925
368 Ga0157380_10005801 3300014326 Bacteria 8642
369 Ga0157380_10041592 3300014326 Bacteria 3587
370 Ga0157380_10200791 3300014326 Bacteria 1769
371 Ga0157380_10778776 3300014326 Bacteria 971
372 Ga0157380_10804785 3300014326 Bacteria 957
373 Ga0157377_10080238 3300014745 Bacteria 1906
374 Ga0157379_10025408 3300014968 Bacteria 5262
375 Ga0157376_10012058 3300014969 Bacteria 6398
376 Ga0157376_10079043 3300014969 Bacteria 2819
377 Ga0157376_10874410 3300014969 Bacteria 915
378 Ga0157376_10955437 3300014969 Bacteria 878
379 Ga0182006_1000216 3300015261 Bacteria 56213
380 Ga0182005_1000119 3300015265 Bacteria 57192
381 Ga0163161_10020699 3300017792 Bacteria 4620
382 Ga0163161_10033804 3300017792 Bacteria 3654
383 Ga0163161_10359575 3300017792 Bacteria 1159
384 Ga0209672_100041 3300025228 Bacteria 278535
385 Ga0209147_100866 3300025229 Bacteria 14070
386 Ga0209437_101838 3300025233 Bacteria 4528
387 Ga0209258_100822 3300025242 Bacteria 17427
388 Ga0209646_1000384 3300025246 Bacteria 28428
389 Ga0209026_1044080 3300025250 Bacteria 643
390 Ga0209148_1001387 3300025254 Bacteria 12523
391 Ga0209759_1056599 3300025256 Bacteria 572
392 Ga0209455_1007106 3300025272 Bacteria 3204
393 Ga0209564_1000010 3300025295 Bacteria 885399
394 Ga0209564_1001321 3300025295 Bacteria 26542
395 Ga0207697_10047453 3300025315 Bacteria 1770
396 Ga0207697_10240881 3300025315 Bacteria 799
397 Ga0207656_10012067 3300025321 Bacteria 3279
398 Ga0207655_1007846 3300025728 Bacteria 6866
399 Ga0207653_10042017 3300025885 Bacteria 1503
400 Ga0207682_10000198 3300025893 Bacteria 27362
401 Ga0207682_10026622 3300025893 Bacteria 2300
402 Ga0207682_10612067 3300025893 Bacteria 513
403 Ga0207642_10008609 3300025899 Bacteria 3512
404 Ga0207642_10196980 3300025899 Bacteria 1110
405 Ga0207688_10154182 3300025901 Bacteria 1359
406 Ga0207680_10057628 3300025903 Bacteria 2351
407 Ga0207647_10009548 3300025904 Bacteria 6886
408 Ga0207685_10585062 3300025905 Bacteria 597
409 Ga0207699_10237170 3300025906 Bacteria 1252
410 Ga0207645_10000676 3300025907 Bacteria 28210
411 Ga0207645_10030039 3300025907 Bacteria 3502
412 Ga0207645_10054591 3300025907 Bacteria 2552
413 Ga0207645_10311729 3300025907 Bacteria 1049
414 Ga0207643_10039589 3300025908 Bacteria 2652
415 Ga0207643_10045286 3300025908 Bacteria 2484
416 Ga0207643_10049201 3300025908 Bacteria 2389
417 Ga0207643_10109580 3300025908 Bacteria 1626
418 Ga0207643_10352679 3300025908 Bacteria 924
419 Ga0207705_10063847 3300025909 Bacteria 2661
420 Ga0207705_10875486 3300025909 Bacteria 696
421 Ga0207684_10112094 3300025910 Bacteria 2335
422 Ga0207654_10464225 3300025911 Bacteria 890
423 Ga0207707_10009678 3300025912 Bacteria 8361
424 Ga0207707_10105173 3300025912 Bacteria 2467
425 Ga0207707_11010548 3300025912 Bacteria 682
426 Ga0207671_10035591 3300025914 Bacteria 3694
427 Ga0207671_10071944 3300025914 Bacteria 2580
428 Ga0207660_10043657 3300025917 Bacteria 3150
429 Ga0207660_10386898 3300025917 Bacteria 1125
430 Ga0207660_10489759 3300025917 Bacteria 997
431 Ga0207662_10070919 3300025918 Bacteria 2108
432 Ga0207662_10239084 3300025918 Bacteria 1188
433 Ga0207662_10686993 3300025918 Bacteria 717
434 Ga0207657_10193589 3300025919 Bacteria 1639
435 Ga0207652_10013645 3300025921 Bacteria 6569
436 Ga0207652_10393285 3300025921 Bacteria 1251
437 Ga0207646_10470972 3300025922 Bacteria 1133
438 Ga0207646_10870301 3300025922 Bacteria 800
439 Ga0207681_10005688 3300025923 Bacteria 7657
440 Ga0207681_10013210 3300025923 Bacteria 5105
441 Ga0207681_10170319 3300025923 Bacteria 1650
442 Ga0207681_10236162 3300025923 Bacteria 1421
443 Ga0207681_10920762 3300025923 Bacteria 732
444 Ga0207650_10018612 3300025925 Bacteria 4876
445 Ga0207650_10114126 3300025925 Bacteria 2095
446 Ga0207650_10250069 3300025925 Bacteria 1435
447 Ga0207650_10492403 3300025925 Bacteria 1024
448 Ga0207650_10637532 3300025925 Bacteria 898
449 Ga0207650_11494197 3300025925 Bacteria 574
450 Ga0207659_10047713 3300025926 Bacteria 3030
451 Ga0207659_10133056 3300025926 Bacteria 1922
452 Ga0207659_10368540 3300025926 Bacteria 1195
453 Ga0207659_11437017 3300025926 Bacteria 591
454 Ga0207659_11662868 3300025926 Unclassified 544
455 Ga0207687_10029887 3300025927 Bacteria 3668
456 Ga0207687_10487589 3300025927 Bacteria 1027
457 Ga0207687_10548927 3300025927 Bacteria 969
458 Ga0207687_10807528 3300025927 Unclassified 800
459 Ga0207664_10048574 3300025929 Bacteria 3338
460 Ga0207644_10010982 3300025931 Bacteria 5981
461 Ga0207644_10013052 3300025931 Bacteria 5529
462 Ga0207644_11312588 3300025931 Bacteria 608
463 Ga0207690_10937728 3300025932 Bacteria 719
464 Ga0207706_10020283 3300025933 Bacteria 5974
465 Ga0207706_10100010 3300025933 Bacteria 2552
466 Ga0207706_10307885 3300025933 Bacteria 1380
467 Ga0207706_10463432 3300025933 Bacteria 1096
468 Ga0207706_11422832 3300025933 Unclassified 568
469 Ga0207686_10159311 3300025934 Bacteria 1580
470 Ga0207686_10219545 3300025934 Bacteria 1372
471 Ga0207709_11653259 3300025935 Bacteria 532
472 Ga0207670_10018384 3300025936 Bacteria 4248
473 Ga0207670_10164638 3300025936 Bacteria 1658
474 Ga0207670_10353646 3300025936 Bacteria 1164
475 Ga0207670_10374350 3300025936 Bacteria 1133
476 Ga0207670_10536282 3300025936 Bacteria 954
477 Ga0207670_11609061 3300025936 Unclassified 552
478 Ga0207669_10031072 3300025937 Bacteria 2978
479 Ga0207669_10104538 3300025937 Bacteria 1881
480 Ga0207669_10238642 3300025937 Bacteria 1346
481 Ga0207669_10342286 3300025937 Bacteria 1152
482 Ga0207669_11354190 3300025937 Bacteria 605
483 Ga0207704_10011015 3300025938 Bacteria 4436
484 Ga0207704_11683730 3300025938 Bacteria 545
485 Ga0207704_11904836 3300025938 Bacteria 511
486 Ga0207665_10270644 3300025939 Bacteria 1261
487 Ga0207665_10295733 3300025939 Bacteria 1209
488 Ga0207691_10000243 3300025940 Bacteria 53649
489 Ga0207691_10001181 3300025940 Bacteria 25967
490 Ga0207691_10037545 3300025940 Bacteria 4486
491 Ga0207691_10091771 3300025940 Bacteria 2721
492 Ga0207691_10247947 3300025940 Bacteria 1538
493 Ga0207691_10406630 3300025940 Bacteria 1161
494 Ga0207691_10533164 3300025940 Bacteria 996
495 Ga0207691_10588554 3300025940 Bacteria 942
496 Ga0207711_10018678 3300025941 Bacteria 5764
497 Ga0207711_10278090 3300025941 Bacteria 1541
498 Ga0207711_11084510 3300025941 Bacteria 741
499 Ga0207689_10015420 3300025942 Bacteria 6470
500 Ga0207689_10049475 3300025942 Bacteria 3467
501 Ga0207689_10108288 3300025942 Bacteria 2283
502 Ga0207689_10755351 3300025942 Bacteria 821
503 Ga0207689_10882363 3300025942 Bacteria 755
504 Ga0207689_11612523 3300025942 Bacteria 540
505 Ga0207689_11652216 3300025942 Bacteria 532
506 Ga0207679_10070680 3300025945 Bacteria 2631
507 Ga0207679_10544100 3300025945 Bacteria 1041
508 Ga0207679_11258125 3300025945 Bacteria 679
