F487405

General Info

Members Datasets Scaffolds Average Seq Length
981 532 1962 170

Family's Representative Sequence

Representative Sequence 3300048916|Ga0496113_0076077|Ga0496113_0076077_1376_2041
Length 202
Sequence VTKGTQWADASRVRVGHHNERRHSIRNTTSEGSVAMQFGRSYEEFEVGAVYRHWPGKTITEADDHLFCLITMNHHPLHLDANYAEQTTQFGRNVVVGNLVYSVLLGQSVPDISGKAIANLEIESLRHVAPTFHGDTIYGETTVLDKWESKSKDDRGVVYVETKGYKQDGTVVCLFRRKVMVPKQNYLDARGGEQPGRPTPTS

Samples

Sample ID Description Type Environment
1 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
81 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
85 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
86 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
87 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
88 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
89 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
90 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
104 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300025227 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in- M7 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
163 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
164 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
165 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
166 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
167 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
168 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300031043 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
175 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
176 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
179 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
180 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
181 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
182 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
183 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
184 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
185 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
186 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
187 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
188 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
196 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
197 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
198 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
199 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
204 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
205 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
206 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
207 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
211 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
212 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
214 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
215 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
217 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
218 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
219 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
220 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
221 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
222 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
223 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
224 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
225 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
226 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
227 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
228 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
229 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
230 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
231 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
232 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
233 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
234 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
235 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
236 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
237 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
238 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
239 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
240 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
241 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
242 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
243 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
244 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
245 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
246 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
247 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
248 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
249 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
250 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
251 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
252 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
253 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
254 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
255 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
256 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
257 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
258 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
259 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
260 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
261 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
262 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
263 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
264 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
265 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
266 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
267 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
268 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
269 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
270 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
271 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
272 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
273 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
274 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
275 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
276 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
277 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
278 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
279 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
280 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
281 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
282 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
283 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
284 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
285 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
286 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
287 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
288 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
289 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
290 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
291 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
292 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
293 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
294 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
295 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
296 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
297 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
298 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
299 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
300 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
301 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
302 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
303 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
304 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
305 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
306 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
307 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
308 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
309 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
310 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
311 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
313 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
314 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
315 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
316 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
317 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
318 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
319 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
320 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
321 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
322 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
323 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
324 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
325 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
326 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
327 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
343 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
344 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
345 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
346 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
347 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
348 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
349 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
350 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
351 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
352 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
353 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
354 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
355 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
356 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
357 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
358 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
359 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
360 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
361 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
364 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
365 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
366 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
367 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
368 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
369 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
370 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
371 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
372 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
373 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
374 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
375 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
376 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
377 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
378 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
379 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
380 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
381 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
382 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
383 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
384 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
385 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
386 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
387 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
388 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
389 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
390 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
391 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
392 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
393 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
394 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
395 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
396 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
397 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
398 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
399 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
400 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
401 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
