F487409
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 981 | 378 | 1962 | 408 |
Family's Representative Sequence
| Representative Sequence | 3300053119|Ga0500595_005256|Ga0500595_005256_4288_5517 |
| Length | 409 |
| Sequence | MPEASPKSLPNSFRSGPDERGHFGIFGGRFVAETLMPLILDLEKAYADAKADPAFQAEMNGHLKDYVGRPSPLYFAERLTEHLRGAKIYFKREELNHTGSHKVNNVLGQIMVARRMGKKRIIAETGAGQHGVATATLCARFGLDCVVYMGAVDVERQQPNVIRMEMLGATVIPVQSGSRTLKDAMNEALRDWVTNVHNTFYCIGTVAGPHPYPMMVRDFQSIIGTETRAQMQQAEGRLPDSLIACIGGGSNAMGLFHPFLDDPSIEIFGVEAAGHGLTQLHAASIAGGRPGVLHGNRTYLLMDDDGQIQDAHSISAGLDYPGIGPEHSWLHETGRVTYLSATDDEALAAFQLLSRLEGIIPALEPAHAIAKVLELAPKRPSDHLMVVNLSGRGDKDVPQVGDILRGRKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 75 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 121 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 122 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 187 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 190 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 191 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 192 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 193 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 194 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 195 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 196 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 198 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 199 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 200 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 201 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 202 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 204 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 207 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 209 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 210 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 212 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 213 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 214 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 215 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 217 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 218 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 221 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 222 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 223 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 225 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 227 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 228 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 229 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 230 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 231 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 232 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 233 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 234 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 235 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 236 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 237 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 238 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 239 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 240 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 241 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 242 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 243 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 311 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 312 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 313 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 314 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 315 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 316 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 319 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 320 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 321 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 322 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 323 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 324 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 325 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 351 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 352 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 353 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 354 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 369 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 370 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 371 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 372 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 373 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 374 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 375 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 376 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 378 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.9 |
| Metatranscriptomes | 0 |
| Isolates | 0.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.75 |
| Nodule | 0 |
| Rhizoplane | 10.19 |
| Rhizosphere | 86.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500595_005256 | 3300053119 | Bacteria | 5673 |
| 2 | JGI24743J22301_10000156 | 3300001991 | Bacteria | 7073 |
| 3 | JGI24735J21928_10032367 | 3300002067 | Bacteria | 1548 |
| 4 | JGI24745J21846_1004712 | 3300002073 | Bacteria | 1468 |
| 5 | JGI24034J26672_10007496 | 3300002239 | Bacteria | 1585 |
| 6 | JGI25153J46596_10004094 | 3300003215 | Bacteria | 7927 |
| 7 | Ga0065712_10016690 | 3300005290 | Bacteria | 2630 |
| 8 | Ga0070658_10012382 | 3300005327 | Bacteria | 6847 |
| 9 | Ga0070676_10051884 | 3300005328 | Bacteria | 2409 |
| 10 | Ga0070676_10163196 | 3300005328 | Bacteria | 1436 |
| 11 | Ga0070683_100006896 | 3300005329 | Bacteria | 9546 |
| 12 | Ga0070690_100000558 | 3300005330 | Bacteria | 18638 |
| 13 | Ga0070670_100000979 | 3300005331 | Bacteria | 22379 |
| 14 | Ga0070670_100001578 | 3300005331 | Bacteria | 18373 |
| 15 | Ga0070666_10006074 | 3300005335 | Bacteria | 7421 |
| 16 | Ga0070666_10008718 | 3300005335 | Bacteria | 6304 |
| 17 | Ga0070680_100158541 | 3300005336 | Bacteria | 1901 |
| 18 | Ga0070682_100038875 | 3300005337 | Bacteria | 2921 |
| 19 | Ga0070682_100117653 | 3300005337 | Bacteria | 1779 |
| 20 | Ga0070682_100136163 | 3300005337 | Bacteria | 1669 |
| 21 | Ga0070660_100001799 | 3300005339 | Bacteria | 14720 |
| 22 | Ga0070689_100002716 | 3300005340 | Bacteria | 11589 |
| 23 | Ga0070689_100010006 | 3300005340 | Bacteria | 6750 |
| 24 | Ga0070691_10000644 | 3300005341 | Bacteria | 13491 |
| 25 | Ga0070687_100014882 | 3300005343 | Bacteria | 3505 |
| 26 | Ga0070661_100001359 | 3300005344 | Bacteria | 17081 |
| 27 | Ga0070661_100071509 | 3300005344 | Bacteria | 2553 |
| 28 | Ga0070668_100001182 | 3300005347 | Bacteria | 18485 |
| 29 | Ga0070669_100003948 | 3300005353 | Bacteria | 10727 |
| 30 | Ga0070675_100024608 | 3300005354 | Bacteria | 4821 |
| 31 | Ga0070675_100044142 | 3300005354 | Bacteria | 3645 |
| 32 | Ga0070671_100001927 | 3300005355 | Bacteria | 15904 |
| 33 | Ga0070671_100011878 | 3300005355 | Bacteria | 7004 |
| 34 | Ga0070674_100000058 | 3300005356 | Bacteria | 49318 |
| 35 | Ga0070674_100005637 | 3300005356 | Bacteria | 7253 |
| 36 | Ga0070688_100000218 | 3300005365 | Bacteria | 30297 |
| 37 | Ga0070688_100018942 | 3300005365 | Bacteria | 3981 |
| 38 | Ga0070688_100048906 | 3300005365 | Bacteria | 2629 |
| 39 | Ga0070688_100077238 | 3300005365 | Bacteria | 2145 |
| 40 | Ga0070659_100002352 | 3300005366 | Bacteria | 13444 |
| 41 | Ga0070659_100113535 | 3300005366 | Bacteria | 2188 |
| 42 | Ga0070667_100002856 | 3300005367 | Bacteria | 14907 |
| 43 | Ga0070667_100057389 | 3300005367 | Bacteria | 3291 |
| 44 | Ga0070667_100143116 | 3300005367 | Bacteria | 2095 |
| 45 | Ga0070667_100296619 | 3300005367 | Bacteria | 1455 |
| 46 | Ga0070703_10012982 | 3300005406 | Bacteria | 2361 |
| 47 | Ga0070709_10006392 | 3300005434 | Bacteria | 6417 |
| 48 | Ga0070709_10013483 | 3300005434 | Bacteria | 4598 |
| 49 | Ga0070714_100018528 | 3300005435 | Bacteria | 5657 |
| 50 | Ga0070714_100039575 | 3300005435 | Bacteria | 3970 |
| 51 | Ga0070714_100118279 | 3300005435 | Bacteria | 2354 |
| 52 | Ga0070713_100010106 | 3300005436 | Bacteria | 6807 |
| 53 | Ga0070713_100147820 | 3300005436 | Bacteria | 2087 |
| 54 | Ga0070710_10005197 | 3300005437 | Bacteria | 6170 |
| 55 | Ga0070710_10025798 | 3300005437 | Bacteria | 3115 |
| 56 | Ga0070710_10041928 | 3300005437 | Bacteria | 2528 |
| 57 | Ga0070710_10053732 | 3300005437 | Bacteria | 2270 |
| 58 | Ga0070701_10000167 | 3300005438 | Bacteria | 20346 |
| 59 | Ga0070701_10062845 | 3300005438 | Bacteria | 1963 |
| 60 | Ga0070711_100000323 | 3300005439 | Bacteria | 24724 |
| 61 | Ga0070711_100070532 | 3300005439 | Bacteria | 2461 |
| 62 | Ga0070705_100000244 | 3300005440 | Bacteria | 32380 |
| 63 | Ga0070705_100060600 | 3300005440 | Bacteria | 2245 |
| 64 | Ga0070700_100001251 | 3300005441 | Bacteria | 12596 |
| 65 | Ga0070663_100001197 | 3300005455 | Bacteria | 14267 |
| 66 | Ga0070663_100042340 | 3300005455 | Bacteria | 3199 |
| 67 | Ga0070678_100001828 | 3300005456 | Bacteria | 11474 |
| 68 | Ga0070678_100045621 | 3300005456 | Bacteria | 3137 |
| 69 | Ga0070678_100051537 | 3300005456 | Bacteria | 2984 |
| 70 | Ga0070678_100088435 | 3300005456 | Bacteria | 2368 |
| 71 | Ga0070662_100006177 | 3300005457 | Bacteria | 7707 |
| 72 | Ga0070662_100042122 | 3300005457 | Bacteria | 3261 |
| 73 | Ga0068867_100006046 | 3300005459 | Bacteria | 8577 |
| 74 | Ga0070685_10011559 | 3300005466 | Bacteria | 4622 |
| 75 | Ga0070707_100125559 | 3300005468 | Bacteria | 2493 |
| 76 | Ga0070699_100088261 | 3300005518 | Bacteria | 2708 |
| 77 | Ga0070679_100019429 | 3300005530 | Bacteria | 6607 |
| 78 | Ga0070679_100134556 | 3300005530 | Bacteria | 2453 |
| 79 | Ga0070679_100135343 | 3300005530 | Bacteria | 2445 |
| 80 | Ga0070697_100047277 | 3300005536 | Bacteria | 3489 |
| 81 | Ga0068853_100002111 | 3300005539 | Bacteria | 14755 |
| 82 | Ga0070672_100000706 | 3300005543 | Bacteria | 19740 |
| 83 | Ga0070672_100068468 | 3300005543 | Bacteria | 2815 |
| 84 | Ga0070672_100133581 | 3300005543 | Bacteria | 2042 |
| 85 | Ga0070686_100001736 | 3300005544 | Bacteria | 12183 |
| 86 | Ga0070686_100010032 | 3300005544 | Bacteria | 5332 |
| 87 | Ga0070686_100240633 | 3300005544 | Bacteria | 1317 |
| 88 | Ga0070695_100000525 | 3300005545 | Bacteria | 20229 |
| 89 | Ga0070695_100030231 | 3300005545 | Bacteria | 3371 |
| 90 | Ga0070695_100076682 | 3300005545 | Bacteria | 2202 |
| 91 | Ga0070696_100064756 | 3300005546 | Bacteria | 2562 |
| 92 | Ga0070693_100001001 | 3300005547 | Bacteria | 12595 |
| 93 | Ga0070665_100005010 | 3300005548 | Bacteria | 13738 |
| 94 | Ga0070665_100164150 | 3300005548 | Bacteria | 2224 |
| 95 | Ga0070704_100002514 | 3300005549 | Bacteria | 10315 |
| 96 | Ga0068855_100009765 | 3300005563 | Bacteria | 11578 |
| 97 | Ga0068855_100045320 | 3300005563 | Bacteria | 5201 |
| 98 | Ga0068855_100108655 | 3300005563 | Bacteria | 3185 |
| 99 | Ga0070664_100002019 | 3300005564 | Bacteria | 16269 |
| 100 | Ga0070664_100102159 | 3300005564 | Bacteria | 2494 |
| 101 | Ga0070664_100270193 | 3300005564 | Bacteria | 1531 |
| 102 | Ga0068857_100002505 | 3300005577 | Bacteria | 15026 |