509 Ga0207667_10131745 3300025949 Bacteria 2575
510 Ga0207651_10011474 3300025960 Bacteria 4963
511 Ga0207651_10034413 3300025960 Bacteria 3281
512 Ga0207651_10081940 3300025960 Unclassified 2328
513 Ga0207651_10153936 3300025960 Bacteria 1794
514 Ga0207712_10613324 3300025961 Bacteria 942
515 Ga0207712_12111792 3300025961 Bacteria 504
516 Ga0207668_10005128 3300025972 Bacteria 7706
517 Ga0207668_10007321 3300025972 Bacteria 6559
518 Ga0207668_10007526 3300025972 Bacteria 6481
519 Ga0207668_10036649 3300025972 Bacteria 3275
520 Ga0207668_10093152 3300025972 Bacteria 2219
521 Ga0207668_10730533 3300025972 Bacteria 872
522 Ga0207640_10118510 3300025981 Bacteria 1891
523 Ga0207640_10425787 3300025981 Bacteria 1087
524 Ga0207640_10431519 3300025981 Bacteria 1081
525 Ga0207640_11063617 3300025981 Bacteria 714
526 Ga0207658_10011658 3300025986 Bacteria 5987
527 Ga0207658_10103985 3300025986 Bacteria 2230
528 Ga0207658_10416996 3300025986 Unclassified 1183
529 Ga0207677_10164429 3300026023 Bacteria 1728
530 Ga0207677_10513924 3300026023 Bacteria 1038
531 Ga0207703_10769894 3300026035 Bacteria 918
532 Ga0207703_10912679 3300026035 Unclassified 841
533 Ga0207703_10999934 3300026035 Bacteria 802
534 Ga0207639_10257170 3300026041 Bacteria 1525
535 Ga0207639_11263962 3300026041 Bacteria 693
536 Ga0207678_10000013 3300026067 Bacteria 141619
537 Ga0207708_10002536 3300026075 Bacteria 13436
538 Ga0207708_10058634 3300026075 Bacteria 2937
539 Ga0207708_10159046 3300026075 Bacteria 1783
540 Ga0207708_10178673 3300026075 Bacteria 1684
541 Ga0207708_10229266 3300026075 Bacteria 1491
542 Ga0207708_10394572 3300026075 Bacteria 1143
543 Ga0207708_10834841 3300026075 Bacteria 795
544 Ga0207702_10272306 3300026078 Bacteria 1597
545 Ga0207641_10112676 3300026088 Bacteria 2414
546 Ga0207641_10115124 3300026088 Bacteria 2390
547 Ga0207641_10239056 3300026088 Bacteria 1691
548 Ga0207641_10357094 3300026088 Bacteria 1394
549 Ga0207641_10364275 3300026088 Bacteria 1381
550 Ga0207641_10871257 3300026088 Bacteria 893
551 Ga0207641_12109513 3300026088 Unclassified 564
552 Ga0207641_12291666 3300026088 Bacteria 540
553 Ga0207648_10009225 3300026089 Bacteria 9476
554 Ga0207648_10012144 3300026089 Bacteria 8073
555 Ga0207648_10017883 3300026089 Bacteria 6432
556 Ga0207648_10112143 3300026089 Bacteria 2394
557 Ga0207648_10551302 3300026089 Bacteria 1059
558 Ga0207648_10891868 3300026089 Bacteria 830
559 Ga0207648_11890090 3300026089 Bacteria 558
560 Ga0207676_10033387 3300026095 Bacteria 3887
561 Ga0207676_10129115 3300026095 Bacteria 2146
562 Ga0207676_10150985 3300026095 Bacteria 2001
563 Ga0207676_10202340 3300026095 Bacteria 1756
564 Ga0207676_10482633 3300026095 Bacteria 1174
565 Ga0207674_10396770 3300026116 Bacteria 1333
566 Ga0207674_11218433 3300026116 Bacteria 722
567 Ga0207675_100001853 3300026118 Bacteria 21203
568 Ga0207675_100020956 3300026118 Bacteria 6095
569 Ga0207675_100046593 3300026118 Bacteria 4051
570 Ga0207675_100110998 3300026118 Bacteria 2587
571 Ga0207675_100268847 3300026118 Bacteria 1654
572 Ga0207675_100307665 3300026118 Bacteria 1545
573 Ga0207675_100673391 3300026118 Bacteria 1042
574 Ga0207675_100755244 3300026118 Bacteria 984
575 Ga0207675_100895014 3300026118 Bacteria 904
576 Ga0207675_101003193 3300026118 Bacteria 853
577 Ga0207675_101787281 3300026118 Bacteria 634
578 Ga0207683_10000308 3300026121 Bacteria 44216
579 Ga0207683_10100953 3300026121 Unclassified 2576
580 Ga0207683_10194654 3300026121 Bacteria 1842
581 Ga0207683_11693062 3300026121 Bacteria 582
582 Ga0207698_10014478 3300026142 Bacteria 5245
583 Ga0207698_11364666 3300026142 Bacteria 724
584 Ga0209281_1004553 3300027111 Bacteria 4122
585 Ga0209967_1007547 3300027364 Bacteria 1489
586 Ga0209981_1000274 3300027378 Bacteria 6602
587 Ga0209996_1000426 3300027395 Bacteria 5104
588 Ga0210000_1012802 3300027462 Bacteria 1248
589 Ga0209995_1002372 3300027471 Bacteria 2972
590 Ga0209968_1028162 3300027526 Bacteria 932
591 Ga0209999_1003045 3300027543 Bacteria 2984
592 Ga0209970_1030478 3300027614 Bacteria 936
593 Ga0209971_1093017 3300027682 Bacteria 736
594 Ga0209974_10435536 3300027876 Bacteria 518
595 Ga0207428_10008206 3300027907 Bacteria 9445
596 Ga0207428_10132309 3300027907 Bacteria 1908
597 Ga0268266_10035503 3300028379 Bacteria 4241
598 Ga0268266_10154387 3300028379 Bacteria 2072
599 Ga0268266_10222798 3300028379 Bacteria 1734
600 Ga0268266_10289909 3300028379 Bacteria 1524
601 Ga0268266_10567504 3300028379 Unclassified 1088
602 Ga0268265_10000606 3300028380 Bacteria 35982
603 Ga0268265_10007059 3300028380 Bacteria 7595
604 Ga0268265_10056208 3300028380 Bacteria 2993
605 Ga0268265_10103415 3300028380 Bacteria 2306
606 Ga0268265_10230804 3300028380 Bacteria 1626
607 Ga0268265_10398107 3300028380 Bacteria 1272
608 Ga0268264_10040446 3300028381 Bacteria 3852
609 Ga0268264_10071335 3300028381 Bacteria 2943
610 Ga0268264_10111072 3300028381 Bacteria 2401
611 Ga0268264_10535440 3300028381 Bacteria 1147
612 Ga0268264_10695181 3300028381 Bacteria 1010
613 Ga0307515_10525023 3300028794 Bacteria 793
614 Ga0265338_10000344 3300028800 Bacteria 84742
615 Ga0237817_12217 3300030083 Bacteria 863
616 Ga0265327_10030111 3300031251 Bacteria 3074
617 Ga0307513_10436371 3300031456 Bacteria 1037
618 Ga0307408_100181728 3300031548 Bacteria 1687
619 Ga0307408_100829886 3300031548 Bacteria 841
620 Ga0307408_100831804 3300031548 Bacteria 840
621 Ga0307408_101444943 3300031548 Bacteria 649
622 Ga0316575_10030526 3300031665 Bacteria 2107
623 Ga0316575_10033995 3300031665 Bacteria 2001
624 Ga0316579_10000015 3300031691 Bacteria 39681
625 Ga0316579_10010200 3300031691 Bacteria 3967
626 Ga0316579_10140937 3300031691 Bacteria 1162
627 Ga0316576_10071290 3300031727 Bacteria 2563
628 Ga0316578_10005745 3300031728 Bacteria 6051
629 Ga0316578_10396209 3300031728 Bacteria 818
630 Ga0316577_10001781 3300031733 Bacteria 10385
631 Ga0307413_10976700 3300031824 Bacteria 724
632 Ga0307413_11268788 3300031824 Bacteria 643
633 Ga0307407_10500016 3300031903 Bacteria 891
634 Ga0307412_10372141 3300031911 Bacteria 1154
635 Ga0307412_10911307 3300031911 Bacteria 771
636 Ga0307409_100724543 3300031995 Bacteria 996
637 Ga0307416_101043310 3300032002 Bacteria 921
638 Ga0307416_101562953 3300032002 Bacteria 765
639 Ga0307411_10125767 3300032005 Bacteria 1864
640 Ga0307411_11439750 3300032005 Bacteria 631
641 Ga0316583_10000483 3300032133 Bacteria 11841
642 Ga0316583_10004823 3300032133 Bacteria 4817
643 Ga0316585_10021392 3300032137 Bacteria 1986
644 Ga0316585_10028949 3300032137 Bacteria 1734
645 Ga0316580_10008681 3300032139 Bacteria 3049
646 Ga0316593_10000385 3300032168 Bacteria 7877
647 Ga0373938_0157733 3300034957 Unclassified 607
648 Ga0373929_0118124 3300035085 Bacteria 684
