F487403

General Info

Members Datasets Scaffolds Average Seq Length
981 307 1962 174

Family's Representative Sequence

Representative Sequence 3300046537|Ga0495598_0153426|Ga0495598_0153426_13_639
Length 208
Sequence LRKARCARVVAAAAMLAESGMLSPPRSSCKRGSTPPMKKPDDLPDAEAALAKLVQRMEGVVAPNAAFVGIYSGGAWLAERLSQRLPDAHPVGFIDVSYYRDDYALSGLKPNTRRTSLPFDVEGARIVLVDDVLYTGRSVRAAINELFDFGRPERIELAVLVDRGGRELPIEPTYAGATISVAPHLSIVLSRDPGGTLSLAVEPSAGVA

Samples

Sample ID Description Type Environment
1 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
199 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
200 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
201 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
202 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
203 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
204 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
205 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
206 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
207 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
208 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
209 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
210 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
211 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
212 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
213 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
216 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
217 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
218 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
219 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
221 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
222 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
223 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
224 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
225 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
226 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
227 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
228 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
229 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
231 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
232 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
236 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
237 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
238 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
239 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
240 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
241 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
242 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
243 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
244 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
245 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
246 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
247 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
248 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
249 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
250 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
251 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
252 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
253 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
254 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
255 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
256 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
257 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
258 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
259 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
260 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
261 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
262 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
263 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
264 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
265 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
266 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
267 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
268 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
269 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
270 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
271 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
274 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
275 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
276 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
277 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
278 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
279 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
280 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
281 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
282 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
285 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
290 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
291 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
292 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
293 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
294 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
295 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
296 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
297 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
298 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
299 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
300 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
301 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
302 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
303 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
304 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
305 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
306 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
307 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.47
Rhizosphere 96.43
Stem 0
Stem Tuber 0
Unclassified 0.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495598_0153426 3300046537 Bacteria 806
2 MBSR1b_contig_9256567 2162886012 Bacteria 949
3 JGI24746J21847_1012872 3300001977 Bacteria 1222
4 JGI24743J22301_10003795 3300001991 Bacteria 2417
5 Ga0065715_10029232 3300005293 Bacteria 1489
6 Ga0070658_10004021 3300005327 Bacteria 12051
7 Ga0070658_10264575 3300005327 Bacteria 1461
8 Ga0070658_10316159 3300005327 Bacteria 1333
9 Ga0070658_10325557 3300005327 Bacteria 1313
10 Ga0070676_10000020 3300005328 Bacteria 48745
11 Ga0070676_10018824 3300005328 Bacteria 3833
12 Ga0070676_10164946 3300005328 Bacteria 1429
13 Ga0070676_10251750 3300005328 Bacteria 1179
14 Ga0070676_10524818 3300005328 Bacteria 844
15 Ga0070676_10599105 3300005328 Bacteria 794
16 Ga0070683_100022189 3300005329 Bacteria 5671
17 Ga0070683_100067726 3300005329 Bacteria 3325
18 Ga0070683_100170577 3300005329 Bacteria 2065
19 Ga0070683_100262885 3300005329 Bacteria 1642
20 Ga0070683_100337012 3300005329 Bacteria 1436
21 Ga0070690_100072976 3300005330 Bacteria 2232
22 Ga0070690_100160755 3300005330 Bacteria 1539
23 Ga0070690_100730195 3300005330 Bacteria 763
24 Ga0070670_100000960 3300005331 Bacteria 22621
25 Ga0070670_100014201 3300005331 Bacteria 6833
26 Ga0070670_100024353 3300005331 Bacteria 5205
27 Ga0070670_100027335 3300005331 Bacteria 4907
28 Ga0070670_100051973 3300005331 Bacteria 3519
29 Ga0070670_100086272 3300005331 Bacteria 2697
30 Ga0070670_100376471 3300005331 Bacteria 1250
31 Ga0070670_100444864 3300005331 Bacteria 1148
32 Ga0070670_100690321 3300005331 Bacteria 917
33 Ga0070677_10000437 3300005333 Bacteria 14297
34 Ga0070677_10003551 3300005333 Bacteria 5032
35 Ga0070677_10120286 3300005333 Bacteria 1185
36 Ga0070677_10497430 3300005333 Bacteria 660
37 Ga0068869_100007801 3300005334 Bacteria 6865
38 Ga0068869_100008412 3300005334 Bacteria 6653
39 Ga0068869_100095394 3300005334 Bacteria 2244
40 Ga0068869_100135117 3300005334 Bacteria 1899
41 Ga0070666_10011189 3300005335 Bacteria 5625
42 Ga0070666_10027667 3300005335 Bacteria 3716
43 Ga0070666_10073258 3300005335 Bacteria 2333
44 Ga0070666_10142695 3300005335 Bacteria 1668
45 Ga0070666_10593834 3300005335 Bacteria 808
46 Ga0070680_100111031 3300005336 Bacteria 2282
47 Ga0070680_100230744 3300005336 Bacteria 1563
48 Ga0070680_100231239 3300005336 Bacteria 1562
49 Ga0070680_100362875 3300005336 Bacteria 1232
50 Ga0070680_100914800 3300005336 Bacteria 757
51 Ga0070682_100012768 3300005337 Bacteria 4822
52 Ga0070682_100497731 3300005337 Bacteria 944
53 Ga0068868_100000764 3300005338 Bacteria 21748
54 Ga0068868_100027592 3300005338 Bacteria 4332
55 Ga0068868_100038607 3300005338 Bacteria 3707
56 Ga0068868_100086612 3300005338 Bacteria 2518
57 Ga0068868_100336468 3300005338 Bacteria 1290
58 Ga0068868_100444427 3300005338 Bacteria 1127
59 Ga0068868_100664489 3300005338 Bacteria 929
60 Ga0070660_100005250 3300005339 Bacteria 8956
61 Ga0070660_100008287 3300005339 Bacteria 7264
62 Ga0070660_100013677 3300005339 Bacteria 5830
63 Ga0070660_100032451 3300005339 Bacteria 3930
64 Ga0070660_100043751 3300005339 Bacteria 3422
65 Ga0070660_100202132 3300005339 Bacteria 1612
66 Ga0070660_100427691 3300005339 Bacteria 1097
67 Ga0070689_100006139 3300005340 Bacteria 8281
68 Ga0070689_100031515 3300005340 Bacteria 4029
69 Ga0070689_100038553 3300005340 Bacteria 3657
70 Ga0070689_100201690 3300005340 Bacteria 1625
71 Ga0070687_100037422 3300005343 Bacteria 2426
72 Ga0070687_100056848 3300005343 Bacteria 2049
73 Ga0070661_100006214 3300005344 Bacteria 8236
74 Ga0070661_100006440 3300005344 Bacteria 8093
75 Ga0070661_100007128 3300005344 Bacteria 7710
76 Ga0070661_100009492 3300005344 Bacteria 6740
77 Ga0070661_100009665 3300005344 Bacteria 6686
78 Ga0070661_100022026 3300005344 Bacteria 4559
79 Ga0070661_100112872 3300005344 Bacteria 2031
80 Ga0070661_100436604 3300005344 Bacteria 1040
81 Ga0070661_101028505 3300005344 Bacteria 684
82 Ga0070692_10079677 3300005345 Bacteria 1761
83 Ga0070692_10803118 3300005345 Bacteria 642
84 Ga0070668_100003723 3300005347 Bacteria 11242
85 Ga0070668_100017474 3300005347 Bacteria 5377
86 Ga0070668_100115344 3300005347 Bacteria 2141
87 Ga0070668_100134089 3300005347 Bacteria 1990
88 Ga0070668_100468015 3300005347 Bacteria 1086
89 Ga0070669_100022652 3300005353 Bacteria 4492
90 Ga0070669_100036983 3300005353 Bacteria 3540
91 Ga0070669_100090243 3300005353 Bacteria 2297
92 Ga0070669_100122754 3300005353 Bacteria 1984
93 Ga0070669_101010594 3300005353 Bacteria 714
94 Ga0070675_100018877 3300005354 Bacteria 5491
95 Ga0070675_100046039 3300005354 Bacteria 3571
96 Ga0070675_100050381 3300005354 Bacteria 3419
97 Ga0070675_100451491 3300005354 Bacteria 1153
98 Ga0070675_100764427 3300005354 Bacteria 882
99 Ga0070675_100926751 3300005354 Bacteria 799
100 Ga0070671_100011099 3300005355 Bacteria 7235
101 Ga0070671_100014746 3300005355 Bacteria 6317
102 Ga0070671_100016126 3300005355 Bacteria 6040
103 Ga0070671_100019329 3300005355 Bacteria 5543