| 103 | Ga0068856_100001461 | 3300005614 | Bacteria | 24755 |
| 104 | Ga0070702_100000160 | 3300005615 | Bacteria | 21352 |
| 105 | Ga0068852_100011281 | 3300005616 | Bacteria | 6720 |
| 106 | Ga0068859_100009742 | 3300005617 | Bacteria | 9703 |
| 107 | Ga0068859_100017077 | 3300005617 | Bacteria | 7286 |
| 108 | Ga0068859_100211451 | 3300005617 | Bacteria | 2026 |
| 109 | Ga0068864_100021520 | 3300005618 | Bacteria | 5401 |
| 110 | Ga0068866_10086755 | 3300005718 | Bacteria | 1694 |
| 111 | Ga0068866_10128541 | 3300005718 | Bacteria | 1437 |
| 112 | Ga0068861_100001540 | 3300005719 | Bacteria | 14622 |
| 113 | Ga0068861_100011029 | 3300005719 | Bacteria | 6280 |
| 114 | Ga0068861_100153772 | 3300005719 | Bacteria | 1890 |
| 115 | Ga0068863_100041725 | 3300005841 | Bacteria | 4362 |
| 116 | Ga0068863_100082916 | 3300005841 | Bacteria | 3038 |
| 117 | Ga0068858_100002070 | 3300005842 | Bacteria | 20423 |
| 118 | Ga0068858_100023618 | 3300005842 | Bacteria | 5728 |
| 119 | Ga0068858_100082451 | 3300005842 | Bacteria | 2989 |
| 120 | Ga0068858_100107445 | 3300005842 | Bacteria | 2605 |
| 121 | Ga0068860_100001211 | 3300005843 | Bacteria | 28175 |
| 122 | Ga0068862_100001219 | 3300005844 | Bacteria | 24255 |
| 123 | Ga0081455_10000002 | 3300005937 | Bacteria | 460472 |
| 124 | Ga0081455_10003269 | 3300005937 | Bacteria | 18754 |
| 125 | Ga0081455_10003984 | 3300005937 | Bacteria | 16759 |
| 126 | Ga0081455_10004134 | 3300005937 | Bacteria | 16402 |
| 127 | Ga0081455_10039925 | 3300005937 | Bacteria | 4143 |
| 128 | Ga0081455_10046596 | 3300005937 | Bacteria | 3760 |
| 129 | Ga0081455_10077732 | 3300005937 | Bacteria | 2729 |
| 130 | Ga0081538_10001982 | 3300005981 | Bacteria | 20446 |
| 131 | Ga0081538_10007700 | 3300005981 | Bacteria | 9281 |
| 132 | Ga0081538_10059381 | 3300005981 | Bacteria | 2209 |
| 133 | Ga0081540_1000038 | 3300005983 | Bacteria | 138179 |
| 134 | Ga0070717_10001529 | 3300006028 | Bacteria | 16025 |
| 135 | Ga0075365_10002715 | 3300006038 | Bacteria | 8818 |
| 136 | Ga0075365_10061635 | 3300006038 | Bacteria | 2506 |
| 137 | Ga0075363_100103359 | 3300006048 | Bacteria | 1578 |
| 138 | Ga0075432_10005584 | 3300006058 | Bacteria | 4284 |
| 139 | Ga0070715_10000087 | 3300006163 | Bacteria | 23392 |
| 140 | Ga0070715_10023047 | 3300006163 | Bacteria | 2434 |
| 141 | Ga0070716_100001096 | 3300006173 | Bacteria | 11895 |
| 142 | Ga0070716_100032888 | 3300006173 | Bacteria | 2833 |
| 143 | Ga0070712_100000402 | 3300006175 | Bacteria | 24612 |
| 144 | Ga0070712_100003821 | 3300006175 | Bacteria | 9276 |
| 145 | Ga0070712_100072540 | 3300006175 | Bacteria | 2466 |
| 146 | Ga0075367_10091291 | 3300006178 | Bacteria | 1853 |
| 147 | Ga0075427_10000093 | 3300006194 | Bacteria | 7279 |
| 148 | Ga0075366_10009417 | 3300006195 | Bacteria | 5452 |
| 149 | Ga0097621_100032235 | 3300006237 | Bacteria | 4164 |
| 150 | Ga0097621_100094266 | 3300006237 | Bacteria | 2509 |
| 151 | Ga0075428_100001888 | 3300006844 | Bacteria | 22478 |
| 152 | Ga0075428_100041680 | 3300006844 | Bacteria | 5047 |
| 153 | Ga0075428_100047155 | 3300006844 | Bacteria | 4733 |
| 154 | Ga0075428_100154629 | 3300006844 | Bacteria | 2492 |
| 155 | Ga0075430_100000014 | 3300006846 | Bacteria | 90404 |
| 156 | Ga0075430_100003974 | 3300006846 | Bacteria | 12467 |
| 157 | Ga0075431_100003756 | 3300006847 | Bacteria | 14756 |
| 158 | Ga0075431_100005449 | 3300006847 | Bacteria | 12571 |
| 159 | Ga0075431_100023150 | 3300006847 | Bacteria | 6352 |
| 160 | Ga0075431_100042376 | 3300006847 | Bacteria | 4694 |
| 161 | Ga0075431_100072515 | 3300006847 | Bacteria | 3553 |
| 162 | Ga0075433_10000100 | 3300006852 | Bacteria | 41448 |
| 163 | Ga0075433_10211927 | 3300006852 | Bacteria | 1721 |
| 164 | Ga0075434_100002146 | 3300006871 | Bacteria | 17174 |
| 165 | Ga0075434_100013424 | 3300006871 | Bacteria | 7795 |
| 166 | Ga0075434_100040797 | 3300006871 | Bacteria | 4597 |
| 167 | Ga0075434_100055889 | 3300006871 | Bacteria | 3922 |
| 168 | Ga0075434_100141269 | 3300006871 | Bacteria | 2428 |
| 169 | Ga0075434_100201307 | 3300006871 | Bacteria | 2011 |
| 170 | Ga0075429_100000134 | 3300006880 | Bacteria | 44385 |
| 171 | Ga0075429_100004155 | 3300006880 | Bacteria | 12386 |
| 172 | Ga0068865_100002320 | 3300006881 | Bacteria | 11214 |
| 173 | Ga0068865_100016421 | 3300006881 | Bacteria | 4738 |
| 174 | Ga0068865_100020413 | 3300006881 | Bacteria | 4295 |
| 175 | Ga0068865_100059010 | 3300006881 | Bacteria | 2682 |
| 176 | Ga0097620_100009742 | 3300006931 | Bacteria | 9703 |
| 177 | Ga0097620_100017077 | 3300006931 | Bacteria | 7286 |
| 178 | Ga0097620_100211446 | 3300006931 | Bacteria | 2026 |
| 179 | Ga0075435_100001103 | 3300007076 | Bacteria | 17174 |
| 180 | Ga0075435_100016405 | 3300007076 | Bacteria | 5585 |
| 181 | Ga0075435_100062137 | 3300007076 | Bacteria | 3031 |
| 182 | Ga0075435_100073107 | 3300007076 | Bacteria | 2802 |
| 183 | Ga0075435_100223113 | 3300007076 | Bacteria | 1600 |
| 184 | Ga0105250_10008146 | 3300009092 | Bacteria | 4463 |
| 185 | Ga0105240_10166536 | 3300009093 | Bacteria | 2614 |
| 186 | Ga0111539_10002127 | 3300009094 | Bacteria | 26486 |
| 187 | Ga0111539_10010658 | 3300009094 | Bacteria | 11577 |
| 188 | Ga0111539_10053340 | 3300009094 | Bacteria | 4813 |
| 189 | Ga0111539_10054322 | 3300009094 | Bacteria | 4767 |
| 190 | Ga0111539_10133877 | 3300009094 | Bacteria | 2902 |
| 191 | Ga0111539_10134097 | 3300009094 | Bacteria | 2900 |
| 192 | Ga0105245_10008866 | 3300009098 | Bacteria | 8775 |
| 193 | Ga0105245_10009264 | 3300009098 | Bacteria | 8587 |
| 194 | Ga0105245_10224957 | 3300009098 | Bacteria | 1812 |
| 195 | Ga0105247_10000434 | 3300009101 | Bacteria | 35494 |
| 196 | Ga0105247_10004142 | 3300009101 | Bacteria | 9308 |
| 197 | Ga0114129_10000346 | 3300009147 | Bacteria | 54020 |
| 198 | Ga0114129_10011877 | 3300009147 | Bacteria | 12386 |
| 199 | Ga0114129_10018730 | 3300009147 | Bacteria | 9861 |
| 200 | Ga0114129_10034682 | 3300009147 | Bacteria | 7127 |
| 201 | Ga0114129_10134293 | 3300009147 | Bacteria | 3396 |
| 202 | Ga0114129_10244525 | 3300009147 | Bacteria | 2411 |
| 203 | Ga0105243_10000507 | 3300009148 | Bacteria | 39767 |
| 204 | Ga0105243_10011435 | 3300009148 | Bacteria | 6717 |
| 205 | Ga0105243_10052142 | 3300009148 | Bacteria | 3239 |
| 206 | Ga0105241_10005818 | 3300009174 | Bacteria | 9107 |
| 207 | Ga0105241_10019674 | 3300009174 | Bacteria | 4982 |
| 208 | Ga0105241_10037524 | 3300009174 | Bacteria | 3651 |
| 209 | Ga0105242_10004899 | 3300009176 | Bacteria | 10363 |
| 210 | Ga0105242_10019865 | 3300009176 | Bacteria | 5263 |
| 211 | Ga0105242_10023965 | 3300009176 | Bacteria | 4816 |
| 212 | Ga0105242_10099868 | 3300009176 | Bacteria | 2457 |
| 213 | Ga0105248_10000988 | 3300009177 | Bacteria | 31515 |
| 214 | Ga0105248_10020493 | 3300009177 | Bacteria | 7327 |
| 215 | Ga0105248_10144815 | 3300009177 | Bacteria | 2681 |
| 216 | Ga0105237_10009394 | 3300009545 | Bacteria | 10472 |
| 217 | Ga0105237_10037197 | 3300009545 | Bacteria | 4922 |
| 218 | Ga0105238_10002082 | 3300009551 | Bacteria | 20198 |
| 219 | Ga0105249_10000532 | 3300009553 | Bacteria | 35087 |
| 220 | Ga0105239_10005098 | 3300010375 | Bacteria | 15508 |
| 221 | Ga0105246_10003283 | 3300011119 | Bacteria | 9796 |
| 222 | Ga0105246_10028822 | 3300011119 | Bacteria | 3650 |
| 223 | Ga0105246_10269594 | 3300011119 | Bacteria | 1360 |
| 224 | Ga0157371_10239902 | 3300013102 | Bacteria | 1304 |
| 225 | Ga0157369_10010140 | 3300013105 | Bacteria | 10753 |
| 226 | Ga0157374_10012940 | 3300013296 | Bacteria | 7272 |
| 227 | Ga0157374_10029231 | 3300013296 | Bacteria | 4987 |
| 228 | Ga0157374_10168293 | 3300013296 | Bacteria | 2137 |
| 229 | Ga0157378_10006397 | 3300013297 | Bacteria | 10298 |
| 230 | Ga0157378_10120370 | 3300013297 | Bacteria | 2419 |
| 231 | Ga0163162_10003596 | 3300013306 | Bacteria | 14843 |
| 232 | Ga0163162_10151937 | 3300013306 | Bacteria | 2434 |
| 233 | Ga0163162_10347885 | 3300013306 | Bacteria | 1615 |
| 234 | Ga0157372_10004090 | 3300013307 | Bacteria | 15643 |
| 235 | Ga0157375_10025538 | 3300013308 | Bacteria | 5491 |
| 236 | Ga0157375_10086589 | 3300013308 | Bacteria | 3184 |
| 237 | Ga0157375_10089891 | 3300013308 | Bacteria | 3128 |
| 238 | Ga0163163_10024496 | 3300014325 | Bacteria | 5744 |
| 239 | Ga0163163_10098613 | 3300014325 | Bacteria | 2943 |
| 240 | Ga0163163_10193457 | 3300014325 | Bacteria | 2082 |
| 241 | Ga0163163_10388195 | 3300014325 | Bacteria | 1454 |
| 242 | Ga0157380_10006562 | 3300014326 | Bacteria | 8205 |
| 243 | Ga0157380_10044750 | 3300014326 | Bacteria | 3470 |
| 244 | Ga0157380_10131628 | 3300014326 | Bacteria | 2135 |
| 245 | Ga0157380_10177218 | 3300014326 | Bacteria | 1869 |
| 246 | Ga0157377_10005295 | 3300014745 | Bacteria | 6047 |
| 247 | Ga0157379_10002179 | 3300014968 | Bacteria | 16284 |
| 248 | Ga0157376_10000635 | 3300014969 | Bacteria | 22726 |
| 249 | Ga0157376_10000870 | 3300014969 | Bacteria | 19800 |
| 250 | Ga0157376_10008015 | 3300014969 | Bacteria | 7585 |
| 251 | Ga0163161_10007111 | 3300017792 | Bacteria | 7736 |
| 252 | Ga0224572_1001703 | 3300024225 | Bacteria | 3340 |
| 253 | Ga0228598_1000862 | 3300024227 | Bacteria | 6560 |
| 254 | Ga0209758_1000634 | 3300025297 | Bacteria | 53757 |
| 255 | Ga0207682_10002570 | 3300025893 | Bacteria | 8101 |
| 256 | Ga0207692_10011923 | 3300025898 | Bacteria | 3719 |
| 257 | Ga0207642_10055174 | 3300025899 | Bacteria | 1816 |
| 258 | Ga0207710_10024063 | 3300025900 | Bacteria | 2621 |
| 259 | Ga0207710_10027186 | 3300025900 | Bacteria | 2476 |
| 260 | Ga0207688_10000117 | 3300025901 | Bacteria | 32379 |
| 261 | Ga0207688_10002148 | 3300025901 | Bacteria | 10604 |
| 262 | Ga0207688_10015078 | 3300025901 | Bacteria | 4193 |
| 263 | Ga0207680_10006436 | 3300025903 | Bacteria | 5677 |
| 264 | Ga0207647_10001715 | 3300025904 | Bacteria | 16829 |
| 265 | Ga0207647_10012551 | 3300025904 | Bacteria | 5893 |
| 266 | Ga0207685_10000153 | 3300025905 | Bacteria | 10365 |
| 267 | Ga0207699_10008009 | 3300025906 | Bacteria | 5191 |
| 268 | Ga0207645_10003330 | 3300025907 | Bacteria | 12252 |
| 269 | Ga0207645_10022721 | 3300025907 | Bacteria | 4077 |
| 270 | Ga0207645_10042976 | 3300025907 | Bacteria | 2891 |
| 271 | Ga0207645_10154140 | 3300025907 | Bacteria | 1501 |
| 272 | Ga0207643_10000291 | 3300025908 | Bacteria | 34985 |
| 273 | Ga0207705_10026919 | 3300025909 | Bacteria | 4098 |
| 274 | Ga0207705_10068034 | 3300025909 | Bacteria | 2578 |
| 275 | Ga0207654_10006050 | 3300025911 | Bacteria | 6086 |
| 276 | Ga0207654_10019490 | 3300025911 | Bacteria | 3581 |
| 277 | Ga0207695_10074221 | 3300025913 | Bacteria | 3463 |
| 278 | Ga0207695_10146905 | 3300025913 | Bacteria | 2301 |
| 279 | Ga0207671_10011961 | 3300025914 | Bacteria | 7016 |
| 280 | Ga0207671_10062945 | 3300025914 | Bacteria | 2756 |
| 281 | Ga0207693_10000881 | 3300025915 | Bacteria | 26868 |
| 282 | Ga0207693_10001247 | 3300025915 | Bacteria | 22646 |
| 283 | Ga0207693_10005019 | 3300025915 | Bacteria | 11108 |
| 284 | Ga0207693_10016774 | 3300025915 | Bacteria | 5847 |
| 285 | Ga0207693_10069958 | 3300025915 | Bacteria | 2746 |
| 286 | Ga0207663_10007911 | 3300025916 | Bacteria | 5545 |
| 287 | Ga0207663_10119852 | 3300025916 | Bacteria | 1800 |
| 288 | Ga0207660_10018006 | 3300025917 | Bacteria | 4704 |
| 289 | Ga0207662_10010121 | 3300025918 | Bacteria | 5197 |