402 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
403 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
404 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
406 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
407 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
408 2508501039 Frankia saprophytica CN3 Isolate Nodule
409 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
410 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
411 2517572101 Frankia sp. DC12 Isolate Nodule
412 2527291627 Frankia casuarinae Thr Isolate Nodule
413 2527291629 Frankia sp. BMG5.23 Isolate Nodule
414 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
415 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
416 2576861822 Frankia sp. CeD Isolate Nodule
417 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
418 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
419 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
420 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
421 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
422 2643221548 Streptomyces sp. Root55 Isolate Unclassified
423 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
424 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
425 2643221647 Streptomyces sp. Root369 Isolate Unclassified
426 2643221670 Streptomyces sp. Root431 Isolate Unclassified
427 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
428 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
429 2643221679 Angustibacter sp. Root456 Isolate Unclassified
430 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
431 2643221714 Streptomyces sp. Root264 Isolate Unclassified
432 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
433 2684623036 Frankia sp. CgIM4 Isolate Nodule
434 2687453737 Frankia sp. BMG5.36 Isolate Nodule
435 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
436 2710264753 Frankia sp. KB5 Isolate Nodule
437 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
438 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
439 2773857924 Frankia sp. CgIS1 Isolate Nodule
440 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
441 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
442 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
443 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
444 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
445 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
446 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
447 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
448 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
449 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
450 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
451 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
452 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
453 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
454 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
455 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
456 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
457 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
458 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
459 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
460 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
461 2858882152 Micromonospora noduli MED15 Isolate Nodule
462 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
463 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
464 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
465 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
466 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
467 2862574272 Streptomyces sp. AcE210 Isolate Nodule
468 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
469 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
470 2867369537 Streptomyces sp. Z26 Isolate Unclassified
471 2867428634 Streptomyces sp. RP5T Isolate Unclassified
472 2867475112 Streptomyces sp. TM32 Isolate Unclassified
473 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
474 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
475 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
476 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
477 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
478 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
479 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
480 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
481 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
482 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
483 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
484 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
485 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
486 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
487 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
488 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
489 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
490 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
491 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
492 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
493 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
494 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
495 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
496 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
497 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
498 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
499 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
500 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
501 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
502 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
503 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
504 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
505 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
506 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
507 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
508 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
509 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
510 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
511 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
512 637000116 Frankia casuarinae CcI3 Isolate Nodule
513 8002775197 Frankia nepalensis CN7 Isolate Nodule
514 8002784119 Frankia sp. AgB1.9 Isolate Nodule
515 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
516 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
517 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
518 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
519 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
520 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
521 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
522 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
523 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
524 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
525 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
526 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
527 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
528 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
529 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
530 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
531 8054920844 Frankia tisae Agncl-8 Isolate Nodule
532 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.52
Metatranscriptomes 1.73
Isolates 12.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.81
Nodule 2.55
Rhizoplane 6.63
Rhizosphere 76.86
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496113_0076077 3300048916 Bacteria 2563
2 LJQas_1003442 3300000549 Bacteria 2117
3 JGI24740J21852_10010152 3300001979 Bacteria 3641
4 JGI24739J22299_10008021 3300001989 Bacteria 3948
5 JGI24737J22298_10003773 3300001990 Bacteria 5333
6 JGI24737J22298_10010845 3300001990 Bacteria 2997
7 JGI24737J22298_10128881 3300001990 Bacteria 747
8 JGI24743J22301_10012921 3300001991 Bacteria 1525
9 JGI24735J21928_10006190 3300002067 Bacteria 3950
10 JGI24735J21928_10013771 3300002067 Bacteria 2536
11 JGI24735J21928_10036761 3300002067 Bacteria 1436
12 JGI24738J21930_10004387 3300002075 Bacteria 3461
13 JGI25406J46586_10081202 3300003203 Bacteria 994
14 JGI25405J52794_10024615 3300003911 Bacteria 1230
15 Ga0070658_10001903 3300005327 Bacteria 17620
16 Ga0070658_10003430 3300005327 Bacteria 13031
17 Ga0070658_10469184 3300005327 Bacteria 1086
18 Ga0070658_10856956 3300005327 Bacteria 790
19 Ga0070658_10879796 3300005327 Bacteria 779
20 Ga0068869_100735627 3300005334 Bacteria 844
21 Ga0070666_10050499 3300005335 Bacteria 2797
22 Ga0070666_10286717 3300005335 Bacteria 1171
23 Ga0070682_100009485 3300005337 Bacteria 5507
24 Ga0068868_100522204 3300005338 Bacteria 1043
25 Ga0068868_100624625 3300005338 Bacteria 957
26 Ga0070660_100727576 3300005339 Bacteria 833
27 Ga0070661_100109707 3300005344 Bacteria 2059
28 Ga0070661_100528573 3300005344 Bacteria 947
29 Ga0070668_100005758 3300005347 Bacteria 9190
30 Ga0070668_100052313 3300005347 Bacteria 3148
31 Ga0070668_100140815 3300005347 Bacteria 1943
32 Ga0070668_100464190 3300005347 Bacteria 1091
33 Ga0070674_100476797 3300005356 Bacteria 1035
34 Ga0070673_100497000 3300005364 Bacteria 1103
35 Ga0070659_100033967 3300005366 Bacteria 3966
36 Ga0070659_101234670 3300005366 Bacteria 662
37 Ga0070667_100009689 3300005367 Bacteria 7983
38 Ga0070714_100000008 3300005435 Bacteria 278734
39 Ga0070714_100349786 3300005435 Bacteria 1388
40 Ga0070714_100521929 3300005435 Bacteria 1135
41 Ga0070710_10000117 3300005437 Bacteria 37541
42 Ga0070711_100103921 3300005439 Bacteria 2071
43 Ga0070705_100054686 3300005440 Bacteria 2343
44 Ga0070700_100000121 3300005441 Bacteria 48058
45 Ga0070708_100053060 3300005445 Bacteria 3596
46 Ga0070663_100000606 3300005455 Bacteria 19194
47 Ga0070663_100048451 3300005455 Bacteria 3013
48 Ga0070678_100092825 3300005456 Bacteria 2320
49 Ga0070681_10092548 3300005458 Bacteria 2972
50 Ga0070685_10328428 3300005466 Bacteria 1039
51 Ga0070707_100204013 3300005468 Bacteria 1927
52 Ga0070698_100226555 3300005471 Bacteria 1802
53 Ga0070698_101305251 3300005471 Bacteria 676
54 Ga0070679_100116836 3300005530 Bacteria 2652
55 Ga0070679_101027013 3300005530 Bacteria 769
56 Ga0070684_100140216 3300005535 Bacteria 2186
57 Ga0070684_100361730 3300005535 Bacteria 1335
58 Ga0070672_100235596 3300005543 Bacteria 1539
59 Ga0070693_100530317 3300005547 Bacteria 840
60 Ga0070665_100001690 3300005548 Bacteria 25404
61 Ga0070665_100117052 3300005548 Bacteria 2667
62 Ga0070665_100176750 3300005548 Bacteria 2136
63 Ga0070665_100201904 3300005548 Bacteria 1989
64 Ga0070665_100412145 3300005548 Bacteria 1360
65 Ga0068855_100010196 3300005563 Bacteria 11327
66 Ga0068855_100641955 3300005563 Bacteria 1141
67 Ga0070664_100104298 3300005564 Bacteria 2469
68 Ga0070664_100122663 3300005564 Bacteria 2276
69 Ga0070664_100147320 3300005564 Bacteria 2077
70 Ga0068857_100048370 3300005577 Bacteria 3776
71 Ga0068857_100057664 3300005577 Bacteria 3447
72 Ga0068857_100153599 3300005577 Bacteria 2086
73 Ga0068856_100332629 3300005614 Bacteria 1537
74 Ga0068856_100342367 3300005614 Bacteria 1514
75 Ga0068856_100982372 3300005614 Bacteria 863
76 Ga0070702_100100009 3300005615 Bacteria 1777
77 Ga0068864_100001934 3300005618 Bacteria 17015
78 Ga0068864_100187527 3300005618 Bacteria 1894
79 Ga0068864_100842607 3300005618 Bacteria 903
80 Ga0068866_10425363 3300005718 Bacteria 862
81 Ga0068870_10606257 3300005840 Bacteria 745
82 Ga0068863_100000263 3300005841 Bacteria 54959
83 Ga0068863_100009084 3300005841 Bacteria 9704
84 Ga0068863_100086631 3300005841 Bacteria 2968
85 Ga0068858_100070317 3300005842 Bacteria 3244
86 Ga0068858_100293960 3300005842 Bacteria 1549
87 Ga0068858_101966732 3300005842 Bacteria 578
88 Ga0068860_100000067 3300005843 Bacteria 180176
89 Ga0081455_10000288 3300005937 Bacteria 66686
90 Ga0081455_10046773 3300005937 Bacteria 3751
91 Ga0081455_10074700 3300005937 Bacteria 2799
92 Ga0081538_10184763 3300005981 Bacteria 885
93 Ga0081539_10000272 3300005985 Bacteria 118649
94 Ga0081539_10005536 3300005985 Bacteria 12806
95 Ga0070717_10006278 3300006028 Bacteria 8729
96 Ga0070717_10657173 3300006028 Bacteria 952
97 Ga0075365_10054381 3300006038 Bacteria 2654
98 Ga0075365_10305184 3300006038 Bacteria 1120
99 Ga0075368_10008492 3300006042 Bacteria 3660
100 Ga0075368_10011215 3300006042 Bacteria 3257
101 Ga0075363_100090957 3300006048 Bacteria 1679
102 Ga0075363_100138619 3300006048 Bacteria 1368
103 Ga0075363_100234805 3300006048 Bacteria 1053
104 Ga0075364_10004394 3300006051 Bacteria 8105