104 Ga0070671_100062682 3300005355 Bacteria 3095
105 Ga0070674_100001866 3300005356 Bacteria 11433
106 Ga0070674_100032696 3300005356 Bacteria 3456
107 Ga0070674_100036557 3300005356 Bacteria 3298
108 Ga0070674_100098913 3300005356 Bacteria 2121
109 Ga0070674_100188272 3300005356 Bacteria 1586
110 Ga0070674_100624167 3300005356 Bacteria 913
111 Ga0070674_100832846 3300005356 Bacteria 799
112 Ga0070673_100004185 3300005364 Bacteria 9101
113 Ga0070673_100022716 3300005364 Bacteria 4570
114 Ga0070673_100033575 3300005364 Bacteria 3876
115 Ga0070673_100110563 3300005364 Bacteria 2278
116 Ga0070673_100450222 3300005364 Bacteria 1158
117 Ga0070688_100012552 3300005365 Bacteria 4749
118 Ga0070688_100024074 3300005365 Bacteria 3587
119 Ga0070688_100061863 3300005365 Bacteria 2368
120 Ga0070688_100499767 3300005365 Bacteria 917
121 Ga0070659_100002143 3300005366 Bacteria 14071
122 Ga0070659_100010039 3300005366 Bacteria 6969
123 Ga0070659_100011288 3300005366 Bacteria 6601
124 Ga0070659_100119874 3300005366 Bacteria 2130
125 Ga0070659_100168357 3300005366 Bacteria 1793
126 Ga0070659_100228075 3300005366 Bacteria 1539
127 Ga0070659_100253298 3300005366 Bacteria 1459
128 Ga0070659_100305306 3300005366 Bacteria 1328
129 Ga0070659_100375670 3300005366 Bacteria 1196
130 Ga0070659_100573130 3300005366 Bacteria 968
131 Ga0070667_100034410 3300005367 Bacteria 4238
132 Ga0070667_100045363 3300005367 Bacteria 3695
133 Ga0070667_100112920 3300005367 Bacteria 2357
134 Ga0070667_100123642 3300005367 Bacteria 2253
135 Ga0070667_100217171 3300005367 Bacteria 1701
136 Ga0070667_101705024 3300005367 Bacteria 593
137 Ga0070709_10341171 3300005434 Bacteria 1104
138 Ga0070709_10442654 3300005434 Bacteria 977
139 Ga0070709_10602732 3300005434 Bacteria 846
140 Ga0070714_100016452 3300005435 Bacteria 5973
141 Ga0070714_100032898 3300005435 Bacteria 4331
142 Ga0070714_100033161 3300005435 Bacteria 4316
143 Ga0070714_100742229 3300005435 Bacteria 949
144 Ga0070713_100000024 3300005436 Bacteria 97482
145 Ga0070713_100075391 3300005436 Bacteria 2861
146 Ga0070713_100982118 3300005436 Bacteria 814
147 Ga0070710_10003207 3300005437 Bacteria 7753
148 Ga0070710_10053643 3300005437 Bacteria 2272
149 Ga0070710_10384301 3300005437 Bacteria 937
150 Ga0070710_10532569 3300005437 Bacteria 809
151 Ga0070701_10237045 3300005438 Bacteria 1095
152 Ga0070711_100008717 3300005439 Bacteria 6223
153 Ga0070711_100022151 3300005439 Bacteria 4115
154 Ga0070711_100070726 3300005439 Bacteria 2457
155 Ga0070711_100114877 3300005439 Bacteria 1982
156 Ga0070705_100338942 3300005440 Bacteria 1092
157 Ga0070705_100444822 3300005440 Bacteria 971
158 Ga0070700_100026820 3300005441 Bacteria 3407
159 Ga0070694_100127744 3300005444 Bacteria 1832
160 Ga0070708_100018850 3300005445 Bacteria 5781
161 Ga0070708_100145836 3300005445 Bacteria 2198
162 Ga0070663_100008642 3300005455 Bacteria 6278
163 Ga0070663_100020093 3300005455 Bacteria 4417
164 Ga0070663_100038948 3300005455 Bacteria 3320
165 Ga0070663_100150371 3300005455 Bacteria 1785
166 Ga0070663_100250821 3300005455 Bacteria 1401
167 Ga0070678_100000272 3300005456 Bacteria 24000
168 Ga0070678_100006947 3300005456 Bacteria 6679
169 Ga0070678_100011722 3300005456 Bacteria 5420
170 Ga0070678_100191118 3300005456 Bacteria 1683
171 Ga0070678_100320366 3300005456 Bacteria 1324
172 Ga0070662_100012689 3300005457 Bacteria 5592
173 Ga0070662_100022693 3300005457 Bacteria 4299
174 Ga0070662_100023330 3300005457 Bacteria 4248
175 Ga0070662_100105079 3300005457 Bacteria 2143
176 Ga0070662_100294731 3300005457 Bacteria 1316
177 Ga0070662_100387220 3300005457 Bacteria 1152
178 Ga0070662_100535912 3300005457 Bacteria 980
179 Ga0070681_10000922 3300005458 Bacteria 24859
180 Ga0070681_10010032 3300005458 Bacteria 9337
181 Ga0070681_10060354 3300005458 Bacteria 3769
182 Ga0070681_10501693 3300005458 Bacteria 1127
183 Ga0068867_100004207 3300005459 Bacteria 10128
184 Ga0068867_100046173 3300005459 Bacteria 3198
185 Ga0068867_100048664 3300005459 Bacteria 3120
186 Ga0068867_100049996 3300005459 Bacteria 3079
187 Ga0068867_100101715 3300005459 Bacteria 2196
188 Ga0070685_10001200 3300005466 Bacteria 13804
189 Ga0070685_10030183 3300005466 Bacteria 3019
190 Ga0070685_10071372 3300005466 Bacteria 2058
191 Ga0070685_10565008 3300005466 Bacteria 814
192 Ga0070685_10792901 3300005466 Bacteria 698
193 Ga0070706_100034770 3300005467 Bacteria 4654
194 Ga0070706_100198602 3300005467 Bacteria 1873
195 Ga0070707_100048251 3300005468 Bacteria 4079
196 Ga0070707_100477306 3300005468 Bacteria 1208
197 Ga0070698_100031329 3300005471 Bacteria 5514
198 Ga0070698_100178280 3300005471 Bacteria 2063
199 Ga0070698_100929835 3300005471 Bacteria 816
200 Ga0070699_100007430 3300005518 Bacteria 9537
201 Ga0070699_100015828 3300005518 Bacteria 6475
202 Ga0070699_100148768 3300005518 Bacteria 2070
203 Ga0070679_100007596 3300005530 Bacteria 10144
204 Ga0070679_100024041 3300005530 Bacteria 5968
205 Ga0070679_100061018 3300005530 Bacteria 3759
206 Ga0070679_100067752 3300005530 Bacteria 3560
207 Ga0070679_100098045 3300005530 Bacteria 2919
208 Ga0070679_100182536 3300005530 Bacteria 2070
209 Ga0070679_100331304 3300005530 Bacteria 1471
210 Ga0070684_100010592 3300005535 Bacteria 7312
211 Ga0070684_100013894 3300005535 Bacteria 6505
212 Ga0070684_100039767 3300005535 Bacteria 4047
213 Ga0070684_100577808 3300005535 Bacteria 1044
214 Ga0070684_100709909 3300005535 Bacteria 938
215 Ga0070697_100026250 3300005536 Bacteria 4651
216 Ga0068853_100007110 3300005539 Bacteria 8958
217 Ga0068853_100017646 3300005539 Bacteria 5891
218 Ga0068853_100029872 3300005539 Bacteria 4598
219 Ga0068853_100039155 3300005539 Bacteria 4042
220 Ga0068853_100053048 3300005539 Bacteria 3492
221 Ga0068853_100646145 3300005539 Bacteria 1007
222 Ga0070672_100005647 3300005543 Bacteria 8323
223 Ga0070672_100022474 3300005543 Bacteria 4634
224 Ga0070672_100138791 3300005543 Bacteria 2003
225 Ga0070672_100236404 3300005543 Bacteria 1536
226 Ga0070672_100274336 3300005543 Bacteria 1424
227 Ga0070672_100551440 3300005543 Bacteria 1001
228 Ga0070672_100774880 3300005543 Bacteria 843
229 Ga0070686_100022952 3300005544 Bacteria 3722
230 Ga0070686_100952706 3300005544 Bacteria 701
231 Ga0070695_100115702 3300005545 Bacteria 1827
232 Ga0070696_100008160 3300005546 Bacteria 7006
233 Ga0070696_100020946 3300005546 Bacteria 4431
234 Ga0070693_100075220 3300005547 Bacteria 1999
235 Ga0070693_100250163 3300005547 Bacteria 1174
236 Ga0070693_100400975 3300005547 Bacteria 951
237 Ga0070693_100507920 3300005547 Bacteria 856
238 Ga0070665_100007107 3300005548 Bacteria 11375
239 Ga0070665_100045327 3300005548 Bacteria 4416
240 Ga0070665_100074845 3300005548 Bacteria 3392
241 Ga0070665_100095116 3300005548 Bacteria 2984
242 Ga0070665_100113331 3300005548 Bacteria 2714
243 Ga0070665_100268086 3300005548 Bacteria 1709
244 Ga0070665_100615754 3300005548 Bacteria 1099
245 Ga0070665_100876333 3300005548 Bacteria 910
246 Ga0070704_100004085 3300005549 Bacteria 8421
247 Ga0070704_100370211 3300005549 Bacteria 1215
248 Ga0068855_100001999 3300005563 Bacteria 25318
249 Ga0068855_100036102 3300005563 Bacteria 5884
250 Ga0068855_100059105 3300005563 Bacteria 4487
251 Ga0068855_100088418 3300005563 Bacteria 3579
252 Ga0068855_100183620 3300005563 Bacteria 2364
253 Ga0068855_100211064 3300005563 Bacteria 2181
254 Ga0068855_100334640 3300005563 Bacteria 1671
255 Ga0068855_100525871 3300005563 Bacteria 1283
256 Ga0068855_100535971 3300005563 Bacteria 1269
257 Ga0070664_100001544 3300005564 Bacteria 18417
258 Ga0070664_100024902 3300005564 Bacteria 4957
259 Ga0070664_100025147 3300005564 Bacteria 4933
260 Ga0070664_100046295 3300005564 Bacteria 3674
261 Ga0070664_100059603 3300005564 Bacteria 3248
262 Ga0070664_100085106 3300005564 Bacteria 2730
263 Ga0070664_100100910 3300005564 Bacteria 2509
264 Ga0070664_100153730 3300005564 Bacteria 2032
265 Ga0070664_100675670 3300005564 Bacteria 961
266 Ga0068857_100000104 3300005577 Bacteria 49946
267 Ga0068857_100194793 3300005577 Bacteria 1846
268 Ga0068857_100214156 3300005577 Bacteria 1758
269 Ga0068857_100874541 3300005577 Bacteria 861
270 Ga0068854_100002772 3300005578 Bacteria 10882
271 Ga0068854_100020888 3300005578 Bacteria 4437
272 Ga0068854_100053555 3300005578 Bacteria 2898
273 Ga0068854_100061865 3300005578 Bacteria 2712
274 Ga0068856_100000898 3300005614 Bacteria 31864
275 Ga0068856_100010329 3300005614 Bacteria 9069
276 Ga0068856_100010416 3300005614 Bacteria 9027
277 Ga0068856_100018162 3300005614 Bacteria 6819
278 Ga0068856_100088154 3300005614 Bacteria 3085
279 Ga0070702_100011026 3300005615 Bacteria 4483
280 Ga0070702_100016298 3300005615 Bacteria 3810
281 Ga0068852_100006785 3300005616 Bacteria 8307
282 Ga0068852_100007702 3300005616 Bacteria 7877
283 Ga0068852_100041036 3300005616 Bacteria 3908
284 Ga0068852_100103657 3300005616 Bacteria 2573
285 Ga0068852_100200850 3300005616 Bacteria 1887
286 Ga0068852_100386673 3300005616 Bacteria 1373
287 Ga0068852_100699584 3300005616 Bacteria 1023
288 Ga0068852_100764485 3300005616 Bacteria 979
289 Ga0068852_100775937 3300005616 Bacteria 972
290 Ga0068852_101159019 3300005616 Bacteria 794
291 Ga0068859_100005180 3300005617 Bacteria 13240
292 Ga0068859_100057838 3300005617 Bacteria 3905
293 Ga0068859_100095464 3300005617 Bacteria 3026
294 Ga0068859_100219531 3300005617 Bacteria 1989
295 Ga0068859_100412444 3300005617 Bacteria 1447
296 Ga0068859_100573750 3300005617 Bacteria 1222
297 Ga0068864_100001981 3300005618 Bacteria 16859
298 Ga0068864_100005823 3300005618 Bacteria 10104
299 Ga0068864_100006757 3300005618 Bacteria 9394
300 Ga0068864_100013225 3300005618 Bacteria 6835
301 Ga0068864_100051127 3300005618 Bacteria 3559
302 Ga0068864_100353511 3300005618 Bacteria 1387
303 Ga0068864_100443230 3300005618 Bacteria 1241
304 Ga0068864_101214670 3300005618 Bacteria 753
305 Ga0068866_10002289 3300005718 Bacteria 7928
306 Ga0068866_10016061 3300005718 Bacteria 3339
307 Ga0068866_10639358 3300005718 Bacteria 723
308 Ga0068861_100008488 3300005719 Bacteria 7073
309 Ga0068861_100125061 3300005719 Bacteria 2080
310 Ga0068851_10002361 3300005834 Bacteria 8301
311 Ga0068851_10007854 3300005834 Bacteria 4912
312 Ga0068851_10086369 3300005834 Bacteria 1646
313 Ga0068851_10094243 3300005834 Bacteria 1581
314 Ga0068851_10165387 3300005834 Bacteria 1218
315 Ga0068870_10005113 3300005840 Bacteria 5706
316 Ga0068870_10005309 3300005840 Bacteria 5615
317 Ga0068870_10186904 3300005840 Bacteria 1247
318 Ga0068863_100000850 3300005841 Bacteria 30447
319 Ga0068863_100007736 3300005841 Bacteria 10510
320 Ga0068863_100008082 3300005841 Bacteria 10274
321 Ga0068863_100173505 3300005841 Bacteria 2069
322 Ga0068863_100200757 3300005841 Bacteria 1918
323 Ga0068863_100759290 3300005841 Bacteria 966
324 Ga0068858_100006127 3300005842 Bacteria 11733
325 Ga0068858_100031645 3300005842 Bacteria 4915
326 Ga0068858_100085902 3300005842 Bacteria 2927
327 Ga0068858_100115664 3300005842 Bacteria 2506
328 Ga0068858_101033066 3300005842 Bacteria 806
329 Ga0068860_100020893 3300005843 Bacteria 6342