| 290 | Ga0207662_10010412 | 3300025918 | Bacteria | 5135 |
| 291 | Ga0207657_10000283 | 3300025919 | Bacteria | 54087 |
| 292 | Ga0207657_10019360 | 3300025919 | Bacteria | 6466 |
| 293 | Ga0207657_10019364 | 3300025919 | Bacteria | 6465 |
| 294 | Ga0207657_10037253 | 3300025919 | Bacteria | 4344 |
| 295 | Ga0207657_10111482 | 3300025919 | Bacteria | 2258 |
| 296 | Ga0207649_10137777 | 3300025920 | Bacteria | 1666 |
| 297 | Ga0207649_10198934 | 3300025920 | Bacteria | 1414 |
| 298 | Ga0207652_10009448 | 3300025921 | Bacteria | 7842 |
| 299 | Ga0207652_10175883 | 3300025921 | Bacteria | 1922 |
| 300 | Ga0207694_10079505 | 3300025924 | Bacteria | 2572 |
| 301 | Ga0207694_10151667 | 3300025924 | Bacteria | 1867 |
| 302 | Ga0207650_10017312 | 3300025925 | Bacteria | 5044 |
| 303 | Ga0207650_10023701 | 3300025925 | Bacteria | 4357 |
| 304 | Ga0207659_10015793 | 3300025926 | Bacteria | 4903 |
| 305 | Ga0207659_10199985 | 3300025926 | Bacteria | 1595 |
| 306 | Ga0207687_10001484 | 3300025927 | Bacteria | 16063 |
| 307 | Ga0207687_10052682 | 3300025927 | Bacteria | 2841 |
| 308 | Ga0207687_10173315 | 3300025927 | Bacteria | 1666 |
| 309 | Ga0207700_10026657 | 3300025928 | Bacteria | 4033 |
| 310 | Ga0207700_10053545 | 3300025928 | Bacteria | 3024 |
| 311 | Ga0207700_10109389 | 3300025928 | Bacteria | 2221 |
| 312 | Ga0207700_10163239 | 3300025928 | Bacteria | 1852 |
| 313 | Ga0207664_10019226 | 3300025929 | Bacteria | 5045 |
| 314 | Ga0207644_10009276 | 3300025931 | Bacteria | 6455 |
| 315 | Ga0207644_10012653 | 3300025931 | Bacteria | 5608 |
| 316 | Ga0207644_10077422 | 3300025931 | Bacteria | 2449 |
| 317 | Ga0207690_10000979 | 3300025932 | Bacteria | 18313 |
| 318 | Ga0207706_10000356 | 3300025933 | Bacteria | 49385 |
| 319 | Ga0207706_10003343 | 3300025933 | Bacteria | 15341 |
| 320 | Ga0207706_10014147 | 3300025933 | Bacteria | 7234 |
| 321 | Ga0207706_10065375 | 3300025933 | Bacteria | 3203 |
| 322 | Ga0207706_10105069 | 3300025933 | Bacteria | 2485 |
| 323 | Ga0207686_10007710 | 3300025934 | Bacteria | 5802 |
| 324 | Ga0207686_10077699 | 3300025934 | Bacteria | 2156 |
| 325 | Ga0207670_10003090 | 3300025936 | Bacteria | 8800 |
| 326 | Ga0207670_10023776 | 3300025936 | Bacteria | 3819 |
| 327 | Ga0207670_10140385 | 3300025936 | Bacteria | 1781 |
| 328 | Ga0207669_10006455 | 3300025937 | Bacteria | 5361 |
| 329 | Ga0207704_10002703 | 3300025938 | Bacteria | 8002 |
| 330 | Ga0207704_10066545 | 3300025938 | Bacteria | 2262 |
| 331 | Ga0207665_10000126 | 3300025939 | Bacteria | 50605 |
| 332 | Ga0207665_10001033 | 3300025939 | Bacteria | 18741 |
| 333 | Ga0207665_10003918 | 3300025939 | Bacteria | 9965 |
| 334 | Ga0207665_10005132 | 3300025939 | Bacteria | 8745 |
| 335 | Ga0207665_10055539 | 3300025939 | Bacteria | 2672 |
| 336 | Ga0207691_10001803 | 3300025940 | Bacteria | 20976 |
| 337 | Ga0207691_10002007 | 3300025940 | Bacteria | 19920 |
| 338 | Ga0207691_10168412 | 3300025940 | Bacteria | 1919 |
| 339 | Ga0207711_10006946 | 3300025941 | Bacteria | 9502 |
| 340 | Ga0207711_10064057 | 3300025941 | Bacteria | 3174 |
| 341 | Ga0207711_10173668 | 3300025941 | Bacteria | 1957 |
| 342 | Ga0207689_10106289 | 3300025942 | Bacteria | 2306 |
| 343 | Ga0207661_10022478 | 3300025944 | Bacteria | 4752 |
| 344 | Ga0207679_10000723 | 3300025945 | Bacteria | 21926 |
| 345 | Ga0207679_10018266 | 3300025945 | Bacteria | 4695 |
| 346 | Ga0207667_10044472 | 3300025949 | Bacteria | 4705 |
| 347 | Ga0207667_10046220 | 3300025949 | Bacteria | 4610 |
| 348 | Ga0207651_10002177 | 3300025960 | Bacteria | 9276 |
| 349 | Ga0207651_10016491 | 3300025960 | Bacteria | 4328 |
| 350 | Ga0207651_10045982 | 3300025960 | Bacteria | 2931 |
| 351 | Ga0207651_10159969 | 3300025960 | Bacteria | 1764 |
| 352 | Ga0207712_10001203 | 3300025961 | Bacteria | 17887 |
| 353 | Ga0207712_10005373 | 3300025961 | Bacteria | 8093 |
| 354 | Ga0207712_10028253 | 3300025961 | Bacteria | 3750 |
| 355 | Ga0207668_10002870 | 3300025972 | Bacteria | 10107 |
| 356 | Ga0207658_10004660 | 3300025986 | Bacteria | 9505 |
| 357 | Ga0207658_10022591 | 3300025986 | Bacteria | 4382 |
| 358 | Ga0207677_10052988 | 3300026023 | Bacteria | 2759 |
| 359 | Ga0207677_10061815 | 3300026023 | Bacteria | 2595 |
| 360 | Ga0207677_10065660 | 3300026023 | Bacteria | 2533 |
| 361 | Ga0207639_10007206 | 3300026041 | Bacteria | 7576 |
| 362 | Ga0207639_10091376 | 3300026041 | Bacteria | 2437 |
| 363 | Ga0207678_10000230 | 3300026067 | Bacteria | 49901 |
| 364 | Ga0207678_10001162 | 3300026067 | Bacteria | 24108 |
| 365 | Ga0207678_10008097 | 3300026067 | Bacteria | 9269 |
| 366 | Ga0207708_10001029 | 3300026075 | Bacteria | 20873 |
| 367 | Ga0207708_10289420 | 3300026075 | Bacteria | 1329 |
| 368 | Ga0207702_10149512 | 3300026078 | Bacteria | 2123 |
| 369 | Ga0207641_10154259 | 3300026088 | Bacteria | 2083 |
| 370 | Ga0207648_10008355 | 3300026089 | Bacteria | 10035 |
| 371 | Ga0207648_10025466 | 3300026089 | Bacteria | 5269 |
| 372 | Ga0207648_10127215 | 3300026089 | Bacteria | 2241 |
| 373 | Ga0207676_10005037 | 3300026095 | Bacteria | 9347 |
| 374 | Ga0207676_10006878 | 3300026095 | Bacteria | 8058 |
| 375 | Ga0207676_10090720 | 3300026095 | Bacteria | 2508 |
| 376 | Ga0207674_10001870 | 3300026116 | Bacteria | 26815 |
| 377 | Ga0207675_100000291 | 3300026118 | Bacteria | 48286 |
| 378 | Ga0207675_100002392 | 3300026118 | Bacteria | 18578 |
| 379 | Ga0207675_100076480 | 3300026118 | Bacteria | 3135 |
| 380 | Ga0207675_100199564 | 3300026118 | Bacteria | 1921 |
| 381 | Ga0207675_100280486 | 3300026118 | Bacteria | 1619 |
| 382 | Ga0207683_10000224 | 3300026121 | Bacteria | 49717 |
| 383 | Ga0207683_10000918 | 3300026121 | Bacteria | 27095 |
| 384 | Ga0207683_10004123 | 3300026121 | Bacteria | 12568 |
| 385 | Ga0207683_10016035 | 3300026121 | Bacteria | 6377 |
| 386 | Ga0207698_10008961 | 3300026142 | Bacteria | 6348 |
| 387 | Ga0209966_1004663 | 3300027695 | Bacteria | 2331 |
| 388 | Ga0207428_10000146 | 3300027907 | Bacteria | 95417 |
| 389 | Ga0207428_10001111 | 3300027907 | Bacteria | 29269 |
| 390 | Ga0207428_10078019 | 3300027907 | Bacteria | 2592 |
| 391 | Ga0268266_10012502 | 3300028379 | Bacteria | 7337 |
| 392 | Ga0268266_10064014 | 3300028379 | Bacteria | 3176 |
| 393 | Ga0268266_10073167 | 3300028379 | Bacteria | 2973 |
| 394 | Ga0268265_10061863 | 3300028380 | Bacteria | 2874 |
| 395 | Ga0268265_10110659 | 3300028380 | Bacteria | 2242 |
| 396 | Ga0268264_10090521 | 3300028381 | Bacteria | 2637 |
| 397 | Ga0268264_10239220 | 3300028381 | Bacteria | 1681 |
| 398 | Ga0268264_10322443 | 3300028381 | Bacteria | 1461 |
| 399 | Ga0265337_1000432 | 3300028556 | Bacteria | 22259 |
| 400 | Ga0265338_10008028 | 3300028800 | Bacteria | 12916 |
| 401 | Ga0265338_10027700 | 3300028800 | Bacteria | 5677 |
| 402 | Ga0265332_10000579 | 3300031238 | Bacteria | 24291 |
| 403 | Ga0265325_10000061 | 3300031241 | Bacteria | 75502 |
| 404 | Ga0265325_10000095 | 3300031241 | Bacteria | 62028 |
| 405 | Ga0265325_10038667 | 3300031241 | Bacteria | 2517 |
| 406 | Ga0265325_10043458 | 3300031241 | Bacteria | 2344 |
| 407 | Ga0265325_10072401 | 3300031241 | Bacteria | 1727 |
| 408 | Ga0265329_10006309 | 3300031242 | Bacteria | 4711 |
| 409 | Ga0265340_10005569 | 3300031247 | Bacteria | 6985 |
| 410 | Ga0265340_10081382 | 3300031247 | Bacteria | 1524 |
| 411 | Ga0265339_10000096 | 3300031249 | Bacteria | 74964 |
| 412 | Ga0265339_10016063 | 3300031249 | Bacteria | 4472 |
| 413 | Ga0265339_10025710 | 3300031249 | Bacteria | 3375 |
| 414 | Ga0265339_10031656 | 3300031249 | Bacteria | 2987 |
| 415 | Ga0265331_10012531 | 3300031250 | Bacteria | 4587 |
| 416 | Ga0265316_10031748 | 3300031344 | Bacteria | 4316 |
| 417 | Ga0265316_10076304 | 3300031344 | Bacteria | 2575 |
| 418 | Ga0265316_10106173 | 3300031344 | Bacteria | 2130 |
| 419 | Ga0265313_10000024 | 3300031595 | Bacteria | 138587 |
| 420 | Ga0265313_10000175 | 3300031595 | Bacteria | 68104 |
| 421 | Ga0265313_10005539 | 3300031595 | Bacteria | 9256 |
| 422 | Ga0265313_10007089 | 3300031595 | Bacteria | 7738 |
| 423 | Ga0265313_10011767 | 3300031595 | Bacteria | 5412 |
| 424 | Ga0265313_10018635 | 3300031595 | Bacteria | 3890 |
| 425 | Ga0265314_10005900 | 3300031711 | Bacteria | 10953 |
| 426 | Ga0265314_10008374 | 3300031711 | Bacteria | 8862 |
| 427 | Ga0265314_10017726 | 3300031711 | Bacteria | 5579 |
| 428 | Ga0265342_10000230 | 3300031712 | Bacteria | 62706 |
| 429 | Ga0265342_10003205 | 3300031712 | Bacteria | 13606 |
| 430 | Ga0265342_10009771 | 3300031712 | Bacteria | 6717 |
| 431 | Ga0265342_10017392 | 3300031712 | Bacteria | 4678 |
| 432 | Ga0265342_10021232 | 3300031712 | Bacteria | 4150 |
| 433 | Ga0265342_10083405 | 3300031712 | Bacteria | 1842 |
| 434 | Ga0316578_10008274 | 3300031728 | Bacteria | 5283 |
| 435 | Ga0316583_10003031 | 3300032133 | Bacteria | 5899 |
| 436 | Ga0373950_0003331 | 3300034818 | Bacteria | 2290 |
| 437 | Ga0373926_0002171 | 3300035083 | Bacteria | 6180 |
| 438 | Ga0373926_0019600 | 3300035083 | Bacteria | 2332 |
| 439 | Ga0373934_0025972 | 3300035086 | Bacteria | 2271 |
| 440 | Ga0373944_0004645 | 3300035089 | Bacteria | 3587 |
| 441 | Ga0373944_0010909 | 3300035089 | Bacteria | 2484 |
| 442 | Ga0373923_0007776 | 3300035111 | Bacteria | 3787 |
| 443 | Ga0373923_0044654 | 3300035111 | Bacteria | 1838 |
| 444 | Ga0373932_0019057 | 3300035112 | Bacteria | 1784 |
| 445 | Ga0373936_0007766 | 3300035113 | Bacteria | 4029 |
| 446 | Ga0373945_0004476 | 3300035116 | Bacteria | 4442 |
| 447 | Ga0373945_0006672 | 3300035116 | Bacteria | 3729 |
| 448 | Ga0373945_0012060 | 3300035116 | Bacteria | 2865 |
| 449 | Ga0373945_0015836 | 3300035116 | Bacteria | 2540 |
| 450 | Ga0373953_0002959 | 3300035117 | Bacteria | 5195 |
| 451 | Ga0373953_0003903 | 3300035117 | Bacteria | 4698 |
| 452 | Ga0373953_0005928 | 3300035117 | Bacteria | 3997 |
| 453 | Ga0373954_0000652 | 3300035118 | Bacteria | 13271 |
| 454 | Ga0373954_0010209 | 3300035118 | Bacteria | 4139 |
| 455 | Ga0373954_0016056 | 3300035118 | Bacteria | 3350 |
| 456 | Ga0373954_0083993 | 3300035118 | Bacteria | 1524 |
| 457 | Ga0373956_0051054 | 3300035119 | Bacteria | 1858 |
| 458 | Ga0373957_0002587 | 3300035120 | Bacteria | 5191 |
| 459 | Ga0373960_0029074 | 3300035121 | Bacteria | 1530 |
| 460 | Ga0373943_0000604 | 3300035170 | Bacteria | 15625 |
| 461 | Ga0373943_0007961 | 3300035170 | Bacteria | 4758 |
| 462 | Ga0373943_0011204 | 3300035170 | Bacteria | 4033 |
| 463 | Ga0373943_0013744 | 3300035170 | Bacteria | 3659 |
| 464 | Ga0373943_0027412 | 3300035170 | Bacteria | 2677 |
| 465 | Ga0373946_0001074 | 3300035171 | Bacteria | 9420 |
| 466 | Ga0373946_0010837 | 3300035171 | Bacteria | 3386 |
| 467 | Ga0373946_0011493 | 3300035171 | Bacteria | 3305 |
| 468 | Ga0373946_0030922 | 3300035171 | Bacteria | 2140 |
| 469 | Ga0373946_0087420 | 3300035171 | Bacteria | 1375 |
| 470 | Ga0373955_0002386 | 3300035172 | Bacteria | 8180 |
| 471 | Ga0373955_0002535 | 3300035172 | Bacteria | 7991 |
| 472 | Ga0373955_0004154 | 3300035172 | Bacteria | 6392 |
| 473 | Ga0373955_0022528 | 3300035172 | Bacteria | 3196 |
| 474 | Ga0316574_0000481 | 3300035398 | Bacteria | 16142 |
| 475 | Ga0373924_0000895 | 3300035410 | Bacteria | 9404 |
| 476 | Ga0373924_0012276 | 3300035410 | Bacteria | 3198 |
| 477 | Ga0373931_0004642 | 3300035691 | Bacteria | 6283 |
| 478 | Ga0373931_0020346 | 3300035691 | Bacteria | 3320 |