649 Ga0373929_0164303 3300035085 Bacteria 603
650 Ga0373934_0000134 3300035086 Bacteria 27424
651 Ga0373934_0440898 3300035086 Bacteria 546
652 Ga0373949_0052465 3300035090 Bacteria 1031
653 Ga0373949_0074343 3300035090 Bacteria 896
654 Ga0373951_0180728 3300035091 Bacteria 606
655 Ga0373952_0296346 3300035092 Bacteria 503
656 Ga0373923_0625352 3300035111 Bacteria 531
657 Ga0373932_0061752 3300035112 Bacteria 1141
658 Ga0373932_0142798 3300035112 Bacteria 815
659 Ga0373936_0025745 3300035113 Bacteria 2302
660 Ga0373936_0059916 3300035113 Bacteria 1552
661 Ga0373939_0203489 3300035114 Bacteria 750
662 Ga0373939_0465874 3300035114 Unclassified 534
663 Ga0373941_0040943 3300035115 Bacteria 1432
664 Ga0373953_0140382 3300035117 Bacteria 1033
665 Ga0373954_0000002 3300035118 Bacteria 147478
666 Ga0373956_0000006 3300035119 Bacteria 65782
667 Ga0373957_0000372 3300035120 Bacteria 11352
668 Ga0373957_0205146 3300035120 Bacteria 822
669 Ga0373960_0051783 3300035121 Bacteria 1221
670 Ga0373960_0118127 3300035121 Bacteria 877
671 Ga0373960_0246755 3300035121 Unclassified 647
672 Ga0373943_0006741 3300035170 Bacteria 5155
673 Ga0373946_0569281 3300035171 Bacteria 585
674 Ga0373955_0136521 3300035172 Bacteria 1435
675 Ga0373955_0272091 3300035172 Bacteria 1018
676 Ga0373955_0577636 3300035172 Bacteria 688
677 Ga0373942_0320732 3300035207 Bacteria 542
678 Ga0373962_0390465 3300035242 Bacteria 510
679 Ga0316574_0081081 3300035398 Bacteria 2060
680 Ga0316574_0191459 3300035398 Bacteria 1315
681 Ga0316574_0225932 3300035398 Bacteria 1199
682 Ga0373924_0117450 3300035410 Bacteria 1153
683 Ga0373931_0047678 3300035691 Bacteria 2268
684 Ga0373935_0036900 3300035692 Bacteria 3057
685 Ga0373935_1004514 3300035692 Bacteria 620
686 Ga0373927_0018661 3300035695 Bacteria 4553
687 Ga0373927_0047624 3300035695 Bacteria 2773
688 Ga0373933_0000564 3300035724 Bacteria 23136
689 Ga0373933_0079276 3300035724 Bacteria 2011
690 Ga0373933_0161536 3300035724 Bacteria 1423
691 Ga0373933_0247749 3300035724 Bacteria 1147
692 Ga0373947_0025727 3300035725 Bacteria 3432
693 Ga0373947_0838267 3300035725 Bacteria 628
694 Ga0373937_0000358 3300036401 Bacteria 42468
695 Ga0373937_0003219 3300036401 Bacteria 13673
696 Ga0373937_0047835 3300036401 Bacteria 3914
697 Ga0373937_0347205 3300036401 Bacteria 1405
698 Ga0373937_1243825 3300036401 Bacteria 693
699 Ga0316582_0003674 3300036647 Bacteria 7582
700 Ga0316582_0019086 3300036647 Bacteria 4006
701 Ga0316582_0385781 3300036647 Bacteria 964
702 Ga0316584_0008900 3300036712 Bacteria 6941
703 Ga0316584_0099029 3300036712 Bacteria 2183
704 Ga0316584_0188920 3300036712 Bacteria 1524
705 Ga0316584_0514716 3300036712 Bacteria 839
706 Ga0373925_0061295 3300037068 Bacteria 2825
707 Ga0373925_0071100 3300037068 Bacteria 2631
708 Ga0373925_0775520 3300037068 Bacteria 790
709 Ga0395899_0004310 3300037312 Bacteria 11107
710 Ga0395900_0006117 3300037418 Bacteria 12551
711 Ga0395900_0270883 3300037418 Bacteria 1692
712 Ga0395898_0298265 3300037466 Bacteria 1537
713 Ga0395898_1603184 3300037466 Bacteria 575
714 Ga0395905_0035171 3300037471 Bacteria 4703
715 Ga0316581_0001262 3300037588 Bacteria 5612
716 Ga0316581_0001282 3300037588 Bacteria 5581
717 Ga0316581_0054570 3300037588 Bacteria 1225
718 Ga0395901_0085802 3300038443 Bacteria 3291
719 Ga0395901_0255660 3300038443 Bacteria 1824
720 Ga0395901_0661644 3300038443 Bacteria 1046
721 Ga0436360_0635523 3300039438 Bacteria 804
722 Ga0436363_1444570 3300039450 Bacteria 873
723 Ga0451802_1603895 3300041460 Bacteria 583
724 Ga0451807_0680206 3300041486 Bacteria 1997
725 Ga0451807_2332697 3300041486 Bacteria 3050
726 Ga0451849_1451196 3300041505 Bacteria 777
727 Ga0451853_0470233 3300041512 Bacteria 611
728 Ga0439441_000116 3300042001 Bacteria 6525
729 Ga0439443_019482 3300042003 Bacteria 1058
730 Ga0439451_003581 3300042009 Bacteria 3145
731 Ga0439462_0064584 3300042015 Bacteria 991
732 Ga0439446_0028390 3300042156 Bacteria 1610
733 Ga0439434_0000212 3300042435 Bacteria 16124
734 Ga0439435_0000206 3300042436 Bacteria 8300
735 Ga0439435_0013850 3300042436 Bacteria 1982
736 Ga0439444_0002792 3300042437 Bacteria 2418
737 Ga0439460_0000714 3300042461 Bacteria 7402
738 Ga0451577_0023914 3300042876 Bacteria 5565
739 Ga0453683_0028389 3300044673 Bacteria 3544
740 Ga0466963_0602491 3300044694 Bacteria 776
741 Ga0466964_0021058 3300044706 Bacteria 2518
742 Ga0466964_0138052 3300044706 Bacteria 1117
743 Ga0466964_0443880 3300044706 Bacteria 687
744 Ga0453684_0276423 3300044712 Bacteria 1917
745 Ga0466957_0344334 3300044842 Bacteria 1010
746 Ga0451576_0000147 3300045051 Bacteria 179223
747 Ga0451576_0196786 3300045051 Bacteria 2105
748 Ga0451576_1110250 3300045051 Bacteria 827
749 Ga0466967_0001049 3300045976 Bacteria 15200
750 Ga0466967_1158875 3300045976 Bacteria 770
751 Ga0495617_004040 3300046452 Bacteria 5392
752 Ga0495603_0225283 3300046455 Bacteria 1081
753 Ga0495651_0000233 3300046462 Bacteria 42757
754 Ga0495653_0359564 3300046463 Bacteria 934
755 Ga0495650_0001544 3300046471 Bacteria 21838
756 Ga0495650_0003055 3300046471 Bacteria 12597
757 Ga0495650_0003627 3300046471 Bacteria 11112
758 Ga0495580_0026867 3300046472 Bacteria 4192
759 Ga0495605_0000635 3300046474 Bacteria 26971
760 Ga0495584_0027265 3300046491 Bacteria 2894
761 Ga0495584_0164912 3300046491 Bacteria 1126
762 Ga0495585_0024699 3300046492 Bacteria 3444
763 Ga0495607_0249086 3300046501 Bacteria 856
764 Ga0495583_0005068 3300046506 Bacteria 9096
765 Ga0495606_0001517 3300046507 Bacteria 30788
766 Ga0495606_0352355 3300046507 Bacteria 781
767 Ga0495610_0003364 3300046512 Bacteria 12537
768 Ga0495631_0017774 3300046518 Bacteria 3357
769 Ga0495637_0010764 3300046520 Bacteria 4412
770 Ga0495643_0000891 3300046522 Bacteria 31774
771 Ga0495648_0019571 3300046524 Bacteria 4755
772 Ga0495642_0128916 3300046528 Bacteria 1088
773 Ga0495642_0276100 3300046528 Bacteria 736
774 Ga0495652_0678468 3300046529 Bacteria 695
775 Ga0495621_0054065 3300046539 Bacteria 1443
776 Ga0495621_0105592 3300046539 Bacteria 1076
777 Ga0495621_0194908 3300046539 Bacteria 813
778 Ga0495621_0418329 3300046539 Bacteria 570
779 Ga0495597_0000288 3300046542 Bacteria 45373
780 Ga0495597_0001250 3300046542 Bacteria 18776
781 Ga0495622_0407801 3300046557 Bacteria 585
782 Ga0495633_0001228 3300046558 Bacteria 20576
783 Ga0495633_0001987 3300046558 Bacteria 14800
784 Ga0495633_0058546 3300046558 Bacteria 1808
785 Ga0495667_0230855 3300046559 Bacteria 1180
786 Ga0495668_0006127 3300046616 Bacteria 7963
787 Ga0495611_0011338 3300046648 Bacteria 3778
788 Ga0495625_0002229 3300046660 Bacteria 21422
789 Ga0495625_0426629 3300046660 Bacteria 823
790 Ga0495659_0214696 3300046664 Bacteria 793
791 Ga0495659_0232478 3300046664 Bacteria 764
792 Ga0495659_0394030 3300046664 Bacteria 597