330 Ga0068860_100028239 3300005843 Bacteria 5400
331 Ga0068860_100045451 3300005843 Bacteria 4188
332 Ga0068860_100093793 3300005843 Bacteria 2861
333 Ga0068860_100094989 3300005843 Bacteria 2841
334 Ga0068860_100109237 3300005843 Bacteria 2643
335 Ga0068860_100213164 3300005843 Bacteria 1874
336 Ga0068862_100128251 3300005844 Bacteria 2241
337 Ga0068862_100371726 3300005844 Bacteria 1331
338 Ga0081539_10054416 3300005985 Bacteria 2234
339 Ga0070715_10033019 3300006163 Bacteria 2113
340 Ga0070716_100013745 3300006173 Bacteria 4134
341 Ga0070716_100054747 3300006173 Bacteria 2280
342 Ga0070712_100054528 3300006175 Bacteria 2795
343 Ga0070712_100088906 3300006175 Bacteria 2258
344 Ga0070712_100119076 3300006175 Bacteria 1984
345 Ga0070712_100330397 3300006175 Bacteria 1242
346 Ga0097621_100046112 3300006237 Bacteria 3525
347 Ga0097621_100088236 3300006237 Bacteria 2591
348 Ga0097621_100164168 3300006237 Bacteria 1911
349 Ga0097621_100197086 3300006237 Bacteria 1747
350 Ga0097621_100228635 3300006237 Bacteria 1623
351 Ga0068871_100007989 3300006358 Bacteria 7590
352 Ga0068871_100032440 3300006358 Bacteria 4126
353 Ga0068871_100035447 3300006358 Bacteria 3965
354 Ga0068871_100122386 3300006358 Bacteria 2199
355 Ga0068871_100129452 3300006358 Bacteria 2139
356 Ga0068871_100212433 3300006358 Bacteria 1674
357 Ga0068871_100227497 3300006358 Bacteria 1618
358 Ga0068871_100952180 3300006358 Bacteria 798
359 Ga0075428_100113133 3300006844 Bacteria 2957
360 Ga0075433_10038083 3300006852 Bacteria 4152
361 Ga0075434_100000977 3300006871 Bacteria 23079
362 Ga0075434_100407414 3300006871 Bacteria 1381
363 Ga0075434_100519852 3300006871 Bacteria 1211
364 Ga0068865_100043173 3300006881 Bacteria 3079
365 Ga0068865_100058648 3300006881 Bacteria 2690
366 Ga0068865_100128040 3300006881 Bacteria 1898
367 Ga0075436_100188648 3300006914 Bacteria 1458
368 Ga0097620_100005180 3300006931 Bacteria 13240
369 Ga0097620_100057837 3300006931 Bacteria 3905
370 Ga0097620_100095464 3300006931 Bacteria 3026
371 Ga0097620_100219532 3300006931 Bacteria 1989
372 Ga0097620_100412467 3300006931 Bacteria 1447
373 Ga0097620_100573665 3300006931 Bacteria 1222
374 Ga0075435_100027991 3300007076 Bacteria 4416
375 Ga0075435_100159055 3300007076 Bacteria 1902
376 Ga0105240_10001001 3300009093 Bacteria 50438
377 Ga0105240_10014078 3300009093 Bacteria 10931
378 Ga0105240_10017602 3300009093 Bacteria 9627
379 Ga0105240_10217802 3300009093 Bacteria 2226
380 Ga0105240_10328561 3300009093 Bacteria 1741
381 Ga0111539_10005490 3300009094 Bacteria 16400
382 Ga0111539_10051415 3300009094 Bacteria 4908
383 Ga0105245_10021378 3300009098 Bacteria 5675
384 Ga0105245_10024734 3300009098 Bacteria 5275
385 Ga0105245_10828547 3300009098 Bacteria 964
386 Ga0105247_10061358 3300009101 Bacteria 2331
387 Ga0105247_10475594 3300009101 Bacteria 906
388 Ga0114129_10815407 3300009147 Bacteria 1189
389 Ga0105243_10068749 3300009148 Bacteria 2855
390 Ga0105243_11150723 3300009148 Bacteria 787
391 Ga0105243_11771578 3300009148 Bacteria 648
392 Ga0105241_10022568 3300009174 Bacteria 4662
393 Ga0105241_10027616 3300009174 Bacteria 4226
394 Ga0105241_10057199 3300009174 Bacteria 2991
395 Ga0105241_10471882 3300009174 Bacteria 1114
396 Ga0105242_10013155 3300009176 Bacteria 6386
397 Ga0105242_10055201 3300009176 Bacteria 3250
398 Ga0105248_10003363 3300009177 Bacteria 17776
399 Ga0105248_10144839 3300009177 Bacteria 2681
400 Ga0105248_10328347 3300009177 Bacteria 1723
401 Ga0105248_10341437 3300009177 Bacteria 1686
402 Ga0105248_10395256 3300009177 Bacteria 1557
403 Ga0105248_12117644 3300009177 Bacteria 640
404 Ga0105237_10091716 3300009545 Bacteria 3028
405 Ga0105237_10195828 3300009545 Bacteria 2021
406 Ga0105237_10693734 3300009545 Bacteria 1025
407 Ga0105238_10002775 3300009551 Bacteria 17478
408 Ga0105238_10028506 3300009551 Bacteria 5688
409 Ga0105238_10441721 3300009551 Bacteria 1297
410 Ga0105238_11271621 3300009551 Bacteria 761
411 Ga0105249_10019007 3300009553 Bacteria 6128
412 Ga0105249_10624603 3300009553 Bacteria 1134
413 Ga0105249_10730622 3300009553 Bacteria 1051
414 Ga0105249_12040922 3300009553 Bacteria 646
415 Ga0105239_10053332 3300010375 Bacteria 4436
416 Ga0105246_10019169 3300011119 Bacteria 4367
417 Ga0105246_10247587 3300011119 Bacteria 1413
418 Ga0105246_10652577 3300011119 Bacteria 916
419 Ga0157373_10000688 3300013100 Bacteria 26553
420 Ga0157373_10029614 3300013100 Bacteria 3942
421 Ga0157373_10074481 3300013100 Bacteria 2395
422 Ga0157373_10427254 3300013100 Bacteria 952
423 Ga0157373_10808542 3300013100 Bacteria 692
424 Ga0157373_10891024 3300013100 Bacteria 660
425 Ga0157371_10001512 3300013102 Bacteria 24037
426 Ga0157371_10027736 3300013102 Bacteria 4104
427 Ga0157371_10098885 3300013102 Bacteria 2069
428 Ga0157371_10153731 3300013102 Bacteria 1641
429 Ga0157371_10171278 3300013102 Bacteria 1551
430 Ga0157371_10318050 3300013102 Bacteria 1129
431 Ga0157370_10004286 3300013104 Bacteria 16429
432 Ga0157370_10004851 3300013104 Bacteria 15274
433 Ga0157370_10009629 3300013104 Bacteria 10281
434 Ga0157370_10025810 3300013104 Bacteria 5812
435 Ga0157370_10033438 3300013104 Bacteria 5014
436 Ga0157370_10114161 3300013104 Bacteria 2524
437 Ga0157370_10276092 3300013104 Bacteria 1553
438 Ga0157369_10021014 3300013105 Bacteria 7298
439 Ga0157369_10024142 3300013105 Bacteria 6767
440 Ga0157369_10027094 3300013105 Bacteria 6355
441 Ga0157369_10213246 3300013105 Bacteria 2023
442 Ga0157369_10264294 3300013105 Bacteria 1794
443 Ga0157369_10644900 3300013105 Bacteria 1092
444 Ga0157374_10002129 3300013296 Bacteria 16670
445 Ga0157374_10020226 3300013296 Bacteria 5904
446 Ga0157374_10026271 3300013296 Bacteria 5238
447 Ga0157374_10120183 3300013296 Bacteria 2535
448 Ga0157374_10162013 3300013296 Bacteria 2178
449 Ga0157374_10202608 3300013296 Bacteria 1943
450 Ga0157374_11318628 3300013296 Bacteria 744
451 Ga0157374_11841339 3300013296 Bacteria 631
452 Ga0157378_10071518 3300013297 Bacteria 3115
453 Ga0157378_10115818 3300013297 Bacteria 2464
454 Ga0157378_10211038 3300013297 Bacteria 1841
455 Ga0157378_10213934 3300013297 Bacteria 1829
456 Ga0157378_10413156 3300013297 Bacteria 1332
457 Ga0157378_10418113 3300013297 Bacteria 1324
458 Ga0157378_11284460 3300013297 Bacteria 773
459 Ga0163162_10025730 3300013306 Bacteria 5818
460 Ga0163162_10067418 3300013306 Bacteria 3629
461 Ga0163162_10088214 3300013306 Bacteria 3181
462 Ga0163162_10422542 3300013306 Bacteria 1465
463 Ga0157372_10000342 3300013307 Bacteria 51414
464 Ga0157372_10009556 3300013307 Bacteria 10311
465 Ga0157372_10041123 3300013307 Bacteria 5110
466 Ga0157372_10044717 3300013307 Bacteria 4908
467 Ga0157372_10060305 3300013307 Bacteria 4245
468 Ga0157372_10397644 3300013307 Bacteria 1606
469 Ga0157372_10768417 3300013307 Bacteria 1120
470 Ga0157372_10774949 3300013307 Bacteria 1115
471 Ga0157372_10850509 3300013307 Bacteria 1059
472 Ga0157372_11230806 3300013307 Bacteria 865
473 Ga0157372_11837225 3300013307 Bacteria 697
474 Ga0157375_10010892 3300013308 Bacteria 8016
475 Ga0157375_10014178 3300013308 Bacteria 7105
476 Ga0157375_10028993 3300013308 Bacteria 5199
477 Ga0157375_10070340 3300013308 Bacteria 3509
478 Ga0157375_10173356 3300013308 Bacteria 2306
479 Ga0157375_10174496 3300013308 Bacteria 2298
480 Ga0163163_10004514 3300014325 Bacteria 11875
481 Ga0163163_10022784 3300014325 Bacteria 5935
482 Ga0163163_10133788 3300014325 Bacteria 2520
483 Ga0163163_10243277 3300014325 Bacteria 1849
484 Ga0157380_10652247 3300014326 Bacteria 1050
485 Ga0157380_10898438 3300014326 Bacteria 912
486 Ga0157380_11210411 3300014326 Bacteria 799
487 Ga0182008_10065092 3300014497 Bacteria 1794
488 Ga0157377_10007363 3300014745 Bacteria 5312
489 Ga0157377_10097925 3300014745 Bacteria 1742
490 Ga0157377_10638851 3300014745 Bacteria 764
491 Ga0157379_10009117 3300014968 Bacteria 8641
492 Ga0157379_10016746 3300014968 Bacteria 6451
493 Ga0157379_10062164 3300014968 Bacteria 3339
494 Ga0157379_10065683 3300014968 Bacteria 3243
495 Ga0157379_10412943 3300014968 Bacteria 1242
496 Ga0157379_10683356 3300014968 Bacteria 963
497 Ga0157379_10740469 3300014968 Bacteria 925
498 Ga0157376_10019365 3300014969 Bacteria 5245
499 Ga0157376_10020207 3300014969 Bacteria 5147
500 Ga0157376_10113198 3300014969 Bacteria 2392
501 Ga0157376_10152499 3300014969 Bacteria 2085
502 Ga0157376_10261668 3300014969 Bacteria 1621
503 Ga0157376_10639184 3300014969 Bacteria 1063
504 Ga0157376_11078151 3300014969 Bacteria 828
505 Ga0163161_10083771 3300017792 Bacteria 2351
506 Ga0163161_10312547 3300017792 Bacteria 1240
507 Ga0163161_10352863 3300017792 Bacteria 1170
508 Ga0206354_11504917 3300020081 Bacteria 1983
509 Ga0206353_10760568 3300020082 Bacteria 2330
510 Ga0207673_1003468 3300025290 Bacteria 1846
511 Ga0207697_10001057 3300025315 Bacteria 15204
512 Ga0207697_10015388 3300025315 Bacteria 3162
513 Ga0207697_10226300 3300025315 Bacteria 825
514 Ga0207656_10012585 3300025321 Bacteria 3220
515 Ga0207656_10044077 3300025321 Bacteria 1904
516 Ga0207656_10095551 3300025321 Bacteria 1355
517 Ga0207656_10237208 3300025321 Bacteria 890
518 Ga0207682_10000068 3300025893 Bacteria 45481
519 Ga0207682_10000862 3300025893 Bacteria 14079
520 Ga0207682_10242411 3300025893 Bacteria 838
521 Ga0207692_10013832 3300025898 Bacteria 3511
522 Ga0207692_10227636 3300025898 Bacteria 1108
523 Ga0207642_10001698 3300025899 Bacteria 6811
524 Ga0207642_10036724 3300025899 Bacteria 2105
525 Ga0207642_10371785 3300025899 Bacteria 849
526 Ga0207710_10107497 3300025900 Bacteria 1322
527 Ga0207688_10118562 3300025901 Bacteria 1543
528 Ga0207688_10134496 3300025901 Bacteria 1451
529 Ga0207680_10002787 3300025903 Bacteria 8177
530 Ga0207680_10023408 3300025903 Bacteria 3372
531 Ga0207680_10050483 3300025903 Bacteria 2482
532 Ga0207685_10016828 3300025905 Bacteria 2349
533 Ga0207699_10008060 3300025906 Bacteria 5178
534 Ga0207699_10305830 3300025906 Bacteria 1111
535 Ga0207699_10476060 3300025906 Bacteria 899
536 Ga0207699_10523835 3300025906 Bacteria 857
537 Ga0207645_10000499 3300025907 Bacteria 32449
538 Ga0207645_10003019 3300025907 Bacteria 13004
539 Ga0207645_10011998 3300025907 Bacteria 5892
540 Ga0207645_10161849 3300025907 Bacteria 1464
541 Ga0207645_10265030 3300025907 Bacteria 1138
542 Ga0207643_10000298 3300025908 Bacteria 34305
543 Ga0207643_10007851 3300025908 Bacteria 5729
544 Ga0207643_10068058 3300025908 Bacteria 2045
545 Ga0207705_10087848 3300025909 Bacteria 2274
546 Ga0207684_10017844 3300025910 Bacteria 6085
547 Ga0207684_10107975 3300025910 Bacteria 2381
548 Ga0207684_10515702 3300025910 Bacteria 1024
549 Ga0207654_10048234 3300025911 Bacteria 2436
550 Ga0207654_10115176 3300025911 Bacteria 1679
551 Ga0207654_10611024 3300025911 Bacteria 779
552 Ga0207707_10016103 3300025912 Bacteria 6519
553 Ga0207707_10062308 3300025912 Bacteria 3245
554 Ga0207707_10074169 3300025912 Bacteria 2967
555 Ga0207707_10159068 3300025912 Bacteria 1975
556 Ga0207707_10183641 3300025912 Bacteria 1825
557 Ga0207707_10201398 3300025912 Bacteria 1736