| 479 | Ga0373931_0099914 | 3300035691 | Bacteria | 1630 |
| 480 | Ga0373935_0000021 | 3300035692 | Bacteria | 65504 |
| 481 | Ga0373935_0037893 | 3300035692 | Bacteria | 3018 |
| 482 | Ga0373927_0000113 | 3300035695 | Bacteria | 60608 |
| 483 | Ga0373927_0044176 | 3300035695 | Bacteria | 2883 |
| 484 | Ga0373933_0001968 | 3300035724 | Bacteria | 11834 |
| 485 | Ga0373933_0004870 | 3300035724 | Bacteria | 7325 |
| 486 | Ga0373933_0007848 | 3300035724 | Bacteria | 5828 |
| 487 | Ga0373933_0026536 | 3300035724 | Bacteria | 3327 |
| 488 | Ga0373947_0000168 | 3300035725 | Bacteria | 35315 |
| 489 | Ga0373947_0001421 | 3300035725 | Bacteria | 14730 |
| 490 | Ga0373947_0020440 | 3300035725 | Bacteria | 3822 |
| 491 | Ga0373947_0040937 | 3300035725 | Bacteria | 2761 |
| 492 | Ga0373947_0072336 | 3300035725 | Bacteria | 2117 |
| 493 | Ga0373947_0123813 | 3300035725 | Bacteria | 1644 |
| 494 | Ga0373937_0000003 | 3300036401 | Bacteria | 235408 |
| 495 | Ga0373937_0000814 | 3300036401 | Bacteria | 26684 |
| 496 | Ga0373937_0001531 | 3300036401 | Bacteria | 19461 |
| 497 | Ga0373937_0001859 | 3300036401 | Bacteria | 17748 |
| 498 | Ga0373937_0002824 | 3300036401 | Bacteria | 14516 |
| 499 | Ga0373937_0015768 | 3300036401 | Bacteria | 6694 |
| 500 | Ga0373937_0041271 | 3300036401 | Bacteria | 4209 |
| 501 | Ga0373937_0195168 | 3300036401 | Bacteria | 1903 |
| 502 | Ga0316584_0032982 | 3300036712 | Bacteria | 3833 |
| 503 | Ga0373925_0006331 | 3300037068 | Bacteria | 8719 |
| 504 | Ga0373925_0011827 | 3300037068 | Bacteria | 6315 |
| 505 | Ga0373925_0039691 | 3300037068 | Bacteria | 3483 |
| 506 | Ga0373925_0046849 | 3300037068 | Bacteria | 3216 |
| 507 | Ga0395899_0045822 | 3300037312 | Bacteria | 3258 |
| 508 | Ga0395900_0000709 | 3300037418 | Bacteria | 44342 |
| 509 | Ga0395900_0114680 | 3300037418 | Bacteria | 2765 |
| 510 | Ga0395900_0256867 | 3300037418 | Bacteria | 1746 |
| 511 | Ga0395898_0015930 | 3300037466 | Bacteria | 7704 |
| 512 | Ga0395898_0020062 | 3300037466 | Bacteria | 6793 |
| 513 | Ga0395898_0145863 | 3300037466 | Bacteria | 2265 |
| 514 | Ga0395898_0336073 | 3300037466 | Bacteria | 1440 |
| 515 | Ga0395905_0001849 | 3300037471 | Bacteria | 24410 |
| 516 | Ga0436364_0455303 | 3300037853 | Bacteria | 2457 |
| 517 | Ga0436364_1417851 | 3300037853 | Bacteria | 1646 |
| 518 | Ga0395901_0009794 | 3300038443 | Bacteria | 9720 |
| 519 | Ga0395901_0127089 | 3300038443 | Bacteria | 2679 |
| 520 | Ga0436365_0558591 | 3300039437 | Bacteria | 4927 |
| 521 | Ga0436365_0823547 | 3300039437 | Bacteria | 3559 |
| 522 | Ga0436365_1845974 | 3300039437 | Bacteria | 3012 |
| 523 | Ga0436360_1374180 | 3300039438 | Bacteria | 1486 |
| 524 | Ga0436361_0026887 | 3300039447 | Bacteria | 4271 |
| 525 | Ga0436361_0370811 | 3300039447 | Bacteria | 1358 |
| 526 | Ga0436361_0570308 | 3300039447 | Bacteria | 9061 |
| 527 | Ga0436363_0479002 | 3300039450 | Bacteria | 2668 |
| 528 | Ga0439453_0000762 | 3300041408 | Bacteria | 3763 |
| 529 | Ga0439443_013414 | 3300042003 | Bacteria | 1224 |
| 530 | Ga0466966_0017375 | 3300044684 | Bacteria | 4754 |
| 531 | Ga0466961_0100503 | 3300044693 | Bacteria | 1822 |
| 532 | Ga0466963_0004364 | 3300044694 | Bacteria | 8215 |
| 533 | Ga0466971_0026503 | 3300044719 | Bacteria | 2591 |
| 534 | Ga0466959_0049316 | 3300045049 | Bacteria | 3093 |
| 535 | Ga0495617_004347 | 3300046452 | Bacteria | 5164 |
| 536 | Ga0495592_0000951 | 3300046454 | Bacteria | 20097 |
| 537 | Ga0495592_0003642 | 3300046454 | Bacteria | 11089 |
| 538 | Ga0495592_0016294 | 3300046454 | Bacteria | 5639 |
| 539 | Ga0495592_0094370 | 3300046454 | Bacteria | 2141 |
| 540 | Ga0495603_0000007 | 3300046455 | Bacteria | 74203 |
| 541 | Ga0495603_0008477 | 3300046455 | Bacteria | 6211 |
| 542 | Ga0495603_0077322 | 3300046455 | Bacteria | 1952 |
| 543 | Ga0495629_0000230 | 3300046459 | Bacteria | 49922 |
| 544 | Ga0495629_0000637 | 3300046459 | Bacteria | 28379 |
| 545 | Ga0495629_0001246 | 3300046459 | Bacteria | 19991 |
| 546 | Ga0495629_0024806 | 3300046459 | Bacteria | 4267 |
| 547 | Ga0495629_0085455 | 3300046459 | Bacteria | 2201 |
| 548 | Ga0495629_0145166 | 3300046459 | Bacteria | 1650 |
| 549 | Ga0495638_0081156 | 3300046460 | Bacteria | 1969 |
| 550 | Ga0495641_0026314 | 3300046461 | Bacteria | 2840 |
| 551 | Ga0495651_0000514 | 3300046462 | Bacteria | 30081 |
| 552 | Ga0495651_0000728 | 3300046462 | Bacteria | 25476 |
| 553 | Ga0495651_0002980 | 3300046462 | Bacteria | 13067 |
| 554 | Ga0495651_0011196 | 3300046462 | Bacteria | 6895 |
| 555 | Ga0495651_0031414 | 3300046462 | Bacteria | 4141 |
| 556 | Ga0495651_0033609 | 3300046462 | Bacteria | 4000 |
| 557 | Ga0495651_0085195 | 3300046462 | Bacteria | 2380 |
| 558 | Ga0495653_0000039 | 3300046463 | Bacteria | 119840 |
| 559 | Ga0495653_0000928 | 3300046463 | Bacteria | 22666 |
| 560 | Ga0495653_0006559 | 3300046463 | Bacteria | 9550 |
| 561 | Ga0495580_0001029 | 3300046472 | Bacteria | 24487 |
| 562 | Ga0495582_0000282 | 3300046473 | Bacteria | 28455 |
| 563 | Ga0495582_0009247 | 3300046473 | Bacteria | 5435 |
| 564 | Ga0495639_0004064 | 3300046475 | Bacteria | 6270 |
| 565 | Ga0495639_0009235 | 3300046475 | Bacteria | 4225 |
| 566 | Ga0495662_0007427 | 3300046476 | Bacteria | 5418 |
| 567 | Ga0495662_0024340 | 3300046476 | Bacteria | 2921 |
| 568 | Ga0495662_0025235 | 3300046476 | Bacteria | 2870 |
| 569 | Ga0495664_0000015 | 3300046477 | Bacteria | 192569 |
| 570 | Ga0495664_0001694 | 3300046477 | Bacteria | 11712 |
| 571 | Ga0495584_0005034 | 3300046491 | Bacteria | 7032 |
| 572 | Ga0495584_0008203 | 3300046491 | Bacteria | 5423 |
| 573 | Ga0495584_0011909 | 3300046491 | Bacteria | 4446 |
| 574 | Ga0495585_0007183 | 3300046492 | Bacteria | 6841 |
| 575 | Ga0495585_0030411 | 3300046492 | Bacteria | 3071 |
| 576 | Ga0495594_0001475 | 3300046499 | Bacteria | 12203 |
| 577 | Ga0495607_0013013 | 3300046501 | Bacteria | 5469 |
| 578 | Ga0495607_0015734 | 3300046501 | Bacteria | 4895 |
| 579 | Ga0495583_0077310 | 3300046506 | Bacteria | 1452 |
| 580 | Ga0495608_0000828 | 3300046511 | Bacteria | 21568 |
| 581 | Ga0495608_0001366 | 3300046511 | Bacteria | 17394 |
| 582 | Ga0495608_0007452 | 3300046511 | Bacteria | 7731 |
| 583 | Ga0495608_0043610 | 3300046511 | Bacteria | 2997 |
| 584 | Ga0495608_0063937 | 3300046511 | Bacteria | 2413 |
| 585 | Ga0495618_0000040 | 3300046514 | Bacteria | 98012 |
| 586 | Ga0495618_0003496 | 3300046514 | Bacteria | 9752 |
| 587 | Ga0495618_0004258 | 3300046514 | Bacteria | 8827 |
| 588 | Ga0495618_0009575 | 3300046514 | Bacteria | 5848 |
| 589 | Ga0495628_0000011 | 3300046516 | Bacteria | 225267 |
| 590 | Ga0495628_0015093 | 3300046516 | Bacteria | 6452 |
| 591 | Ga0495628_0016697 | 3300046516 | Bacteria | 6121 |
| 592 | Ga0495628_0034383 | 3300046516 | Bacteria | 4076 |
| 593 | Ga0495628_0114065 | 3300046516 | Bacteria | 2077 |
| 594 | Ga0495628_0154444 | 3300046516 | Bacteria | 1747 |
| 595 | Ga0495630_0018517 | 3300046517 | Bacteria | 5116 |
| 596 | Ga0495630_0020607 | 3300046517 | Bacteria | 4862 |
| 597 | Ga0495630_0054217 | 3300046517 | Bacteria | 3004 |
| 598 | Ga0495631_0064605 | 3300046518 | Bacteria | 1584 |
| 599 | Ga0495637_0009381 | 3300046520 | Bacteria | 4774 |
| 600 | Ga0495644_0000207 | 3300046523 | Bacteria | 27708 |
| 601 | Ga0495644_0007281 | 3300046523 | Bacteria | 4276 |
| 602 | Ga0495666_0017461 | 3300046526 | Bacteria | 3574 |
| 603 | Ga0495666_0056573 | 3300046526 | Bacteria | 1878 |
| 604 | Ga0495652_0000014 | 3300046529 | Bacteria | 225484 |
| 605 | Ga0495652_0004995 | 3300046529 | Bacteria | 12562 |
| 606 | Ga0495652_0086281 | 3300046529 | Bacteria | 2578 |
| 607 | Ga0495665_0011731 | 3300046531 | Bacteria | 4747 |
| 608 | Ga0495640_0000008 | 3300046533 | Bacteria | 220320 |
| 609 | Ga0495640_0002965 | 3300046533 | Bacteria | 13663 |
| 610 | Ga0495640_0011428 | 3300046533 | Bacteria | 6833 |
| 611 | Ga0495640_0060940 | 3300046533 | Bacteria | 2565 |
| 612 | Ga0495640_0097920 | 3300046533 | Bacteria | 1928 |
| 613 | Ga0495586_0134360 | 3300046535 | Bacteria | 1386 |
| 614 | Ga0495587_0000015 | 3300046536 | Bacteria | 187415 |
| 615 | Ga0495587_0003782 | 3300046536 | Bacteria | 10043 |
| 616 | Ga0495587_0014883 | 3300046536 | Bacteria | 4867 |
| 617 | Ga0495587_0036527 | 3300046536 | Bacteria | 2955 |
| 618 | Ga0495587_0120577 | 3300046536 | Bacteria | 1502 |
| 619 | Ga0495598_0001615 | 3300046537 | Bacteria | 4516 |
| 620 | Ga0495598_0005602 | 3300046537 | Bacteria | 2793 |
| 621 | Ga0495598_0011091 | 3300046537 | Bacteria | 2176 |
| 622 | Ga0495645_0000205 | 3300046543 | Bacteria | 42289 |
| 623 | Ga0495645_0006238 | 3300046543 | Bacteria | 8258 |
| 624 | Ga0495645_0020829 | 3300046543 | Bacteria | 4737 |
| 625 | Ga0495645_0127082 | 3300046543 | Bacteria | 1790 |
| 626 | Ga0495645_0134683 | 3300046543 | Bacteria | 1729 |
| 627 | Ga0495645_0224424 | 3300046543 | Bacteria | 1262 |
| 628 | Ga0495622_0001237 | 3300046557 | Bacteria | 13118 |
| 629 | Ga0495622_0005346 | 3300046557 | Bacteria | 5960 |
| 630 | Ga0495622_0006378 | 3300046557 | Bacteria | 5476 |
| 631 | Ga0495633_0011556 | 3300046558 | Bacteria | 4753 |
| 632 | Ga0495633_0024402 | 3300046558 | Bacteria | 2989 |
| 633 | Ga0495667_0000013 | 3300046559 | Bacteria | 220294 |
| 634 | Ga0495667_0009130 | 3300046559 | Bacteria | 6732 |
| 635 | Ga0495667_0010115 | 3300046559 | Bacteria | 6385 |
| 636 | Ga0495667_0036530 | 3300046559 | Bacteria | 3279 |
| 637 | Ga0495667_0059839 | 3300046559 | Bacteria | 2499 |
| 638 | Ga0495667_0066249 | 3300046559 | Bacteria | 2361 |
| 639 | Ga0495656_0000115 | 3300046615 | Bacteria | 31179 |
| 640 | Ga0495634_0005029 | 3300046642 | Bacteria | 10206 |
| 641 | Ga0495634_0005103 | 3300046642 | Bacteria | 10141 |
| 642 | Ga0495634_0005808 | 3300046642 | Bacteria | 9416 |
| 643 | Ga0495634_0018918 | 3300046642 | Bacteria | 4898 |
| 644 | Ga0495634_0023133 | 3300046642 | Bacteria | 4370 |
| 645 | Ga0495634_0023225 | 3300046642 | Bacteria | 4361 |
| 646 | Ga0495634_0040947 | 3300046642 | Bacteria | 3148 |
| 647 | Ga0495634_0084990 | 3300046642 | Bacteria | 2063 |
| 648 | Ga0495634_0101536 | 3300046642 | Bacteria | 1858 |
| 649 | Ga0495611_0000905 | 3300046648 | Bacteria | 16099 |
| 650 | Ga0495635_0000012 | 3300046663 | Bacteria | 225271 |
| 651 | Ga0495635_0009166 | 3300046663 | Bacteria | 6909 |
| 652 | Ga0495635_0011301 | 3300046663 | Bacteria | 6262 |
| 653 | Ga0495635_0014147 | 3300046663 | Bacteria | 5583 |
| 654 | Ga0495635_0016366 | 3300046663 | Bacteria | 5177 |
| 655 | Ga0495635_0075730 | 3300046663 | Bacteria | 2305 |
| 656 | Ga0495635_0239688 | 3300046663 | Bacteria | 1224 |
| 657 | Ga0495661_0019120 | 3300046665 | Bacteria | 4495 |
| 658 | Ga0495661_0103888 | 3300046665 | Bacteria | 1594 |
| 659 | Ga0495588_0000342 | 3300046674 | Bacteria | 30293 |
| 660 | Ga0495588_0008442 | 3300046674 | Bacteria | 4727 |
| 661 | Ga0495588_0035342 | 3300046674 | Bacteria | 2532 |
| 662 | Ga0495657_0001768 | 3300046675 | Bacteria | 18483 |
| 663 | Ga0495657_0008566 | 3300046675 | Bacteria | 7812 |
| 664 | Ga0495657_0009114 | 3300046675 | Bacteria | 7540 |
| 665 | Ga0495657_0019681 | 3300046675 | Bacteria | 4866 |
| 666 | Ga0495599_0000008 | 3300046678 | Bacteria | 225534 |
| 667 | Ga0495599_0017550 | 3300046678 | Bacteria | 4448 |
| 668 | Ga0495599_0064118 | 3300046678 | Bacteria | 2295 |