793 Ga0495657_0022573 3300046675 Bacteria 4506
794 Ga0495599_0229993 3300046678 Bacteria 1132
795 Ga0495599_0798874 3300046678 Bacteria 539
796 Ga0495623_0334738 3300046679 Bacteria 828
797 Ga0495646_0223782 3300046680 Bacteria 1016
798 Ga0495647_0090012 3300046681 Bacteria 1257
799 Ga0495669_0042821 3300046684 Bacteria 2014
800 Ga0495669_0170482 3300046684 Bacteria 1035
801 Ga0495670_0003908 3300046691 Bacteria 7320
802 Ga0495670_0484820 3300046691 Bacteria 671
803 Ga0495671_0069779 3300046692 Bacteria 1727
804 Ga0495671_0134307 3300046692 Bacteria 1206
805 Ga0495649_0001795 3300046694 Bacteria 15780
806 Ga0495649_0363175 3300046694 Bacteria 730
807 Ga0495589_0041328 3300046794 Bacteria 2301
808 Ga0495604_0150888 3300047317 Bacteria 1651
809 Ga0495636_0001239 3300047318 Bacteria 9652
810 Ga0495636_0037440 3300047318 Bacteria 2003
811 Ga0495636_0074493 3300047318 Bacteria 1454
812 Ga0495636_0161940 3300047318 Bacteria 1008
813 Ga0495674_0011089 3300047319 Bacteria 8509
814 Ga0495672_0001040 3300047320 Bacteria 28407
815 Ga0495676_1076910 3300047321 Bacteria 511
816 Ga0495680_0178343 3300047322 Bacteria 1535
817 Ga0495680_0284998 3300047322 Bacteria 1163
818 Ga0495683_0071477 3300047323 Bacteria 1703
819 Ga0495683_0276296 3300047323 Bacteria 729
820 Ga0495675_0741735 3300047444 Bacteria 547
821 Ga0495677_0019685 3300047445 Bacteria 2447
822 Ga0495677_0140460 3300047445 Bacteria 927
823 Ga0495677_0242725 3300047445 Bacteria 704
824 Ga0495677_0379970 3300047445 Bacteria 558
825 Ga0495686_0105936 3300047472 Bacteria 1691
826 Ga0495602_0030492 3300048088 Bacteria 5113
827 Ga0495615_0182378 3300048090 Bacteria 640
828 Ga0495615_0280598 3300048090 Bacteria 535
829 Ga0496100_1225962 3300048903 Bacteria 592
830 Ga0496102_0000082 3300048905 Bacteria 139079
831 Ga0496102_0047863 3300048905 Bacteria 3887
832 Ga0496102_1062859 3300048905 Bacteria 729
833 Ga0496103_0066025 3300048906 Bacteria 2258
834 Ga0496103_0347642 3300048906 Bacteria 953
835 Ga0496103_0393577 3300048906 Bacteria 890
836 Ga0496106_0192535 3300048909 Bacteria 1622
837 Ga0496107_0379772 3300048910 Bacteria 1051
838 Ga0496108_0344050 3300048911 Bacteria 1301
839 Ga0496110_0536630 3300048913 Bacteria 1064
840 Ga0496111_0523171 3300048914 Bacteria 872
841 Ga0496112_0076310 3300048915 Bacteria 3315
842 Ga0496113_1563851 3300048916 Bacteria 508
843 Ga0496115_0471551 3300048918 Bacteria 1012
844 Ga0496115_1214065 3300048918 Bacteria 566
845 Ga0496116_0048615 3300048919 Bacteria 2845
846 Ga0496120_0173576 3300048923 Bacteria 1064
847 Ga0496122_0046444 3300048925 Bacteria 3363
848 Ga0496123_0006778 3300048926 Bacteria 11006
849 Ga0496124_0358112 3300048927 Bacteria 1029
850 Ga0496125_0040546 3300048928 Bacteria 3993
851 Ga0495678_001082 3300049459 Bacteria 23004
852 Ga0495678_243424 3300049459 Bacteria 537
853 Ga0495682_0080302 3300049460 Bacteria 1173
854 Ga0501291_011127 3300049514 Bacteria 1292
855 Ga0501292_017546 3300049515 Bacteria 1133
856 Ga0501298_122829 3300049521 Bacteria 613
857 Ga0501031_0704530 3300049568 Bacteria 648
858 Ga0501034_0053868 3300049571 Bacteria 4050
859 Ga0501036_0937023 3300049572 Bacteria 710
860 Ga0501036_1745253 3300049572 Bacteria 501
861 Ga0501037_0918886 3300049573 Bacteria 573
862 Ga0501038_0945091 3300049574 Bacteria 635
863 Ga0501039_0020140 3300049575 Bacteria 5115
864 Ga0501040_0609611 3300049576 Bacteria 789
865 Ga0501040_1403187 3300049576 Bacteria 507
866 Ga0501041_0063052 3300049577 Bacteria 2270
867 Ga0501046_0657115 3300049580 Bacteria 741
868 Ga0501047_0175940 3300049581 Bacteria 2007
869 Ga0501048_0465107 3300049582 Bacteria 906
870 Ga0501067_0068582 3300049583 Bacteria 1964
871 Ga0501067_0492210 3300049583 Bacteria 686
872 Ga0501068_0078372 3300049584 Bacteria 2025
873 Ga0501069_0033482 3300049585 Bacteria 2831
874 Ga0501069_0068700 3300049585 Bacteria 1983
875 Ga0501070_0005016 3300049586 Bacteria 11294
876 Ga0501071_0000992 3300049587 Bacteria 15550
877 Ga0501071_0206685 3300049587 Bacteria 1476
878 Ga0501071_0672692 3300049587 Bacteria 797
879 Ga0501072_0039301 3300049588 Bacteria 3715
880 Ga0501072_0044939 3300049588 Bacteria 3472
881 Ga0501072_1566929 3300049588 Bacteria 508
882 Ga0501073_0014106 3300049589 Bacteria 5806
883 Ga0501073_0020687 3300049589 Bacteria 4746
884 Ga0501073_0044227 3300049589 Bacteria 3139
885 Ga0501073_0126736 3300049589 Bacteria 1769
886 Ga0501073_0658564 3300049589 Bacteria 723
887 Ga0501074_0051011 3300049590 Bacteria 2986
888 Ga0501074_0613353 3300049590 Bacteria 769
889 Ga0501075_0004058 3300049591 Bacteria 9884
890 Ga0501075_0190161 3300049591 Bacteria 1566
891 Ga0501076_0007046 3300049592 Bacteria 8166
892 Ga0501076_0989243 3300049592 Bacteria 693
893 Ga0501077_0780346 3300049593 Bacteria 614
894 Ga0501209_120950 3300049656 Bacteria 777
895 Ga0501210_041048 3300049657 Bacteria 508
896 Ga0501227_214815 3300049665 Bacteria 547
897 Ga0501233_080143 3300049668 Bacteria 839
898 Ga0501236_108293 3300049670 Bacteria 553
899 Ga0501238_036258 3300049671 Bacteria 720
900 Ga0501229_025299 3300049706 Bacteria 798
901 Ga0501079_0298026 3300049741 Bacteria 1261
902 Ga0501080_0000702 3300049742 Bacteria 26939
903 Ga0501080_0108918 3300049742 Bacteria 2567
904 Ga0501080_0165598 3300049742 Bacteria 2040
905 Ga0501080_0440280 3300049742 Bacteria 1169
906 Ga0501080_0553069 3300049742 Bacteria 1025
907 Ga0501081_0017373 3300049743 Bacteria 4761
908 Ga0501083_0047000 3300049744 Bacteria 2918
909 Ga0501263_030547 3300049760 Bacteria 760
910 Ga0501268_162210 3300049765 Bacteria 522
911 Ga0501035_0526722 3300049822 Bacteria 970
912 Ga0501035_1443530 3300049822 Bacteria 526
913 Ga0501044_0930798 3300049823 Bacteria 743
914 Ga0501045_0202285 3300049824 Bacteria 1480
915 nmdc:mga05p37_325958_c1 3300050507 Bacteria 1816
916 nmdc:mga09592_1739728_c1 3300050508 Bacteria 502
917 nmdc:mga09592_24148_c1 3300050508 Bacteria 5026
918 nmdc:mga09592_310877_c1 3300050508 Bacteria 1366
919 nmdc:mga0qj67_1283043_c1 3300050509 Bacteria 568
920 nmdc:mga0qj67_337701_c1 3300050509 Unclassified 1219
921 nmdc:mga0qj67_48258_c1 3300050509 Bacteria 3364
922 nmdc:mga06r32_42207_c1 3300050510 Bacteria 4336
923 nmdc:mga06r32_45053_c1 3300050510 Bacteria 4203
924 nmdc:mga06r32_500298_c1 3300050510 Bacteria 1192
925 nmdc:mga08y16_12222_c1 3300050511 Bacteria 9022
926 nmdc:mga08y16_1265296_c1 3300050511 Bacteria 706
927 nmdc:mga08y16_12995_c1 3300050511 Bacteria 8762
928 nmdc:mga08y16_1525026_c1 3300050511 Bacteria 628
929 nmdc:mga08y16_1773734_c1 3300050511 Bacteria 571
930 nmdc:mga08y16_594708_c1 3300050511 Bacteria 1116
931 nmdc:mga08y16_775464_c1 3300050511 Bacteria 953
932 nmdc:mga0n895_13666_c1 3300050512 Bacteria 7339
933 nmdc:mga0n895_157436_c1 3300050512 Bacteria 2302
934 nmdc:mga0n895_18900_c1 3300050512 Bacteria 6391