105 Ga0075364_10181213 3300006051 Bacteria 1425
106 Ga0075364_10502633 3300006051 Bacteria 829
107 Ga0070712_100440872 3300006175 Bacteria 1083
108 Ga0075367_10033897 3300006178 Bacteria 2946
109 Ga0075367_10107967 3300006178 Bacteria 1706
110 Ga0075367_10127481 3300006178 Bacteria 1571
111 Ga0075370_10024496 3300006353 Bacteria 3335
112 Ga0075370_10100865 3300006353 Bacteria 1670
113 Ga0075428_100080213 3300006844 Bacteria 3561
114 Ga0075431_100001048 3300006847 Bacteria 24677
115 Ga0075434_101490802 3300006871 Bacteria 686
116 Ga0075429_100000366 3300006880 Bacteria 33350
117 Ga0075429_100583960 3300006880 Bacteria 979
118 Ga0068865_100081493 3300006881 Bacteria 2324
119 Ga0099826_10136966 3300006948 Bacteria 1420
120 Ga0105240_10008590 3300009093 Bacteria 14599
121 Ga0105240_10303218 3300009093 Bacteria 1827
122 Ga0105240_10584873 3300009093 Bacteria 1231
123 Ga0105240_10749681 3300009093 Bacteria 1062
124 Ga0111539_10490986 3300009094 Bacteria 1430
125 Ga0111539_11369771 3300009094 Bacteria 821
126 Ga0111539_12266450 3300009094 Bacteria 630
127 Ga0105245_10223712 3300009098 Bacteria 1817
128 Ga0105247_10127975 3300009101 Bacteria 1653
129 Ga0105247_10174073 3300009101 Bacteria 1433
130 Ga0114129_10003185 3300009147 Bacteria 23009
131 Ga0114129_10054519 3300009147 Bacteria 5605
132 Ga0114129_10163076 3300009147 Bacteria 3043
133 Ga0105243_10198160 3300009148 Bacteria 1759
134 Ga0105243_11137547 3300009148 Bacteria 791
135 Ga0105241_10004674 3300009174 Bacteria 10118
136 Ga0105242_10596379 3300009176 Bacteria 1066
137 Ga0105248_10072118 3300009177 Bacteria 3881
138 Ga0105237_10230572 3300009545 Bacteria 1852
139 Ga0105237_10364185 3300009545 Bacteria 1450
140 Ga0105237_12080949 3300009545 Bacteria 577
141 Ga0105238_10007937 3300009551 Bacteria 10618
142 Ga0105238_10034037 3300009551 Bacteria 5185
143 Ga0105238_10736103 3300009551 Bacteria 999
144 Ga0105238_11132778 3300009551 Bacteria 806
145 Ga0105249_10528119 3300009553 Bacteria 1228
146 Ga0105033_117532 3300009986 Bacteria 646
147 Ga0099796_10305370 3300010159 Bacteria 675
148 Ga0105239_10029191 3300010375 Bacteria 6064
149 Ga0105246_10185823 3300011119 Bacteria 1604
150 Ga0105246_10395488 3300011119 Bacteria 1146
151 Ga0157337_1007427 3300012483 Bacteria 783
152 Ga0157343_1002312 3300012488 Bacteria 1029
153 Ga0157343_1006218 3300012488 Bacteria 799
154 Ga0157323_1014486 3300012495 Bacteria 677
155 Ga0157345_1010543 3300012498 Bacteria 806
156 Ga0157324_1003090 3300012506 Bacteria 1066
157 Ga0157327_1022259 3300012512 Bacteria 726
158 Ga0157326_1013430 3300012513 Bacteria 945
159 Ga0157370_10013984 3300013104 Bacteria 8240
160 Ga0157369_10028188 3300013105 Bacteria 6216
161 Ga0157369_10723576 3300013105 Bacteria 1024
162 Ga0157374_10126129 3300013296 Bacteria 2474
163 Ga0157374_10804610 3300013296 Bacteria 956
164 Ga0157374_11051819 3300013296 Bacteria 834
165 Ga0157372_10001175 3300013307 Bacteria 28280
166 Ga0157372_10230986 3300013307 Bacteria 2145
167 Ga0157375_11241522 3300013308 Bacteria 875
168 Ga0163163_10008500 3300014325 Bacteria 9124
169 Ga0163163_10212447 3300014325 Bacteria 1984
170 Ga0157380_10016454 3300014326 Bacteria 5455
171 Ga0157380_10731815 3300014326 Bacteria 998
172 Ga0157380_11142581 3300014326 Bacteria 820
173 Ga0182008_10006605 3300014497 Bacteria 6467
174 Ga0157379_10227745 3300014968 Bacteria 1689
175 Ga0157379_11734671 3300014968 Bacteria 612
176 Ga0157376_10436327 3300014969 Bacteria 1274
177 Ga0157376_10744551 3300014969 Bacteria 989
178 Ga0157376_11140659 3300014969 Bacteria 806
179 Ga0182006_1015903 3300015261 Bacteria 3217
180 Ga0182007_10000483 3300015262 Bacteria 23980
181 Ga0182005_1041319 3300015265 Bacteria 1254
182 Ga0182005_1254819 3300015265 Bacteria 544
183 Ga0183367_1001 3300015688 Bacteria 1225545
184 Ga0163161_10112190 3300017792 Bacteria 2040
185 Ga0206349_1637531 3300020075 Bacteria 953
186 Ga0206351_10834330 3300020077 Bacteria 549
187 Ga0206353_10310562 3300020082 Bacteria 586
188 Ga0206353_11871755 3300020082 Bacteria 1295
189 Ga0213875_10007641 3300021388 Bacteria 5570
190 Ga0213875_10009695 3300021388 Bacteria 4860
191 Ga0224712_10520508 3300022467 Bacteria 576
192 Ga0207638_1001625 3300025227 Bacteria 785
193 Ga0209758_1007704 3300025297 Bacteria 7233
194 Ga0207426_1005200 3300025302 Bacteria 6042
195 Ga0207692_10000578 3300025898 Bacteria 13048
196 Ga0207688_10061399 3300025901 Bacteria 2118
197 Ga0207680_10206766 3300025903 Bacteria 1340
198 Ga0207680_10397404 3300025903 Bacteria 974
199 Ga0207647_10002261 3300025904 Bacteria 14677
200 Ga0207647_10009502 3300025904 Bacteria 6905
201 Ga0207647_10013506 3300025904 Bacteria 5655
202 Ga0207647_10171641 3300025904 Bacteria 1262
203 Ga0207699_10054371 3300025906 Bacteria 2378
204 Ga0207643_10482514 3300025908 Bacteria 791
205 Ga0207705_10193274 3300025909 Bacteria 1540
206 Ga0207705_10424816 3300025909 Bacteria 1029
207 Ga0207705_10713196 3300025909 Bacteria 780
208 Ga0207654_10002315 3300025911 Bacteria 9779
209 Ga0207707_10162677 3300025912 Bacteria 1951
210 Ga0207695_10000679 3300025913 Bacteria 66777
211 Ga0207695_10027158 3300025913 Bacteria 6376
212 Ga0207695_10961098 3300025913 Bacteria 734
213 Ga0207671_10000052 3300025914 Bacteria 188462
214 Ga0207671_10279597 3300025914 Bacteria 1316
215 Ga0207693_10113510 3300025915 Bacteria 2125
216 Ga0207693_10190338 3300025915 Bacteria 1615
217 Ga0207657_10481357 3300025919 Bacteria 973
218 Ga0207649_10019001 3300025920 Bacteria 3922
219 Ga0207646_10029388 3300025922 Bacteria 4997
220 Ga0207681_10359234 3300025923 Bacteria 1168
221 Ga0207694_10000079 3300025924 Bacteria 111767
222 Ga0207650_10376357 3300025925 Bacteria 1172
223 Ga0207687_10212242 3300025927 Bacteria 1519
224 Ga0207664_10000002 3300025929 Bacteria 657053
225 Ga0207664_10344216 3300025929 Bacteria 1319
226 Ga0207664_10739323 3300025929 Bacteria 885
227 Ga0207690_10020873 3300025932 Bacteria 4054
228 Ga0207690_10887677 3300025932 Bacteria 739
229 Ga0207709_10622529 3300025935 Bacteria 857
230 Ga0207709_11009895 3300025935 Bacteria 680
231 Ga0207669_10888767 3300025937 Bacteria 744
232 Ga0207704_10397384 3300025938 Bacteria 1087
233 Ga0207704_10431180 3300025938 Bacteria 1048
234 Ga0207711_10018580 3300025941 Bacteria 5780
235 Ga0207711_10853528 3300025941 Bacteria 847
236 Ga0207661_10456292 3300025944 Bacteria 1164
237 Ga0207679_10021823 3300025945 Bacteria 4348
238 Ga0207679_10055751 3300025945 Bacteria 2915
239 Ga0207679_10128576 3300025945 Bacteria 2029
240 Ga0207667_10040738 3300025949 Bacteria 4945
241 Ga0207668_10007254 3300025972 Bacteria 6584
242 Ga0207668_10036803 3300025972 Bacteria 3270
243 Ga0207668_10108573 3300025972 Bacteria 2077
244 Ga0207668_10386134 3300025972 Bacteria 1180
245 Ga0207640_10009569 3300025981 Bacteria 5432
246 Ga0207658_10003074 3300025986 Bacteria 11936
247 Ga0207658_10120953 3300025986 Bacteria 2088
248 Ga0207677_10781212 3300026023 Bacteria 853
249 Ga0207703_10013650 3300026035 Bacteria 6329
250 Ga0207703_10093621 3300026035 Bacteria 2531
251 Ga0207703_10170547 3300026035 Bacteria 1914
252 Ga0207639_10056875 3300026041 Bacteria 3000
253 Ga0207639_10909568 3300026041 Bacteria 823
254 Ga0207678_10000377 3300026067 Bacteria 40712
255 Ga0207678_10072035 3300026067 Bacteria 2961
256 Ga0207678_10426378 3300026067 Bacteria 1150
257 Ga0207678_10488790 3300026067 Bacteria 1072
258 Ga0207678_11287548 3300026067 Bacteria 647
259 Ga0207708_10000151 3300026075 Bacteria 55654
260 Ga0207708_10028752 3300026075 Bacteria 4209
261 Ga0207708_10490027 3300026075 Bacteria 1029
262 Ga0207702_10769731 3300026078 Bacteria 951
263 Ga0207641_10002388 3300026088 Bacteria 17327
264 Ga0207641_10321223 3300026088 Bacteria 1468
265 Ga0207641_10442044 3300026088 Bacteria 1255
266 Ga0207641_10648024 3300026088 Bacteria 1037
267 Ga0207648_11343906 3300026089 Bacteria 672
268 Ga0207676_10020103 3300026095 Bacteria 4880
269 Ga0207676_10422076 3300026095 Bacteria 1251
270 Ga0207676_10508133 3300026095 Bacteria 1145
271 Ga0207674_10019724 3300026116 Bacteria 7298
272 Ga0207674_10022613 3300026116 Bacteria 6747
273 Ga0207674_10023457 3300026116 Bacteria 6609
274 Ga0207674_10029539 3300026116 Bacteria 5771
275 Ga0207674_11004474 3300026116 Bacteria 803
276 Ga0207683_10044339 3300026121 Bacteria 3888
277 Ga0207683_10083312 3300026121 Bacteria 2842
278 Ga0207698_12147223 3300026142 Bacteria 572
279 Ga0209813_10002493 3300027866 Bacteria 4213
280 Ga0268266_10006214 3300028379 Bacteria 10971
281 Ga0268266_10108526 3300028379 Bacteria 2456
282 Ga0268266_10348450 3300028379 Bacteria 1391
283 Ga0268266_10833362 3300028379 Bacteria 891
284 Ga0268264_10000114 3300028381 Bacteria 203211
285 Ga0268264_10118000 3300028381 Bacteria 2334
286 Ga0268264_10470013 3300028381 Bacteria 1221
287 Ga0268264_10659134 3300028381 Bacteria 1036
288 Ga0307517_10000344 3300028786 Bacteria 80274
289 Ga0307515_10191646 3300028794 Bacteria 1952
290 Ga0307511_10254637 3300030521 Bacteria 839
291 Ga0307512_10143546 3300030522 Bacteria 1452
292 Ga0316177_1080666 3300030731 Bacteria 685
293 Ga0316177_1109865 3300030731 Bacteria 10572
294 Ga0316176_1208571 3300030732 Bacteria 7039
295 Ga0314311_1209569 3300030733 Bacteria 4653
296 Ga0316180_1109531 3300030736 Bacteria 2121
297 Ga0265763_1001149 3300030763 Bacteria 1829
298 Ga0265776_100008 3300030880 Bacteria 6194
299 Ga0265764_100082 3300030882 Bacteria 2557
300 Ga0265761_102098 3300030889 Bacteria 914
301 Ga0265779_100363 3300031043 Bacteria 1690
302 Ga0265760_10045194 3300031090 Bacteria 1319
303 Ga0265327_10000860 3300031251 Bacteria 45217
304 Ga0307513_10020394 3300031456 Bacteria 7864
305 Ga0307513_10194317 3300031456 Bacteria 1877
306 Ga0307509_10086897 3300031507 Bacteria 3214
307 Ga0307509_10239808 3300031507 Bacteria 1607
308 Ga0307408_100062168 3300031548 Bacteria 2728
309 Ga0307508_10003092 3300031616 Bacteria 17092
310 Ga0307508_10018606 3300031616 Bacteria 6313
311 Ga0307508_10365528 3300031616 Bacteria 1034
312 Ga0307514_10010722 3300031649 Bacteria 7656
313 Ga0316575_10003414 3300031665 Bacteria 5472
314 Ga0316576_10000192 3300031727 Bacteria 25476
315 Ga0316576_10000810 3300031727 Bacteria 15787
316 Ga0316576_10005181 3300031727 Bacteria 7922
317 Ga0316578_10019903 3300031728 Bacteria 3701
318 Ga0316578_10080862 3300031728 Bacteria 1933
319 Ga0307516_10071167 3300031730 Bacteria 3339
320 Ga0307516_10336249 3300031730 Bacteria 1178
321 Ga0307405_10060036 3300031731 Bacteria 2398
322 Ga0316577_10014148 3300031733 Bacteria 4379
323 Ga0307413_10011054 3300031824 Bacteria 4415
324 Ga0307413_10237044 3300031824 Bacteria 1344
325 Ga0307413_10525664 3300031824 Bacteria 955
326 Ga0307410_10608165 3300031852 Bacteria 912
327 Ga0307406_10005687 3300031901 Bacteria 6820
328 Ga0307406_10817464 3300031901 Bacteria 788
329 Ga0307412_10048637 3300031911 Bacteria 2790
330 Ga0307409_100000369 3300031995 Bacteria 18914
331 Ga0307409_100131796 3300031995 Bacteria 2138
332 Ga0307409_100221007 3300031995 Bacteria 1710
333 Ga0307416_100102206 3300032002 Bacteria 2498
334 Ga0307416_100294959 3300032002 Bacteria 1608
335 Ga0307416_101147265 3300032002 Bacteria 882
336 Ga0307416_101534100 3300032002 Bacteria 772
337 Ga0307414_10499333 3300032004 Bacteria 1076
338 Ga0307411_11045517 3300032005 Bacteria 733
339 Ga0307415_100000012 3300032126 Bacteria 84249
340 Ga0307415_100829767 3300032126 Bacteria 846
341 Ga0316583_10003969 3300032133 Bacteria 5256
342 Ga0316585_10001740 3300032137 Bacteria 5802
343 Ga0307507_10018043 3300033179 Bacteria 8056
344 Ga0307507_10140570 3300033179 Bacteria 1853
345 Ga0307507_10333475 3300033179 Bacteria 904
346 Ga0307510_10156276 3300033180 Bacteria 1887
347 Ga0307510_10216760 3300033180 Bacteria 1430
348 Ga0316592_1009125 3300033524 Bacteria 1979
349 Ga0316586_1005666 3300033527 Bacteria 1766
350 Ga0316588_1007943 3300033528 Bacteria 2170
351 Ga0316596_1015067 3300033541 Bacteria 1924
352 Ga0373934_0006812 3300035086 Bacteria 4242
353 Ga0373934_0021608 3300035086 Bacteria 2479
354 Ga0373957_0008923 3300035120 Bacteria 3267
355 Ga0373955_0031714 3300035172 Bacteria 2769
356 Ga0373942_0281096 3300035207 Bacteria 573
357 Ga0316574_0000472 3300035398 Bacteria 16265
358 Ga0316574_0009351 3300035398 Bacteria 5487
359 Ga0373931_0148164 3300035691 Bacteria 1366
360 Ga0373935_0338566 3300035692 Bacteria 1071
361 Ga0373933_0003631 3300035724 Bacteria 8548
362 Ga0373937_0089250 3300036401 Bacteria 2854
363 Ga0373937_0222916 3300036401 Bacteria 1775
364 Ga0373937_0513332 3300036401 Bacteria 1139
365 Ga0265778_000478 3300036457 Bacteria 3138
366 Ga0316582_0093320 3300036647 Bacteria 1984
367 Ga0316584_0004515 3300036712 Bacteria 9213
368 Ga0316584_0010614 3300036712 Bacteria 6444
369 Ga0373925_0000869 3300037068 Bacteria 27621