| 669 | Ga0495623_0000106 | 3300046679 | Bacteria | 51561 |
| 670 | Ga0495623_0002503 | 3300046679 | Bacteria | 12172 |
| 671 | Ga0495623_0002644 | 3300046679 | Bacteria | 11821 |
| 672 | Ga0495623_0033043 | 3300046679 | Bacteria | 3321 |
| 673 | Ga0495623_0053345 | 3300046679 | Bacteria | 2553 |
| 674 | Ga0495646_0000004 | 3300046680 | Bacteria | 268993 |
| 675 | Ga0495646_0008221 | 3300046680 | Bacteria | 6632 |
| 676 | Ga0495646_0008648 | 3300046680 | Bacteria | 6469 |
| 677 | Ga0495646_0028709 | 3300046680 | Bacteria | 3482 |
| 678 | Ga0495646_0038816 | 3300046680 | Bacteria | 2938 |
| 679 | Ga0495647_0000609 | 3300046681 | Bacteria | 10553 |
| 680 | Ga0495647_0024849 | 3300046681 | Bacteria | 2184 |
| 681 | Ga0495658_0002035 | 3300046683 | Bacteria | 10290 |
| 682 | Ga0495658_0007124 | 3300046683 | Bacteria | 5525 |
| 683 | Ga0495658_0094419 | 3300046683 | Bacteria | 1776 |
| 684 | Ga0495658_0101231 | 3300046683 | Bacteria | 1720 |
| 685 | Ga0495613_0000346 | 3300046689 | Bacteria | 41120 |
| 686 | Ga0495613_0009566 | 3300046689 | Bacteria | 7200 |
| 687 | Ga0495613_0054086 | 3300046689 | Bacteria | 2952 |
| 688 | Ga0495613_0061107 | 3300046689 | Bacteria | 2759 |
| 689 | Ga0495613_0096575 | 3300046689 | Bacteria | 2137 |
| 690 | Ga0495613_0152087 | 3300046689 | Bacteria | 1650 |
| 691 | Ga0495624_0006638 | 3300046690 | Bacteria | 8178 |
| 692 | Ga0495624_0009104 | 3300046690 | Bacteria | 6886 |
| 693 | Ga0495624_0048852 | 3300046690 | Bacteria | 2684 |
| 694 | Ga0495670_0000652 | 3300046691 | Bacteria | 16575 |
| 695 | Ga0495670_0027851 | 3300046691 | Bacteria | 2801 |
| 696 | Ga0495589_0029823 | 3300046794 | Bacteria | 2750 |
| 697 | Ga0495589_0030166 | 3300046794 | Bacteria | 2732 |
| 698 | Ga0495600_0001602 | 3300046809 | Bacteria | 12596 |
| 699 | Ga0495600_0004261 | 3300046809 | Bacteria | 8545 |
| 700 | Ga0495600_0010911 | 3300046809 | Bacteria | 5650 |
| 701 | Ga0495600_0011149 | 3300046809 | Bacteria | 5597 |
| 702 | Ga0495600_0014091 | 3300046809 | Bacteria | 5036 |
| 703 | Ga0495581_0000751 | 3300047315 | Bacteria | 17198 |
| 704 | Ga0495581_0014777 | 3300047315 | Bacteria | 4528 |
| 705 | Ga0495581_0055955 | 3300047315 | Bacteria | 2276 |
| 706 | Ga0495581_0085800 | 3300047315 | Bacteria | 1825 |
| 707 | Ga0495604_0000001 | 3300047317 | Bacteria | 708627 |
| 708 | Ga0495604_0005535 | 3300047317 | Bacteria | 10016 |
| 709 | Ga0495604_0009327 | 3300047317 | Bacteria | 7768 |
| 710 | Ga0495604_0022878 | 3300047317 | Bacteria | 4988 |
| 711 | Ga0495674_0000023 | 3300047319 | Bacteria | 157443 |
| 712 | Ga0495674_0006257 | 3300047319 | Bacteria | 11421 |
| 713 | Ga0495674_0045843 | 3300047319 | Bacteria | 3882 |
| 714 | Ga0495676_0032798 | 3300047321 | Bacteria | 4381 |
| 715 | Ga0495676_0047166 | 3300047321 | Bacteria | 3487 |
| 716 | Ga0495676_0087048 | 3300047321 | Bacteria | 2349 |
| 717 | Ga0495676_0096936 | 3300047321 | Bacteria | 2191 |
| 718 | Ga0495680_0000313 | 3300047322 | Bacteria | 54486 |
| 719 | Ga0495680_0008135 | 3300047322 | Bacteria | 9559 |
| 720 | Ga0495680_0009019 | 3300047322 | Bacteria | 9012 |
| 721 | Ga0495680_0009850 | 3300047322 | Bacteria | 8566 |
| 722 | Ga0495680_0014387 | 3300047322 | Bacteria | 6854 |
| 723 | Ga0495680_0022623 | 3300047322 | Bacteria | 5236 |
| 724 | Ga0495680_0044025 | 3300047322 | Bacteria | 3531 |
| 725 | Ga0495675_0000298 | 3300047444 | Bacteria | 35706 |
| 726 | Ga0495675_0000606 | 3300047444 | Bacteria | 23109 |
| 727 | Ga0495675_0024419 | 3300047444 | Bacteria | 3853 |
| 728 | Ga0495675_0028255 | 3300047444 | Bacteria | 3576 |
| 729 | Ga0495677_0032275 | 3300047445 | Bacteria | 1907 |
| 730 | Ga0495679_030560 | 3300047446 | Bacteria | 1747 |
| 731 | Ga0495684_0000007 | 3300047471 | Bacteria | 225614 |
| 732 | Ga0495684_0005076 | 3300047471 | Bacteria | 10266 |
| 733 | Ga0495684_0026635 | 3300047471 | Bacteria | 4443 |
| 734 | Ga0495684_0044356 | 3300047471 | Bacteria | 3404 |
| 735 | Ga0495684_0205080 | 3300047471 | Bacteria | 1452 |
| 736 | Ga0495593_0000257 | 3300047673 | Bacteria | 28617 |
| 737 | Ga0495593_0005443 | 3300047673 | Bacteria | 7523 |
| 738 | Ga0495593_0020803 | 3300047673 | Bacteria | 3670 |
| 739 | Ga0495602_0000157 | 3300048088 | Bacteria | 63001 |
| 740 | Ga0495602_0005154 | 3300048088 | Bacteria | 13692 |
| 741 | Ga0495602_0032937 | 3300048088 | Bacteria | 4871 |
| 742 | Ga0495602_0034428 | 3300048088 | Bacteria | 4738 |
| 743 | Ga0495602_0125018 | 3300048088 | Bacteria | 2062 |
| 744 | Ga0495614_0001571 | 3300048089 | Bacteria | 9918 |
| 745 | Ga0495614_0007539 | 3300048089 | Bacteria | 4844 |
| 746 | Ga0495614_0016209 | 3300048089 | Bacteria | 3245 |
| 747 | Ga0496100_0002229 | 3300048903 | Bacteria | 9788 |
| 748 | Ga0496100_0005055 | 3300048903 | Bacteria | 7060 |
| 749 | Ga0496100_0008109 | 3300048903 | Bacteria | 5844 |
| 750 | Ga0496100_0062501 | 3300048903 | Bacteria | 2457 |
| 751 | Ga0496101_0012447 | 3300048904 | Bacteria | 5678 |
| 752 | Ga0496101_0014278 | 3300048904 | Bacteria | 5334 |
| 753 | Ga0496101_0020480 | 3300048904 | Bacteria | 4529 |
| 754 | Ga0496101_0024432 | 3300048904 | Bacteria | 4182 |
| 755 | Ga0496101_0044963 | 3300048904 | Bacteria | 3161 |
| 756 | Ga0496101_0125869 | 3300048904 | Bacteria | 1941 |
| 757 | Ga0496101_0187144 | 3300048904 | Bacteria | 1596 |
| 758 | Ga0496102_0009037 | 3300048905 | Bacteria | 8551 |
| 759 | Ga0496102_0091642 | 3300048905 | Bacteria | 2813 |
| 760 | Ga0496102_0096386 | 3300048905 | Bacteria | 2742 |
| 761 | Ga0496102_0109173 | 3300048905 | Bacteria | 2578 |
| 762 | Ga0496102_0124309 | 3300048905 | Bacteria | 2411 |
| 763 | Ga0496102_0361432 | 3300048905 | Bacteria | 1367 |
| 764 | Ga0496103_0001199 | 3300048906 | Bacteria | 17784 |
| 765 | Ga0496103_0006458 | 3300048906 | Bacteria | 6996 |
| 766 | Ga0496103_0039808 | 3300048906 | Bacteria | 2889 |
| 767 | Ga0496103_0202145 | 3300048906 | Bacteria | 1278 |
| 768 | Ga0496104_0003034 | 3300048907 | Bacteria | 14466 |
| 769 | Ga0496104_0005924 | 3300048907 | Bacteria | 10704 |
| 770 | Ga0496104_0013973 | 3300048907 | Bacteria | 7243 |
| 771 | Ga0496104_0018566 | 3300048907 | Bacteria | 6347 |
| 772 | Ga0496104_0027045 | 3300048907 | Bacteria | 5305 |
| 773 | Ga0496104_0032679 | 3300048907 | Bacteria | 4843 |
| 774 | Ga0496104_0079932 | 3300048907 | Bacteria | 3116 |
| 775 | Ga0496104_0111732 | 3300048907 | Bacteria | 2620 |
| 776 | Ga0496104_0185565 | 3300048907 | Bacteria | 1991 |
| 777 | Ga0496104_0336884 | 3300048907 | Bacteria | 1421 |
| 778 | Ga0496105_0000168 | 3300048908 | Bacteria | 43805 |
| 779 | Ga0496105_0001325 | 3300048908 | Bacteria | 17329 |
| 780 | Ga0496105_0002827 | 3300048908 | Bacteria | 12692 |
| 781 | Ga0496105_0036413 | 3300048908 | Bacteria | 4053 |
| 782 | Ga0496105_0044807 | 3300048908 | Bacteria | 3649 |
| 783 | Ga0496105_0048634 | 3300048908 | Bacteria | 3500 |
| 784 | Ga0496105_0063704 | 3300048908 | Bacteria | 3042 |
| 785 | Ga0496106_0006526 | 3300048909 | Bacteria | 8635 |
| 786 | Ga0496106_0016453 | 3300048909 | Bacteria | 5471 |
| 787 | Ga0496106_0022416 | 3300048909 | Bacteria | 4690 |
| 788 | Ga0496106_0063959 | 3300048909 | Bacteria | 2798 |
| 789 | Ga0496106_0093856 | 3300048909 | Bacteria | 2319 |
| 790 | Ga0496106_0189468 | 3300048909 | Bacteria | 1635 |
| 791 | Ga0496106_0233893 | 3300048909 | Bacteria | 1467 |
| 792 | Ga0496107_0023841 | 3300048910 | Bacteria | 4324 |
| 793 | Ga0496107_0049396 | 3300048910 | Bacteria | 3031 |
| 794 | Ga0496107_0067139 | 3300048910 | Bacteria | 2601 |
| 795 | Ga0496107_0071765 | 3300048910 | Bacteria | 2516 |
| 796 | Ga0496107_0111355 | 3300048910 | Bacteria | 2012 |
| 797 | Ga0496107_0221846 | 3300048910 | Bacteria | 1406 |
| 798 | Ga0496108_0000698 | 3300048911 | Bacteria | 26059 |
| 799 | Ga0496108_0001234 | 3300048911 | Bacteria | 20061 |
| 800 | Ga0496108_0012413 | 3300048911 | Bacteria | 6932 |
| 801 | Ga0496108_0149923 | 3300048911 | Bacteria | 2012 |
| 802 | Ga0496108_0161868 | 3300048911 | Bacteria | 1934 |
| 803 | Ga0496108_0176296 | 3300048911 | Bacteria | 1850 |
| 804 | Ga0496109_0002525 | 3300048912 | Bacteria | 15340 |
| 805 | Ga0496109_0019370 | 3300048912 | Bacteria | 5999 |
| 806 | Ga0496109_0035224 | 3300048912 | Bacteria | 4513 |
| 807 | Ga0496109_0078184 | 3300048912 | Bacteria | 3045 |
| 808 | Ga0496109_0080957 | 3300048912 | Bacteria | 2992 |
| 809 | Ga0496109_0428613 | 3300048912 | Bacteria | 1249 |
| 810 | Ga0496110_0001180 | 3300048913 | Bacteria | 18578 |
| 811 | Ga0496110_0001215 | 3300048913 | Bacteria | 18339 |
| 812 | Ga0496110_0014100 | 3300048913 | Bacteria | 6626 |
| 813 | Ga0496110_0017116 | 3300048913 | Bacteria | 6060 |
| 814 | Ga0496110_0107662 | 3300048913 | Bacteria | 2502 |
| 815 | Ga0496110_0179606 | 3300048913 | Bacteria | 1922 |
| 816 | Ga0496110_0188286 | 3300048913 | Bacteria | 1874 |
| 817 | Ga0496111_0007840 | 3300048914 | Bacteria | 7032 |
| 818 | Ga0496111_0012852 | 3300048914 | Bacteria | 5681 |
| 819 | Ga0496111_0017532 | 3300048914 | Bacteria | 4951 |
| 820 | Ga0496111_0022493 | 3300048914 | Bacteria | 4414 |
| 821 | Ga0496111_0040618 | 3300048914 | Bacteria | 3337 |
| 822 | Ga0496111_0043800 | 3300048914 | Bacteria | 3217 |
| 823 | Ga0496111_0060052 | 3300048914 | Bacteria | 2755 |
| 824 | Ga0496112_0002582 | 3300048915 | Bacteria | 14625 |
| 825 | Ga0496112_0004511 | 3300048915 | Bacteria | 11818 |
| 826 | Ga0496112_0005150 | 3300048915 | Bacteria | 11242 |
| 827 | Ga0496112_0013642 | 3300048915 | Bacteria | 7508 |
| 828 | Ga0496112_0013939 | 3300048915 | Bacteria | 7437 |
| 829 | Ga0496112_0014646 | 3300048915 | Bacteria | 7286 |
| 830 | Ga0496112_0034929 | 3300048915 | Bacteria | 4893 |
| 831 | Ga0496112_0035443 | 3300048915 | Bacteria | 4861 |
| 832 | Ga0496112_0074443 | 3300048915 | Bacteria | 3358 |
| 833 | Ga0496112_0117353 | 3300048915 | Bacteria | 2631 |
| 834 | Ga0496112_0270428 | 3300048915 | Bacteria | 1648 |
| 835 | Ga0496113_0026983 | 3300048916 | Bacteria | 4112 |
| 836 | Ga0496113_0036387 | 3300048916 | Bacteria | 3606 |
| 837 | Ga0496113_0038493 | 3300048916 | Bacteria | 3517 |
| 838 | Ga0496113_0064171 | 3300048916 | Bacteria | 2776 |
| 839 | Ga0496113_0133678 | 3300048916 | Bacteria | 1948 |
| 840 | Ga0496113_0159605 | 3300048916 | Bacteria | 1782 |
| 841 | Ga0496114_0002124 | 3300048917 | Bacteria | 15069 |
| 842 | Ga0496114_0022236 | 3300048917 | Bacteria | 5166 |
| 843 | Ga0496114_0075838 | 3300048917 | Bacteria | 2832 |
| 844 | Ga0496114_0295014 | 3300048917 | Bacteria | 1431 |
| 845 | Ga0496115_0014432 | 3300048918 | Bacteria | 5980 |
| 846 | Ga0496115_0220646 | 3300048918 | Bacteria | 1564 |
| 847 | Ga0496126_0029077 | 3300048929 | Bacteria | 5253 |
| 848 | Ga0501031_0009137 | 3300049568 | Bacteria | 6445 |
| 849 | Ga0501033_0008625 | 3300049570 | Bacteria | 7888 |
| 850 | Ga0501033_0107151 | 3300049570 | Bacteria | 2036 |
| 851 | Ga0501034_0015790 | 3300049571 | Bacteria | 7756 |
| 852 | Ga0501036_0110009 | 3300049572 | Bacteria | 2328 |
| 853 | Ga0501037_0011810 | 3300049573 | Bacteria | 6433 |
| 854 | Ga0501037_0074140 | 3300049573 | Bacteria | 2474 |
| 855 | Ga0501038_0016880 | 3300049574 | Bacteria | 6608 |
| 856 | Ga0501038_0177958 | 3300049574 | Bacteria | 1718 |
| 857 | Ga0501039_0134079 | 3300049575 | Bacteria | 1944 |
| 858 | Ga0501042_0040845 | 3300049578 | Bacteria | 3297 |
| 859 | Ga0501042_0095475 | 3300049578 | Bacteria | 2136 |