558 Ga0207707_10439690 3300025912 Bacteria 1117
559 Ga0207695_10019257 3300025913 Bacteria 7860
560 Ga0207695_10103714 3300025913 Bacteria 2835
561 Ga0207695_10173143 3300025913 Bacteria 2083
562 Ga0207671_10396976 3300025914 Bacteria 1097
563 Ga0207671_10684001 3300025914 Bacteria 816
564 Ga0207693_10000688 3300025915 Bacteria 30338
565 Ga0207693_10026232 3300025915 Bacteria 4612
566 Ga0207693_10128013 3300025915 Bacteria 1996
567 Ga0207663_10014545 3300025916 Bacteria 4312
568 Ga0207663_10016108 3300025916 Bacteria 4137
569 Ga0207663_10243442 3300025916 Bacteria 1320
570 Ga0207660_10010989 3300025917 Bacteria 5886
571 Ga0207660_10080298 3300025917 Bacteria 2394
572 Ga0207660_10349097 3300025917 Bacteria 1185
573 Ga0207660_10730734 3300025917 Bacteria 808
574 Ga0207662_10009794 3300025918 Bacteria 5286
575 Ga0207662_10053247 3300025918 Bacteria 2410
576 Ga0207657_10001035 3300025919 Bacteria 29424
577 Ga0207657_10003755 3300025919 Bacteria 16138
578 Ga0207657_10004727 3300025919 Bacteria 14376
579 Ga0207657_10005705 3300025919 Bacteria 12994
580 Ga0207657_10006460 3300025919 Bacteria 12148
581 Ga0207657_10017794 3300025919 Bacteria 6803
582 Ga0207657_10047964 3300025919 Bacteria 3730
583 Ga0207649_10005227 3300025920 Bacteria 7010
584 Ga0207649_10017283 3300025920 Bacteria 4088
585 Ga0207649_10077211 3300025920 Bacteria 2145
586 Ga0207649_10105478 3300025920 Bacteria 1873
587 Ga0207649_10269335 3300025920 Bacteria 1234
588 Ga0207649_10293419 3300025920 Bacteria 1186
589 Ga0207652_10018438 3300025921 Bacteria 5724
590 Ga0207652_10035989 3300025921 Bacteria 4183
591 Ga0207652_10048304 3300025921 Bacteria 3638
592 Ga0207652_10164989 3300025921 Bacteria 1986
593 Ga0207646_10075084 3300025922 Bacteria 3020
594 Ga0207646_10108871 3300025922 Bacteria 2486
595 Ga0207681_10037122 3300025923 Bacteria 3219
596 Ga0207681_10058511 3300025923 Bacteria 2639
597 Ga0207681_10074356 3300025923 Bacteria 2380
598 Ga0207681_10125142 3300025923 Bacteria 1891
599 Ga0207681_10235393 3300025923 Bacteria 1423
600 Ga0207694_10142305 3300025924 Bacteria 1929
601 Ga0207650_10003014 3300025925 Bacteria 11605
602 Ga0207650_10011723 3300025925 Bacteria 6042
603 Ga0207650_10011789 3300025925 Bacteria 6026
604 Ga0207650_10023387 3300025925 Bacteria 4381
605 Ga0207650_10036419 3300025925 Bacteria 3580
606 Ga0207650_10043490 3300025925 Bacteria 3297
607 Ga0207650_10076898 3300025925 Bacteria 2522
608 Ga0207650_10413015 3300025925 Bacteria 1119
609 Ga0207659_10013625 3300025926 Bacteria 5214
610 Ga0207659_10016878 3300025926 Bacteria 4761
611 Ga0207659_10026956 3300025926 Bacteria 3884
612 Ga0207659_10627471 3300025926 Bacteria 917
613 Ga0207659_10862424 3300025926 Bacteria 778
614 Ga0207687_10003274 3300025927 Bacteria 10962
615 Ga0207687_10033821 3300025927 Bacteria 3469
616 Ga0207687_10119451 3300025927 Bacteria 1969
617 Ga0207700_10000108 3300025928 Bacteria 49828
618 Ga0207700_10091642 3300025928 Bacteria 2401
619 Ga0207700_10206168 3300025928 Bacteria 1659
620 Ga0207700_11395422 3300025928 Bacteria 623
621 Ga0207664_10000327 3300025929 Bacteria 35277
622 Ga0207664_10041339 3300025929 Bacteria 3591
623 Ga0207664_10062403 3300025929 Bacteria 2976
624 Ga0207664_10406116 3300025929 Bacteria 1212
625 Ga0207644_10003706 3300025931 Bacteria 9901
626 Ga0207644_10023601 3300025931 Bacteria 4215
627 Ga0207644_10036595 3300025931 Bacteria 3447
628 Ga0207644_10044217 3300025931 Bacteria 3163
629 Ga0207644_10054651 3300025931 Bacteria 2876
630 Ga0207644_10062983 3300025931 Bacteria 2691
631 Ga0207690_10098408 3300025932 Bacteria 2083
632 Ga0207690_10128413 3300025932 Bacteria 1852
633 Ga0207690_10141344 3300025932 Bacteria 1774
634 Ga0207690_10147027 3300025932 Bacteria 1743
635 Ga0207690_10172051 3300025932 Bacteria 1624
636 Ga0207690_10195314 3300025932 Bacteria 1533
637 Ga0207690_10199750 3300025932 Bacteria 1518
638 Ga0207690_10325423 3300025932 Bacteria 1209
639 Ga0207690_10383307 3300025932 Bacteria 1118
640 Ga0207690_10679449 3300025932 Bacteria 845
641 Ga0207706_10006265 3300025933 Bacteria 11061
642 Ga0207706_10020379 3300025933 Bacteria 5961
643 Ga0207706_10020670 3300025933 Bacteria 5915
644 Ga0207706_10066934 3300025933 Bacteria 3161
645 Ga0207686_10000485 3300025934 Bacteria 26204
646 Ga0207709_10797781 3300025935 Bacteria 762
647 Ga0207709_10890364 3300025935 Bacteria 723
648 Ga0207670_10016092 3300025936 Bacteria 4487
649 Ga0207670_10125806 3300025936 Bacteria 1870
650 Ga0207670_10282359 3300025936 Bacteria 1294
651 Ga0207669_10066907 3300025937 Bacteria 2236
652 Ga0207669_10206239 3300025937 Bacteria 1431
653 Ga0207669_10538093 3300025937 Bacteria 940
654 Ga0207669_10542868 3300025937 Bacteria 937
655 Ga0207669_10775422 3300025937 Bacteria 793
656 Ga0207704_10010592 3300025938 Bacteria 4504
657 Ga0207704_10031155 3300025938 Bacteria 3000
658 Ga0207704_10592833 3300025938 Bacteria 906
659 Ga0207665_10015162 3300025939 Bacteria 5062
660 Ga0207665_10065575 3300025939 Bacteria 2469
661 Ga0207691_10000152 3300025940 Bacteria 64344
662 Ga0207691_10010112 3300025940 Bacteria 9055
663 Ga0207691_10089904 3300025940 Bacteria 2753
664 Ga0207691_10112605 3300025940 Bacteria 2418
665 Ga0207691_10188765 3300025940 Bacteria 1798
666 Ga0207691_10210801 3300025940 Bacteria 1687
667 Ga0207691_10345524 3300025940 Bacteria 1273
668 Ga0207691_10552688 3300025940 Bacteria 976
669 Ga0207711_10000260 3300025941 Bacteria 57379
670 Ga0207711_10013156 3300025941 Bacteria 6872
671 Ga0207711_10227719 3300025941 Bacteria 1707
672 Ga0207711_10332150 3300025941 Bacteria 1406
673 Ga0207689_10000361 3300025942 Bacteria 42843
674 Ga0207689_10008422 3300025942 Bacteria 8980
675 Ga0207689_10011684 3300025942 Bacteria 7525
676 Ga0207689_10094464 3300025942 Bacteria 2456
677 Ga0207689_10488866 3300025942 Bacteria 1031
678 Ga0207661_10025735 3300025944 Bacteria 4477
679 Ga0207661_10061662 3300025944 Bacteria 3030
680 Ga0207661_10252736 3300025944 Bacteria 1567
681 Ga0207661_10282373 3300025944 Bacteria 1484
682 Ga0207679_10000674 3300025945 Bacteria 22908
683 Ga0207679_10026428 3300025945 Bacteria 4002
684 Ga0207679_10062209 3300025945 Bacteria 2781
685 Ga0207679_10077482 3300025945 Bacteria 2529
686 Ga0207679_10200484 3300025945 Bacteria 1666
687 Ga0207679_10397468 3300025945 Bacteria 1212
688 Ga0207679_10492098 3300025945 Bacteria 1093
689 Ga0207679_10962119 3300025945 Bacteria 782
690 Ga0207667_10004922 3300025949 Bacteria 16313
691 Ga0207667_10024927 3300025949 Bacteria 6556
692 Ga0207667_10026827 3300025949 Bacteria 6286
693 Ga0207667_10035525 3300025949 Bacteria 5345
694 Ga0207667_10112633 3300025949 Bacteria 2805
695 Ga0207667_10142540 3300025949 Bacteria 2467
696 Ga0207667_10167039 3300025949 Bacteria 2262
697 Ga0207667_10171989 3300025949 Bacteria 2226
698 Ga0207667_10281475 3300025949 Bacteria 1699
699 Ga0207667_10751870 3300025949 Bacteria 974
700 Ga0207667_10778565 3300025949 Bacteria 955
701 Ga0207651_10044039 3300025960 Bacteria 2983
702 Ga0207651_10086989 3300025960 Bacteria 2273
703 Ga0207651_10297113 3300025960 Bacteria 1341
704 Ga0207651_10367927 3300025960 Bacteria 1215
705 Ga0207712_10029999 3300025961 Bacteria 3654
706 Ga0207712_10450363 3300025961 Bacteria 1091
707 Ga0207668_10001312 3300025972 Bacteria 14772
708 Ga0207668_10011701 3300025972 Bacteria 5341
709 Ga0207668_10067979 3300025972 Bacteria 2531
710 Ga0207668_10162250 3300025972 Bacteria 1743
711 Ga0207668_10409339 3300025972 Bacteria 1148
712 Ga0207640_10012419 3300025981 Bacteria 4849
713 Ga0207640_10044591 3300025981 Bacteria 2842
714 Ga0207640_10057258 3300025981 Bacteria 2562
715 Ga0207640_10125859 3300025981 Bacteria 1845
716 Ga0207640_10129329 3300025981 Bacteria 1823
717 Ga0207658_10002215 3300025986 Bacteria 14429
718 Ga0207658_10080828 3300025986 Bacteria 2490
719 Ga0207658_10174607 3300025986 Bacteria 1773
720 Ga0207658_10328799 3300025986 Bacteria 1325
721 Ga0207658_10508050 3300025986 Bacteria 1074
722 Ga0207677_10000160 3300026023 Bacteria 53532
723 Ga0207677_10010043 3300026023 Bacteria 5343
724 Ga0207677_10036705 3300026023 Bacteria 3197
725 Ga0207677_10094070 3300026023 Bacteria 2187
726 Ga0207703_10010791 3300026035 Bacteria 7127
727 Ga0207703_10069267 3300026035 Bacteria 2909
728 Ga0207639_10007013 3300026041 Bacteria 7680
729 Ga0207639_10012440 3300026041 Bacteria 5926
730 Ga0207639_10032898 3300026041 Bacteria 3821
731 Ga0207639_10177667 3300026041 Bacteria 1808
732 Ga0207639_10312337 3300026041 Bacteria 1393
733 Ga0207639_10468310 3300026041 Bacteria 1147
734 Ga0207639_10569996 3300026041 Bacteria 1041
735 Ga0207639_10680611 3300026041 Bacteria 953
736 Ga0207678_10007730 3300026067 Bacteria 9497
737 Ga0207678_10008302 3300026067 Bacteria 9151
738 Ga0207678_10010416 3300026067 Bacteria 8161
739 Ga0207678_10015890 3300026067 Bacteria 6613
740 Ga0207678_10028046 3300026067 Bacteria 4917
741 Ga0207678_10144302 3300026067 Bacteria 2032
742 Ga0207708_10063133 3300026075 Bacteria 2830
743 Ga0207702_10006633 3300026078 Bacteria 9954
744 Ga0207702_10016800 3300026078 Bacteria 6057
745 Ga0207702_10028735 3300026078 Bacteria 4623
746 Ga0207702_10051666 3300026078 Bacteria 3475
747 Ga0207702_10139643 3300026078 Bacteria 2191
748 Ga0207641_10006193 3300026088 Bacteria 10122
749 Ga0207641_10008699 3300026088 Bacteria 8383
750 Ga0207641_10059380 3300026088 Bacteria 3256
751 Ga0207641_10153304 3300026088 Bacteria 2088
752 Ga0207641_10162988 3300026088 Bacteria 2028
753 Ga0207641_10693659 3300026088 Bacteria 1002
754 Ga0207648_10007837 3300026089 Bacteria 10425
755 Ga0207648_10021514 3300026089 Bacteria 5797
756 Ga0207648_10048128 3300026089 Bacteria 3734
757 Ga0207648_10052134 3300026089 Bacteria 3577
758 Ga0207648_10816947 3300026089 Bacteria 868
759 Ga0207676_10001563 3300026095 Bacteria 16883
760 Ga0207676_10003026 3300026095 Bacteria 11990
761 Ga0207676_10016942 3300026095 Bacteria 5277
762 Ga0207676_10039512 3300026095 Bacteria 3609
763 Ga0207676_10130994 3300026095 Bacteria 2132
764 Ga0207676_10565251 3300026095 Bacteria 1088
765 Ga0207676_10895458 3300026095 Bacteria 870
766 Ga0207674_10000954 3300026116 Bacteria 37774
767 Ga0207674_10001783 3300026116 Bacteria 27505
768 Ga0207674_10022206 3300026116 Bacteria 6820
769 Ga0207674_10085389 3300026116 Bacteria 3151
770 Ga0207674_10131730 3300026116 Bacteria 2463
771 Ga0207674_10244912 3300026116 Bacteria 1740
772 Ga0207674_10729390 3300026116 Bacteria 956
773 Ga0207675_100041844 3300026118 Bacteria 4278
774 Ga0207675_100049349 3300026118 Bacteria 3929
775 Ga0207675_100053956 3300026118 Bacteria 3750
776 Ga0207675_100067285 3300026118 Bacteria 3348
777 Ga0207683_10000307 3300026121 Bacteria 44287
778 Ga0207683_10005487 3300026121 Bacteria 10865
779 Ga0207683_10005668 3300026121 Bacteria 10707
780 Ga0207683_10020819 3300026121 Bacteria 5611
781 Ga0207683_10185176 3300026121 Bacteria 1889
782 Ga0207698_10002898 3300026142 Bacteria 10262
783 Ga0207698_10038284 3300026142 Bacteria 3542
784 Ga0207698_10043478 3300026142 Bacteria 3366
785 Ga0207698_10070777 3300026142 Bacteria 2765
786 Ga0207698_10101508 3300026142 Bacteria 2386