370 Ga0395899_0326103 3300037312 Bacteria 1033
371 Ga0395900_0125534 3300037418 Bacteria 2632
372 Ga0395900_0416786 3300037418 Bacteria 1304
373 Ga0395900_0913801 3300037418 Bacteria 801
374 Ga0395900_1408896 3300037418 Bacteria 610
375 Ga0395898_0008038 3300037466 Bacteria 11182
376 Ga0395898_0030406 3300037466 Bacteria 5404
377 Ga0395898_0086423 3300037466 Bacteria 3022
378 Ga0395898_0184225 3300037466 Bacteria 1995
379 Ga0395898_0795284 3300037466 Bacteria 886
380 Ga0316581_0000925 3300037588 Bacteria 6245
381 Ga0436364_0119540 3300037853 Bacteria 19100
382 Ga0436364_0930558 3300037853 Bacteria 7583
383 Ga0395901_0018191 3300038443 Bacteria 7174
384 Ga0395901_0027684 3300038443 Bacteria 5827
385 Ga0395901_0037243 3300038443 Bacteria 5031
386 Ga0395901_0494822 3300038443 Bacteria 1245
387 Ga0395901_1506621 3300038443 Bacteria 628
388 Ga0436365_1649406 3300039437 Bacteria 879
389 Ga0436360_0486273 3300039438 Bacteria 831
390 Ga0436363_1020776 3300039450 Bacteria 730
391 Ga0439466_0033405 3300041411 Bacteria 1748
392 Ga0439465_0067368 3300041413 Bacteria 1195
393 Ga0451807_0935894 3300041486 Bacteria 757
394 Ga0451849_0098137 3300041505 Bacteria 747
395 Ga0451849_1001175 3300041505 Bacteria 628
396 Ga0451851_0854016 3300041507 Bacteria 743
397 Ga0439433_0003699 3300041999 Bacteria 3286
398 Ga0439457_000906 3300042014 Bacteria 8947
399 Ga0439457_005004 3300042014 Bacteria 3389
400 Ga0450894_000084 3300042131 Bacteria 15364
401 Ga0450898_015870 3300042134 Bacteria 1280
402 Ga0450899_002814 3300042135 Bacteria 1881
403 Ga0450900_044335 3300042136 Bacteria 671
404 Ga0450903_009793 3300042138 Bacteria 1558
405 Ga0450906_010238 3300042145 Bacteria 1777
406 Ga0439458_0000260 3300042157 Bacteria 12835
407 Ga0450908_010771 3300042184 Bacteria 1683
408 Ga0439459_0090639 3300042438 Bacteria 735
409 Ga0466969_0005190 3300044656 Bacteria 6926
410 Ga0466969_0173428 3300044656 Bacteria 988
411 Ga0466972_0003135 3300044658 Bacteria 8207
412 Ga0466972_0009521 3300044658 Bacteria 4880
413 Ga0466972_0024819 3300044658 Bacteria 2975
414 Ga0466965_0004182 3300044683 Bacteria 6413
415 Ga0466965_0005029 3300044683 Bacteria 5923
416 Ga0466965_0007395 3300044683 Bacteria 5042
417 Ga0466966_0022938 3300044684 Bacteria 4089
418 Ga0466966_0041941 3300044684 Bacteria 2939
419 Ga0466966_0343754 3300044684 Bacteria 896
420 Ga0466961_0006030 3300044693 Bacteria 7685
421 Ga0466961_0052929 3300044693 Bacteria 2591
422 Ga0466961_0061886 3300044693 Bacteria 2379
423 Ga0466961_0154777 3300044693 Bacteria 1430
424 Ga0466961_0549002 3300044693 Bacteria 696
425 Ga0466963_0001025 3300044694 Bacteria 14497
426 Ga0466963_0035665 3300044694 Bacteria 3241
427 Ga0466963_0526925 3300044694 Bacteria 834
428 Ga0466964_0005930 3300044706 Bacteria 4550
429 Ga0466964_0019842 3300044706 Bacteria 2587
430 Ga0466971_0000360 3300044719 Bacteria 17428
431 Ga0466971_0024293 3300044719 Bacteria 2704
432 Ga0466971_0286415 3300044719 Bacteria 789
433 Ga0466968_0012734 3300044735 Bacteria 3299
434 Ga0466968_0063723 3300044735 Bacteria 1593
435 Ga0466968_0139410 3300044735 Bacteria 1108
436 Ga0466968_0380636 3300044735 Bacteria 689
437 Ga0466970_0008236 3300044765 Bacteria 5237
438 Ga0466970_0015973 3300044765 Bacteria 3865
439 Ga0466970_0066631 3300044765 Bacteria 1933
440 Ga0466970_0092029 3300044765 Bacteria 1647
441 Ga0466970_0160621 3300044765 Bacteria 1243
442 Ga0466957_0000665 3300044842 Bacteria 17463
443 Ga0466957_0324761 3300044842 Bacteria 1039
444 Ga0466960_0003337 3300044901 Bacteria 6159
445 Ga0466960_0013260 3300044901 Bacteria 3497
446 Ga0466960_0052143 3300044901 Bacteria 1978
447 Ga0466960_0166004 3300044901 Bacteria 1189
448 Ga0466960_0218914 3300044901 Bacteria 1047
449 Ga0466960_0224695 3300044901 Bacteria 1034
450 Ga0466959_0004284 3300045049 Bacteria 9516
451 Ga0466959_0030100 3300045049 Bacteria 4020
452 Ga0466959_0098411 3300045049 Bacteria 2096
453 Ga0466958_0002860 3300045836 Bacteria 8789
454 Ga0466958_0294111 3300045836 Bacteria 1042
455 Ga0466958_0494806 3300045836 Bacteria 793
456 Ga0466967_0011268 3300045976 Bacteria 6758
457 Ga0466967_0103064 3300045976 Bacteria 2611
458 Ga0466967_0172364 3300045976 Bacteria 2036
459 Ga0466967_0409292 3300045976 Bacteria 1321
460 Ga0466967_0922060 3300045976 Bacteria 869
461 Ga0466967_1667178 3300045976 Bacteria 635
462 Ga0495627_078019 3300046453 Bacteria 962
463 Ga0495592_0126290 3300046454 Bacteria 1794
464 Ga0495592_0208048 3300046454 Bacteria 1316
465 Ga0495603_0177179 3300046455 Bacteria 1234
466 Ga0495629_0067016 3300046459 Bacteria 2506
467 Ga0495629_0085592 3300046459 Bacteria 2199
468 Ga0495629_0452977 3300046459 Bacteria 869
469 Ga0495638_0171807 3300046460 Bacteria 1243
470 Ga0495641_0174997 3300046461 Bacteria 960
471 Ga0495651_0007219 3300046462 Bacteria 8492
472 Ga0495651_0011746 3300046462 Bacteria 6729
473 Ga0495651_0015709 3300046462 Bacteria 5862
474 Ga0495651_0052728 3300046462 Bacteria 3132
475 Ga0495653_0016927 3300046463 Bacteria 5930
476 Ga0495653_0042553 3300046463 Bacteria 3536
477 Ga0495662_0373927 3300046476 Bacteria 700
478 Ga0495664_0033230 3300046477 Bacteria 3032
479 Ga0495585_0054794 3300046492 Bacteria 2204
480 Ga0495585_0209731 3300046492 Bacteria 988
481 Ga0495594_0002125 3300046499 Bacteria 10318
482 Ga0495594_0192948 3300046499 Bacteria 1160
483 Ga0495607_0105493 3300046501 Bacteria 1502
484 Ga0495608_0005268 3300046511 Bacteria 9239
485 Ga0495618_0011168 3300046514 Bacteria 5444
486 Ga0495618_0022588 3300046514 Bacteria 3886
487 Ga0495628_0011365 3300046516 Bacteria 7530
488 Ga0495628_0015282 3300046516 Bacteria 6413
489 Ga0495628_0026709 3300046516 Bacteria 4703
490 Ga0495628_0328819 3300046516 Bacteria 1127
491 Ga0495628_0468267 3300046516 Bacteria 913
492 Ga0495637_0061728 3300046520 Bacteria 1536
493 Ga0495643_0010091 3300046522 Bacteria 5826
494 Ga0495652_0000972 3300046529 Bacteria 32777
495 Ga0495652_0010502 3300046529 Bacteria 8391
496 Ga0495652_0022800 3300046529 Bacteria 5555
497 Ga0495652_0036616 3300046529 Bacteria 4263
498 Ga0495652_0318978 3300046529 Bacteria 1123
499 Ga0495665_0296197 3300046531 Bacteria 829
500 Ga0495640_0002880 3300046533 Bacteria 13861
501 Ga0495640_0003531 3300046533 Bacteria 12572
502 Ga0495587_0009578 3300046536 Bacteria 6201
503 Ga0495587_0310905 3300046536 Bacteria 880
504 Ga0495587_0384528 3300046536 Bacteria 780
505 Ga0495645_0063399 3300046543 Bacteria 2676
506 Ga0495622_0033622 3300046557 Bacteria 2393
507 Ga0495667_0006353 3300046559 Bacteria 8016
508 Ga0495667_0015057 3300046559 Bacteria 5220
509 Ga0495667_0016726 3300046559 Bacteria 4954
510 Ga0495667_0287032 3300046559 Bacteria 1044
511 Ga0495634_0008990 3300046642 Bacteria 7393
512 Ga0495634_0012007 3300046642 Bacteria 6279
513 Ga0495634_0618800 3300046642 Bacteria 627
514 Ga0495611_0276779 3300046648 Bacteria 776
515 Ga0495635_0001652 3300046663 Bacteria 15030
516 Ga0495635_0006862 3300046663 Bacteria 7955
517 Ga0495657_0000195 3300046675 Bacteria 54506
518 Ga0495657_0006270 3300046675 Bacteria 9318
519 Ga0495657_0023829 3300046675 Bacteria 4368
520 Ga0495657_0506467 3300046675 Bacteria 704
521 Ga0495599_0007812 3300046678 Bacteria 6491
522 Ga0495623_0121724 3300046679 Bacteria 1570
523 Ga0495646_0074976 3300046680 Bacteria 1984
524 Ga0495646_0161315 3300046680 Bacteria 1241
525 Ga0495658_0080350 3300046683 Bacteria 1912
526 Ga0495669_0022866 3300046684 Bacteria 2717
527 Ga0495613_0000948 3300046689 Bacteria 22175
528 Ga0495613_0218130 3300046689 Bacteria 1340
529 Ga0495670_0010405 3300046691 Bacteria 4570
530 Ga0495670_0527501 3300046691 Bacteria 642
531 Ga0495589_0106916 3300046794 Bacteria 1351
532 Ga0495600_0004775 3300046809 Bacteria 8132
533 Ga0495600_0014301 3300046809 Bacteria 4999
534 Ga0495600_0024758 3300046809 Bacteria 3865
535 Ga0495600_0037550 3300046809 Bacteria 3149
536 Ga0495660_0423688 3300046810 Bacteria 579
537 Ga0495581_0013742 3300047315 Bacteria 4694
538 Ga0495581_0089906 3300047315 Bacteria 1781
539 Ga0495581_0245187 3300047315 Bacteria 1048
540 Ga0495604_0003276 3300047317 Bacteria 12940
541 Ga0495604_0023521 3300047317 Bacteria 4915
542 Ga0495604_0074499 3300047317 Bacteria 2558
543 Ga0495604_0193110 3300047317 Bacteria 1417
544 Ga0495674_0009916 3300047319 Bacteria 9034
545 Ga0495674_0567912 3300047319 Bacteria 901
546 Ga0495676_0000578 3300047321 Bacteria 30172
547 Ga0495680_0017250 3300047322 Bacteria 6172
548 Ga0495680_0373891 3300047322 Bacteria 988
549 Ga0495687_027920 3300047443 Bacteria 2633
550 Ga0495687_108571 3300047443 Bacteria 1025
551 Ga0495675_0011016 3300047444 Bacteria 5668
552 Ga0495675_0050379 3300047444 Bacteria 2647
553 Ga0495675_0093623 3300047444 Bacteria 1885
554 Ga0495675_0132591 3300047444 Bacteria 1548
555 Ga0495685_005388 3300047447 Bacteria 4174
556 Ga0495685_083233 3300047447 Bacteria 1064
557 Ga0495681_0015121 3300047470 Bacteria 4379
558 Ga0495684_0009203 3300047471 Bacteria 7624
559 Ga0495684_0120573 3300047471 Bacteria 1975
560 Ga0495686_0094985 3300047472 Bacteria 1806
561 Ga0495593_0174851 3300047673 Bacteria 1082
562 Ga0495602_0045490 3300048088 Bacteria 3971
563 Ga0495614_0150421 3300048089 Bacteria 1038
564 Ga0495626_0258988 3300048091 Bacteria 696
565 Ga0496100_0150425 3300048903 Bacteria 1660
566 Ga0496100_0172023 3300048903 Bacteria 1561
567 Ga0496100_0764628 3300048903 Bacteria 756
568 Ga0496101_0064165 3300048904 Bacteria 2675
569 Ga0496101_0621349 3300048904 Bacteria 854
570 Ga0496102_0001582 3300048905 Bacteria 20084
571 Ga0496102_0001756 3300048905 Bacteria 18887
572 Ga0496102_0357723 3300048905 Bacteria 1374
573 Ga0496102_0754548 3300048905 Bacteria 896
574 Ga0496102_0769408 3300048905 Bacteria 885
575 Ga0496102_1727347 3300048905 Bacteria 543
576 Ga0496103_0010531 3300048906 Bacteria 5475
577 Ga0496103_0045308 3300048906 Bacteria 2714
578 Ga0496103_0155275 3300048906 Bacteria 1467
579 Ga0496103_0831406 3300048906 Bacteria 581
580 Ga0496104_0002885 3300048907 Bacteria 14814
581 Ga0496104_0194856 3300048907 Bacteria 1938
582 Ga0496104_0285490 3300048907 Bacteria 1563
583 Ga0496104_0609995 3300048907 Bacteria 1001
584 Ga0496104_0702797 3300048907 Bacteria 919
585 Ga0496104_0829805 3300048907 Bacteria 830
586 Ga0496105_0007482 3300048908 Bacteria 8458
587 Ga0496105_0020454 3300048908 Bacteria 5348
588 Ga0496105_0092676 3300048908 Bacteria 2494
589 Ga0496106_0220829 3300048909 Bacteria 1511
590 Ga0496106_0238191 3300048909 Bacteria 1454
591 Ga0496107_0046753 3300048910 Bacteria 3115
592 Ga0496108_0007960 3300048911 Bacteria 8596
593 Ga0496108_0054645 3300048911 Bacteria 3351
594 Ga0496108_0095519 3300048911 Bacteria 2531
595 Ga0496108_0115693 3300048911 Bacteria 2297
596 Ga0496109_0015006 3300048912 Bacteria 6742
597 Ga0496109_0029176 3300048912 Bacteria 4940
598 Ga0496109_0130133 3300048912 Bacteria 2348
599 Ga0496109_1039244 3300048912 Bacteria 757
600 Ga0496109_1094345 3300048912 Bacteria 734
601 Ga0496110_0005721 3300048913 Bacteria 9763
602 Ga0496110_0043840 3300048913 Bacteria 3905
603 Ga0496110_0068614 3300048913 Bacteria 3138
604 Ga0496110_0085747 3300048913 Bacteria 2811
605 Ga0496110_0201320 3300048913 Bacteria 1809
606 Ga0496110_0223326 3300048913 Bacteria 1713
607 Ga0496111_0014112 3300048914 Bacteria 5449
608 Ga0496111_0030311 3300048914 Bacteria 3847
609 Ga0496111_0039685 3300048914 Bacteria 3377
610 Ga0496111_0207316 3300048914 Bacteria 1456
611 Ga0496112_0036181 3300048915 Bacteria 4814
612 Ga0496112_0810293 3300048915 Bacteria 861
613 Ga0496113_0055243 3300048916 Bacteria 2976
614 Ga0496113_0117867 3300048916 Bacteria 2073
615 Ga0496113_0237546 3300048916 Bacteria 1454
616 Ga0496114_0003472 3300048917 Bacteria 12096
617 Ga0496114_0032735 3300048917 Bacteria 4281
618 Ga0496114_0036171 3300048917 Bacteria 4081
619 Ga0496114_0092164 3300048917 Bacteria 2574
620 Ga0496114_0101850 3300048917 Bacteria 2452
621 Ga0496114_0137808 3300048917 Bacteria 2111
622 Ga0496114_0317386 3300048917 Bacteria 1377
623 Ga0496114_0563480 3300048917 Bacteria 1006
624 Ga0496115_0022662 3300048918 Bacteria 4869
625 Ga0496115_0371401 3300048918 Bacteria 1164
626 Ga0496124_0129777 3300048927 Bacteria 2004
627 Ga0496126_0469609 3300048929 Bacteria 1010
628 Ga0501031_0017952 3300049568 Bacteria 4603
629 Ga0501031_0020167 3300049568 Bacteria 4345
630 Ga0501031_0048889 3300049568 Bacteria 2756
631 Ga0501031_0168199 3300049568 Bacteria 1432
632 Ga0501031_0238575 3300049568 Bacteria 1182
633 Ga0501031_0279498 3300049568 Bacteria 1083
634 Ga0501031_0477362 3300049568 Bacteria 805
635 Ga0501032_0008234 3300049569 Bacteria 7601
636 Ga0501032_0017889 3300049569 Bacteria 4973
637 Ga0501032_0062566 3300049569 Bacteria 2493
638 Ga0501032_0258897 3300049569 Bacteria 1128