| 860 | Ga0501046_0011715 | 3300049580 | Bacteria | 7491 |
| 861 | Ga0501046_0150520 | 3300049580 | Bacteria | 1756 |
| 862 | Ga0501047_0041454 | 3300049581 | Bacteria | 4448 |
| 863 | Ga0501047_0051232 | 3300049581 | Bacteria | 3988 |
| 864 | Ga0501047_0125596 | 3300049581 | Bacteria | 2446 |
| 865 | Ga0501069_0045163 | 3300049585 | Bacteria | 2440 |
| 866 | Ga0501069_0107636 | 3300049585 | Bacteria | 1586 |
| 867 | Ga0501070_0090860 | 3300049586 | Bacteria | 2527 |
| 868 | Ga0501070_0134002 | 3300049586 | Bacteria | 2045 |
| 869 | Ga0501070_0313991 | 3300049586 | Bacteria | 1275 |
| 870 | Ga0501071_0090270 | 3300049587 | Bacteria | 2250 |
| 871 | Ga0501071_0095168 | 3300049587 | Bacteria | 2191 |
| 872 | Ga0501072_0007684 | 3300049588 | Bacteria | 8183 |
| 873 | Ga0501072_0036634 | 3300049588 | Bacteria | 3846 |
| 874 | Ga0501072_0040431 | 3300049588 | Bacteria | 3661 |
| 875 | Ga0501072_0082509 | 3300049588 | Bacteria | 2548 |
| 876 | Ga0501073_0015219 | 3300049589 | Bacteria | 5580 |
| 877 | Ga0501074_0200058 | 3300049590 | Bacteria | 1424 |
| 878 | Ga0501075_0008636 | 3300049591 | Bacteria | 7103 |
| 879 | Ga0501075_0119966 | 3300049591 | Bacteria | 2001 |
| 880 | Ga0501075_0128522 | 3300049591 | Bacteria | 1929 |
| 881 | Ga0501077_0003311 | 3300049593 | Bacteria | 9695 |
| 882 | Ga0501077_0049674 | 3300049593 | Bacteria | 2665 |
| 883 | Ga0501079_0143176 | 3300049741 | Bacteria | 1862 |
| 884 | Ga0501079_0186676 | 3300049741 | Bacteria | 1618 |
| 885 | Ga0501080_0016224 | 3300049742 | Bacteria | 6876 |
| 886 | Ga0501080_0083170 | 3300049742 | Bacteria | 2974 |
| 887 | Ga0501080_0213246 | 3300049742 | Bacteria | 1769 |
| 888 | Ga0501081_0010251 | 3300049743 | Bacteria | 6118 |
| 889 | Ga0501083_0052405 | 3300049744 | Bacteria | 2741 |
| 890 | Ga0501083_0106316 | 3300049744 | Bacteria | 1847 |
| 891 | Ga0501035_0019348 | 3300049822 | Bacteria | 6263 |
| 892 | Ga0501044_0027158 | 3300049823 | Bacteria | 6054 |
| 893 | Ga0501045_0042253 | 3300049824 | Bacteria | 3319 |
| 894 | nmdc:mga03683_2479_c1 | 3300050489 | Bacteria | 5081 |
| 895 | nmdc:mga0yw44_3015_c1 | 3300050492 | Bacteria | 7358 |
| 896 | nmdc:mga0k408_8682_c1 | 3300050493 | Bacteria | 5464 |
| 897 | nmdc:mga06z11_33998_c1 | 3300050494 | Bacteria | 2498 |
| 898 | nmdc:mga06z11_38208_c1 | 3300050494 | Bacteria | 2383 |
| 899 | nmdc:mga05p37_111_c2 | 3300050507 | Bacteria | 41438 |
| 900 | nmdc:mga05p37_2840_c2 | 3300050507 | Bacteria | 6883 |
| 901 | nmdc:mga05p37_349124_c1 | 3300050507 | Bacteria | 1742 |
| 902 | nmdc:mga05p37_38591_c1 | 3300050507 | Bacteria | 5859 |
| 903 | nmdc:mga05p37_6754_c1 | 3300050507 | Bacteria | 13528 |
| 904 | nmdc:mga05p37_71975_c1 | 3300050507 | Bacteria | 4254 |
| 905 | nmdc:mga09592_137_c1 | 3300050508 | Bacteria | 48140 |
| 906 | nmdc:mga09592_14833_c1 | 3300050508 | Bacteria | 6361 |
| 907 | nmdc:mga09592_186_c1 | 3300050508 | Bacteria | 44400 |
| 908 | nmdc:mga0qj67_189_c1 | 3300050509 | Bacteria | 41860 |
| 909 | nmdc:mga0qj67_26591_c1 | 3300050509 | Bacteria | 4479 |
| 910 | nmdc:mga0qj67_3744_c1 | 3300050509 | Bacteria | 10982 |
| 911 | nmdc:mga0qj67_86350_c1 | 3300050509 | Bacteria | 2517 |
| 912 | nmdc:mga06r32_107166_c1 | 3300050510 | Bacteria | 2746 |
| 913 | nmdc:mga06r32_4386_c1 | 3300050510 | Bacteria | 12619 |
| 914 | nmdc:mga06r32_84426_c1 | 3300050510 | Bacteria | 3095 |
| 915 | nmdc:mga08y16_1052_c1 | 3300050511 | Bacteria | 27127 |
| 916 | nmdc:mga08y16_128385_c1 | 3300050511 | Bacteria | 2637 |
| 917 | nmdc:mga08y16_16548_c1 | 3300050511 | Bacteria | 7758 |
| 918 | nmdc:mga08y16_4695_c1 | 3300050511 | Bacteria | 14238 |
| 919 | nmdc:mga08y16_88116_c1 | 3300050511 | Bacteria | 3234 |
| 920 | nmdc:mga08y16_91249_c1 | 3300050511 | Bacteria | 3175 |
| 921 | nmdc:mga0n895_29540_c1 | 3300050512 | Bacteria | 5230 |
| 922 | nmdc:mga0n895_6052_c1 | 3300050512 | Bacteria | 10200 |
| 923 | nmdc:mga0rr50_200588_c1 | 3300050513 | Bacteria | 1639 |
| 924 | nmdc:mga0rr50_324395_c1 | 3300050513 | Bacteria | 1291 |
| 925 | nmdc:mga08x19_18_c1 | 3300050514 | Bacteria | 321445 |
| 926 | nmdc:mga0a205_2281_c1 | 3300050515 | Bacteria | 16910 |
| 927 | nmdc:mga0a205_3471_c1 | 3300050515 | Bacteria | 14082 |
| 928 | Ga0495601_0000014 | 3300053077 | Bacteria | 220318 |
| 929 | Ga0495601_0000114 | 3300053077 | Bacteria | 44359 |
| 930 | Ga0495601_0003125 | 3300053077 | Bacteria | 9464 |
| 931 | Ga0495601_0003240 | 3300053077 | Bacteria | 9298 |
| 932 | Ga0495601_0005625 | 3300053077 | Bacteria | 7308 |
| 933 | Ga0495601_0007472 | 3300053077 | Bacteria | 6412 |
| 934 | Ga0495601_0013583 | 3300053077 | Bacteria | 4898 |
| 935 | Ga0495601_0070554 | 3300053077 | Bacteria | 2230 |
| 936 | Ga0495601_0075227 | 3300053077 | Bacteria | 2161 |
| 937 | Ga0495601_0112810 | 3300053077 | Bacteria | 1761 |
| 938 | Ga0495601_0114131 | 3300053077 | Bacteria | 1751 |
| 939 | Ga0495612_0000014 | 3300053078 | Bacteria | 187444 |
| 940 | Ga0495612_0001226 | 3300053078 | Bacteria | 10568 |
| 941 | Ga0495612_0002041 | 3300053078 | Bacteria | 8319 |
| 942 | Ga0495612_0016843 | 3300053078 | Bacteria | 2928 |
| 943 | Ga0495655_0000761 | 3300053083 | Bacteria | 5066 |
| 944 | Ga0495655_0002639 | 3300053083 | Bacteria | 2875 |
| 945 | Ga0495595_0000209 | 3300053084 | Bacteria | 23600 |
| 946 | Ga0495595_0000388 | 3300053084 | Bacteria | 16679 |
| 947 | Ga0495595_0003019 | 3300053084 | Bacteria | 6655 |
| 948 | Ga0495595_0004730 | 3300053084 | Bacteria | 5475 |
| 949 | Ga0495595_0021769 | 3300053084 | Bacteria | 2805 |
| 950 | Ga0495595_0033113 | 3300053084 | Bacteria | 2330 |
| 951 | Ga0495619_0000006 | 3300053085 | Bacteria | 384835 |
| 952 | Ga0495619_0000201 | 3300053085 | Bacteria | 43295 |
| 953 | Ga0495619_0000206 | 3300053085 | Bacteria | 42730 |
| 954 | Ga0495619_0000722 | 3300053085 | Bacteria | 21605 |
| 955 | Ga0495619_0006050 | 3300053085 | Bacteria | 7665 |
| 956 | Ga0495619_0006889 | 3300053085 | Bacteria | 7186 |
| 957 | Ga0495619_0013349 | 3300053085 | Bacteria | 5175 |
| 958 | Ga0495619_0019963 | 3300053085 | Bacteria | 4263 |
| 959 | Ga0495619_0061651 | 3300053085 | Bacteria | 2495 |
| 960 | Ga0495619_0079231 | 3300053085 | Bacteria | 2209 |
| 961 | Ga0500643_004738 | 3300053087 | Bacteria | 6043 |
| 962 | Ga0500644_0000868 | 3300053088 | Bacteria | 9893 |
| 963 | Ga0500566_0063148 | 3300053094 | Bacteria | 2092 |
| 964 | Ga0500566_0116592 | 3300053094 | Bacteria | 1445 |
| 965 | Ga0500641_0009044 | 3300053096 | Bacteria | 3573 |
| 966 | Ga0500641_0042002 | 3300053096 | Bacteria | 1851 |
| 967 | Ga0500593_034322 | 3300053117 | Bacteria | 2270 |
| 968 | Ga0500595_000001 | 3300053119 | Bacteria | 1088438 |
| 969 | Ga0500652_002348 | 3300053131 | Bacteria | 5691 |
| 970 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 971 | Ga0500616_0004491 | 3300053153 | Bacteria | 9918 |
| 972 | Ga0500616_0011353 | 3300053153 | Bacteria | 5267 |
| 973 | Ga0500616_0075126 | 3300053153 | Bacteria | 1711 |
| 974 | Ga0500645_002616 | 3300053730 | Bacteria | 7886 |
| 975 | Ga0501082_0000101 | 3300060353 | Bacteria | 66608 |
| 976 | Ga0501082_0057559 | 3300060353 | Bacteria | 3349 |
| 977 | Ga0530510_0010924 | 3300061734 | Bacteria | 6370 |
| 978 | Ga0530510_0022984 | 3300061734 | Bacteria | 4443 |
| 979 | Ga0530510_0037126 | 3300061734 | Bacteria | 3512 |
| 980 | Ga0530510_0293664 | 3300061734 | Bacteria | 1215 |
| 981 | 2643758102 | 2643221547 | Bacteria | 4740017 |
| 982 | Ga0500595_005256 | |||
| 983 | JGI24743J22301_10000156 | |||
| 984 | JGI24735J21928_10032367 | |||
| 985 | JGI24745J21846_1004712 | |||
| 986 | JGI24034J26672_10007496 | |||
| 987 | JGI25153J46596_10004094 | |||
| 988 | Ga0065712_10016690 | |||
| 989 | Ga0070658_10012382 | |||
| 990 | Ga0070676_10051884 | |||
| 991 | Ga0070676_10163196 | |||
| 992 | Ga0070683_100006896 | |||
| 993 | Ga0070690_100000558 | |||
| 994 | Ga0070670_100000979 | |||
| 995 | Ga0070670_100001578 | |||
| 996 | Ga0070666_10006074 | |||
| 997 | Ga0070666_10008718 | |||
| 998 | Ga0070680_100158541 | |||
| 999 | Ga0070682_100038875 | |||
| 1000 | Ga0070682_100117653 | |||
| 1001 | Ga0070682_100136163 | |||
| 1002 | Ga0070660_100001799 | |||
| 1003 | Ga0070689_100002716 | |||
| 1004 | Ga0070689_100010006 | |||
| 1005 | Ga0070691_10000644 | |||
| 1006 | Ga0070687_100014882 | |||
| 1007 | Ga0070661_100001359 | |||
| 1008 | Ga0070661_100071509 | |||
| 1009 | Ga0070668_100001182 | |||
| 1010 | Ga0070669_100003948 | |||
| 1011 | Ga0070675_100024608 | |||
| 1012 | Ga0070675_100044142 | |||
| 1013 | Ga0070671_100001927 | |||
| 1014 | Ga0070671_100011878 | |||
| 1015 | Ga0070674_100000058 | |||
| 1016 | Ga0070674_100005637 | |||
| 1017 | Ga0070688_100000218 | |||
| 1018 | Ga0070688_100018942 | |||
| 1019 | Ga0070688_100048906 | |||
| 1020 | Ga0070688_100077238 | |||
| 1021 | Ga0070659_100002352 | |||
| 1022 | Ga0070659_100113535 | |||
| 1023 | Ga0070667_100002856 | |||
| 1024 | Ga0070667_100057389 | |||
| 1025 | Ga0070667_100143116 | |||
| 1026 | Ga0070667_100296619 | |||
| 1027 | Ga0070703_10012982 | |||
| 1028 | Ga0070709_10006392 | |||
| 1029 | Ga0070709_10013483 | |||
| 1030 | Ga0070714_100018528 | |||
| 1031 | Ga0070714_100039575 | |||
| 1032 | Ga0070714_100118279 | |||
| 1033 | Ga0070713_100010106 | |||
| 1034 | Ga0070713_100147820 | |||
| 1035 | Ga0070710_10005197 | |||
| 1036 | Ga0070710_10025798 | |||
| 1037 | Ga0070710_10041928 | |||
| 1038 | Ga0070710_10053732 | |||
| 1039 | Ga0070701_10000167 | |||
| 1040 | Ga0070701_10062845 | |||
| 1041 | Ga0070711_100000323 | |||
| 1042 | Ga0070711_100070532 | |||
| 1043 | Ga0070705_100000244 | |||
| 1044 | Ga0070705_100060600 | |||
| 1045 | Ga0070700_100001251 | |||
| 1046 | Ga0070663_100001197 | |||
| 1047 | Ga0070663_100042340 | |||
| 1048 | Ga0070678_100001828 | |||
| 1049 | Ga0070678_100045621 | |||
| 1050 | Ga0070678_100051537 | |||
| 1051 | Ga0070678_100088435 | |||
| 1052 | Ga0070662_100006177 | |||
| 1053 | Ga0070662_100042122 | |||
| 1054 | Ga0068867_100006046 | |||
| 1055 | Ga0070685_10011559 | |||
| 1056 | Ga0070707_100125559 | |||
| 1057 | Ga0070699_100088261 | |||
| 1058 | Ga0070679_100019429 | |||
| 1059 | Ga0070679_100134556 | |||
| 1060 | Ga0070679_100135343 | |||
| 1061 | Ga0070697_100047277 | |||
| 1062 | Ga0068853_100002111 | |||
| 1063 | Ga0070672_100000706 | |||
| 1064 | Ga0070672_100068468 | |||
| 1065 | Ga0070672_100133581 | |||
| 1066 | Ga0070686_100001736 | |||
| 1067 | Ga0070686_100010032 | |||
| 1068 | Ga0070686_100240633 | |||
| 1069 | Ga0070695_100000525 | |||
| 1070 | Ga0070695_100030231 | |||
| 1071 | Ga0070695_100076682 | |||
| 1072 | Ga0070696_100064756 | |||
| 1073 | Ga0070693_100001001 | |||
| 1074 | Ga0070665_100005010 | |||
| 1075 | Ga0070665_100164150 | |||
| 1076 | Ga0070704_100002514 | |||
| 1077 | Ga0068855_100009765 | |||
| 1078 | Ga0068855_100045320 | |||
| 1079 | Ga0068855_100108655 | |||
| 1080 | Ga0070664_100002019 | |||
| 1081 | Ga0070664_100102159 | |||
| 1082 | Ga0070664_100270193 | |||
| 1083 | Ga0068857_100002505 | |||
| 1084 | Ga0068856_100001461 | |||
| 1085 | Ga0070702_100000160 | |||
| 1086 | Ga0068852_100011281 | |||
| 1087 | Ga0068859_100009742 | |||
| 1088 | Ga0068859_100017077 | |||
| 1089 | Ga0068859_100211451 | |||
| 1090 | Ga0068864_100021520 | |||
| 1091 | Ga0068866_10086755 | |||
| 1092 | Ga0068866_10128541 | |||
| 1093 | Ga0068861_100001540 | |||
| 1094 | Ga0068861_100011029 | |||
| 1095 | Ga0068861_100153772 | |||