787 Ga0207698_10176086 3300026142 Bacteria 1889
788 Ga0207698_10183744 3300026142 Bacteria 1855
789 Ga0207698_10554898 3300026142 Bacteria 1127
790 Ga0209971_1004107 3300027682 Bacteria 3449
791 Ga0209998_10017248 3300027717 Bacteria 1524
792 Ga0209974_10017195 3300027876 Bacteria 2399
793 Ga0207428_10030035 3300027907 Bacteria 4496
794 Ga0207428_10416080 3300027907 Bacteria 983
795 Ga0268266_10014269 3300028379 Bacteria 6834
796 Ga0268266_10029685 3300028379 Bacteria 4646
797 Ga0268266_10040586 3300028379 Bacteria 3967
798 Ga0268266_10092184 3300028379 Bacteria 2658
799 Ga0268266_10181808 3300028379 Bacteria 1915
800 Ga0268266_10490018 3300028379 Bacteria 1172
801 Ga0268265_10025969 3300028380 Bacteria 4164
802 Ga0268265_10299947 3300028380 Bacteria 1446
803 Ga0268265_10405176 3300028380 Bacteria 1262
804 Ga0268264_10018617 3300028381 Bacteria 5678
805 Ga0268264_10029155 3300028381 Bacteria 4519
806 Ga0268264_10075159 3300028381 Bacteria 2872
807 Ga0268264_10152198 3300028381 Bacteria 2075
808 Ga0268264_10221679 3300028381 Bacteria 1741
809 Ga0268264_10359920 3300028381 Bacteria 1387
810 Ga0268264_10489291 3300028381 Bacteria 1198
811 Ga0268264_10722438 3300028381 Bacteria 991
812 Ga0265330_10001736 3300031235 Bacteria 12276
813 Ga0265332_10000223 3300031238 Bacteria 45573
814 Ga0265325_10022624 3300031241 Bacteria 3441
815 Ga0265329_10001192 3300031242 Bacteria 12748
816 Ga0265331_10005474 3300031250 Bacteria 7663
817 Ga0265327_10015013 3300031251 Bacteria 5033
818 Ga0307408_100023527 3300031548 Bacteria 4198
819 Ga0307408_101109526 3300031548 Bacteria 734
820 Ga0265313_10097831 3300031595 Bacteria 1307
821 Ga0265342_10003423 3300031712 Bacteria 13030
822 Ga0307405_10001148 3300031731 Bacteria 10877
823 Ga0307405_10023287 3300031731 Bacteria 3517
824 Ga0307413_10003236 3300031824 Bacteria 6819
825 Ga0307413_10029877 3300031824 Bacteria 3055
826 Ga0307410_10005500 3300031852 Bacteria 6713
827 Ga0307410_10176924 3300031852 Bacteria 1612
828 Ga0307406_10001372 3300031901 Bacteria 13560
829 Ga0307406_10012069 3300031901 Bacteria 4915
830 Ga0307407_10018154 3300031903 Bacteria 3550
831 Ga0307407_10214278 3300031903 Bacteria 1298
832 Ga0307412_10023680 3300031911 Bacteria 3781
833 Ga0307412_10379169 3300031911 Bacteria 1144
834 Ga0307409_100008724 3300031995 Bacteria 6178
835 Ga0307409_101770776 3300031995 Bacteria 647
836 Ga0307416_100004440 3300032002 Bacteria 8455
837 Ga0307414_10014149 3300032004 Bacteria 4771
838 Ga0307414_10180847 3300032004 Bacteria 1696
839 Ga0307411_10003774 3300032005 Bacteria 7115
840 Ga0307411_10010499 3300032005 Bacteria 4940
841 Ga0307415_100001711 3300032126 Bacteria 10659
842 Ga0373934_0050166 3300035086 Bacteria 1653
843 Ga0373923_0007171 3300035111 Bacteria 3906
844 Ga0373923_0144156 3300035111 Bacteria 1078
845 Ga0373932_0100288 3300035112 Bacteria 941
846 Ga0373945_0044582 3300035116 Bacteria 1613
847 Ga0373945_0251145 3300035116 Bacteria 747
848 Ga0373953_0080514 3300035117 Bacteria 1353
849 Ga0373954_0012021 3300035118 Bacteria 3846
850 Ga0373956_0012665 3300035119 Bacteria 3500
851 Ga0373957_0068934 3300035120 Bacteria 1380
852 Ga0373943_0044850 3300035170 Bacteria 2153
853 Ga0373943_0050653 3300035170 Bacteria 2041
854 Ga0373943_0276553 3300035170 Bacteria 948
855 Ga0373955_0000665 3300035172 Bacteria 14648
856 Ga0373931_0121934 3300035691 Bacteria 1491
857 Ga0373935_0107589 3300035692 Bacteria 1846
858 Ga0373927_0014587 3300035695 Bacteria 5198
859 Ga0373933_0031340 3300035724 Bacteria 3084
860 Ga0373933_0115538 3300035724 Bacteria 1677
861 Ga0373933_0333256 3300035724 Bacteria 984
862 Ga0373947_0014054 3300035725 Bacteria 4589
863 Ga0373947_0018908 3300035725 Bacteria 3969
864 Ga0373947_0155557 3300035725 Bacteria 1475
865 Ga0373937_0012233 3300036401 Bacteria 7538
866 Ga0373937_0018647 3300036401 Bacteria 6199
867 Ga0373937_0025552 3300036401 Bacteria 5332
868 Ga0373937_0475824 3300036401 Bacteria 1186
869 Ga0373925_0184675 3300037068 Bacteria 1652
870 Ga0373925_0205230 3300037068 Bacteria 1568
871 Ga0373925_0227280 3300037068 Bacteria 1491
872 Ga0395905_0336122 3300037471 Bacteria 1401
873 Ga0395905_0566657 3300037471 Bacteria 1037
874 Ga0395901_0099213 3300038443 Bacteria 3054
875 Ga0395901_0168319 3300038443 Bacteria 2300
876 Ga0436365_0449299 3300039437 Bacteria 1304
877 Ga0439448_0034723 3300042005 Bacteria 1613
878 Ga0450913_007479 3300042117 Bacteria 822
879 Ga0451577_0301074 3300042876 Bacteria 1453
880 Ga0466957_0845012 3300044842 Bacteria 652
881 Ga0451576_0830186 3300045051 Bacteria 970
882 Ga0466958_0209322 3300045836 Bacteria 1242
883 Ga0466967_0647383 3300045976 Bacteria 1045
884 Ga0466967_1060965 3300045976 Bacteria 807
885 Ga0495603_0080328 3300046455 Bacteria 1911
886 Ga0495651_0150328 3300046462 Bacteria 1679
887 Ga0495580_0139310 3300046472 Bacteria 1682
888 Ga0495580_0197576 3300046472 Bacteria 1386
889 Ga0495582_0132921 3300046473 Bacteria 1406
890 Ga0495639_0003698 3300046475 Bacteria 6585
891 Ga0495594_0193782 3300046499 Bacteria 1158
892 Ga0495628_0070309 3300046516 Bacteria 2729
893 Ga0495665_0059905 3300046531 Bacteria 2009
894 Ga0495586_0387389 3300046535 Bacteria 804
895 Ga0495621_0000486 3300046539 Bacteria 9783
896 Ga0495645_0020175 3300046543 Bacteria 4805
897 Ga0495645_0042208 3300046543 Bacteria 3326
898 Ga0495634_0405408 3300046642 Bacteria 809
899 Ga0495635_0015643 3300046663 Bacteria 5299
900 Ga0495659_0014811 3300046664 Bacteria 2558
901 Ga0495588_0174332 3300046674 Bacteria 1137
902 Ga0495623_0035412 3300046679 Bacteria 3200
903 Ga0495647_0013211 3300046681 Bacteria 2857
904 Ga0495658_0029337 3300046683 Bacteria 2977
905 Ga0495600_0075282 3300046809 Bacteria 2204
906 Ga0495581_0004461 3300047315 Bacteria 8093
907 Ga0495604_0041915 3300047317 Bacteria 3589
908 Ga0495636_0180527 3300047318 Bacteria 958
909 Ga0495674_0033357 3300047319 Bacteria 4665
910 Ga0495680_0047045 3300047322 Bacteria 3397
911 Ga0495684_0007134 3300047471 Bacteria 8668
912 Ga0495614_0006060 3300048089 Bacteria 5434
913 Ga0496100_0111861 3300048903 Bacteria 1898
914 Ga0496102_0169652 3300048905 Bacteria 2054
915 Ga0496102_0374235 3300048905 Bacteria 1340
916 Ga0496102_0484552 3300048905 Bacteria 1158
917 Ga0496102_0913937 3300048905 Bacteria 799
918 Ga0496102_0919980 3300048905 Bacteria 796
919 Ga0496103_0081321 3300048906 Bacteria 2038
920 Ga0496104_0021317 3300048907 Bacteria 5947
921 Ga0496104_0726528 3300048907 Bacteria 900
922 Ga0496105_0043664 3300048908 Bacteria 3697
923 Ga0496106_0000293 3300048909 Bacteria 35117
924 Ga0496106_0033009 3300048909 Bacteria 3860
925 Ga0496106_0269073 3300048909 Bacteria 1364
926 Ga0496107_0016461 3300048910 Bacteria 5194
927 Ga0496107_0018628 3300048910 Bacteria 4891
928 Ga0496107_0026708 3300048910 Bacteria 4095
929 Ga0496108_0002941 3300048911 Bacteria 13704
930 Ga0496108_0119850 3300048911 Bacteria 2256
931 Ga0496108_0213010 3300048911 Bacteria 1677
932 Ga0496109_0017072 3300048912 Bacteria 6351
933 Ga0496109_0381985 3300048912 Bacteria 1330
934 Ga0496109_0576476 3300048912 Bacteria 1061
935 Ga0496110_0003434 3300048913 Bacteria 12126
936 Ga0496110_0819999 3300048913 Bacteria 835
937 Ga0496110_1086656 3300048913 Bacteria 708
938 Ga0496112_0002224 3300048915 Bacteria 15480
939 Ga0496112_0044353 3300048915 Bacteria 4356
940 Ga0496112_0107510 3300048915 Bacteria 2759
941 Ga0496112_0147784 3300048915 Bacteria 2318
942 Ga0496113_0046897 3300048916 Bacteria 3210
943 Ga0496113_0130363 3300048916 Bacteria 1972
944 Ga0496113_0551806 3300048916 Bacteria 924
945 Ga0496114_0006565 3300048917 Bacteria 9174
946 Ga0496115_0076318 3300048918 Bacteria 2724
947 Ga0501040_0163501 3300049576 Bacteria 1574
948 Ga0501041_0148864 3300049577 Bacteria 1461
949 Ga0501047_0202869 3300049581 Bacteria 1843
950 Ga0501048_0624179 3300049582 Bacteria 774
951 Ga0501067_0002730 3300049583 Bacteria 9705
952 Ga0501070_0001748 3300049586 Bacteria 19203
953 Ga0501070_0143825 3300049586 Bacteria 1969
954 Ga0501072_0023076 3300049588 Bacteria 4831
955 Ga0501072_0219820 3300049588 Bacteria 1514
956 Ga0501073_0010025 3300049589 Bacteria 6966
957 Ga0501074_0058577 3300049590 Bacteria 2775
958 Ga0501075_0190093 3300049591 Bacteria 1566
959 Ga0501079_1217717 3300049741 Bacteria 593
960 Ga0501080_0007438 3300049742 Bacteria 9887
961 Ga0501080_0086425 3300049742 Bacteria 2914
962 Ga0501083_0047989 3300049744 Bacteria 2883
963 Ga0501083_0121333 3300049744 Bacteria 1714
964 Ga0501035_0502845 3300049822 Bacteria 997
965 nmdc:mga08y16_147370_c1 3300050511 Bacteria 2447
966 nmdc:mga08y16_550056_c1 3300050511 Bacteria 1168
967 nmdc:mga08y16_78409_c1 3300050511 Bacteria 3444
968 nmdc:mga0n895_55143_c1 3300050512 Bacteria 3911
969 nmdc:mga0n895_94947_c1 3300050512 Bacteria 2986
970 nmdc:mga0rr50_422002_c1 3300050513 Bacteria 1128
971 nmdc:mga0rr50_50831_c1 3300050513 Bacteria 3073
972 nmdc:mga08x19_689674_c1 3300050514 Bacteria 725
973 nmdc:mga0a205_1177256_c1 3300050515 Bacteria 614
974 nmdc:mga0a205_5659_c1 3300050515 Bacteria 11259
975 Ga0495601_0205977 3300053077 Bacteria 1285
976 Ga0495595_0214818 3300053084 Bacteria 959
977 Ga0495595_0414487 3300053084 Unclassified 683
978 Ga0495619_0052750 3300053085 Bacteria 2689
979 Ga0495619_0074367 3300053085 Bacteria 2278
980 Ga0501082_0298050 3300060353 Bacteria 1404
981 Ga0501082_0943423 3300060353 Bacteria 754
982 Ga0495598_0153426
983 MBSR1b_contig_9256567
984 JGI24746J21847_1012872
985 JGI24743J22301_10003795
986 Ga0065715_10029232
987 Ga0070658_10004021
988 Ga0070658_10264575
989 Ga0070658_10316159
990 Ga0070658_10325557
991 Ga0070676_10000020
992 Ga0070676_10018824
993 Ga0070676_10164946
994 Ga0070676_10251750
995 Ga0070676_10524818
996 Ga0070676_10599105
997 Ga0070683_100022189
998 Ga0070683_100067726
999 Ga0070683_100170577
1000 Ga0070683_100262885
1001 Ga0070683_100337012
1002 Ga0070690_100072976
1003 Ga0070690_100160755
1004 Ga0070690_100730195
1005 Ga0070670_100000960
1006 Ga0070670_100014201
1007 Ga0070670_100024353
1008 Ga0070670_100027335
1009 Ga0070670_100051973
1010 Ga0070670_100086272
1011 Ga0070670_100376471
1012 Ga0070670_100444864
1013 Ga0070670_100690321
1014 Ga0070677_10000437
1015 Ga0070677_10003551
1016 Ga0070677_10120286
1017 Ga0070677_10497430
1018 Ga0068869_100007801
1019 Ga0068869_100008412
1020 Ga0068869_100095394
1021 Ga0068869_100135117
1022 Ga0070666_10011189
1023 Ga0070666_10027667
1024 Ga0070666_10073258
1025 Ga0070666_10142695
1026 Ga0070666_10593834
1027 Ga0070680_100111031
1028 Ga0070680_100230744
1029 Ga0070680_100231239
1030 Ga0070680_100362875
1031 Ga0070680_100914800
1032 Ga0070682_100012768
1033 Ga0070682_100497731
1034 Ga0068868_100000764
1035 Ga0068868_100027592
1036 Ga0068868_100038607
1037 Ga0068868_100086612
1038 Ga0068868_100336468
1039 Ga0068868_100444427
1040 Ga0068868_100664489
1041 Ga0070660_100005250
1042 Ga0070660_100008287
1043 Ga0070660_100013677
1044 Ga0070660_100032451
1045 Ga0070660_100043751
1046 Ga0070660_100202132
1047 Ga0070660_100427691
1048 Ga0070689_100006139
1049 Ga0070689_100031515
1050 Ga0070689_100038553
1051 Ga0070689_100201690
1052 Ga0070687_100037422
1053 Ga0070687_100056848