639 Ga0501032_0336492 3300049569 Bacteria 973
640 Ga0501032_0338104 3300049569 Bacteria 970
641 Ga0501032_0383132 3300049569 Bacteria 904
642 Ga0501032_0604468 3300049569 Bacteria 697
643 Ga0501033_0002605 3300049570 Bacteria 15201
644 Ga0501033_0009265 3300049570 Bacteria 7584
645 Ga0501033_0020024 3300049570 Bacteria 5057
646 Ga0501033_0029149 3300049570 Bacteria 4147
647 Ga0501033_0048391 3300049570 Bacteria 3158
648 Ga0501033_0156437 3300049570 Bacteria 1642
649 Ga0501033_0242545 3300049570 Bacteria 1278
650 Ga0501034_0003777 3300049571 Bacteria 17090
651 Ga0501034_0022734 3300049571 Bacteria 6387
652 Ga0501034_0038161 3300049571 Bacteria 4864
653 Ga0501034_0046104 3300049571 Bacteria 4404
654 Ga0501034_0103107 3300049571 Bacteria 2846
655 Ga0501036_0011970 3300049572 Bacteria 7191
656 Ga0501036_0018297 3300049572 Bacteria 5866
657 Ga0501036_0038885 3300049572 Bacteria 4028
658 Ga0501036_0051220 3300049572 Bacteria 3496
659 Ga0501036_0138820 3300049572 Bacteria 2051
660 Ga0501036_0166757 3300049572 Bacteria 1856
661 Ga0501036_0567429 3300049572 Bacteria 942
662 Ga0501036_0608017 3300049572 Bacteria 906
663 Ga0501036_0998085 3300049572 Bacteria 685
664 Ga0501037_0004560 3300049573 Bacteria 10076
665 Ga0501037_0011090 3300049573 Bacteria 6631
666 Ga0501037_0023056 3300049573 Bacteria 4604
667 Ga0501037_0031773 3300049573 Bacteria 3898
668 Ga0501037_0049741 3300049573 Bacteria 3069
669 Ga0501037_0278924 3300049573 Bacteria 1165
670 Ga0501038_0002308 3300049574 Bacteria 17738
671 Ga0501038_0014193 3300049574 Bacteria 7257
672 Ga0501038_0050590 3300049574 Bacteria 3589
673 Ga0501038_0056214 3300049574 Bacteria 3379
674 Ga0501038_0148514 3300049574 Bacteria 1912
675 Ga0501038_0160218 3300049574 Bacteria 1829
676 Ga0501038_0421736 3300049574 Bacteria 1029
677 Ga0501039_0018932 3300049575 Bacteria 5284
678 Ga0501039_0035127 3300049575 Bacteria 3868
679 Ga0501039_0051535 3300049575 Bacteria 3184
680 Ga0501039_0165667 3300049575 Bacteria 1738
681 Ga0501039_0529537 3300049575 Bacteria 925
682 Ga0501039_0571038 3300049575 Bacteria 887
683 Ga0501040_0001190 3300049576 Bacteria 16556
684 Ga0501040_0047549 3300049576 Bacteria 2929
685 Ga0501040_0320087 3300049576 Bacteria 1109
686 Ga0501040_0663884 3300049576 Bacteria 754
687 Ga0501041_0001720 3300049577 Bacteria 12275
688 Ga0501041_0001863 3300049577 Bacteria 11806
689 Ga0501041_0014514 3300049577 Bacteria 4679
690 Ga0501042_0000472 3300049578 Bacteria 20838
691 Ga0501042_0016631 3300049578 Bacteria 5053
692 Ga0501042_0031191 3300049578 Bacteria 3771
693 Ga0501042_0186687 3300049578 Bacteria 1495
694 Ga0501043_0035662 3300049579 Bacteria 3912
695 Ga0501043_0049063 3300049579 Bacteria 3318
696 Ga0501043_0106379 3300049579 Bacteria 2203
697 Ga0501043_0164832 3300049579 Bacteria 1731
698 Ga0501043_0263912 3300049579 Bacteria 1323
699 Ga0501043_0411605 3300049579 Bacteria 1020
700 Ga0501046_0006667 3300049580 Bacteria 10196
701 Ga0501046_0015151 3300049580 Bacteria 6484
702 Ga0501046_0137271 3300049580 Bacteria 1852
703 Ga0501046_0352761 3300049580 Bacteria 1068
704 Ga0501046_0726874 3300049580 Bacteria 698
705 Ga0501047_0000023 3300049581 Bacteria 240478
706 Ga0501047_0005683 3300049581 Bacteria 11738
707 Ga0501047_0009572 3300049581 Bacteria 9158
708 Ga0501047_0021299 3300049581 Bacteria 6223
709 Ga0501047_0040398 3300049581 Bacteria 4511
710 Ga0501047_0283006 3300049581 Bacteria 1502
711 Ga0501047_0352768 3300049581 Bacteria 1307
712 Ga0501048_0009146 3300049582 Bacteria 7451
713 Ga0501048_0009974 3300049582 Bacteria 7111
714 Ga0501048_0011797 3300049582 Bacteria 6514
715 Ga0501048_0051426 3300049582 Bacteria 2933
716 Ga0501048_0087054 3300049582 Bacteria 2204
717 Ga0501067_0006012 3300049583 Bacteria 6727
718 Ga0501067_0085045 3300049583 Bacteria 1755
719 Ga0501067_0381987 3300049583 Bacteria 785
720 Ga0501068_0002329 3300049584 Bacteria 10122
721 Ga0501068_0164213 3300049584 Bacteria 1400
722 Ga0501068_0208028 3300049584 Bacteria 1242
723 Ga0501069_0009227 3300049585 Bacteria 5205
724 Ga0501069_0219326 3300049585 Bacteria 1105
725 Ga0501070_0000628 3300049586 Bacteria 32441
726 Ga0501070_0018431 3300049586 Bacteria 5857
727 Ga0501070_0074784 3300049586 Bacteria 2804
728 Ga0501070_0564086 3300049586 Bacteria 910
729 Ga0501070_0895690 3300049586 Bacteria 692
730 Ga0501071_0003479 3300049587 Bacteria 9835
731 Ga0501071_0007491 3300049587 Bacteria 7173
732 Ga0501071_0106773 3300049587 Bacteria 2067
733 Ga0501072_0011963 3300049588 Bacteria 6629
734 Ga0501072_0027613 3300049588 Bacteria 4427
735 Ga0501072_0029303 3300049588 Bacteria 4299
736 Ga0501072_0060532 3300049588 Bacteria 2985
737 Ga0501072_0098777 3300049588 Bacteria 2321
738 Ga0501073_0012824 3300049589 Bacteria 6108
739 Ga0501073_0114686 3300049589 Bacteria 1868
740 Ga0501074_0068948 3300049590 Bacteria 2542
741 Ga0501074_0128428 3300049590 Bacteria 1814
742 Ga0501074_0169718 3300049590 Bacteria 1557
743 Ga0501074_0252188 3300049590 Bacteria 1255
744 Ga0501074_0297420 3300049590 Bacteria 1147
745 Ga0501075_0087914 3300049591 Bacteria 2355
746 Ga0501075_0235169 3300049591 Bacteria 1397
747 Ga0501075_1293197 3300049591 Bacteria 553
748 Ga0501076_0012589 3300049592 Bacteria 6328
749 Ga0501076_0014136 3300049592 Bacteria 6003
750 Ga0501076_0022279 3300049592 Bacteria 4868
751 Ga0501077_0006448 3300049593 Bacteria 7203
752 Ga0501251_018267 3300049681 Bacteria 908
753 Ga0501255_034719 3300049684 Bacteria 717
754 Ga0501221_129668 3300049704 Bacteria 651
755 Ga0501079_0007791 3300049741 Bacteria 8108
756 Ga0501079_0016024 3300049741 Bacteria 5726
757 Ga0501079_0091238 3300049741 Bacteria 2360
758 Ga0501079_0552767 3300049741 Bacteria 905
759 Ga0501080_0022335 3300049742 Bacteria 5861
760 Ga0501080_0036896 3300049742 Bacteria 4563
761 Ga0501080_0039448 3300049742 Bacteria 4407
762 Ga0501080_0133479 3300049742 Bacteria 2298
763 Ga0501080_0194594 3300049742 Bacteria 1863
764 Ga0501081_0051596 3300049743 Bacteria 2837
765 Ga0501081_0089261 3300049743 Bacteria 2166
766 Ga0501083_0001532 3300049744 Bacteria 15795
767 Ga0501083_0167387 3300049744 Bacteria 1437
768 Ga0501276_010684 3300049773 Bacteria 775
769 Ga0501035_0010362 3300049822 Bacteria 8642
770 Ga0501035_0012451 3300049822 Bacteria 7860
771 Ga0501035_0035774 3300049822 Bacteria 4505
772 Ga0501035_0042881 3300049822 Bacteria 4078
773 Ga0501035_0073515 3300049822 Bacteria 3025
774 Ga0501035_0109331 3300049822 Bacteria 2423
775 Ga0501035_0218608 3300049822 Bacteria 1627
776 Ga0501044_0004956 3300049823 Bacteria 14888
777 Ga0501044_0011856 3300049823 Bacteria 9444
778 Ga0501044_0015121 3300049823 Bacteria 8317
779 Ga0501044_0049683 3300049823 Bacteria 4330
780 Ga0501044_0125389 3300049823 Bacteria 2565
781 Ga0501044_0138258 3300049823 Bacteria 2425
782 Ga0501044_0274487 3300049823 Bacteria 1621
783 Ga0501044_0301307 3300049823 Bacteria 1531
784 Ga0501044_0423905 3300049823 Bacteria 1240
785 Ga0501044_0669804 3300049823 Bacteria 925
786 Ga0501045_0008667 3300049824 Bacteria 7091
787 Ga0501045_0017200 3300049824 Bacteria 5133
788 Ga0501045_0019369 3300049824 Bacteria 4850
789 Ga0501045_0027452 3300049824 Bacteria 4103
790 Ga0501045_0104575 3300049824 Bacteria 2098
791 Ga0501045_0151400 3300049824 Bacteria 1726
792 Ga0501045_0441791 3300049824 Bacteria 967
793 nmdc:mga00v17_86820_c1 3300050491 Bacteria 1961
794 nmdc:mga0yw44_104661_c1 3300050492 Bacteria 890
795 nmdc:mga0yw44_117488_c1 3300050492 Bacteria 1710
796 nmdc:mga0yw44_37973_c1 3300050492 Bacteria 2847
797 nmdc:mga06z11_3612_c1 3300050494 Bacteria 5996
798 nmdc:mga06z11_36604_c1 3300050494 Bacteria 2424
799 nmdc:mga04h51_3526_c1 3300050495 Bacteria 3806
800 nmdc:mga04h51_60170_c1 3300050495 Bacteria 1300
801 nmdc:mga07m45_44368_c1 3300050496 Bacteria 2495
802 nmdc:mga07m45_82148_c1 3300050496 Bacteria 1840
803 nmdc:mga05p37_245018_c1 3300050507 Bacteria 2152
804 nmdc:mga05p37_408130_c1 3300050507 Bacteria 1584
805 nmdc:mga09592_234852_c1 3300050508 Bacteria 1589
806 nmdc:mga09592_879049_c1 3300050508 Bacteria 754
807 nmdc:mga06r32_7761_c1 3300050510 Bacteria 9647
808 nmdc:mga08y16_1058934_c1 3300050511 Bacteria 788
809 nmdc:mga08y16_15813_c1 3300050511 Bacteria 7934
810 nmdc:mga0n895_766136_c1 3300050512 Bacteria 957
811 Ga0495601_0043523 3300053077 Bacteria 2820
812 Ga0495612_0054492 3300053078 Bacteria 1648
813 Ga0495612_0073145 3300053078 Bacteria 1432
814 Ga0495619_0019537 3300053085 Bacteria 4309
815 Ga0495619_0020298 3300053085 Bacteria 4230
816 Ga0495619_0074621 3300053085 Bacteria 2275
817 Ga0495619_0139768 3300053085 Bacteria 1667
818 Ga0495619_0690602 3300053085 Bacteria 694
819 Ga0500578_0005050 3300053086 Bacteria 9074
820 Ga0500578_0470766 3300053086 Bacteria 712
821 Ga0500643_000240 3300053087 Bacteria 50980
822 Ga0500644_0161353 3300053088 Bacteria 906
823 Ga0500646_0079736 3300053090 Bacteria 997
824 Ga0500641_0026444 3300053096 Bacteria 2253
825 Ga0500654_073692 3300053099 Bacteria 1644
826 Ga0500660_088710 3300053100 Bacteria 1389
827 Ga0500557_168130 3300053105 Bacteria 717
828 Ga0500560_016688 3300053107 Bacteria 2009
829 Ga0500569_002756 3300053109 Bacteria 3500
830 Ga0500572_123780 3300053111 Bacteria 838
831 Ga0500580_058106 3300053113 Bacteria 1616
832 Ga0500614_066811 3300053123 Bacteria 978
833 Ga0500652_001934 3300053131 Bacteria 6239
834 Ga0500655_079212 3300053133 Bacteria 675
835 Ga0500655_090143 3300053133 Bacteria 636
836 Ga0500658_0018734 3300053134 Bacteria 2599
837 Ga0500658_0311224 3300053134 Bacteria 724
838 Ga0500559_0022755 3300053136 Bacteria 2658
839 Ga0500573_0126463 3300053140 Bacteria 1418
840 Ga0500579_102733 3300053143 Bacteria 1481
841 Ga0500600_0139934 3300053149 Bacteria 1219
842 Ga0500616_0080356 3300053153 Bacteria 1639
843 Ga0500630_182419 3300053159 Bacteria 844
844 Ga0500633_0002132 3300053160 Bacteria 3991
845 Ga0500634_0020648 3300053161 Bacteria 3563
846 Ga0500656_000325 3300053732 Bacteria 3371
847 Ga0500587_004066 3300053739 Bacteria 2022
848 Ga0501084_0022367 3300054114 Bacteria 5275
849 Ga0501084_0106770 3300054114 Bacteria 2352
850 Ga0587106_022009 3300059605 Bacteria 955
851 Ga0501082_0010125 3300060353 Bacteria 8117
852 Ga0501082_0011473 3300060353 Bacteria 7625
853 Ga0501082_0108069 3300060353 Bacteria 2407
854 Ga0466962_0001673 3300061719 Bacteria 10405
855 Ga0530510_0024569 3300061734 Bacteria 4301
856 Ga0530510_0258759 3300061734 Bacteria 1297
857 2508672358 2508501039 Bacteria 9978592
858 2515493921 2515154088 Bacteria 5526283
859 2515755297 2515154137 Bacteria 5711575
860 2517760705 2517572101 Bacteria 6884336
861 2528204834 2527291627 Bacteria 5309833
862 2528216272 2527291629 Bacteria 5267418
863 2546950181 2546825537 Bacteria 5389291
864 2547410286 2547132111 Bacteria 8013147
865 2579750780 2576861822 Bacteria 5004595
866 2585298139 2582581312 Bacteria 7308206
867 2585304636 2582581313 Bacteria 10042643
868 2585314747 2582581314 Bacteria 11452267
869 2616698178 2616644814 Bacteria 11555299
870 2616901488 2616644941 Bacteria 8510691
871 2643762048 2643221548 Bacteria 8053412
872 2643946240 2643221587 Bacteria 7586415
873 2644134807 2643221624 Bacteria 4384879
874 2644261973 2643221647 Bacteria 10741251
875 2644388010 2643221670 Bacteria 6497041
876 2644433029 2643221677 Bacteria 7584031
877 2644442825 2643221678 Bacteria 9540101
878 2644444325 2643221679 Bacteria 3839507
879 2644460525 2643221682 Bacteria 6743283
880 2644631320 2643221714 Bacteria 9015452
881 2676198232 2675902999 Bacteria 9438463
882 2686543238 2684623036 Bacteria 5199090
883 2689961103 2687453737 Bacteria 11203906
884 2689990680 2687453743 Bacteria 8361025
885 2710606208 2710264753 Bacteria 5455564
886 2772641678 2772190715 Bacteria 6959372
887 2774842810 2773857921 Bacteria 9435764
888 2774865979 2773857924 Bacteria 5256821
889 2784591630 2784132148 Bacteria 8627943
890 2785340103 2784746763 Bacteria 9783172
891 2785372634 2784746768 Bacteria 10036182
892 2786675349 2786546132 Bacteria 10419719
893 2793983359 2791355406 Bacteria 11364898
894 2795785815 2795385470 Bacteria 8317180
895 2795791466 2795385472 Bacteria 6627535
896 2804848904 2802429296 Bacteria 7227771
897 2808844989 2808606359 Bacteria 9866990
898 2808914588 2808606375 Bacteria 9466072
899 2811843533 2808606982 Bacteria 7791042
900 2812354699 2811994879 Bacteria 9313447
901 2812477668 2811994917 Bacteria 7761064
902 2816426755 2816332119 Bacteria 8120218
903 2819698789 2818991463 Bacteria 7948711
904 2819740053 2818991472 Bacteria 10089953
905 2852636319 2852635781 Bacteria 8251373
906 2855672233 2855670206 Bacteria 7120389
907 2855678872 2855676851 Bacteria 7063653
908 2857295155 2857288857 Bacteria 7189066
909 2858849882 2858848962 Bacteria 6963058
910 2858888542 2858882152 Bacteria 7230291