| 1096 | Ga0068863_100041725 | |||
| 1097 | Ga0068863_100082916 | |||
| 1098 | Ga0068858_100002070 | |||
| 1099 | Ga0068858_100023618 | |||
| 1100 | Ga0068858_100082451 | |||
| 1101 | Ga0068858_100107445 | |||
| 1102 | Ga0068860_100001211 | |||
| 1103 | Ga0068862_100001219 | |||
| 1104 | Ga0081455_10000002 | |||
| 1105 | Ga0081455_10003269 | |||
| 1106 | Ga0081455_10003984 | |||
| 1107 | Ga0081455_10004134 | |||
| 1108 | Ga0081455_10039925 | |||
| 1109 | Ga0081455_10046596 | |||
| 1110 | Ga0081455_10077732 | |||
| 1111 | Ga0081538_10001982 | |||
| 1112 | Ga0081538_10007700 | |||
| 1113 | Ga0081538_10059381 | |||
| 1114 | Ga0081540_1000038 | |||
| 1115 | Ga0070717_10001529 | |||
| 1116 | Ga0075365_10002715 | |||
| 1117 | Ga0075365_10061635 | |||
| 1118 | Ga0075363_100103359 | |||
| 1119 | Ga0075432_10005584 | |||
| 1120 | Ga0070715_10000087 | |||
| 1121 | Ga0070715_10023047 | |||
| 1122 | Ga0070716_100001096 | |||
| 1123 | Ga0070716_100032888 | |||
| 1124 | Ga0070712_100000402 | |||
| 1125 | Ga0070712_100003821 | |||
| 1126 | Ga0070712_100072540 | |||
| 1127 | Ga0075367_10091291 | |||
| 1128 | Ga0075427_10000093 | |||
| 1129 | Ga0075366_10009417 | |||
| 1130 | Ga0097621_100032235 | |||
| 1131 | Ga0097621_100094266 | |||
| 1132 | Ga0075428_100001888 | |||
| 1133 | Ga0075428_100041680 | |||
| 1134 | Ga0075428_100047155 | |||
| 1135 | Ga0075428_100154629 | |||
| 1136 | Ga0075430_100000014 | |||
| 1137 | Ga0075430_100003974 | |||
| 1138 | Ga0075431_100003756 | |||
| 1139 | Ga0075431_100005449 | |||
| 1140 | Ga0075431_100023150 | |||
| 1141 | Ga0075431_100042376 | |||
| 1142 | Ga0075431_100072515 | |||
| 1143 | Ga0075433_10000100 | |||
| 1144 | Ga0075433_10211927 | |||
| 1145 | Ga0075434_100002146 | |||
| 1146 | Ga0075434_100013424 | |||
| 1147 | Ga0075434_100040797 | |||
| 1148 | Ga0075434_100055889 | |||
| 1149 | Ga0075434_100141269 | |||
| 1150 | Ga0075434_100201307 | |||
| 1151 | Ga0075429_100000134 | |||
| 1152 | Ga0075429_100004155 | |||
| 1153 | Ga0068865_100002320 | |||
| 1154 | Ga0068865_100016421 | |||
| 1155 | Ga0068865_100020413 | |||
| 1156 | Ga0068865_100059010 | |||
| 1157 | Ga0097620_100009742 | |||
| 1158 | Ga0097620_100017077 | |||
| 1159 | Ga0097620_100211446 | |||
| 1160 | Ga0075435_100001103 | |||
| 1161 | Ga0075435_100016405 | |||
| 1162 | Ga0075435_100062137 | |||
| 1163 | Ga0075435_100073107 | |||
| 1164 | Ga0075435_100223113 | |||
| 1165 | Ga0105250_10008146 | |||
| 1166 | Ga0105240_10166536 | |||
| 1167 | Ga0111539_10002127 | |||
| 1168 | Ga0111539_10010658 | |||
| 1169 | Ga0111539_10053340 | |||
| 1170 | Ga0111539_10054322 | |||
| 1171 | Ga0111539_10133877 | |||
| 1172 | Ga0111539_10134097 | |||
| 1173 | Ga0105245_10008866 | |||
| 1174 | Ga0105245_10009264 | |||
| 1175 | Ga0105245_10224957 | |||
| 1176 | Ga0105247_10000434 | |||
| 1177 | Ga0105247_10004142 | |||
| 1178 | Ga0114129_10000346 | |||
| 1179 | Ga0114129_10011877 | |||
| 1180 | Ga0114129_10018730 | |||
| 1181 | Ga0114129_10034682 | |||
| 1182 | Ga0114129_10134293 | |||
| 1183 | Ga0114129_10244525 | |||
| 1184 | Ga0105243_10000507 | |||
| 1185 | Ga0105243_10011435 | |||
| 1186 | Ga0105243_10052142 | |||
| 1187 | Ga0105241_10005818 | |||
| 1188 | Ga0105241_10019674 | |||
| 1189 | Ga0105241_10037524 | |||
| 1190 | Ga0105242_10004899 | |||
| 1191 | Ga0105242_10019865 | |||
| 1192 | Ga0105242_10023965 | |||
| 1193 | Ga0105242_10099868 | |||
| 1194 | Ga0105248_10000988 | |||
| 1195 | Ga0105248_10020493 | |||
| 1196 | Ga0105248_10144815 | |||
| 1197 | Ga0105237_10009394 | |||
| 1198 | Ga0105237_10037197 | |||
| 1199 | Ga0105238_10002082 | |||
| 1200 | Ga0105249_10000532 | |||
| 1201 | Ga0105239_10005098 | |||
| 1202 | Ga0105246_10003283 | |||
| 1203 | Ga0105246_10028822 | |||
| 1204 | Ga0105246_10269594 | |||
| 1205 | Ga0157371_10239902 | |||
| 1206 | Ga0157369_10010140 | |||
| 1207 | Ga0157374_10012940 | |||
| 1208 | Ga0157374_10029231 | |||
| 1209 | Ga0157374_10168293 | |||
| 1210 | Ga0157378_10006397 | |||
| 1211 | Ga0157378_10120370 | |||
| 1212 | Ga0163162_10003596 | |||
| 1213 | Ga0163162_10151937 | |||
| 1214 | Ga0163162_10347885 | |||
| 1215 | Ga0157372_10004090 | |||
| 1216 | Ga0157375_10025538 | |||
| 1217 | Ga0157375_10086589 | |||
| 1218 | Ga0157375_10089891 | |||
| 1219 | Ga0163163_10024496 | |||
| 1220 | Ga0163163_10098613 | |||
| 1221 | Ga0163163_10193457 | |||
| 1222 | Ga0163163_10388195 | |||
| 1223 | Ga0157380_10006562 | |||
| 1224 | Ga0157380_10044750 | |||
| 1225 | Ga0157380_10131628 | |||
| 1226 | Ga0157380_10177218 | |||
| 1227 | Ga0157377_10005295 | |||
| 1228 | Ga0157379_10002179 | |||
| 1229 | Ga0157376_10000635 | |||
| 1230 | Ga0157376_10000870 | |||
| 1231 | Ga0157376_10008015 | |||
| 1232 | Ga0163161_10007111 | |||
| 1233 | Ga0224572_1001703 | |||
| 1234 | Ga0228598_1000862 | |||
| 1235 | Ga0209758_1000634 | |||
| 1236 | Ga0207682_10002570 | |||
| 1237 | Ga0207692_10011923 | |||
| 1238 | Ga0207642_10055174 | |||
| 1239 | Ga0207710_10024063 | |||
| 1240 | Ga0207710_10027186 | |||
| 1241 | Ga0207688_10000117 | |||
| 1242 | Ga0207688_10002148 | |||
| 1243 | Ga0207688_10015078 | |||
| 1244 | Ga0207680_10006436 | |||
| 1245 | Ga0207647_10001715 | |||
| 1246 | Ga0207647_10012551 | |||
| 1247 | Ga0207685_10000153 | |||
| 1248 | Ga0207699_10008009 | |||
| 1249 | Ga0207645_10003330 | |||
| 1250 | Ga0207645_10022721 | |||
| 1251 | Ga0207645_10042976 | |||
| 1252 | Ga0207645_10154140 | |||
| 1253 | Ga0207643_10000291 | |||
| 1254 | Ga0207705_10026919 | |||
| 1255 | Ga0207705_10068034 | |||
| 1256 | Ga0207654_10006050 | |||
| 1257 | Ga0207654_10019490 | |||
| 1258 | Ga0207695_10074221 | |||
| 1259 | Ga0207695_10146905 | |||
| 1260 | Ga0207671_10011961 | |||
| 1261 | Ga0207671_10062945 | |||
| 1262 | Ga0207693_10000881 | |||
| 1263 | Ga0207693_10001247 | |||
| 1264 | Ga0207693_10005019 | |||
| 1265 | Ga0207693_10016774 | |||
| 1266 | Ga0207693_10069958 | |||
| 1267 | Ga0207663_10007911 | |||
| 1268 | Ga0207663_10119852 | |||
| 1269 | Ga0207660_10018006 | |||
| 1270 | Ga0207662_10010121 | |||
| 1271 | Ga0207662_10010412 | |||
| 1272 | Ga0207657_10000283 | |||
| 1273 | Ga0207657_10019360 | |||
| 1274 | Ga0207657_10019364 | |||
| 1275 | Ga0207657_10037253 | |||
| 1276 | Ga0207657_10111482 | |||
| 1277 | Ga0207649_10137777 | |||
| 1278 | Ga0207649_10198934 | |||
| 1279 | Ga0207652_10009448 | |||
| 1280 | Ga0207652_10175883 | |||
| 1281 | Ga0207694_10079505 | |||
| 1282 | Ga0207694_10151667 | |||
| 1283 | Ga0207650_10017312 | |||
| 1284 | Ga0207650_10023701 | |||
| 1285 | Ga0207659_10015793 | |||
| 1286 | Ga0207659_10199985 | |||
| 1287 | Ga0207687_10001484 | |||
| 1288 | Ga0207687_10052682 | |||
| 1289 | Ga0207687_10173315 | |||
| 1290 | Ga0207700_10026657 | |||
| 1291 | Ga0207700_10053545 | |||
| 1292 | Ga0207700_10109389 | |||
| 1293 | Ga0207700_10163239 | |||
| 1294 | Ga0207664_10019226 | |||
| 1295 | Ga0207644_10009276 | |||
| 1296 | Ga0207644_10012653 | |||
| 1297 | Ga0207644_10077422 | |||
| 1298 | Ga0207690_10000979 | |||
| 1299 | Ga0207706_10000356 | |||
| 1300 | Ga0207706_10003343 | |||
| 1301 | Ga0207706_10014147 | |||
| 1302 | Ga0207706_10065375 | |||
| 1303 | Ga0207706_10105069 | |||
| 1304 | Ga0207686_10007710 | |||
| 1305 | Ga0207686_10077699 | |||
| 1306 | Ga0207670_10003090 | |||
| 1307 | Ga0207670_10023776 | |||
| 1308 | Ga0207670_10140385 | |||
| 1309 | Ga0207669_10006455 | |||
| 1310 | Ga0207704_10002703 | |||
| 1311 | Ga0207704_10066545 | |||
| 1312 | Ga0207665_10000126 | |||
| 1313 | Ga0207665_10001033 | |||
| 1314 | Ga0207665_10003918 | |||
| 1315 | Ga0207665_10005132 | |||
| 1316 | Ga0207665_10055539 | |||
| 1317 | Ga0207691_10001803 | |||
| 1318 | Ga0207691_10002007 | |||
| 1319 | Ga0207691_10168412 | |||
| 1320 | Ga0207711_10006946 | |||
| 1321 | Ga0207711_10064057 | |||
| 1322 | Ga0207711_10173668 | |||
| 1323 | Ga0207689_10106289 | |||
| 1324 | Ga0207661_10022478 | |||
| 1325 | Ga0207679_10000723 | |||
| 1326 | Ga0207679_10018266 | |||
| 1327 | Ga0207667_10044472 | |||
| 1328 | Ga0207667_10046220 | |||
| 1329 | Ga0207651_10002177 | |||
| 1330 | Ga0207651_10016491 | |||
| 1331 | Ga0207651_10045982 | |||
| 1332 | Ga0207651_10159969 | |||
| 1333 | Ga0207712_10001203 | |||
| 1334 | Ga0207712_10005373 | |||
| 1335 | Ga0207712_10028253 | |||
| 1336 | Ga0207668_10002870 | |||
| 1337 | Ga0207658_10004660 | |||
| 1338 | Ga0207658_10022591 | |||
| 1339 | Ga0207677_10052988 | |||
| 1340 | Ga0207677_10061815 | |||
| 1341 | Ga0207677_10065660 | |||
| 1342 | Ga0207639_10007206 | |||
| 1343 | Ga0207639_10091376 | |||
| 1344 | Ga0207678_10000230 | |||
| 1345 | Ga0207678_10001162 | |||
| 1346 | Ga0207678_10008097 | |||
| 1347 | Ga0207708_10001029 | |||
| 1348 | Ga0207708_10289420 | |||
| 1349 | Ga0207702_10149512 | |||
| 1350 | Ga0207641_10154259 | |||
| 1351 | Ga0207648_10008355 | |||
| 1352 | Ga0207648_10025466 | |||
| 1353 | Ga0207648_10127215 | |||
| 1354 | Ga0207676_10005037 | |||
| 1355 | Ga0207676_10006878 | |||
| 1356 | Ga0207676_10090720 | |||
| 1357 | Ga0207674_10001870 | |||
| 1358 | Ga0207675_100000291 | |||
| 1359 | Ga0207675_100002392 | |||
| 1360 | Ga0207675_100076480 | |||
| 1361 | Ga0207675_100199564 | |||
| 1362 | Ga0207675_100280486 | |||
| 1363 | Ga0207683_10000224 | |||
| 1364 | Ga0207683_10000918 | |||
| 1365 | Ga0207683_10004123 | |||
| 1366 | Ga0207683_10016035 | |||
| 1367 | Ga0207698_10008961 | |||
| 1368 | Ga0209966_1004663 | |||
| 1369 | Ga0207428_10000146 | |||
| 1370 | Ga0207428_10001111 | |||
| 1371 | Ga0207428_10078019 | |||
| 1372 | Ga0268266_10012502 | |||
| 1373 | Ga0268266_10064014 | |||
| 1374 | Ga0268266_10073167 | |||
| 1375 | Ga0268265_10061863 | |||
| 1376 | Ga0268265_10110659 | |||
| 1377 | Ga0268264_10090521 | |||
| 1378 | Ga0268264_10239220 | |||
| 1379 | Ga0268264_10322443 | |||
| 1380 | Ga0265337_1000432 | |||
| 1381 | Ga0265338_10008028 | |||
| 1382 | Ga0265338_10027700 | |||
| 1383 | Ga0265332_10000579 | |||
| 1384 | Ga0265325_10000061 | |||
| 1385 | Ga0265325_10000095 | |||
| 1386 | Ga0265325_10038667 | |||
| 1387 | Ga0265325_10043458 | |||
| 1388 | Ga0265325_10072401 | |||
| 1389 | Ga0265329_10006309 | |||
| 1390 | Ga0265340_10005569 | |||
| 1391 | Ga0265340_10081382 | |||
| 1392 | Ga0265339_10000096 | |||
| 1393 | Ga0265339_10016063 | |||
| 1394 | Ga0265339_10025710 | |||
| 1395 | Ga0265339_10031656 | |||
| 1396 | Ga0265331_10012531 | |||
| 1397 | Ga0265316_10031748 | |||
| 1398 | Ga0265316_10076304 | |||
| 1399 | Ga0265316_10106173 | |||
| 1400 | Ga0265313_10000024 | |||
| 1401 | Ga0265313_10000175 | |||
| 1402 | Ga0265313_10005539 | |||
| 1403 | Ga0265313_10007089 | |||
| 1404 | Ga0265313_10011767 | |||
| 1405 | Ga0265313_10018635 | |||
| 1406 | Ga0265314_10005900 | |||
| 1407 | Ga0265314_10008374 | |||
| 1408 | Ga0265314_10017726 | |||
| 1409 | Ga0265342_10000230 | |||
| 1410 | Ga0265342_10003205 | |||
| 1411 | Ga0265342_10009771 | |||
| 1412 | Ga0265342_10017392 | |||
| 1413 | Ga0265342_10021232 | |||
| 1414 | Ga0265342_10083405 | |||
| 1415 | Ga0316578_10008274 | |||
| 1416 | Ga0316583_10003031 | |||
| 1417 | Ga0373950_0003331 | |||
| 1418 | Ga0373926_0002171 | |||
| 1419 | Ga0373926_0019600 | |||
| 1420 | Ga0373934_0025972 | |||
| 1421 | Ga0373944_0004645 | |||
| 1422 | Ga0373944_0010909 | |||
| 1423 | Ga0373923_0007776 | |||
| 1424 | Ga0373923_0044654 | |||
| 1425 | Ga0373932_0019057 | |||
| 1426 | Ga0373936_0007766 | |||