935 nmdc:mga0n895_2090538_c1 3300050512 Bacteria 523
936 nmdc:mga0n895_332007_c1 3300050512 Bacteria 1540
937 nmdc:mga0rr50_265435_c1 3300050513 Bacteria 1429
938 nmdc:mga0rr50_367362_c1 3300050513 Bacteria 1212
939 nmdc:mga08x19_13941_c1 3300050514 Bacteria 4869
940 nmdc:mga08x19_367441_c1 3300050514 Bacteria 1006
941 nmdc:mga08x19_4051_c1 3300050514 Bacteria 8704
942 nmdc:mga08x19_483065_c1 3300050514 Bacteria 874
943 nmdc:mga08x19_75883_c1 3300050514 Bacteria 2199
944 nmdc:mga08x19_848419_c1 3300050514 Bacteria 649
945 nmdc:mga0a205_201535_c1 3300050515 Bacteria 1880
946 nmdc:mga0a205_21134_c1 3300050515 Bacteria 6155
947 nmdc:mga0a205_573741_c1 3300050515 Bacteria 982
948 Ga0495619_0370050 3300053085 Bacteria 991
949 Ga0500641_0226762 3300053096 Bacteria 791
950 Ga0500594_0081341 3300053118 Bacteria 969
951 Ga0500642_0294423 3300053130 Bacteria 734
952 Ga0500586_000619 3300053145 Bacteria 7214
953 Ga0501084_0081724 3300054114 Bacteria 2711
954 Ga0501084_1015371 3300054114 Bacteria 697
955 Ga0590071_201214 3300059421 Bacteria 524
956 Ga0587079_106088 3300059647 Bacteria 677
957 Ga0587102_016759 3300059649 Bacteria 791
958 Ga0587111_0037126 3300060346 Bacteria 1023
959 Ga0501082_0023335 3300060353 Bacteria 5337
960 Ga0501082_0093054 3300060353 Bacteria 2604
961 Ga0501082_1509367 3300060353 Bacteria 587
962 2501080264 2501025502 Bacteria 9641094
963 2510253128 2510065045 Bacteria 7761063
964 2511089759 2510917013 Bacteria 9951648
965 2511095156 2510917014 Bacteria 8296963
966 2511104815 2510917015 Bacteria 7950052
967 2512347298 2512047030 Bacteria 9031815
968 2513551329 2513237082 Bacteria 8640282
969 2513559971 2513237083 Bacteria 8410967
970 2515681724 2515154122 Bacteria 8609520
971 2516016732 2515154189 Bacteria 9629850
972 2719638918 2718217991 Bacteria 7829542
973 2808968391 2808606384 Bacteria 8474373
974 2809003222 2808606390 Bacteria 8476311
975 2809010499 2808606391 Bacteria 8308166
976 2856293193 2856287931 Bacteria 7223934
977 2857366690 2857357740 Bacteria 9937880
978 2883090586 2883087390 Bacteria 9532701
979 2885274158 2885270888 Bacteria 9831543
980 2902689043 2902682994 Bacteria 8951596
981 8003957236 8003955200 Bacteria 8601927
982 8055268098 8055266321 Bacteria 7999742
983 Ga0436361_1182555
984 JGI24739J22299_10090089
985 JGI24737J22298_10235586
986 JGI25156J39149_1052173
987 rootH1_10054400
988 rootL2_10349020
989 rootH1_10132885
990 Ga0055527_1002500
991 Ga0055535_1004905
992 Ga0055542_1035846
993 Ga0055529_1026361
994 Ga0055526_1000149
995 Ga0065707_10603957
996 Ga0070658_10065736
997 Ga0070676_10001435
998 Ga0070676_10247279
999 Ga0070676_10321729
1000 Ga0070676_10331220
1001 Ga0070683_100069027
1002 Ga0070690_100776109
1003 Ga0070670_100003563
1004 Ga0070670_100010188
1005 Ga0070670_100039316
1006 Ga0070670_100136031
1007 Ga0070670_100261144
1008 Ga0070670_100332215
1009 Ga0070670_100750698
1010 Ga0070677_10000343
1011 Ga0068869_100009083
1012 Ga0068869_100039879
1013 Ga0068869_101066159
1014 Ga0070666_10530612
1015 Ga0070680_100047758
1016 Ga0070682_101119016
1017 Ga0068868_100015555
1018 Ga0068868_100205658
1019 Ga0068868_101003437
1020 Ga0070689_100044203
1021 Ga0070689_100233871
1022 Ga0070689_100372085
1023 Ga0070689_100494696
1024 Ga0070689_100797461
1025 Ga0070687_100105981
1026 Ga0070661_101770516
1027 Ga0070692_10007318
1028 Ga0070692_10042581
1029 Ga0070692_10050336
1030 Ga0070692_10378737
1031 Ga0070668_100006797
1032 Ga0070668_100010955
1033 Ga0070668_100025704
1034 Ga0070668_100027239
1035 Ga0070668_100110179
1036 Ga0070668_100259447
1037 Ga0070668_100274145
1038 Ga0070668_100638347
1039 Ga0070668_101861703
1040 Ga0070669_100002973
1041 Ga0070669_100021805
1042 Ga0070669_100251345
1043 Ga0070675_100003678
1044 Ga0070675_100012472
1045 Ga0070675_100024736
1046 Ga0070675_100027916
1047 Ga0070675_100029547
1048 Ga0070675_100283993
1049 Ga0070671_100000272
1050 Ga0070671_100008199
1051 Ga0070671_100270159
1052 Ga0070671_102058122
1053 Ga0070674_100005249
1054 Ga0070674_100034622
1055 Ga0070674_101500840
1056 Ga0070673_100001140
1057 Ga0070673_100026294
1058 Ga0070673_100072629
1059 Ga0070673_100121931
1060 Ga0070688_100354713
1061 Ga0070688_101516301
1062 Ga0070659_100083041
1063 Ga0070659_101152340
1064 Ga0070667_100052861
1065 Ga0070667_100140760
1066 Ga0070667_100634378
1067 Ga0070703_10044843
1068 Ga0070714_102010201
1069 Ga0070713_100225309
1070 Ga0070701_10121258
1071 Ga0070701_10201152
1072 Ga0070705_100016156
1073 Ga0070705_100020022
1074 Ga0070705_100036344
1075 Ga0070705_100115744
1076 Ga0070700_100001031
1077 Ga0070700_100268752
1078 Ga0070700_100285341
1079 Ga0070700_100306351
1080 Ga0070700_100365933
1081 Ga0070694_100028846
1082 Ga0070694_100040671
1083 Ga0070694_100067401
1084 Ga0070694_100502819
1085 Ga0070694_100809555
1086 Ga0070663_100001918
1087 Ga0070663_100027027
1088 Ga0070678_100085002
1089 Ga0070678_100098340
1090 Ga0070678_100184096
1091 Ga0070678_101195126
1092 Ga0070662_100014326
1093 Ga0070662_100374375
1094 Ga0070662_101068537
1095 Ga0070681_10004336
1096 Ga0070681_10232956
1097 Ga0070681_10685450
1098 Ga0068867_100002138
1099 Ga0068867_100012234
1100 Ga0068867_100083659
1101 Ga0068867_100119410
1102 Ga0068867_100484352
1103 Ga0068867_100653289
1104 Ga0070685_10191559
1105 Ga0070706_100169581
1106 Ga0070707_100796182
1107 Ga0070698_100271956
1108 Ga0070698_100702411
1109 Ga0070698_100770047
1110 Ga0070699_101378827
1111 Ga0070679_100449119
1112 Ga0070679_100778638
1113 Ga0070679_101976911
1114 Ga0070684_100848038
1115 Ga0070697_100033084
1116 Ga0068853_100004289
1117 Ga0068853_100388817
1118 Ga0068853_101408921
1119 Ga0070672_100054860
1120 Ga0070672_100088452
1121 Ga0070672_100143722
1122 Ga0070672_100250812
1123 Ga0070672_100258234
1124 Ga0070672_100514592
1125 Ga0070672_100580341
1126 Ga0070672_101403050
1127 Ga0070672_101659165
1128 Ga0070686_100073813
1129 Ga0070686_100643806
1130 Ga0070695_100000362
1131 Ga0070695_100041788
1132 Ga0070695_100200820
1133 Ga0070695_100334984
1134 Ga0070695_100394208
1135 Ga0070695_100634511
1136 Ga0070696_100000505
1137 Ga0070696_100053479
1138 Ga0070696_100161151
1139 Ga0070696_100196947
1140 Ga0070696_100421529
1141 Ga0070696_101117185
1142 Ga0070696_102012307
1143 Ga0070693_100140515
1144 Ga0070693_100578294
1145 Ga0070693_100595189
1146 Ga0070693_101221868
1147 Ga0070665_100142453
1148 Ga0070665_100142944
1149 Ga0070665_100172776
1150 Ga0070665_100504639
1151 Ga0070665_100648163
1152 Ga0070665_100832906
1153 Ga0070704_100016021
1154 Ga0070704_101142662
1155 Ga0070704_102207376
1156 Ga0068855_100511907
1157 Ga0068855_101961287
1158 Ga0068855_102032307
1159 Ga0070664_100036137
1160 Ga0070664_100439196
1161 Ga0070664_100987814
1162 Ga0068857_100978731
1163 Ga0068857_101698472
1164 Ga0068854_100084706
1165 Ga0068854_100366708