911 2858890752 2858888857 Bacteria 7060307
912 2858898560 2858895516 Bacteria 7378898
913 2862283412 2862281513 Bacteria 9621493
914 2862390352 2862382967 Bacteria 10317375
915 2862507767 2862507626 Bacteria 9425308
916 2862576441 2862574272 Bacteria 10567477
917 2863409864 2863404153 Bacteria 9672205
918 2866618709 2866612099 Bacteria 7543886
919 2867374649 2867369537 Bacteria 6501581
920 2867432043 2867428634 Bacteria 9590268
921 2867475209 2867475112 Bacteria 6909112
922 2869054262 2869048445 Bacteria 6875584
923 2869065829 2869061728 Bacteria 7112407
924 2869070619 2869068681 Bacteria 7205615
925 2873152940 2873151551 Bacteria 8625867
926 2877678081 2877676314 Bacteria 9512378
927 2880493741 2880489317 Bacteria 7096270
928 2880498583 2880495981 Bacteria 7340502
929 2899360249 2899359706 Bacteria 10940472
930 2912716320 2912715099 Bacteria 9460473
931 2912729232 2912723979 Bacteria 8557534
932 2912763903 2912757875 Bacteria 7940295
933 2918507479 2918501144 Bacteria 8668083
934 2919449458 2919446982 Bacteria 3994487
935 2919471214 2919468124 Bacteria 9133025
936 2929227160 2929226422 Bacteria 7248583
937 2935395380 2935390628 Bacteria 7043367
938 2946070964 2946064051 Bacteria 8957905
939 2946078895 2946072368 Bacteria 8999607
940 2947225759 2947224130 Bacteria 9938529
941 2954009930 2954002825 Bacteria 9173742
942 2954382866 2954380949 Bacteria 10050426
943 2954680024 2954673503 Bacteria 9685905
944 2954684126 2954682443 Bacteria 9862841
945 2954693687 2954691527 Bacteria 10720516
946 2954708783 2954701450 Bacteria 10834262
947 2954713333 2954711539 Bacteria 10867210
948 2954723293 2954721474 Bacteria 10456478
949 2954738535 2954731030 Bacteria 10243860
950 2954742200 2954740390 Bacteria 10229294
951 2954757393 2954749733 Bacteria 10366972
952 2954761178 2954759201 Bacteria 9358192
953 2990061817 2990059506 Bacteria 9321252
954 2990090598 2990088156 Bacteria 6657676
955 2997457426 2997451912 Bacteria 8492419
956 2997603496 2997600082 Bacteria 9896405
957 3006323104 3006321560 Bacteria 8247479
958 3006393740 3006393351 Bacteria 6615579
959 3006427119 3006425503 Bacteria 6491253
960 3006488801 3006486233 Bacteria 8157040
961 637879501 637000116 Bacteria 5433628
962 8002782599 8002775197 Bacteria 10728764
963 8002789199 8002784119 Bacteria 9788632
964 8003320379 8003314358 Bacteria 10575343
965 8003835328 8003830390 Bacteria 6541657
966 8003857196 8003856774 Bacteria 7675274
967 8008563957 8008558824 Bacteria 10610750
968 8008576106 8008574985 Bacteria 7815457
969 8023626171 8023623736 Bacteria 8593882
970 8025417517 8025413630 Bacteria 7014048
971 8047895315 8047893842 Bacteria 11723082
972 8048130608 8048127548 Bacteria 11053136
973 8048363638 8048356638 Bacteria 11044339
974 8048372341 8048369669 Bacteria 11666822
975 8048381275 8048379754 Bacteria 11877923
976 8048407048 8048406513 Bacteria 8936924
977 8054708094 8054704163 Bacteria 7247792
978 8054730983 8054727385 Bacteria 7558670
979 8054735114 8054734606 Bacteria 6947278
980 8054922266 8054920844 Bacteria 7068637
981 8056837021 8056829672 Bacteria 9045328
982 Ga0496113_0076077
983 LJQas_1003442
984 JGI24740J21852_10010152
985 JGI24739J22299_10008021
986 JGI24737J22298_10003773
987 JGI24737J22298_10010845
988 JGI24737J22298_10128881
989 JGI24743J22301_10012921
990 JGI24735J21928_10006190
991 JGI24735J21928_10013771
992 JGI24735J21928_10036761
993 JGI24738J21930_10004387
994 JGI25406J46586_10081202
995 JGI25405J52794_10024615
996 Ga0070658_10001903
997 Ga0070658_10003430
998 Ga0070658_10469184
999 Ga0070658_10856956
1000 Ga0070658_10879796
1001 Ga0068869_100735627
1002 Ga0070666_10050499
1003 Ga0070666_10286717
1004 Ga0070682_100009485
1005 Ga0068868_100522204
1006 Ga0068868_100624625
1007 Ga0070660_100727576
1008 Ga0070661_100109707
1009 Ga0070661_100528573
1010 Ga0070668_100005758
1011 Ga0070668_100052313
1012 Ga0070668_100140815
1013 Ga0070668_100464190
1014 Ga0070674_100476797
1015 Ga0070673_100497000
1016 Ga0070659_100033967
1017 Ga0070659_101234670
1018 Ga0070667_100009689
1019 Ga0070714_100000008
1020 Ga0070714_100349786
1021 Ga0070714_100521929
1022 Ga0070710_10000117
1023 Ga0070711_100103921
1024 Ga0070705_100054686
1025 Ga0070700_100000121
1026 Ga0070708_100053060
1027 Ga0070663_100000606
1028 Ga0070663_100048451
1029 Ga0070678_100092825
1030 Ga0070681_10092548
1031 Ga0070685_10328428
1032 Ga0070707_100204013
1033 Ga0070698_100226555
1034 Ga0070698_101305251
1035 Ga0070679_100116836
1036 Ga0070679_101027013
1037 Ga0070684_100140216
1038 Ga0070684_100361730
1039 Ga0070672_100235596
1040 Ga0070693_100530317
1041 Ga0070665_100001690
1042 Ga0070665_100117052
1043 Ga0070665_100176750
1044 Ga0070665_100201904
1045 Ga0070665_100412145
1046 Ga0068855_100010196
1047 Ga0068855_100641955
1048 Ga0070664_100104298
1049 Ga0070664_100122663
1050 Ga0070664_100147320
1051 Ga0068857_100048370
1052 Ga0068857_100057664
1053 Ga0068857_100153599
1054 Ga0068856_100332629
1055 Ga0068856_100342367
1056 Ga0068856_100982372
1057 Ga0070702_100100009
1058 Ga0068864_100001934
1059 Ga0068864_100187527
1060 Ga0068864_100842607
1061 Ga0068866_10425363
1062 Ga0068870_10606257
1063 Ga0068863_100000263
1064 Ga0068863_100009084
1065 Ga0068863_100086631
1066 Ga0068858_100070317
1067 Ga0068858_100293960
1068 Ga0068858_101966732
1069 Ga0068860_100000067
1070 Ga0081455_10000288
1071 Ga0081455_10046773
1072 Ga0081455_10074700
1073 Ga0081538_10184763
1074 Ga0081539_10000272
1075 Ga0081539_10005536
1076 Ga0070717_10006278
1077 Ga0070717_10657173
1078 Ga0075365_10054381
1079 Ga0075365_10305184
1080 Ga0075368_10008492
1081 Ga0075368_10011215
1082 Ga0075363_100090957
1083 Ga0075363_100138619
1084 Ga0075363_100234805
1085 Ga0075364_10004394
1086 Ga0075364_10181213
1087 Ga0075364_10502633
1088 Ga0070712_100440872
1089 Ga0075367_10033897
1090 Ga0075367_10107967
1091 Ga0075367_10127481
1092 Ga0075370_10024496
1093 Ga0075370_10100865
1094 Ga0075428_100080213
1095 Ga0075431_100001048
1096 Ga0075434_101490802
1097 Ga0075429_100000366
1098 Ga0075429_100583960
1099 Ga0068865_100081493
1100 Ga0099826_10136966
1101 Ga0105240_10008590
1102 Ga0105240_10303218
1103 Ga0105240_10584873
1104 Ga0105240_10749681
1105 Ga0111539_10490986
1106 Ga0111539_11369771
1107 Ga0111539_12266450
1108 Ga0105245_10223712
1109 Ga0105247_10127975
1110 Ga0105247_10174073
1111 Ga0114129_10003185
1112 Ga0114129_10054519
1113 Ga0114129_10163076
1114 Ga0105243_10198160
1115 Ga0105243_11137547
1116 Ga0105241_10004674
1117 Ga0105242_10596379
1118 Ga0105248_10072118
1119 Ga0105237_10230572
1120 Ga0105237_10364185
1121 Ga0105237_12080949
1122 Ga0105238_10007937
1123 Ga0105238_10034037
1124 Ga0105238_10736103
1125 Ga0105238_11132778
1126 Ga0105249_10528119
1127 Ga0105033_117532
1128 Ga0099796_10305370
1129 Ga0105239_10029191
1130 Ga0105246_10185823
1131 Ga0105246_10395488
1132 Ga0157337_1007427
1133 Ga0157343_1002312
1134 Ga0157343_1006218
1135 Ga0157323_1014486
1136 Ga0157345_1010543
1137 Ga0157324_1003090
1138 Ga0157327_1022259
1139 Ga0157326_1013430
1140 Ga0157370_10013984
1141 Ga0157369_10028188
1142 Ga0157369_10723576
1143 Ga0157374_10126129
1144 Ga0157374_10804610
1145 Ga0157374_11051819
1146 Ga0157372_10001175
1147 Ga0157372_10230986
1148 Ga0157375_11241522
1149 Ga0163163_10008500
1150 Ga0163163_10212447
1151 Ga0157380_10016454
1152 Ga0157380_10731815
1153 Ga0157380_11142581
1154 Ga0182008_10006605
1155 Ga0157379_10227745
1156 Ga0157379_11734671
1157 Ga0157376_10436327
1158 Ga0157376_10744551
1159 Ga0157376_11140659
1160 Ga0182006_1015903
1161 Ga0182007_10000483
1162 Ga0182005_1041319
1163 Ga0182005_1254819
1164 Ga0183367_1001
1165 Ga0163161_10112190
1166 Ga0206349_1637531
1167 Ga0206351_10834330
1168 Ga0206353_10310562
1169 Ga0206353_11871755
1170 Ga0213875_10007641
1171 Ga0213875_10009695
1172 Ga0224712_10520508
1173 Ga0207638_1001625
1174 Ga0209758_1007704
1175 Ga0207426_1005200
1176 Ga0207692_10000578
1177 Ga0207688_10061399
1178 Ga0207680_10206766
1179 Ga0207680_10397404
1180 Ga0207647_10002261
1181 Ga0207647_10009502
1182 Ga0207647_10013506
1183 Ga0207647_10171641
1184 Ga0207699_10054371
1185 Ga0207643_10482514
1186 Ga0207705_10193274
1187 Ga0207705_10424816
1188 Ga0207705_10713196
1189 Ga0207654_10002315
1190 Ga0207707_10162677
1191 Ga0207695_10000679
1192 Ga0207695_10027158
1193 Ga0207695_10961098
1194 Ga0207671_10000052
1195 Ga0207671_10279597
1196 Ga0207693_10113510
1197 Ga0207693_10190338
1198 Ga0207657_10481357
1199 Ga0207649_10019001
1200 Ga0207646_10029388
1201 Ga0207681_10359234
1202 Ga0207694_10000079
1203 Ga0207650_10376357
1204 Ga0207687_10212242
1205 Ga0207664_10000002
1206 Ga0207664_10344216
1207 Ga0207664_10739323
1208 Ga0207690_10020873
1209 Ga0207690_10887677
1210 Ga0207709_10622529
1211 Ga0207709_11009895
1212 Ga0207669_10888767
1213 Ga0207704_10397384
1214 Ga0207704_10431180
1215 Ga0207711_10018580
1216 Ga0207711_10853528
1217 Ga0207661_10456292
1218 Ga0207679_10021823
1219 Ga0207679_10055751
1220 Ga0207679_10128576
1221 Ga0207667_10040738
1222 Ga0207668_10007254
1223 Ga0207668_10036803
1224 Ga0207668_10108573
1225 Ga0207668_10386134
1226 Ga0207640_10009569
1227 Ga0207658_10003074
1228 Ga0207658_10120953
1229 Ga0207677_10781212
1230 Ga0207703_10013650
1231 Ga0207703_10093621
1232 Ga0207703_10170547
1233 Ga0207639_10056875
1234 Ga0207639_10909568
1235 Ga0207678_10000377
1236 Ga0207678_10072035
1237 Ga0207678_10426378
1238 Ga0207678_10488790
1239 Ga0207678_11287548
1240 Ga0207708_10000151
1241 Ga0207708_10028752
1242 Ga0207708_10490027
1243 Ga0207702_10769731
1244 Ga0207641_10002388
1245 Ga0207641_10321223
1246 Ga0207641_10442044
1247 Ga0207641_10648024
1248 Ga0207648_11343906
1249 Ga0207676_10020103
1250 Ga0207676_10422076
1251 Ga0207676_10508133
1252 Ga0207674_10019724
1253 Ga0207674_10022613
1254 Ga0207674_10023457
1255 Ga0207674_10029539
1256 Ga0207674_11004474
1257 Ga0207683_10044339
1258 Ga0207683_10083312
1259 Ga0207698_12147223
1260 Ga0209813_10002493
1261 Ga0268266_10006214
1262 Ga0268266_10108526
1263 Ga0268266_10348450
1264 Ga0268266_10833362
1265 Ga0268264_10000114
1266 Ga0268264_10118000
1267 Ga0268264_10470013
1268 Ga0268264_10659134
1269 Ga0307517_10000344
1270 Ga0307515_10191646
1271 Ga0307511_10254637
1272 Ga0307512_10143546
1273 Ga0316177_1080666
1274 Ga0316177_1109865
1275 Ga0316176_1208571
1276 Ga0314311_1209569
1277 Ga0316180_1109531
1278 Ga0265763_1001149
1279 Ga0265776_100008
1280 Ga0265764_100082
1281 Ga0265761_102098
1282 Ga0265779_100363
1283 Ga0265760_10045194
1284 Ga0265327_10000860
1285 Ga0307513_10020394
1286 Ga0307513_10194317
1287 Ga0307509_10086897
1288 Ga0307509_10239808
1289 Ga0307408_100062168
1290 Ga0307508_10003092
1291 Ga0307508_10018606
1292 Ga0307508_10365528
1293 Ga0307514_10010722
1294 Ga0316575_10003414
1295 Ga0316576_10000192
1296 Ga0316576_10000810
1297 Ga0316576_10005181
1298 Ga0316578_10019903
1299 Ga0316578_10080862
1300 Ga0307516_10071167
1301 Ga0307516_10336249
1302 Ga0307405_10060036
1303 Ga0316577_10014148
1304 Ga0307413_10011054
1305 Ga0307413_10237044
1306 Ga0307413_10525664
1307 Ga0307410_10608165
1308 Ga0307406_10005687
1309 Ga0307406_10817464
1310 Ga0307412_10048637
1311 Ga0307409_100000369
1312 Ga0307409_100131796
1313 Ga0307409_100221007
1314 Ga0307416_100102206
1315 Ga0307416_100294959
1316 Ga0307416_101147265
1317 Ga0307416_101534100
1318 Ga0307414_10499333
1319 Ga0307411_11045517
1320 Ga0307415_100000012
1321 Ga0307415_100829767
1322 Ga0316583_10003969
1323 Ga0316585_10001740
1324 Ga0307507_10018043
1325 Ga0307507_10140570
1326 Ga0307507_10333475
1327 Ga0307510_10156276
1328 Ga0307510_10216760
1329 Ga0316592_1009125
1330 Ga0316586_1005666
1331 Ga0316588_1007943
1332 Ga0316596_1015067
1333 Ga0373934_0006812
1334 Ga0373934_0021608
1335 Ga0373957_0008923
1336 Ga0373955_0031714
1337 Ga0373942_0281096
1338 Ga0316574_0000472
1339 Ga0316574_0009351
1340 Ga0373931_0148164
1341 Ga0373935_0338566
1342 Ga0373933_0003631
1343 Ga0373937_0089250
1344 Ga0373937_0222916
1345 Ga0373937_0513332
1346 Ga0265778_000478
1347 Ga0316582_0093320
1348 Ga0316584_0004515
1349 Ga0316584_0010614
1350 Ga0373925_0000869
1351 Ga0395899_0326103
1352 Ga0395900_0125534
1353 Ga0395900_0416786
1354 Ga0395900_0913801
1355 Ga0395900_1408896
1356 Ga0395898_0008038
1357 Ga0395898_0030406
1358 Ga0395898_0086423
1359 Ga0395898_0184225
1360 Ga0395898_0795284
1361 Ga0316581_0000925
1362 Ga0436364_0119540
1363 Ga0436364_0930558
1364 Ga0395901_0018191
1365 Ga0395901_0027684
1366 Ga0395901_0037243
1367 Ga0395901_0494822
1368 Ga0395901_1506621
1369 Ga0436365_1649406
1370 Ga0436360_0486273
1371 Ga0436363_1020776
1372 Ga0439466_0033405
1373 Ga0439465_0067368
1374 Ga0451807_0935894
1375 Ga0451849_0098137
1376 Ga0451849_1001175
1377 Ga0451851_0854016
1378 Ga0439433_0003699