1054 Ga0070661_100006214
1055 Ga0070661_100006440
1056 Ga0070661_100007128
1057 Ga0070661_100009492
1058 Ga0070661_100009665
1059 Ga0070661_100022026
1060 Ga0070661_100112872
1061 Ga0070661_100436604
1062 Ga0070661_101028505
1063 Ga0070692_10079677
1064 Ga0070692_10803118
1065 Ga0070668_100003723
1066 Ga0070668_100017474
1067 Ga0070668_100115344
1068 Ga0070668_100134089
1069 Ga0070668_100468015
1070 Ga0070669_100022652
1071 Ga0070669_100036983
1072 Ga0070669_100090243
1073 Ga0070669_100122754
1074 Ga0070669_101010594
1075 Ga0070675_100018877
1076 Ga0070675_100046039
1077 Ga0070675_100050381
1078 Ga0070675_100451491
1079 Ga0070675_100764427
1080 Ga0070675_100926751
1081 Ga0070671_100011099
1082 Ga0070671_100014746
1083 Ga0070671_100016126
1084 Ga0070671_100019329
1085 Ga0070671_100062682
1086 Ga0070674_100001866
1087 Ga0070674_100032696
1088 Ga0070674_100036557
1089 Ga0070674_100098913
1090 Ga0070674_100188272
1091 Ga0070674_100624167
1092 Ga0070674_100832846
1093 Ga0070673_100004185
1094 Ga0070673_100022716
1095 Ga0070673_100033575
1096 Ga0070673_100110563
1097 Ga0070673_100450222
1098 Ga0070688_100012552
1099 Ga0070688_100024074
1100 Ga0070688_100061863
1101 Ga0070688_100499767
1102 Ga0070659_100002143
1103 Ga0070659_100010039
1104 Ga0070659_100011288
1105 Ga0070659_100119874
1106 Ga0070659_100168357
1107 Ga0070659_100228075
1108 Ga0070659_100253298
1109 Ga0070659_100305306
1110 Ga0070659_100375670
1111 Ga0070659_100573130
1112 Ga0070667_100034410
1113 Ga0070667_100045363
1114 Ga0070667_100112920
1115 Ga0070667_100123642
1116 Ga0070667_100217171
1117 Ga0070667_101705024
1118 Ga0070709_10341171
1119 Ga0070709_10442654
1120 Ga0070709_10602732
1121 Ga0070714_100016452
1122 Ga0070714_100032898
1123 Ga0070714_100033161
1124 Ga0070714_100742229
1125 Ga0070713_100000024
1126 Ga0070713_100075391
1127 Ga0070713_100982118
1128 Ga0070710_10003207
1129 Ga0070710_10053643
1130 Ga0070710_10384301
1131 Ga0070710_10532569
1132 Ga0070701_10237045
1133 Ga0070711_100008717
1134 Ga0070711_100022151
1135 Ga0070711_100070726
1136 Ga0070711_100114877
1137 Ga0070705_100338942
1138 Ga0070705_100444822
1139 Ga0070700_100026820
1140 Ga0070694_100127744
1141 Ga0070708_100018850
1142 Ga0070708_100145836
1143 Ga0070663_100008642
1144 Ga0070663_100020093
1145 Ga0070663_100038948
1146 Ga0070663_100150371
1147 Ga0070663_100250821
1148 Ga0070678_100000272
1149 Ga0070678_100006947
1150 Ga0070678_100011722
1151 Ga0070678_100191118
1152 Ga0070678_100320366
1153 Ga0070662_100012689
1154 Ga0070662_100022693
1155 Ga0070662_100023330
1156 Ga0070662_100105079
1157 Ga0070662_100294731
1158 Ga0070662_100387220
1159 Ga0070662_100535912
1160 Ga0070681_10000922
1161 Ga0070681_10010032
1162 Ga0070681_10060354
1163 Ga0070681_10501693
1164 Ga0068867_100004207
1165 Ga0068867_100046173
1166 Ga0068867_100048664
1167 Ga0068867_100049996
1168 Ga0068867_100101715
1169 Ga0070685_10001200
1170 Ga0070685_10030183
1171 Ga0070685_10071372
1172 Ga0070685_10565008
1173 Ga0070685_10792901
1174 Ga0070706_100034770
1175 Ga0070706_100198602
1176 Ga0070707_100048251
1177 Ga0070707_100477306
1178 Ga0070698_100031329
1179 Ga0070698_100178280
1180 Ga0070698_100929835
1181 Ga0070699_100007430
1182 Ga0070699_100015828
1183 Ga0070699_100148768
1184 Ga0070679_100007596
1185 Ga0070679_100024041
1186 Ga0070679_100061018
1187 Ga0070679_100067752
1188 Ga0070679_100098045
1189 Ga0070679_100182536
1190 Ga0070679_100331304
1191 Ga0070684_100010592
1192 Ga0070684_100013894
1193 Ga0070684_100039767
1194 Ga0070684_100577808
1195 Ga0070684_100709909
1196 Ga0070697_100026250
1197 Ga0068853_100007110
1198 Ga0068853_100017646
1199 Ga0068853_100029872
1200 Ga0068853_100039155
1201 Ga0068853_100053048
1202 Ga0068853_100646145
1203 Ga0070672_100005647
1204 Ga0070672_100022474
1205 Ga0070672_100138791
1206 Ga0070672_100236404
1207 Ga0070672_100274336
1208 Ga0070672_100551440
1209 Ga0070672_100774880
1210 Ga0070686_100022952
1211 Ga0070686_100952706
1212 Ga0070695_100115702
1213 Ga0070696_100008160
1214 Ga0070696_100020946
1215 Ga0070693_100075220
1216 Ga0070693_100250163
1217 Ga0070693_100400975
1218 Ga0070693_100507920
1219 Ga0070665_100007107
1220 Ga0070665_100045327
1221 Ga0070665_100074845
1222 Ga0070665_100095116
1223 Ga0070665_100113331
1224 Ga0070665_100268086
1225 Ga0070665_100615754
1226 Ga0070665_100876333
1227 Ga0070704_100004085
1228 Ga0070704_100370211
1229 Ga0068855_100001999
1230 Ga0068855_100036102
1231 Ga0068855_100059105
1232 Ga0068855_100088418
1233 Ga0068855_100183620
1234 Ga0068855_100211064
1235 Ga0068855_100334640
1236 Ga0068855_100525871
1237 Ga0068855_100535971
1238 Ga0070664_100001544
1239 Ga0070664_100024902
1240 Ga0070664_100025147
1241 Ga0070664_100046295
1242 Ga0070664_100059603
1243 Ga0070664_100085106
1244 Ga0070664_100100910
1245 Ga0070664_100153730
1246 Ga0070664_100675670
1247 Ga0068857_100000104
1248 Ga0068857_100194793
1249 Ga0068857_100214156
1250 Ga0068857_100874541
1251 Ga0068854_100002772
1252 Ga0068854_100020888
1253 Ga0068854_100053555
1254 Ga0068854_100061865
1255 Ga0068856_100000898
1256 Ga0068856_100010329
1257 Ga0068856_100010416
1258 Ga0068856_100018162
1259 Ga0068856_100088154
1260 Ga0070702_100011026
1261 Ga0070702_100016298
1262 Ga0068852_100006785
1263 Ga0068852_100007702
1264 Ga0068852_100041036
1265 Ga0068852_100103657
1266 Ga0068852_100200850
1267 Ga0068852_100386673
1268 Ga0068852_100699584
1269 Ga0068852_100764485
1270 Ga0068852_100775937
1271 Ga0068852_101159019
1272 Ga0068859_100005180
1273 Ga0068859_100057838
1274 Ga0068859_100095464
1275 Ga0068859_100219531
1276 Ga0068859_100412444
1277 Ga0068859_100573750
1278 Ga0068864_100001981
1279 Ga0068864_100005823
1280 Ga0068864_100006757
1281 Ga0068864_100013225
1282 Ga0068864_100051127
1283 Ga0068864_100353511
1284 Ga0068864_100443230
1285 Ga0068864_101214670
1286 Ga0068866_10002289
1287 Ga0068866_10016061
1288 Ga0068866_10639358
1289 Ga0068861_100008488
1290 Ga0068861_100125061
1291 Ga0068851_10002361
1292 Ga0068851_10007854
1293 Ga0068851_10086369
1294 Ga0068851_10094243
1295 Ga0068851_10165387
1296 Ga0068870_10005113
1297 Ga0068870_10005309
1298 Ga0068870_10186904
1299 Ga0068863_100000850
1300 Ga0068863_100007736
1301 Ga0068863_100008082
1302 Ga0068863_100173505
1303 Ga0068863_100200757
1304 Ga0068863_100759290
1305 Ga0068858_100006127
1306 Ga0068858_100031645
1307 Ga0068858_100085902
1308 Ga0068858_100115664
1309 Ga0068858_101033066
1310 Ga0068860_100020893
1311 Ga0068860_100028239
1312 Ga0068860_100045451
1313 Ga0068860_100093793
1314 Ga0068860_100094989
1315 Ga0068860_100109237
1316 Ga0068860_100213164
1317 Ga0068862_100128251
1318 Ga0068862_100371726
1319 Ga0081539_10054416
1320 Ga0070715_10033019
1321 Ga0070716_100013745
1322 Ga0070716_100054747
1323 Ga0070712_100054528
1324 Ga0070712_100088906
1325 Ga0070712_100119076
1326 Ga0070712_100330397
1327 Ga0097621_100046112
1328 Ga0097621_100088236
1329 Ga0097621_100164168
1330 Ga0097621_100197086
1331 Ga0097621_100228635
1332 Ga0068871_100007989
1333 Ga0068871_100032440
1334 Ga0068871_100035447
1335 Ga0068871_100122386
1336 Ga0068871_100129452
1337 Ga0068871_100212433
1338 Ga0068871_100227497
1339 Ga0068871_100952180
1340 Ga0075428_100113133
1341 Ga0075433_10038083
1342 Ga0075434_100000977
1343 Ga0075434_100407414
1344 Ga0075434_100519852
1345 Ga0068865_100043173
1346 Ga0068865_100058648
1347 Ga0068865_100128040
1348 Ga0075436_100188648
1349 Ga0097620_100005180
1350 Ga0097620_100057837
1351 Ga0097620_100095464
1352 Ga0097620_100219532
1353 Ga0097620_100412467
1354 Ga0097620_100573665
1355 Ga0075435_100027991
1356 Ga0075435_100159055
1357 Ga0105240_10001001
1358 Ga0105240_10014078
1359 Ga0105240_10017602
1360 Ga0105240_10217802
1361 Ga0105240_10328561
1362 Ga0111539_10005490
1363 Ga0111539_10051415
1364 Ga0105245_10021378
1365 Ga0105245_10024734
1366 Ga0105245_10828547
1367 Ga0105247_10061358
1368 Ga0105247_10475594
1369 Ga0114129_10815407
1370 Ga0105243_10068749
1371 Ga0105243_11150723
1372 Ga0105243_11771578
1373 Ga0105241_10022568
1374 Ga0105241_10027616
1375 Ga0105241_10057199
1376 Ga0105241_10471882
1377 Ga0105242_10013155
1378 Ga0105242_10055201
1379 Ga0105248_10003363
1380 Ga0105248_10144839
1381 Ga0105248_10328347
1382 Ga0105248_10341437
1383 Ga0105248_10395256
1384 Ga0105248_12117644
1385 Ga0105237_10091716
1386 Ga0105237_10195828
1387 Ga0105237_10693734
1388 Ga0105238_10002775
1389 Ga0105238_10028506
1390 Ga0105238_10441721
1391 Ga0105238_11271621
1392 Ga0105249_10019007
1393 Ga0105249_10624603
1394 Ga0105249_10730622
1395 Ga0105249_12040922
1396 Ga0105239_10053332
1397 Ga0105246_10019169
1398 Ga0105246_10247587
1399 Ga0105246_10652577
1400 Ga0157373_10000688
1401 Ga0157373_10029614
1402 Ga0157373_10074481
1403 Ga0157373_10427254
1404 Ga0157373_10808542
1405 Ga0157373_10891024
1406 Ga0157371_10001512
1407 Ga0157371_10027736
1408 Ga0157371_10098885
1409 Ga0157371_10153731
1410 Ga0157371_10171278
1411 Ga0157371_10318050
1412 Ga0157370_10004286
1413 Ga0157370_10004851
1414 Ga0157370_10009629
1415 Ga0157370_10025810
1416 Ga0157370_10033438
1417 Ga0157370_10114161
1418 Ga0157370_10276092
1419 Ga0157369_10021014
1420 Ga0157369_10024142
1421 Ga0157369_10027094
1422 Ga0157369_10213246
1423 Ga0157369_10264294
1424 Ga0157369_10644900
1425 Ga0157374_10002129
1426 Ga0157374_10020226
1427 Ga0157374_10026271
1428 Ga0157374_10120183
1429 Ga0157374_10162013
1430 Ga0157374_10202608
1431 Ga0157374_11318628
1432 Ga0157374_11841339
1433 Ga0157378_10071518
1434 Ga0157378_10115818
1435 Ga0157378_10211038
1436 Ga0157378_10213934
1437 Ga0157378_10413156
1438 Ga0157378_10418113
1439 Ga0157378_11284460
1440 Ga0163162_10025730
1441 Ga0163162_10067418
1442 Ga0163162_10088214
1443 Ga0163162_10422542
1444 Ga0157372_10000342
1445 Ga0157372_10009556
1446 Ga0157372_10041123
1447 Ga0157372_10044717
1448 Ga0157372_10060305
1449 Ga0157372_10397644
1450 Ga0157372_10768417
1451 Ga0157372_10774949
1452 Ga0157372_10850509
1453 Ga0157372_11230806
1454 Ga0157372_11837225
1455 Ga0157375_10010892
1456 Ga0157375_10014178
1457 Ga0157375_10028993
1458 Ga0157375_10070340
1459 Ga0157375_10173356
1460 Ga0157375_10174496
1461 Ga0163163_10004514
1462 Ga0163163_10022784
1463 Ga0163163_10133788
1464 Ga0163163_10243277
1465 Ga0157380_10652247
1466 Ga0157380_10898438
1467 Ga0157380_11210411
1468 Ga0182008_10065092
1469 Ga0157377_10007363
1470 Ga0157377_10097925
1471 Ga0157377_10638851
1472 Ga0157379_10009117
1473 Ga0157379_10016746
1474 Ga0157379_10062164
1475 Ga0157379_10065683
1476 Ga0157379_10412943
1477 Ga0157379_10683356
1478 Ga0157379_10740469
1479 Ga0157376_10019365
1480 Ga0157376_10020207
1481 Ga0157376_10113198
1482 Ga0157376_10152499
1483 Ga0157376_10261668
1484 Ga0157376_10639184
1485 Ga0157376_11078151
1486 Ga0163161_10083771
1487 Ga0163161_10312547
1488 Ga0163161_10352863
1489 Ga0206354_11504917
1490 Ga0206353_10760568
1491 Ga0207673_1003468
1492 Ga0207697_10001057
1493 Ga0207697_10015388
1494 Ga0207697_10226300
1495 Ga0207656_10012585
1496 Ga0207656_10044077
1497 Ga0207656_10095551
1498 Ga0207656_10237208
1499 Ga0207682_10000068
1500 Ga0207682_10000862