1166 Ga0068854_100470663
1167 Ga0068854_100484517
1168 Ga0068856_100144536
1169 Ga0068856_100338379
1170 Ga0070702_100008243
1171 Ga0070702_100138509
1172 Ga0070702_100179160
1173 Ga0070702_100348826
1174 Ga0070702_100463840
1175 Ga0070702_100583979
1176 Ga0068852_100002156
1177 Ga0068852_101755589
1178 Ga0068859_100024361
1179 Ga0068859_100680431
1180 Ga0068859_101040905
1181 Ga0068859_102056068
1182 Ga0068859_102283931
1183 Ga0068859_102341637
1184 Ga0068859_103146018
1185 Ga0068864_100034508
1186 Ga0068864_100035655
1187 Ga0068864_100062455
1188 Ga0068864_100155302
1189 Ga0068864_100176547
1190 Ga0068864_101331595
1191 Ga0068866_10321836
1192 Ga0068866_10418662
1193 Ga0068861_100001104
1194 Ga0068861_100086738
1195 Ga0068861_100210631
1196 Ga0068861_100242385
1197 Ga0068861_100336369
1198 Ga0068861_100715396
1199 Ga0068861_100793843
1200 Ga0068861_101379962
1201 Ga0068851_10001153
1202 Ga0068851_10620193
1203 Ga0068851_10979707
1204 Ga0068870_10020819
1205 Ga0068870_10058629
1206 Ga0068870_10063872
1207 Ga0068870_10072546
1208 Ga0068870_10176719
1209 Ga0068863_100019911
1210 Ga0068863_100020923
1211 Ga0068863_100037554
1212 Ga0068863_100279781
1213 Ga0068863_100577917
1214 Ga0068858_100014384
1215 Ga0068858_100820756
1216 Ga0068858_100908099
1217 Ga0068860_100074707
1218 Ga0068860_100115727
1219 Ga0068860_100626423
1220 Ga0068860_100630676
1221 Ga0068862_100001798
1222 Ga0068862_100093345
1223 Ga0068862_100169713
1224 Ga0068862_100201451
1225 Ga0068862_100418843
1226 Ga0068862_100611945
1227 Ga0068862_101069913
1228 Ga0070715_10714684
1229 Ga0070716_100247135
1230 Ga0070716_100453044
1231 Ga0075366_10567510
1232 Ga0075366_10867145
1233 Ga0097621_100013711
1234 Ga0097621_100014830
1235 Ga0097621_100116903
1236 Ga0097621_101322934
1237 Ga0068871_100028272
1238 Ga0068871_100444041
1239 Ga0068871_100647272
1240 Ga0068871_100964219
1241 Ga0068871_100994484
1242 Ga0068871_101823323
1243 Ga0075428_100139214
1244 Ga0075428_100782575
1245 Ga0075428_101258707
1246 Ga0075430_100003340
1247 Ga0075430_100626827
1248 Ga0075430_101410397
1249 Ga0075430_101444695
1250 Ga0075431_100146664
1251 Ga0075431_100752966
1252 Ga0075433_10231742
1253 Ga0075433_10255444
1254 Ga0075434_100100901
1255 Ga0075434_100697291
1256 Ga0075434_102366301
1257 Ga0075429_100003041
1258 Ga0068865_100026154
1259 Ga0068865_100028722
1260 Ga0068865_100032078
1261 Ga0075436_100005116
1262 Ga0075436_100008567
1263 Ga0075436_100014985
1264 Ga0075436_100023095
1265 Ga0075436_100027380
1266 Ga0097620_100024361
1267 Ga0097620_100680472
1268 Ga0097620_101040940
1269 Ga0097620_102055846
1270 Ga0097620_102283865
1271 Ga0097620_102342153
1272 Ga0097620_103143761
1273 Ga0075435_100048639
1274 Ga0075435_100153380
1275 Ga0075435_100441910
1276 Ga0075435_100500327
1277 Ga0075435_101044791
1278 Ga0075435_101235768
1279 Ga0099794_10192190
1280 Ga0105244_10001943
1281 Ga0111539_10068982
1282 Ga0111539_10169101
1283 Ga0111539_10207000
1284 Ga0111539_10241710
1285 Ga0111539_10764449
1286 Ga0111539_11322971
1287 Ga0111539_11333324
1288 Ga0111539_12071521
1289 Ga0105245_10024073
1290 Ga0105245_10024841
1291 Ga0105245_10439406
1292 Ga0105245_10536860
1293 Ga0105245_11322382
1294 Ga0105245_12026452
1295 Ga0105247_10005196
1296 Ga0105247_10777281
1297 Ga0114129_10281193
1298 Ga0114129_11355901
1299 Ga0114129_12654672
1300 Ga0105243_10002425
1301 Ga0105243_10171534
1302 Ga0105241_10742711
1303 Ga0105241_11874651
1304 Ga0105242_10006248
1305 Ga0105242_10196669
1306 Ga0105242_10305091
1307 Ga0105242_10429105
1308 Ga0105248_10000992
1309 Ga0105248_10088473
1310 Ga0105248_10341517
1311 Ga0105248_10681694
1312 Ga0105237_10016087
1313 Ga0105238_10957048
1314 Ga0105249_10049127
1315 Ga0105249_11819985
1316 Ga0105239_10377220
1317 Ga0105239_10450025
1318 Ga0105239_10605315
1319 Ga0105246_10034593
1320 Ga0105246_10723807
1321 Ga0157371_11556417
1322 Ga0157374_10072086
1323 Ga0157374_10163480
1324 Ga0157374_10180513
1325 Ga0157378_10211669
1326 Ga0157378_11127728
1327 Ga0157378_11562892
1328 Ga0157378_11805173
1329 Ga0163162_10020397
1330 Ga0163162_10176898
1331 Ga0163162_10189891
1332 Ga0163162_10286935
1333 Ga0163162_10580090
1334 Ga0163162_11387607
1335 Ga0163162_12037595
1336 Ga0157372_10338033
1337 Ga0157375_10012622
1338 Ga0157375_10045551
1339 Ga0157375_10057193
1340 Ga0157375_10101514
1341 Ga0157375_10531471
1342 Ga0157375_10826088
1343 Ga0157375_11653512
1344 Ga0157375_12394512
1345 Ga0163163_10039634
1346 Ga0163163_10052788
1347 Ga0163163_10101835
1348 Ga0163163_10946256
1349 Ga0157380_10005801
1350 Ga0157380_10041592
1351 Ga0157380_10200791
1352 Ga0157380_10778776
1353 Ga0157380_10804785
1354 Ga0157377_10080238
1355 Ga0157379_10025408
1356 Ga0157376_10012058
1357 Ga0157376_10079043
1358 Ga0157376_10874410
1359 Ga0157376_10955437
1360 Ga0182006_1000216
1361 Ga0182005_1000119
1362 Ga0163161_10020699
1363 Ga0163161_10033804
1364 Ga0163161_10359575
1365 Ga0209672_100041
1366 Ga0209147_100866
1367 Ga0209437_101838
1368 Ga0209258_100822
1369 Ga0209646_1000384
1370 Ga0209026_1044080
1371 Ga0209148_1001387
1372 Ga0209759_1056599
1373 Ga0209455_1007106
1374 Ga0209564_1000010
1375 Ga0209564_1001321
1376 Ga0207697_10047453
1377 Ga0207697_10240881
1378 Ga0207656_10012067
1379 Ga0207655_1007846
1380 Ga0207653_10042017
1381 Ga0207682_10000198
1382 Ga0207682_10026622
1383 Ga0207682_10612067
1384 Ga0207642_10008609
1385 Ga0207642_10196980
1386 Ga0207688_10154182
1387 Ga0207680_10057628
1388 Ga0207647_10009548
1389 Ga0207685_10585062
1390 Ga0207699_10237170
1391 Ga0207645_10000676
1392 Ga0207645_10030039
1393 Ga0207645_10054591
1394 Ga0207645_10311729
1395 Ga0207643_10039589
1396 Ga0207643_10045286
1397 Ga0207643_10049201
1398 Ga0207643_10109580
1399 Ga0207643_10352679
1400 Ga0207705_10063847
1401 Ga0207705_10875486
1402 Ga0207684_10112094
1403 Ga0207654_10464225
1404 Ga0207707_10009678
1405 Ga0207707_10105173
1406 Ga0207707_11010548
1407 Ga0207671_10035591
1408 Ga0207671_10071944
1409 Ga0207660_10043657
1410 Ga0207660_10386898
1411 Ga0207660_10489759
1412 Ga0207662_10070919
1413 Ga0207662_10239084
1414 Ga0207662_10686993
1415 Ga0207657_10193589
1416 Ga0207652_10013645
1417 Ga0207652_10393285
1418 Ga0207646_10470972
1419 Ga0207646_10870301
1420 Ga0207681_10005688
1421 Ga0207681_10013210
1422 Ga0207681_10170319
1423 Ga0207681_10236162
1424 Ga0207681_10920762
1425 Ga0207650_10018612
1426 Ga0207650_10114126
1427 Ga0207650_10250069
1428 Ga0207650_10492403
1429 Ga0207650_10637532
1430 Ga0207650_11494197
1431 Ga0207659_10047713
1432 Ga0207659_10133056
1433 Ga0207659_10368540
1434 Ga0207659_11437017
1435 Ga0207659_11662868
1436 Ga0207687_10029887
1437 Ga0207687_10487589
1438 Ga0207687_10548927
1439 Ga0207687_10807528
1440 Ga0207664_10048574
1441 Ga0207644_10010982
1442 Ga0207644_10013052