1379 Ga0439457_000906
1380 Ga0439457_005004
1381 Ga0450894_000084
1382 Ga0450898_015870
1383 Ga0450899_002814
1384 Ga0450900_044335
1385 Ga0450903_009793
1386 Ga0450906_010238
1387 Ga0439458_0000260
1388 Ga0450908_010771
1389 Ga0439459_0090639
1390 Ga0466969_0005190
1391 Ga0466969_0173428
1392 Ga0466972_0003135
1393 Ga0466972_0009521
1394 Ga0466972_0024819
1395 Ga0466965_0004182
1396 Ga0466965_0005029
1397 Ga0466965_0007395
1398 Ga0466966_0022938
1399 Ga0466966_0041941
1400 Ga0466966_0343754
1401 Ga0466961_0006030
1402 Ga0466961_0052929
1403 Ga0466961_0061886
1404 Ga0466961_0154777
1405 Ga0466961_0549002
1406 Ga0466963_0001025
1407 Ga0466963_0035665
1408 Ga0466963_0526925
1409 Ga0466964_0005930
1410 Ga0466964_0019842
1411 Ga0466971_0000360
1412 Ga0466971_0024293
1413 Ga0466971_0286415
1414 Ga0466968_0012734
1415 Ga0466968_0063723
1416 Ga0466968_0139410
1417 Ga0466968_0380636
1418 Ga0466970_0008236
1419 Ga0466970_0015973
1420 Ga0466970_0066631
1421 Ga0466970_0092029
1422 Ga0466970_0160621
1423 Ga0466957_0000665
1424 Ga0466957_0324761
1425 Ga0466960_0003337
1426 Ga0466960_0013260
1427 Ga0466960_0052143
1428 Ga0466960_0166004
1429 Ga0466960_0218914
1430 Ga0466960_0224695
1431 Ga0466959_0004284
1432 Ga0466959_0030100
1433 Ga0466959_0098411
1434 Ga0466958_0002860
1435 Ga0466958_0294111
1436 Ga0466958_0494806
1437 Ga0466967_0011268
1438 Ga0466967_0103064
1439 Ga0466967_0172364
1440 Ga0466967_0409292
1441 Ga0466967_0922060
1442 Ga0466967_1667178
1443 Ga0495627_078019
1444 Ga0495592_0126290
1445 Ga0495592_0208048
1446 Ga0495603_0177179
1447 Ga0495629_0067016
1448 Ga0495629_0085592
1449 Ga0495629_0452977
1450 Ga0495638_0171807
1451 Ga0495641_0174997
1452 Ga0495651_0007219
1453 Ga0495651_0011746
1454 Ga0495651_0015709
1455 Ga0495651_0052728
1456 Ga0495653_0016927
1457 Ga0495653_0042553
1458 Ga0495662_0373927
1459 Ga0495664_0033230
1460 Ga0495585_0054794
1461 Ga0495585_0209731
1462 Ga0495594_0002125
1463 Ga0495594_0192948
1464 Ga0495607_0105493
1465 Ga0495608_0005268
1466 Ga0495618_0011168
1467 Ga0495618_0022588
1468 Ga0495628_0011365
1469 Ga0495628_0015282
1470 Ga0495628_0026709
1471 Ga0495628_0328819
1472 Ga0495628_0468267
1473 Ga0495637_0061728
1474 Ga0495643_0010091
1475 Ga0495652_0000972
1476 Ga0495652_0010502
1477 Ga0495652_0022800
1478 Ga0495652_0036616
1479 Ga0495652_0318978
1480 Ga0495665_0296197
1481 Ga0495640_0002880
1482 Ga0495640_0003531
1483 Ga0495587_0009578
1484 Ga0495587_0310905
1485 Ga0495587_0384528
1486 Ga0495645_0063399
1487 Ga0495622_0033622
1488 Ga0495667_0006353
1489 Ga0495667_0015057
1490 Ga0495667_0016726
1491 Ga0495667_0287032
1492 Ga0495634_0008990
1493 Ga0495634_0012007
1494 Ga0495634_0618800
1495 Ga0495611_0276779
1496 Ga0495635_0001652
1497 Ga0495635_0006862
1498 Ga0495657_0000195
1499 Ga0495657_0006270
1500 Ga0495657_0023829
1501 Ga0495657_0506467
1502 Ga0495599_0007812
1503 Ga0495623_0121724
1504 Ga0495646_0074976
1505 Ga0495646_0161315
1506 Ga0495658_0080350
1507 Ga0495669_0022866
1508 Ga0495613_0000948
1509 Ga0495613_0218130
1510 Ga0495670_0010405
1511 Ga0495670_0527501
1512 Ga0495589_0106916
1513 Ga0495600_0004775
1514 Ga0495600_0014301
1515 Ga0495600_0024758
1516 Ga0495600_0037550
1517 Ga0495660_0423688
1518 Ga0495581_0013742
1519 Ga0495581_0089906
1520 Ga0495581_0245187
1521 Ga0495604_0003276
1522 Ga0495604_0023521
1523 Ga0495604_0074499
1524 Ga0495604_0193110
1525 Ga0495674_0009916
1526 Ga0495674_0567912
1527 Ga0495676_0000578
1528 Ga0495680_0017250
1529 Ga0495680_0373891
1530 Ga0495687_027920
1531 Ga0495687_108571
1532 Ga0495675_0011016
1533 Ga0495675_0050379
1534 Ga0495675_0093623
1535 Ga0495675_0132591
1536 Ga0495685_005388
1537 Ga0495685_083233
1538 Ga0495681_0015121
1539 Ga0495684_0009203
1540 Ga0495684_0120573
1541 Ga0495686_0094985
1542 Ga0495593_0174851
1543 Ga0495602_0045490
1544 Ga0495614_0150421
1545 Ga0495626_0258988
1546 Ga0496100_0150425
1547 Ga0496100_0172023
1548 Ga0496100_0764628
1549 Ga0496101_0064165
1550 Ga0496101_0621349
1551 Ga0496102_0001582
1552 Ga0496102_0001756
1553 Ga0496102_0357723
1554 Ga0496102_0754548
1555 Ga0496102_0769408
1556 Ga0496102_1727347
1557 Ga0496103_0010531
1558 Ga0496103_0045308
1559 Ga0496103_0155275
1560 Ga0496103_0831406
1561 Ga0496104_0002885
1562 Ga0496104_0194856
1563 Ga0496104_0285490
1564 Ga0496104_0609995
1565 Ga0496104_0702797
1566 Ga0496104_0829805
1567 Ga0496105_0007482
1568 Ga0496105_0020454
1569 Ga0496105_0092676
1570 Ga0496106_0220829
1571 Ga0496106_0238191
1572 Ga0496107_0046753
1573 Ga0496108_0007960
1574 Ga0496108_0054645
1575 Ga0496108_0095519
1576 Ga0496108_0115693
1577 Ga0496109_0015006
1578 Ga0496109_0029176
1579 Ga0496109_0130133
1580 Ga0496109_1039244
1581 Ga0496109_1094345
1582 Ga0496110_0005721
1583 Ga0496110_0043840
1584 Ga0496110_0068614
1585 Ga0496110_0085747
1586 Ga0496110_0201320
1587 Ga0496110_0223326
1588 Ga0496111_0014112
1589 Ga0496111_0030311
1590 Ga0496111_0039685
1591 Ga0496111_0207316
1592 Ga0496112_0036181
1593 Ga0496112_0810293
1594 Ga0496113_0055243
1595 Ga0496113_0117867
1596 Ga0496113_0237546
1597 Ga0496114_0003472
1598 Ga0496114_0032735
1599 Ga0496114_0036171
1600 Ga0496114_0092164
1601 Ga0496114_0101850
1602 Ga0496114_0137808
1603 Ga0496114_0317386
1604 Ga0496114_0563480
1605 Ga0496115_0022662
1606 Ga0496115_0371401
1607 Ga0496124_0129777
1608 Ga0496126_0469609
1609 Ga0501031_0017952
1610 Ga0501031_0020167
1611 Ga0501031_0048889
1612 Ga0501031_0168199
1613 Ga0501031_0238575
1614 Ga0501031_0279498
1615 Ga0501031_0477362
1616 Ga0501032_0008234
1617 Ga0501032_0017889
1618 Ga0501032_0062566
1619 Ga0501032_0258897
1620 Ga0501032_0336492
1621 Ga0501032_0338104
1622 Ga0501032_0383132
1623 Ga0501032_0604468
1624 Ga0501033_0002605
1625 Ga0501033_0009265
1626 Ga0501033_0020024
1627 Ga0501033_0029149
1628 Ga0501033_0048391
1629 Ga0501033_0156437
1630 Ga0501033_0242545
1631 Ga0501034_0003777
1632 Ga0501034_0022734
1633 Ga0501034_0038161
1634 Ga0501034_0046104
1635 Ga0501034_0103107
1636 Ga0501036_0011970
1637 Ga0501036_0018297
1638 Ga0501036_0038885
1639 Ga0501036_0051220
1640 Ga0501036_0138820
1641 Ga0501036_0166757
1642 Ga0501036_0567429
1643 Ga0501036_0608017
1644 Ga0501036_0998085
1645 Ga0501037_0004560
1646 Ga0501037_0011090
1647 Ga0501037_0023056
1648 Ga0501037_0031773
1649 Ga0501037_0049741
1650 Ga0501037_0278924
1651 Ga0501038_0002308
1652 Ga0501038_0014193
1653 Ga0501038_0050590
1654 Ga0501038_0056214
1655 Ga0501038_0148514
1656 Ga0501038_0160218
1657 Ga0501038_0421736
1658 Ga0501039_0018932
1659 Ga0501039_0035127
1660 Ga0501039_0051535
1661 Ga0501039_0165667
1662 Ga0501039_0529537
1663 Ga0501039_0571038
1664 Ga0501040_0001190
1665 Ga0501040_0047549
1666 Ga0501040_0320087
1667 Ga0501040_0663884
1668 Ga0501041_0001720
1669 Ga0501041_0001863
1670 Ga0501041_0014514
1671 Ga0501042_0000472
1672 Ga0501042_0016631
1673 Ga0501042_0031191
1674 Ga0501042_0186687
1675 Ga0501043_0035662
1676 Ga0501043_0049063
1677 Ga0501043_0106379
1678 Ga0501043_0164832
1679 Ga0501043_0263912
1680 Ga0501043_0411605
1681 Ga0501046_0006667
1682 Ga0501046_0015151
1683 Ga0501046_0137271
1684 Ga0501046_0352761
1685 Ga0501046_0726874
1686 Ga0501047_0000023
1687 Ga0501047_0005683
1688 Ga0501047_0009572
1689 Ga0501047_0021299
1690 Ga0501047_0040398
1691 Ga0501047_0283006
1692 Ga0501047_0352768
1693 Ga0501048_0009146
1694 Ga0501048_0009974
1695 Ga0501048_0011797
1696 Ga0501048_0051426
1697 Ga0501048_0087054
1698 Ga0501067_0006012
1699 Ga0501067_0085045
1700 Ga0501067_0381987
1701 Ga0501068_0002329
1702 Ga0501068_0164213
1703 Ga0501068_0208028
1704 Ga0501069_0009227
1705 Ga0501069_0219326
1706 Ga0501070_0000628
1707 Ga0501070_0018431
1708 Ga0501070_0074784
1709 Ga0501070_0564086
1710 Ga0501070_0895690
1711 Ga0501071_0003479
1712 Ga0501071_0007491
1713 Ga0501071_0106773
1714 Ga0501072_0011963
1715 Ga0501072_0027613
1716 Ga0501072_0029303
1717 Ga0501072_0060532
1718 Ga0501072_0098777
1719 Ga0501073_0012824
1720 Ga0501073_0114686
1721 Ga0501074_0068948
1722 Ga0501074_0128428
1723 Ga0501074_0169718
1724 Ga0501074_0252188
1725 Ga0501074_0297420
1726 Ga0501075_0087914
1727 Ga0501075_0235169
1728 Ga0501075_1293197
1729 Ga0501076_0012589
1730 Ga0501076_0014136
1731 Ga0501076_0022279
1732 Ga0501077_0006448
1733 Ga0501251_018267
1734 Ga0501255_034719
1735 Ga0501221_129668
1736 Ga0501079_0007791
1737 Ga0501079_0016024
1738 Ga0501079_0091238
1739 Ga0501079_0552767
1740 Ga0501080_0022335
1741 Ga0501080_0036896
1742 Ga0501080_0039448
1743 Ga0501080_0133479
1744 Ga0501080_0194594
1745 Ga0501081_0051596
1746 Ga0501081_0089261
1747 Ga0501083_0001532
1748 Ga0501083_0167387
1749 Ga0501276_010684
1750 Ga0501035_0010362
1751 Ga0501035_0012451
1752 Ga0501035_0035774
1753 Ga0501035_0042881
1754 Ga0501035_0073515
1755 Ga0501035_0109331
1756 Ga0501035_0218608
1757 Ga0501044_0004956
1758 Ga0501044_0011856
1759 Ga0501044_0015121
1760 Ga0501044_0049683
1761 Ga0501044_0125389
1762 Ga0501044_0138258
1763 Ga0501044_0274487
1764 Ga0501044_0301307
1765 Ga0501044_0423905
1766 Ga0501044_0669804
1767 Ga0501045_0008667
1768 Ga0501045_0017200
1769 Ga0501045_0019369
1770 Ga0501045_0027452
1771 Ga0501045_0104575
1772 Ga0501045_0151400
1773 Ga0501045_0441791
1774 nmdc:mga00v17_86820_c1
1775 nmdc:mga0yw44_104661_c1
1776 nmdc:mga0yw44_117488_c1
1777 nmdc:mga0yw44_37973_c1
1778 nmdc:mga06z11_3612_c1
1779 nmdc:mga06z11_36604_c1
1780 nmdc:mga04h51_3526_c1
1781 nmdc:mga04h51_60170_c1
1782 nmdc:mga07m45_44368_c1
1783 nmdc:mga07m45_82148_c1
1784 nmdc:mga05p37_245018_c1
1785 nmdc:mga05p37_408130_c1
1786 nmdc:mga09592_234852_c1
1787 nmdc:mga09592_879049_c1
1788 nmdc:mga06r32_7761_c1
1789 nmdc:mga08y16_1058934_c1
1790 nmdc:mga08y16_15813_c1
1791 nmdc:mga0n895_766136_c1
1792 Ga0495601_0043523
1793 Ga0495612_0054492
1794 Ga0495612_0073145
1795 Ga0495619_0019537
1796 Ga0495619_0020298
1797 Ga0495619_0074621
1798 Ga0495619_0139768
1799 Ga0495619_0690602
1800 Ga0500578_0005050
1801 Ga0500578_0470766
1802 Ga0500643_000240
1803 Ga0500644_0161353
1804 Ga0500646_0079736
1805 Ga0500641_0026444
1806 Ga0500654_073692
1807 Ga0500660_088710
1808 Ga0500557_168130
1809 Ga0500560_016688
1810 Ga0500569_002756
1811 Ga0500572_123780
1812 Ga0500580_058106
1813 Ga0500614_066811
1814 Ga0500652_001934
1815 Ga0500655_079212
1816 Ga0500655_090143
1817 Ga0500658_0018734
1818 Ga0500658_0311224
1819 Ga0500559_0022755
1820 Ga0500573_0126463
1821 Ga0500579_102733
1822 Ga0500600_0139934
1823 Ga0500616_0080356
1824 Ga0500630_182419
1825 Ga0500633_0002132
1826 Ga0500634_0020648
1827 Ga0500656_000325
1828 Ga0500587_004066
1829 Ga0501084_0022367
1830 Ga0501084_0106770
1831 Ga0587106_022009
1832 Ga0501082_0010125
1833 Ga0501082_0011473
1834 Ga0501082_0108069
1835 Ga0466962_0001673
1836 Ga0530510_0024569
1837 Ga0530510_0258759
1838 2508672358
1839 2515493921
1840 2515755297
1841 2517760705
1842 2528204834
1843 2528216272
1844 2546950181
1845 2547410286
1846 2579750780
1847 2585298139
1848 2585304636
1849 2585314747
1850 2616698178
1851 2616901488
1852 2643762048
1853 2643946240
1854 2644134807
1855 2644261973
1856 2644388010
1857 2644433029
1858 2644442825
1859 2644444325
1860 2644460525
1861 2644631320
1862 2676198232
1863 2686543238
1864 2689961103
1865 2689990680
1866 2710606208
1867 2772641678
1868 2774842810
1869 2774865979
1870 2784591630
1871 2785340103
1872 2785372634
1873 2786675349
1874 2793983359
1875 2795785815
1876 2795791466
1877 2804848904
1878 2808844989
1879 2808914588
1880 2811843533
1881 2812354699
1882 2812477668
1883 2816426755
1884 2819698789
1885 2819740053
1886 2852636319
1887 2855672233
1888 2855678872
1889 2857295155
1890 2858849882
1891 2858888542
1892 2858890752
1893 2858898560
1894 2862283412
1895 2862390352
1896 2862507767
1897 2862576441
1898 2863409864
1899 2866618709
1900 2867374649
1901 2867432043
1902 2867475209
1903 2869054262
1904 2869065829
1905 2869070619
1906 2873152940
1907 2877678081
1908 2880493741
1909 2880498583
1910 2899360249
1911 2912716320
1912 2912729232
1913 2912763903
1914 2918507479
1915 2919449458
1916 2919471214
1917 2929227160
1918 2935395380
1919 2946070964
1920 2946078895
1921 2947225759
1922 2954009930
1923 2954382866
1924 2954680024
1925 2954684126
1926 2954693687
1927 2954708783
1928 2954713333
1929 2954723293
1930 2954738535
1931 2954742200
1932 2954757393
1933 2954761178
1934 2990061817
1935 2990090598
1936 2997457426
1937 2997603496
1938 3006323104
1939 3006393740
1940 3006427119
1941 3006488801
1942 637879501
1943 8002782599
1944 8002789199
1945 8003320379
1946 8003835328
1947 8003857196
1948 8008563957
1949 8008576106
1950 8023626171
1951 8025417517
1952 8047895315
1953 8048130608
1954 8048363638
1955 8048372341
1956 8048381275
1957 8048407048
1958 8054708094
1959 8054730983
1960 8054735114
1961 8054922266
1962 8056837021