1501 Ga0207682_10242411
1502 Ga0207692_10013832
1503 Ga0207692_10227636
1504 Ga0207642_10001698
1505 Ga0207642_10036724
1506 Ga0207642_10371785
1507 Ga0207710_10107497
1508 Ga0207688_10118562
1509 Ga0207688_10134496
1510 Ga0207680_10002787
1511 Ga0207680_10023408
1512 Ga0207680_10050483
1513 Ga0207685_10016828
1514 Ga0207699_10008060
1515 Ga0207699_10305830
1516 Ga0207699_10476060
1517 Ga0207699_10523835
1518 Ga0207645_10000499
1519 Ga0207645_10003019
1520 Ga0207645_10011998
1521 Ga0207645_10161849
1522 Ga0207645_10265030
1523 Ga0207643_10000298
1524 Ga0207643_10007851
1525 Ga0207643_10068058
1526 Ga0207705_10087848
1527 Ga0207684_10017844
1528 Ga0207684_10107975
1529 Ga0207684_10515702
1530 Ga0207654_10048234
1531 Ga0207654_10115176
1532 Ga0207654_10611024
1533 Ga0207707_10016103
1534 Ga0207707_10062308
1535 Ga0207707_10074169
1536 Ga0207707_10159068
1537 Ga0207707_10183641
1538 Ga0207707_10201398
1539 Ga0207707_10439690
1540 Ga0207695_10019257
1541 Ga0207695_10103714
1542 Ga0207695_10173143
1543 Ga0207671_10396976
1544 Ga0207671_10684001
1545 Ga0207693_10000688
1546 Ga0207693_10026232
1547 Ga0207693_10128013
1548 Ga0207663_10014545
1549 Ga0207663_10016108
1550 Ga0207663_10243442
1551 Ga0207660_10010989
1552 Ga0207660_10080298
1553 Ga0207660_10349097
1554 Ga0207660_10730734
1555 Ga0207662_10009794
1556 Ga0207662_10053247
1557 Ga0207657_10001035
1558 Ga0207657_10003755
1559 Ga0207657_10004727
1560 Ga0207657_10005705
1561 Ga0207657_10006460
1562 Ga0207657_10017794
1563 Ga0207657_10047964
1564 Ga0207649_10005227
1565 Ga0207649_10017283
1566 Ga0207649_10077211
1567 Ga0207649_10105478
1568 Ga0207649_10269335
1569 Ga0207649_10293419
1570 Ga0207652_10018438
1571 Ga0207652_10035989
1572 Ga0207652_10048304
1573 Ga0207652_10164989
1574 Ga0207646_10075084
1575 Ga0207646_10108871
1576 Ga0207681_10037122
1577 Ga0207681_10058511
1578 Ga0207681_10074356
1579 Ga0207681_10125142
1580 Ga0207681_10235393
1581 Ga0207694_10142305
1582 Ga0207650_10003014
1583 Ga0207650_10011723
1584 Ga0207650_10011789
1585 Ga0207650_10023387
1586 Ga0207650_10036419
1587 Ga0207650_10043490
1588 Ga0207650_10076898
1589 Ga0207650_10413015
1590 Ga0207659_10013625
1591 Ga0207659_10016878
1592 Ga0207659_10026956
1593 Ga0207659_10627471
1594 Ga0207659_10862424
1595 Ga0207687_10003274
1596 Ga0207687_10033821
1597 Ga0207687_10119451
1598 Ga0207700_10000108
1599 Ga0207700_10091642
1600 Ga0207700_10206168
1601 Ga0207700_11395422
1602 Ga0207664_10000327
1603 Ga0207664_10041339
1604 Ga0207664_10062403
1605 Ga0207664_10406116
1606 Ga0207644_10003706
1607 Ga0207644_10023601
1608 Ga0207644_10036595
1609 Ga0207644_10044217
1610 Ga0207644_10054651
1611 Ga0207644_10062983
1612 Ga0207690_10098408
1613 Ga0207690_10128413
1614 Ga0207690_10141344
1615 Ga0207690_10147027
1616 Ga0207690_10172051
1617 Ga0207690_10195314
1618 Ga0207690_10199750
1619 Ga0207690_10325423
1620 Ga0207690_10383307
1621 Ga0207690_10679449
1622 Ga0207706_10006265
1623 Ga0207706_10020379
1624 Ga0207706_10020670
1625 Ga0207706_10066934
1626 Ga0207686_10000485
1627 Ga0207709_10797781
1628 Ga0207709_10890364
1629 Ga0207670_10016092
1630 Ga0207670_10125806
1631 Ga0207670_10282359
1632 Ga0207669_10066907
1633 Ga0207669_10206239
1634 Ga0207669_10538093
1635 Ga0207669_10542868
1636 Ga0207669_10775422
1637 Ga0207704_10010592
1638 Ga0207704_10031155
1639 Ga0207704_10592833
1640 Ga0207665_10015162
1641 Ga0207665_10065575
1642 Ga0207691_10000152
1643 Ga0207691_10010112
1644 Ga0207691_10089904
1645 Ga0207691_10112605
1646 Ga0207691_10188765
1647 Ga0207691_10210801
1648 Ga0207691_10345524
1649 Ga0207691_10552688
1650 Ga0207711_10000260
1651 Ga0207711_10013156
1652 Ga0207711_10227719
1653 Ga0207711_10332150
1654 Ga0207689_10000361
1655 Ga0207689_10008422
1656 Ga0207689_10011684
1657 Ga0207689_10094464
1658 Ga0207689_10488866
1659 Ga0207661_10025735
1660 Ga0207661_10061662
1661 Ga0207661_10252736
1662 Ga0207661_10282373
1663 Ga0207679_10000674
1664 Ga0207679_10026428
1665 Ga0207679_10062209
1666 Ga0207679_10077482
1667 Ga0207679_10200484
1668 Ga0207679_10397468
1669 Ga0207679_10492098
1670 Ga0207679_10962119
1671 Ga0207667_10004922
1672 Ga0207667_10024927
1673 Ga0207667_10026827
1674 Ga0207667_10035525
1675 Ga0207667_10112633
1676 Ga0207667_10142540
1677 Ga0207667_10167039
1678 Ga0207667_10171989
1679 Ga0207667_10281475
1680 Ga0207667_10751870
1681 Ga0207667_10778565
1682 Ga0207651_10044039
1683 Ga0207651_10086989
1684 Ga0207651_10297113
1685 Ga0207651_10367927
1686 Ga0207712_10029999
1687 Ga0207712_10450363
1688 Ga0207668_10001312
1689 Ga0207668_10011701
1690 Ga0207668_10067979
1691 Ga0207668_10162250
1692 Ga0207668_10409339
1693 Ga0207640_10012419
1694 Ga0207640_10044591
1695 Ga0207640_10057258
1696 Ga0207640_10125859
1697 Ga0207640_10129329
1698 Ga0207658_10002215
1699 Ga0207658_10080828
1700 Ga0207658_10174607
1701 Ga0207658_10328799
1702 Ga0207658_10508050
1703 Ga0207677_10000160
1704 Ga0207677_10010043
1705 Ga0207677_10036705
1706 Ga0207677_10094070
1707 Ga0207703_10010791
1708 Ga0207703_10069267
1709 Ga0207639_10007013
1710 Ga0207639_10012440
1711 Ga0207639_10032898
1712 Ga0207639_10177667
1713 Ga0207639_10312337
1714 Ga0207639_10468310
1715 Ga0207639_10569996
1716 Ga0207639_10680611
1717 Ga0207678_10007730
1718 Ga0207678_10008302
1719 Ga0207678_10010416
1720 Ga0207678_10015890
1721 Ga0207678_10028046
1722 Ga0207678_10144302
1723 Ga0207708_10063133
1724 Ga0207702_10006633
1725 Ga0207702_10016800
1726 Ga0207702_10028735
1727 Ga0207702_10051666
1728 Ga0207702_10139643
1729 Ga0207641_10006193
1730 Ga0207641_10008699
1731 Ga0207641_10059380
1732 Ga0207641_10153304
1733 Ga0207641_10162988
1734 Ga0207641_10693659
1735 Ga0207648_10007837
1736 Ga0207648_10021514
1737 Ga0207648_10048128
1738 Ga0207648_10052134
1739 Ga0207648_10816947
1740 Ga0207676_10001563
1741 Ga0207676_10003026
1742 Ga0207676_10016942
1743 Ga0207676_10039512
1744 Ga0207676_10130994
1745 Ga0207676_10565251
1746 Ga0207676_10895458
1747 Ga0207674_10000954
1748 Ga0207674_10001783
1749 Ga0207674_10022206
1750 Ga0207674_10085389
1751 Ga0207674_10131730
1752 Ga0207674_10244912
1753 Ga0207674_10729390
1754 Ga0207675_100041844
1755 Ga0207675_100049349
1756 Ga0207675_100053956
1757 Ga0207675_100067285
1758 Ga0207683_10000307
1759 Ga0207683_10005487
1760 Ga0207683_10005668
1761 Ga0207683_10020819
1762 Ga0207683_10185176
1763 Ga0207698_10002898
1764 Ga0207698_10038284
1765 Ga0207698_10043478
1766 Ga0207698_10070777
1767 Ga0207698_10101508
1768 Ga0207698_10176086
1769 Ga0207698_10183744
1770 Ga0207698_10554898
1771 Ga0209971_1004107
1772 Ga0209998_10017248
1773 Ga0209974_10017195
1774 Ga0207428_10030035
1775 Ga0207428_10416080
1776 Ga0268266_10014269
1777 Ga0268266_10029685
1778 Ga0268266_10040586
1779 Ga0268266_10092184
1780 Ga0268266_10181808
1781 Ga0268266_10490018
1782 Ga0268265_10025969
1783 Ga0268265_10299947
1784 Ga0268265_10405176
1785 Ga0268264_10018617
1786 Ga0268264_10029155
1787 Ga0268264_10075159
1788 Ga0268264_10152198
1789 Ga0268264_10221679
1790 Ga0268264_10359920
1791 Ga0268264_10489291
1792 Ga0268264_10722438
1793 Ga0265330_10001736
1794 Ga0265332_10000223
1795 Ga0265325_10022624
1796 Ga0265329_10001192
1797 Ga0265331_10005474
1798 Ga0265327_10015013
1799 Ga0307408_100023527
1800 Ga0307408_101109526
1801 Ga0265313_10097831
1802 Ga0265342_10003423
1803 Ga0307405_10001148
1804 Ga0307405_10023287
1805 Ga0307413_10003236
1806 Ga0307413_10029877
1807 Ga0307410_10005500
1808 Ga0307410_10176924
1809 Ga0307406_10001372
1810 Ga0307406_10012069
1811 Ga0307407_10018154
1812 Ga0307407_10214278
1813 Ga0307412_10023680
1814 Ga0307412_10379169
1815 Ga0307409_100008724
1816 Ga0307409_101770776
1817 Ga0307416_100004440
1818 Ga0307414_10014149
1819 Ga0307414_10180847
1820 Ga0307411_10003774
1821 Ga0307411_10010499
1822 Ga0307415_100001711
1823 Ga0373934_0050166
1824 Ga0373923_0007171
1825 Ga0373923_0144156
1826 Ga0373932_0100288
1827 Ga0373945_0044582
1828 Ga0373945_0251145
1829 Ga0373953_0080514
1830 Ga0373954_0012021
1831 Ga0373956_0012665
1832 Ga0373957_0068934
1833 Ga0373943_0044850
1834 Ga0373943_0050653
1835 Ga0373943_0276553
1836 Ga0373955_0000665
1837 Ga0373931_0121934
1838 Ga0373935_0107589
1839 Ga0373927_0014587
1840 Ga0373933_0031340
1841 Ga0373933_0115538
1842 Ga0373933_0333256
1843 Ga0373947_0014054
1844 Ga0373947_0018908
1845 Ga0373947_0155557
1846 Ga0373937_0012233
1847 Ga0373937_0018647
1848 Ga0373937_0025552
1849 Ga0373937_0475824
1850 Ga0373925_0184675
1851 Ga0373925_0205230
1852 Ga0373925_0227280
1853 Ga0395905_0336122
1854 Ga0395905_0566657
1855 Ga0395901_0099213
1856 Ga0395901_0168319
1857 Ga0436365_0449299
1858 Ga0439448_0034723
1859 Ga0450913_007479
1860 Ga0451577_0301074
1861 Ga0466957_0845012
1862 Ga0451576_0830186
1863 Ga0466958_0209322
1864 Ga0466967_0647383
1865 Ga0466967_1060965
1866 Ga0495603_0080328
1867 Ga0495651_0150328
1868 Ga0495580_0139310
1869 Ga0495580_0197576
1870 Ga0495582_0132921
1871 Ga0495639_0003698
1872 Ga0495594_0193782
1873 Ga0495628_0070309
1874 Ga0495665_0059905
1875 Ga0495586_0387389
1876 Ga0495621_0000486
1877 Ga0495645_0020175
1878 Ga0495645_0042208
1879 Ga0495634_0405408
1880 Ga0495635_0015643
1881 Ga0495659_0014811
1882 Ga0495588_0174332
1883 Ga0495623_0035412
1884 Ga0495647_0013211
1885 Ga0495658_0029337
1886 Ga0495600_0075282
1887 Ga0495581_0004461
1888 Ga0495604_0041915
1889 Ga0495636_0180527
1890 Ga0495674_0033357
1891 Ga0495680_0047045
1892 Ga0495684_0007134
1893 Ga0495614_0006060
1894 Ga0496100_0111861
1895 Ga0496102_0169652
1896 Ga0496102_0374235
1897 Ga0496102_0484552
1898 Ga0496102_0913937
1899 Ga0496102_0919980
1900 Ga0496103_0081321
1901 Ga0496104_0021317
1902 Ga0496104_0726528
1903 Ga0496105_0043664
1904 Ga0496106_0000293
1905 Ga0496106_0033009
1906 Ga0496106_0269073
1907 Ga0496107_0016461
1908 Ga0496107_0018628
1909 Ga0496107_0026708
1910 Ga0496108_0002941
1911 Ga0496108_0119850
1912 Ga0496108_0213010
1913 Ga0496109_0017072
1914 Ga0496109_0381985
1915 Ga0496109_0576476
1916 Ga0496110_0003434
1917 Ga0496110_0819999
1918 Ga0496110_1086656
1919 Ga0496112_0002224
1920 Ga0496112_0044353
1921 Ga0496112_0107510
1922 Ga0496112_0147784
1923 Ga0496113_0046897
1924 Ga0496113_0130363
1925 Ga0496113_0551806
1926 Ga0496114_0006565
1927 Ga0496115_0076318
1928 Ga0501040_0163501
1929 Ga0501041_0148864
1930 Ga0501047_0202869
1931 Ga0501048_0624179
1932 Ga0501067_0002730
1933 Ga0501070_0001748
1934 Ga0501070_0143825
1935 Ga0501072_0023076
1936 Ga0501072_0219820
1937 Ga0501073_0010025
1938 Ga0501074_0058577
1939 Ga0501075_0190093
1940 Ga0501079_1217717
1941 Ga0501080_0007438
1942 Ga0501080_0086425
1943 Ga0501083_0047989
1944 Ga0501083_0121333
1945 Ga0501035_0502845
1946 nmdc:mga08y16_147370_c1
1947 nmdc:mga08y16_550056_c1
1948 nmdc:mga08y16_78409_c1
1949 nmdc:mga0n895_55143_c1
1950 nmdc:mga0n895_94947_c1
1951 nmdc:mga0rr50_422002_c1
1952 nmdc:mga0rr50_50831_c1
1953 nmdc:mga08x19_689674_c1
1954 nmdc:mga0a205_1177256_c1
1955 nmdc:mga0a205_5659_c1
1956 Ga0495601_0205977
1957 Ga0495595_0214818
1958 Ga0495595_0414487
1959 Ga0495619_0052750
1960 Ga0495619_0074367
1961 Ga0501082_0298050
1962 Ga0501082_0943423