1443 Ga0207644_11312588
1444 Ga0207690_10937728
1445 Ga0207706_10020283
1446 Ga0207706_10100010
1447 Ga0207706_10307885
1448 Ga0207706_10463432
1449 Ga0207706_11422832
1450 Ga0207686_10159311
1451 Ga0207686_10219545
1452 Ga0207709_11653259
1453 Ga0207670_10018384
1454 Ga0207670_10164638
1455 Ga0207670_10353646
1456 Ga0207670_10374350
1457 Ga0207670_10536282
1458 Ga0207670_11609061
1459 Ga0207669_10031072
1460 Ga0207669_10104538
1461 Ga0207669_10238642
1462 Ga0207669_10342286
1463 Ga0207669_11354190
1464 Ga0207704_10011015
1465 Ga0207704_11683730
1466 Ga0207704_11904836
1467 Ga0207665_10270644
1468 Ga0207665_10295733
1469 Ga0207691_10000243
1470 Ga0207691_10001181
1471 Ga0207691_10037545
1472 Ga0207691_10091771
1473 Ga0207691_10247947
1474 Ga0207691_10406630
1475 Ga0207691_10533164
1476 Ga0207691_10588554
1477 Ga0207711_10018678
1478 Ga0207711_10278090
1479 Ga0207711_11084510
1480 Ga0207689_10015420
1481 Ga0207689_10049475
1482 Ga0207689_10108288
1483 Ga0207689_10755351
1484 Ga0207689_10882363
1485 Ga0207689_11612523
1486 Ga0207689_11652216
1487 Ga0207679_10070680
1488 Ga0207679_10544100
1489 Ga0207679_11258125
1490 Ga0207667_10131745
1491 Ga0207651_10011474
1492 Ga0207651_10034413
1493 Ga0207651_10081940
1494 Ga0207651_10153936
1495 Ga0207712_10613324
1496 Ga0207712_12111792
1497 Ga0207668_10005128
1498 Ga0207668_10007321
1499 Ga0207668_10007526
1500 Ga0207668_10036649
1501 Ga0207668_10093152
1502 Ga0207668_10730533
1503 Ga0207640_10118510
1504 Ga0207640_10425787
1505 Ga0207640_10431519
1506 Ga0207640_11063617
1507 Ga0207658_10011658
1508 Ga0207658_10103985
1509 Ga0207658_10416996
1510 Ga0207677_10164429
1511 Ga0207677_10513924
1512 Ga0207703_10769894
1513 Ga0207703_10912679
1514 Ga0207703_10999934
1515 Ga0207639_10257170
1516 Ga0207639_11263962
1517 Ga0207678_10000013
1518 Ga0207708_10002536
1519 Ga0207708_10058634
1520 Ga0207708_10159046
1521 Ga0207708_10178673
1522 Ga0207708_10229266
1523 Ga0207708_10394572
1524 Ga0207708_10834841
1525 Ga0207702_10272306
1526 Ga0207641_10112676
1527 Ga0207641_10115124
1528 Ga0207641_10239056
1529 Ga0207641_10357094
1530 Ga0207641_10364275
1531 Ga0207641_10871257
1532 Ga0207641_12109513
1533 Ga0207641_12291666
1534 Ga0207648_10009225
1535 Ga0207648_10012144
1536 Ga0207648_10017883
1537 Ga0207648_10112143
1538 Ga0207648_10551302
1539 Ga0207648_10891868
1540 Ga0207648_11890090
1541 Ga0207676_10033387
1542 Ga0207676_10129115
1543 Ga0207676_10150985
1544 Ga0207676_10202340
1545 Ga0207676_10482633
1546 Ga0207674_10396770
1547 Ga0207674_11218433
1548 Ga0207675_100001853
1549 Ga0207675_100020956
1550 Ga0207675_100046593
1551 Ga0207675_100110998
1552 Ga0207675_100268847
1553 Ga0207675_100307665
1554 Ga0207675_100673391
1555 Ga0207675_100755244
1556 Ga0207675_100895014
1557 Ga0207675_101003193
1558 Ga0207675_101787281
1559 Ga0207683_10000308
1560 Ga0207683_10100953
1561 Ga0207683_10194654
1562 Ga0207683_11693062
1563 Ga0207698_10014478
1564 Ga0207698_11364666
1565 Ga0209281_1004553
1566 Ga0209967_1007547
1567 Ga0209981_1000274
1568 Ga0209996_1000426
1569 Ga0210000_1012802
1570 Ga0209995_1002372
1571 Ga0209968_1028162
1572 Ga0209999_1003045
1573 Ga0209970_1030478
1574 Ga0209971_1093017
1575 Ga0209974_10435536
1576 Ga0207428_10008206
1577 Ga0207428_10132309
1578 Ga0268266_10035503
1579 Ga0268266_10154387
1580 Ga0268266_10222798
1581 Ga0268266_10289909
1582 Ga0268266_10567504
1583 Ga0268265_10000606
1584 Ga0268265_10007059
1585 Ga0268265_10056208
1586 Ga0268265_10103415
1587 Ga0268265_10230804
1588 Ga0268265_10398107
1589 Ga0268264_10040446
1590 Ga0268264_10071335
1591 Ga0268264_10111072
1592 Ga0268264_10535440
1593 Ga0268264_10695181
1594 Ga0307515_10525023
1595 Ga0265338_10000344
1596 Ga0237817_12217
1597 Ga0265327_10030111
1598 Ga0307513_10436371
1599 Ga0307408_100181728
1600 Ga0307408_100829886
1601 Ga0307408_100831804
1602 Ga0307408_101444943
1603 Ga0316575_10030526
1604 Ga0316575_10033995
1605 Ga0316579_10000015
1606 Ga0316579_10010200
1607 Ga0316579_10140937
1608 Ga0316576_10071290
1609 Ga0316578_10005745
1610 Ga0316578_10396209
1611 Ga0316577_10001781
1612 Ga0307413_10976700
1613 Ga0307413_11268788
1614 Ga0307407_10500016
1615 Ga0307412_10372141
1616 Ga0307412_10911307
1617 Ga0307409_100724543
1618 Ga0307416_101043310
1619 Ga0307416_101562953
1620 Ga0307411_10125767
1621 Ga0307411_11439750
1622 Ga0316583_10000483
1623 Ga0316583_10004823
1624 Ga0316585_10021392
1625 Ga0316585_10028949
1626 Ga0316580_10008681
1627 Ga0316593_10000385
1628 Ga0373938_0157733
1629 Ga0373929_0118124
1630 Ga0373929_0164303
1631 Ga0373934_0000134
1632 Ga0373934_0440898
1633 Ga0373949_0052465
1634 Ga0373949_0074343
1635 Ga0373951_0180728
1636 Ga0373952_0296346
1637 Ga0373923_0625352
1638 Ga0373932_0061752
1639 Ga0373932_0142798
1640 Ga0373936_0025745
1641 Ga0373936_0059916
1642 Ga0373939_0203489
1643 Ga0373939_0465874
1644 Ga0373941_0040943
1645 Ga0373953_0140382
1646 Ga0373954_0000002
1647 Ga0373956_0000006
1648 Ga0373957_0000372
1649 Ga0373957_0205146
1650 Ga0373960_0051783
1651 Ga0373960_0118127
1652 Ga0373960_0246755
1653 Ga0373943_0006741
1654 Ga0373946_0569281
1655 Ga0373955_0136521
1656 Ga0373955_0272091
1657 Ga0373955_0577636
1658 Ga0373942_0320732
1659 Ga0373962_0390465
1660 Ga0316574_0081081
1661 Ga0316574_0191459
1662 Ga0316574_0225932
1663 Ga0373924_0117450
1664 Ga0373931_0047678
1665 Ga0373935_0036900
1666 Ga0373935_1004514
1667 Ga0373927_0018661
1668 Ga0373927_0047624
1669 Ga0373933_0000564
1670 Ga0373933_0079276
1671 Ga0373933_0161536
1672 Ga0373933_0247749
1673 Ga0373947_0025727
1674 Ga0373947_0838267
1675 Ga0373937_0000358
1676 Ga0373937_0003219
1677 Ga0373937_0047835
1678 Ga0373937_0347205
1679 Ga0373937_1243825
1680 Ga0316582_0003674
1681 Ga0316582_0019086
1682 Ga0316582_0385781
1683 Ga0316584_0008900
1684 Ga0316584_0099029
1685 Ga0316584_0188920
1686 Ga0316584_0514716
1687 Ga0373925_0061295
1688 Ga0373925_0071100
1689 Ga0373925_0775520
1690 Ga0395899_0004310
1691 Ga0395900_0006117
1692 Ga0395900_0270883
1693 Ga0395898_0298265
1694 Ga0395898_1603184
1695 Ga0395905_0035171
1696 Ga0316581_0001262
1697 Ga0316581_0001282
1698 Ga0316581_0054570
1699 Ga0395901_0085802
1700 Ga0395901_0255660
1701 Ga0395901_0661644
1702 Ga0436360_0635523
1703 Ga0436363_1444570
1704 Ga0451802_1603895
1705 Ga0451807_0680206
1706 Ga0451807_2332697
1707 Ga0451849_1451196
1708 Ga0451853_0470233
1709 Ga0439441_000116
1710 Ga0439443_019482
1711 Ga0439451_003581
1712 Ga0439462_0064584
1713 Ga0439446_0028390
1714 Ga0439434_0000212
1715 Ga0439435_0000206
1716 Ga0439435_0013850
1717 Ga0439444_0002792
1718 Ga0439460_0000714
1719 Ga0451577_0023914
1720 Ga0453683_0028389
1721 Ga0466963_0602491
1722 Ga0466964_0021058
1723 Ga0466964_0138052
1724 Ga0466964_0443880
1725 Ga0453684_0276423
1726 Ga0466957_0344334
1727 Ga0451576_0000147