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19315

MC_hydratase

Mesaconyl-CoA hydratase

26

200

0.92

PF01575

MaoC_dehydratas

MaoC like domain

44

165

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4e3e-assembly1.cif.gz_A crystal structure of putative maoc domain protein dehydratase from chloroflexus aurantiacus j-10-fl 0.9278 5 148
8hgn-assembly1.cif.gz_A crystal structure of meac (mesaconyl-coa hydratase) 0.9249 5 149
5cpg-assembly1.cif.gz_B r-hydratase phaj1 from pseudomonas aeruginosa in the unliganded form 0.9164 6 148
4ffu-assembly2.cif.gz_K crystal structure of putative maoc-like (monoamine oxidase-like) protein, similar to nodn from sinorhizo bium meliloti 1021 0.8975 4 146
7q1v-assembly1.cif.gz_D arches protomer (trimer of trwg/virb8peri) structure from the fully-assembled r388 type iv secretion system determined by cryo-em. 0.883 102 147
ID Description Score Start End Superfamily
af_I6Y9H2_24_180_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9567 1 149 3.10.129.10
af_A0A2R8QPM6_23_166_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9341 10 147 3.10.129.10
5cpgB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9164 6 148 3.10.129.10
af_I6Y9H2_24_180_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9035 1 149 3.10.129.10
1z54D00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8989 83 145 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A7C1UID5-F1-model_v4 MaoC family dehydratase 0.9941 3 140
AF-A0A841BQG0-F1-model_v4 Acyl dehydratase 0.9898 1 149 GO:0016829
AF-W9H5Q8-F1-model_v4 MaoC family dehydratase 0.9887 3 151
AF-A0A7U3E4M0-F1-model_v4 deleted 0.9883 3 149
AF-A0A2X3KSH4-F1-model_v4 deleted 0.9882 1 149

Map