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

41

183

0.89

PF14681

UPRTase

Uracil phosphoribosyltransferase

43

166

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p3k-assembly1.cif.gz_A structure of ancestral pyrr protein (plumpyrr) 0.8344 9 168
4p83-assembly1.cif.gz_D structure of engineered pyrr protein (purple pyrr) 0.8272 7 168
4p81-assembly1.cif.gz_B structure of ancestral pyrr protein (ancorangepyrr) 0.8271 7 168
5bqo-assembly2.cif.gz_C hypoxanthine-guanine-xanthine phosphoribosyltransferase (hgxprt) from sulfolobus solfataricus with sulfate bound in the 5-phosphoribosyl binding site. 0.8262 10 144
1non-assembly1.cif.gz_A pyrr, the regulator of the pyrimidine biosynthetic operon in bacillus caldolyticus 0.8252 7 168
ID Description Score Start End Superfamily
af_Q09811_922_1035_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8621 148 170 1.10.10.10
af_Q54DM3_929_1039_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8361 148 169 1.10.10.10
4p83D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8272 7 168 3.40.50.2020
2v79A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8112 148 167 1.10.10.10
af_P9WHK3_1_193_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8021 9 164 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A259DAR2-F1-model_v4 Phosphoribosyltransferase domain-containing protein 0.9416 79 169
AF-A0A2I6S3Z7-F1-model_v4 Bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR 0.9375 6 168 GO:0016757
AF-A0A4Y6KWS3-F1-model_v4 Bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase 0.9322 7 168 GO:0016757
AF-A0A7X7LWV5-F1-model_v4 Bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR (EC 2.4.2.9) 0.9263 6 168 GO:0004845
AF-N6Y5F5-F1-model_v4 Bifunctional pyrimidine regulatory protein PyrR uracil phosphoribosyltransferase (EC 2.4.2.9) 0.9245 6 169 GO:0004845

Map