1728 Ga0451576_0196786
1729 Ga0451576_1110250
1730 Ga0466967_0001049
1731 Ga0466967_1158875
1732 Ga0495617_004040
1733 Ga0495603_0225283
1734 Ga0495651_0000233
1735 Ga0495653_0359564
1736 Ga0495650_0001544
1737 Ga0495650_0003055
1738 Ga0495650_0003627
1739 Ga0495580_0026867
1740 Ga0495605_0000635
1741 Ga0495584_0027265
1742 Ga0495584_0164912
1743 Ga0495585_0024699
1744 Ga0495607_0249086
1745 Ga0495583_0005068
1746 Ga0495606_0001517
1747 Ga0495606_0352355
1748 Ga0495610_0003364
1749 Ga0495631_0017774
1750 Ga0495637_0010764
1751 Ga0495643_0000891
1752 Ga0495648_0019571
1753 Ga0495642_0128916
1754 Ga0495642_0276100
1755 Ga0495652_0678468
1756 Ga0495621_0054065
1757 Ga0495621_0105592
1758 Ga0495621_0194908
1759 Ga0495621_0418329
1760 Ga0495597_0000288
1761 Ga0495597_0001250
1762 Ga0495622_0407801
1763 Ga0495633_0001228
1764 Ga0495633_0001987
1765 Ga0495633_0058546
1766 Ga0495667_0230855
1767 Ga0495668_0006127
1768 Ga0495611_0011338
1769 Ga0495625_0002229
1770 Ga0495625_0426629
1771 Ga0495659_0214696
1772 Ga0495659_0232478
1773 Ga0495659_0394030
1774 Ga0495657_0022573
1775 Ga0495599_0229993
1776 Ga0495599_0798874
1777 Ga0495623_0334738
1778 Ga0495646_0223782
1779 Ga0495647_0090012
1780 Ga0495669_0042821
1781 Ga0495669_0170482
1782 Ga0495670_0003908
1783 Ga0495670_0484820
1784 Ga0495671_0069779
1785 Ga0495671_0134307
1786 Ga0495649_0001795
1787 Ga0495649_0363175
1788 Ga0495589_0041328
1789 Ga0495604_0150888
1790 Ga0495636_0001239
1791 Ga0495636_0037440
1792 Ga0495636_0074493
1793 Ga0495636_0161940
1794 Ga0495674_0011089
1795 Ga0495672_0001040
1796 Ga0495676_1076910
1797 Ga0495680_0178343
1798 Ga0495680_0284998
1799 Ga0495683_0071477
1800 Ga0495683_0276296
1801 Ga0495675_0741735
1802 Ga0495677_0019685
1803 Ga0495677_0140460
1804 Ga0495677_0242725
1805 Ga0495677_0379970
1806 Ga0495686_0105936
1807 Ga0495602_0030492
1808 Ga0495615_0182378
1809 Ga0495615_0280598
1810 Ga0496100_1225962
1811 Ga0496102_0000082
1812 Ga0496102_0047863
1813 Ga0496102_1062859
1814 Ga0496103_0066025
1815 Ga0496103_0347642
1816 Ga0496103_0393577
1817 Ga0496106_0192535
1818 Ga0496107_0379772
1819 Ga0496108_0344050
1820 Ga0496110_0536630
1821 Ga0496111_0523171
1822 Ga0496112_0076310
1823 Ga0496113_1563851
1824 Ga0496115_0471551
1825 Ga0496115_1214065
1826 Ga0496116_0048615
1827 Ga0496120_0173576
1828 Ga0496122_0046444
1829 Ga0496123_0006778
1830 Ga0496124_0358112
1831 Ga0496125_0040546
1832 Ga0495678_001082
1833 Ga0495678_243424
1834 Ga0495682_0080302
1835 Ga0501291_011127
1836 Ga0501292_017546
1837 Ga0501298_122829
1838 Ga0501031_0704530
1839 Ga0501034_0053868
1840 Ga0501036_0937023
1841 Ga0501036_1745253
1842 Ga0501037_0918886
1843 Ga0501038_0945091
1844 Ga0501039_0020140
1845 Ga0501040_0609611
1846 Ga0501040_1403187
1847 Ga0501041_0063052
1848 Ga0501046_0657115
1849 Ga0501047_0175940
1850 Ga0501048_0465107
1851 Ga0501067_0068582
1852 Ga0501067_0492210
1853 Ga0501068_0078372
1854 Ga0501069_0033482
1855 Ga0501069_0068700
1856 Ga0501070_0005016
1857 Ga0501071_0000992
1858 Ga0501071_0206685
1859 Ga0501071_0672692
1860 Ga0501072_0039301
1861 Ga0501072_0044939
1862 Ga0501072_1566929
1863 Ga0501073_0014106
1864 Ga0501073_0020687
1865 Ga0501073_0044227
1866 Ga0501073_0126736
1867 Ga0501073_0658564
1868 Ga0501074_0051011
1869 Ga0501074_0613353
1870 Ga0501075_0004058
1871 Ga0501075_0190161
1872 Ga0501076_0007046
1873 Ga0501076_0989243
1874 Ga0501077_0780346
1875 Ga0501209_120950
1876 Ga0501210_041048
1877 Ga0501227_214815
1878 Ga0501233_080143
1879 Ga0501236_108293
1880 Ga0501238_036258
1881 Ga0501229_025299
1882 Ga0501079_0298026
1883 Ga0501080_0000702
1884 Ga0501080_0108918
1885 Ga0501080_0165598
1886 Ga0501080_0440280
1887 Ga0501080_0553069
1888 Ga0501081_0017373
1889 Ga0501083_0047000
1890 Ga0501263_030547
1891 Ga0501268_162210
1892 Ga0501035_0526722
1893 Ga0501035_1443530
1894 Ga0501044_0930798
1895 Ga0501045_0202285
1896 nmdc:mga05p37_325958_c1
1897 nmdc:mga09592_1739728_c1
1898 nmdc:mga09592_24148_c1
1899 nmdc:mga09592_310877_c1
1900 nmdc:mga0qj67_1283043_c1
1901 nmdc:mga0qj67_337701_c1
1902 nmdc:mga0qj67_48258_c1
1903 nmdc:mga06r32_42207_c1
1904 nmdc:mga06r32_45053_c1
1905 nmdc:mga06r32_500298_c1
1906 nmdc:mga08y16_12222_c1
1907 nmdc:mga08y16_1265296_c1
1908 nmdc:mga08y16_12995_c1
1909 nmdc:mga08y16_1525026_c1
1910 nmdc:mga08y16_1773734_c1
1911 nmdc:mga08y16_594708_c1
1912 nmdc:mga08y16_775464_c1
1913 nmdc:mga0n895_13666_c1
1914 nmdc:mga0n895_157436_c1
1915 nmdc:mga0n895_18900_c1
1916 nmdc:mga0n895_2090538_c1
1917 nmdc:mga0n895_332007_c1
1918 nmdc:mga0rr50_265435_c1
1919 nmdc:mga0rr50_367362_c1
1920 nmdc:mga08x19_13941_c1
1921 nmdc:mga08x19_367441_c1
1922 nmdc:mga08x19_4051_c1
1923 nmdc:mga08x19_483065_c1
1924 nmdc:mga08x19_75883_c1
1925 nmdc:mga08x19_848419_c1
1926 nmdc:mga0a205_201535_c1
1927 nmdc:mga0a205_21134_c1
1928 nmdc:mga0a205_573741_c1
1929 Ga0495619_0370050
1930 Ga0500641_0226762
1931 Ga0500594_0081341
1932 Ga0500642_0294423
1933 Ga0500586_000619
1934 Ga0501084_0081724
1935 Ga0501084_1015371
1936 Ga0590071_201214
1937 Ga0587079_106088
1938 Ga0587102_016759
1939 Ga0587111_0037126
1940 Ga0501082_0023335
1941 Ga0501082_0093054
1942 Ga0501082_1509367
1943 2501080264
1944 2510253128
1945 2511089759
1946 2511095156
1947 2511104815
1948 2512347298
1949 2513551329
1950 2513559971
1951 2515681724
1952 2516016732
1953 2719638918
1954 2808968391
1955 2809003222
1956 2809010499
1957 2856293193
1958 2857366690
1959 2883090586
1960 2885274158
1961 2902689043
1962 8003957236
1963 8055268098

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5abr-assembly1.cif.gz_B structure of fesi protein from azotobacter vinelandii 0.9382 7 105
7p8n-assembly1.cif.gz_b tmhydabc- t. maritima hydrogenase with bridge closed 0.9222 7 103
7p8n-assembly1.cif.gz_B tmhydabc- t. maritima hydrogenase with bridge closed 0.9167 7 103
7p92-assembly1.cif.gz_B tmhydabc- t. maritima bifurcating hydrogenase with bridge domain up 0.9121 7 103
7q4v-assembly1.cif.gz_B electron bifurcating hydrogenase - hydabc from a. woodii 0.9107 3 105
ID Description Score Start End Superfamily
5abrB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9382 7 105 3.40.30.10
1m2dB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.894 7 105 3.40.30.10
af_Q55BP2_216_308_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8774 7 105 3.40.30.10
5abrB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.87 7 105 3.40.30.10
1m2dB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8606 7 105 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2Z6TL74-F1-model_v4 deleted 0.9952 34 105
AF-B9B3A7-F1-model_v4 deleted 0.9951 1 105
AF-A2VV29-F1-model_v4 deleted 0.9943 1 105
AF-A0A5E4S288-F1-model_v4 Ferredoxin, 2Fe-2S 0.9929 1 105
AF-A0A5Q4GE00-F1-model_v4 (2Fe-2S) ferredoxin domain-containing protein 0.9927 3 105

Map