| 1427 | Ga0373945_0004476 | |||
| 1428 | Ga0373945_0006672 | |||
| 1429 | Ga0373945_0012060 | |||
| 1430 | Ga0373945_0015836 | |||
| 1431 | Ga0373953_0002959 | |||
| 1432 | Ga0373953_0003903 | |||
| 1433 | Ga0373953_0005928 | |||
| 1434 | Ga0373954_0000652 | |||
| 1435 | Ga0373954_0010209 | |||
| 1436 | Ga0373954_0016056 | |||
| 1437 | Ga0373954_0083993 | |||
| 1438 | Ga0373956_0051054 | |||
| 1439 | Ga0373957_0002587 | |||
| 1440 | Ga0373960_0029074 | |||
| 1441 | Ga0373943_0000604 | |||
| 1442 | Ga0373943_0007961 | |||
| 1443 | Ga0373943_0011204 | |||
| 1444 | Ga0373943_0013744 | |||
| 1445 | Ga0373943_0027412 | |||
| 1446 | Ga0373946_0001074 | |||
| 1447 | Ga0373946_0010837 | |||
| 1448 | Ga0373946_0011493 | |||
| 1449 | Ga0373946_0030922 | |||
| 1450 | Ga0373946_0087420 | |||
| 1451 | Ga0373955_0002386 | |||
| 1452 | Ga0373955_0002535 | |||
| 1453 | Ga0373955_0004154 | |||
| 1454 | Ga0373955_0022528 | |||
| 1455 | Ga0316574_0000481 | |||
| 1456 | Ga0373924_0000895 | |||
| 1457 | Ga0373924_0012276 | |||
| 1458 | Ga0373931_0004642 | |||
| 1459 | Ga0373931_0020346 | |||
| 1460 | Ga0373931_0099914 | |||
| 1461 | Ga0373935_0000021 | |||
| 1462 | Ga0373935_0037893 | |||
| 1463 | Ga0373927_0000113 | |||
| 1464 | Ga0373927_0044176 | |||
| 1465 | Ga0373933_0001968 | |||
| 1466 | Ga0373933_0004870 | |||
| 1467 | Ga0373933_0007848 | |||
| 1468 | Ga0373933_0026536 | |||
| 1469 | Ga0373947_0000168 | |||
| 1470 | Ga0373947_0001421 | |||
| 1471 | Ga0373947_0020440 | |||
| 1472 | Ga0373947_0040937 | |||
| 1473 | Ga0373947_0072336 | |||
| 1474 | Ga0373947_0123813 | |||
| 1475 | Ga0373937_0000003 | |||
| 1476 | Ga0373937_0000814 | |||
| 1477 | Ga0373937_0001531 | |||
| 1478 | Ga0373937_0001859 | |||
| 1479 | Ga0373937_0002824 | |||
| 1480 | Ga0373937_0015768 | |||
| 1481 | Ga0373937_0041271 | |||
| 1482 | Ga0373937_0195168 | |||
| 1483 | Ga0316584_0032982 | |||
| 1484 | Ga0373925_0006331 | |||
| 1485 | Ga0373925_0011827 | |||
| 1486 | Ga0373925_0039691 | |||
| 1487 | Ga0373925_0046849 | |||
| 1488 | Ga0395899_0045822 | |||
| 1489 | Ga0395900_0000709 | |||
| 1490 | Ga0395900_0114680 | |||
| 1491 | Ga0395900_0256867 | |||
| 1492 | Ga0395898_0015930 | |||
| 1493 | Ga0395898_0020062 | |||
| 1494 | Ga0395898_0145863 | |||
| 1495 | Ga0395898_0336073 | |||
| 1496 | Ga0395905_0001849 | |||
| 1497 | Ga0436364_0455303 | |||
| 1498 | Ga0436364_1417851 | |||
| 1499 | Ga0395901_0009794 | |||
| 1500 | Ga0395901_0127089 | |||
| 1501 | Ga0436365_0558591 | |||
| 1502 | Ga0436365_0823547 | |||
| 1503 | Ga0436365_1845974 | |||
| 1504 | Ga0436360_1374180 | |||
| 1505 | Ga0436361_0026887 | |||
| 1506 | Ga0436361_0370811 | |||
| 1507 | Ga0436361_0570308 | |||
| 1508 | Ga0436363_0479002 | |||
| 1509 | Ga0439453_0000762 | |||
| 1510 | Ga0439443_013414 | |||
| 1511 | Ga0466966_0017375 | |||
| 1512 | Ga0466961_0100503 | |||
| 1513 | Ga0466963_0004364 | |||
| 1514 | Ga0466971_0026503 | |||
| 1515 | Ga0466959_0049316 | |||
| 1516 | Ga0495617_004347 | |||
| 1517 | Ga0495592_0000951 | |||
| 1518 | Ga0495592_0003642 | |||
| 1519 | Ga0495592_0016294 | |||
| 1520 | Ga0495592_0094370 | |||
| 1521 | Ga0495603_0000007 | |||
| 1522 | Ga0495603_0008477 | |||
| 1523 | Ga0495603_0077322 | |||
| 1524 | Ga0495629_0000230 | |||
| 1525 | Ga0495629_0000637 | |||
| 1526 | Ga0495629_0001246 | |||
| 1527 | Ga0495629_0024806 | |||
| 1528 | Ga0495629_0085455 | |||
| 1529 | Ga0495629_0145166 | |||
| 1530 | Ga0495638_0081156 | |||
| 1531 | Ga0495641_0026314 | |||
| 1532 | Ga0495651_0000514 | |||
| 1533 | Ga0495651_0000728 | |||
| 1534 | Ga0495651_0002980 | |||
| 1535 | Ga0495651_0011196 | |||
| 1536 | Ga0495651_0031414 | |||
| 1537 | Ga0495651_0033609 | |||
| 1538 | Ga0495651_0085195 | |||
| 1539 | Ga0495653_0000039 | |||
| 1540 | Ga0495653_0000928 | |||
| 1541 | Ga0495653_0006559 | |||
| 1542 | Ga0495580_0001029 | |||
| 1543 | Ga0495582_0000282 | |||
| 1544 | Ga0495582_0009247 | |||
| 1545 | Ga0495639_0004064 | |||
| 1546 | Ga0495639_0009235 | |||
| 1547 | Ga0495662_0007427 | |||
| 1548 | Ga0495662_0024340 | |||
| 1549 | Ga0495662_0025235 | |||
| 1550 | Ga0495664_0000015 | |||
| 1551 | Ga0495664_0001694 | |||
| 1552 | Ga0495584_0005034 | |||
| 1553 | Ga0495584_0008203 | |||
| 1554 | Ga0495584_0011909 | |||
| 1555 | Ga0495585_0007183 | |||
| 1556 | Ga0495585_0030411 | |||
| 1557 | Ga0495594_0001475 | |||
| 1558 | Ga0495607_0013013 | |||
| 1559 | Ga0495607_0015734 | |||
| 1560 | Ga0495583_0077310 | |||
| 1561 | Ga0495608_0000828 | |||
| 1562 | Ga0495608_0001366 | |||
| 1563 | Ga0495608_0007452 | |||
| 1564 | Ga0495608_0043610 | |||
| 1565 | Ga0495608_0063937 | |||
| 1566 | Ga0495618_0000040 | |||
| 1567 | Ga0495618_0003496 | |||
| 1568 | Ga0495618_0004258 | |||
| 1569 | Ga0495618_0009575 | |||
| 1570 | Ga0495628_0000011 | |||
| 1571 | Ga0495628_0015093 | |||
| 1572 | Ga0495628_0016697 | |||
| 1573 | Ga0495628_0034383 | |||
| 1574 | Ga0495628_0114065 | |||
| 1575 | Ga0495628_0154444 | |||
| 1576 | Ga0495630_0018517 | |||
| 1577 | Ga0495630_0020607 | |||
| 1578 | Ga0495630_0054217 | |||
| 1579 | Ga0495631_0064605 | |||
| 1580 | Ga0495637_0009381 | |||
| 1581 | Ga0495644_0000207 | |||
| 1582 | Ga0495644_0007281 | |||
| 1583 | Ga0495666_0017461 | |||
| 1584 | Ga0495666_0056573 | |||
| 1585 | Ga0495652_0000014 | |||
| 1586 | Ga0495652_0004995 | |||
| 1587 | Ga0495652_0086281 | |||
| 1588 | Ga0495665_0011731 | |||
| 1589 | Ga0495640_0000008 | |||
| 1590 | Ga0495640_0002965 | |||
| 1591 | Ga0495640_0011428 | |||
| 1592 | Ga0495640_0060940 | |||
| 1593 | Ga0495640_0097920 | |||
| 1594 | Ga0495586_0134360 | |||
| 1595 | Ga0495587_0000015 | |||
| 1596 | Ga0495587_0003782 | |||
| 1597 | Ga0495587_0014883 | |||
| 1598 | Ga0495587_0036527 | |||
| 1599 | Ga0495587_0120577 | |||
| 1600 | Ga0495598_0001615 | |||
| 1601 | Ga0495598_0005602 | |||
| 1602 | Ga0495598_0011091 | |||
| 1603 | Ga0495645_0000205 | |||
| 1604 | Ga0495645_0006238 | |||
| 1605 | Ga0495645_0020829 | |||
| 1606 | Ga0495645_0127082 | |||
| 1607 | Ga0495645_0134683 | |||
| 1608 | Ga0495645_0224424 | |||
| 1609 | Ga0495622_0001237 | |||
| 1610 | Ga0495622_0005346 | |||
| 1611 | Ga0495622_0006378 | |||
| 1612 | Ga0495633_0011556 | |||
| 1613 | Ga0495633_0024402 | |||
| 1614 | Ga0495667_0000013 | |||
| 1615 | Ga0495667_0009130 | |||
| 1616 | Ga0495667_0010115 | |||
| 1617 | Ga0495667_0036530 | |||
| 1618 | Ga0495667_0059839 | |||
| 1619 | Ga0495667_0066249 | |||
| 1620 | Ga0495656_0000115 | |||
| 1621 | Ga0495634_0005029 | |||
| 1622 | Ga0495634_0005103 | |||
| 1623 | Ga0495634_0005808 | |||
| 1624 | Ga0495634_0018918 | |||
| 1625 | Ga0495634_0023133 | |||
| 1626 | Ga0495634_0023225 | |||
| 1627 | Ga0495634_0040947 | |||
| 1628 | Ga0495634_0084990 | |||
| 1629 | Ga0495634_0101536 | |||
| 1630 | Ga0495611_0000905 | |||
| 1631 | Ga0495635_0000012 | |||
| 1632 | Ga0495635_0009166 | |||
| 1633 | Ga0495635_0011301 | |||
| 1634 | Ga0495635_0014147 | |||
| 1635 | Ga0495635_0016366 | |||
| 1636 | Ga0495635_0075730 | |||
| 1637 | Ga0495635_0239688 | |||
| 1638 | Ga0495661_0019120 | |||
| 1639 | Ga0495661_0103888 | |||
| 1640 | Ga0495588_0000342 | |||
| 1641 | Ga0495588_0008442 | |||
| 1642 | Ga0495588_0035342 | |||
| 1643 | Ga0495657_0001768 | |||
| 1644 | Ga0495657_0008566 | |||
| 1645 | Ga0495657_0009114 | |||
| 1646 | Ga0495657_0019681 | |||
| 1647 | Ga0495599_0000008 | |||
| 1648 | Ga0495599_0017550 | |||
| 1649 | Ga0495599_0064118 | |||
| 1650 | Ga0495623_0000106 | |||
| 1651 | Ga0495623_0002503 | |||
| 1652 | Ga0495623_0002644 | |||
| 1653 | Ga0495623_0033043 | |||
| 1654 | Ga0495623_0053345 | |||
| 1655 | Ga0495646_0000004 | |||
| 1656 | Ga0495646_0008221 | |||
| 1657 | Ga0495646_0008648 | |||
| 1658 | Ga0495646_0028709 | |||
| 1659 | Ga0495646_0038816 | |||
| 1660 | Ga0495647_0000609 | |||
| 1661 | Ga0495647_0024849 | |||
| 1662 | Ga0495658_0002035 | |||
| 1663 | Ga0495658_0007124 | |||
| 1664 | Ga0495658_0094419 | |||
| 1665 | Ga0495658_0101231 | |||
| 1666 | Ga0495613_0000346 | |||
| 1667 | Ga0495613_0009566 | |||
| 1668 | Ga0495613_0054086 | |||
| 1669 | Ga0495613_0061107 | |||
| 1670 | Ga0495613_0096575 | |||
| 1671 | Ga0495613_0152087 | |||
| 1672 | Ga0495624_0006638 | |||
| 1673 | Ga0495624_0009104 | |||
| 1674 | Ga0495624_0048852 | |||
| 1675 | Ga0495670_0000652 | |||
| 1676 | Ga0495670_0027851 | |||
| 1677 | Ga0495589_0029823 | |||
| 1678 | Ga0495589_0030166 | |||
| 1679 | Ga0495600_0001602 | |||
| 1680 | Ga0495600_0004261 | |||
| 1681 | Ga0495600_0010911 | |||
| 1682 | Ga0495600_0011149 | |||
| 1683 | Ga0495600_0014091 | |||
| 1684 | Ga0495581_0000751 | |||
| 1685 | Ga0495581_0014777 | |||
| 1686 | Ga0495581_0055955 | |||
| 1687 | Ga0495581_0085800 | |||
| 1688 | Ga0495604_0000001 | |||
| 1689 | Ga0495604_0005535 | |||
| 1690 | Ga0495604_0009327 | |||
| 1691 | Ga0495604_0022878 | |||
| 1692 | Ga0495674_0000023 | |||
| 1693 | Ga0495674_0006257 | |||
| 1694 | Ga0495674_0045843 | |||
| 1695 | Ga0495676_0032798 | |||
| 1696 | Ga0495676_0047166 | |||
| 1697 | Ga0495676_0087048 | |||
| 1698 | Ga0495676_0096936 | |||
| 1699 | Ga0495680_0000313 | |||
| 1700 | Ga0495680_0008135 | |||
| 1701 | Ga0495680_0009019 | |||
| 1702 | Ga0495680_0009850 | |||
| 1703 | Ga0495680_0014387 | |||
| 1704 | Ga0495680_0022623 | |||
| 1705 | Ga0495680_0044025 | |||
| 1706 | Ga0495675_0000298 | |||
| 1707 | Ga0495675_0000606 | |||
| 1708 | Ga0495675_0024419 | |||
| 1709 | Ga0495675_0028255 | |||
| 1710 | Ga0495677_0032275 | |||
| 1711 | Ga0495679_030560 | |||
| 1712 | Ga0495684_0000007 | |||
| 1713 | Ga0495684_0005076 | |||
| 1714 | Ga0495684_0026635 | |||
| 1715 | Ga0495684_0044356 | |||
| 1716 | Ga0495684_0205080 | |||
| 1717 | Ga0495593_0000257 | |||
| 1718 | Ga0495593_0005443 | |||
| 1719 | Ga0495593_0020803 | |||
| 1720 | Ga0495602_0000157 | |||
| 1721 | Ga0495602_0005154 | |||
| 1722 | Ga0495602_0032937 | |||
| 1723 | Ga0495602_0034428 | |||
| 1724 | Ga0495602_0125018 | |||
| 1725 | Ga0495614_0001571 | |||
| 1726 | Ga0495614_0007539 | |||
| 1727 | Ga0495614_0016209 | |||
| 1728 | Ga0496100_0002229 | |||
| 1729 | Ga0496100_0005055 | |||
| 1730 | Ga0496100_0008109 | |||
| 1731 | Ga0496100_0062501 | |||
| 1732 | Ga0496101_0012447 | |||
| 1733 | Ga0496101_0014278 | |||
| 1734 | Ga0496101_0020480 | |||
| 1735 | Ga0496101_0024432 | |||
| 1736 | Ga0496101_0044963 | |||
| 1737 | Ga0496101_0125869 | |||
| 1738 | Ga0496101_0187144 | |||
| 1739 | Ga0496102_0009037 | |||
| 1740 | Ga0496102_0091642 | |||
| 1741 | Ga0496102_0096386 | |||
| 1742 | Ga0496102_0109173 | |||
| 1743 | Ga0496102_0124309 | |||
| 1744 | Ga0496102_0361432 | |||
| 1745 | Ga0496103_0001199 | |||
| 1746 | Ga0496103_0006458 | |||
| 1747 | Ga0496103_0039808 | |||
| 1748 | Ga0496103_0202145 | |||
| 1749 | Ga0496104_0003034 | |||
| 1750 | Ga0496104_0005924 | |||
| 1751 | Ga0496104_0013973 | |||
| 1752 | Ga0496104_0018566 | |||
| 1753 | Ga0496104_0027045 | |||
| 1754 | Ga0496104_0032679 | |||
| 1755 | Ga0496104_0079932 | |||
| 1756 | Ga0496104_0111732 | |||
| 1757 | Ga0496104_0185565 | |||
| 1758 | Ga0496104_0336884 | |||
| 1759 | Ga0496105_0000168 | |||
| 1760 | Ga0496105_0001325 | |||
| 1761 | Ga0496105_0002827 | |||
| 1762 | Ga0496105_0036413 | |||
| 1763 | Ga0496105_0044807 | |||
| 1764 | Ga0496105_0048634 | |||
| 1765 | Ga0496105_0063704 | |||
| 1766 | Ga0496106_0006526 | |||
| 1767 | Ga0496106_0016453 | |||
| 1768 | Ga0496106_0022416 | |||
| 1769 | Ga0496106_0063959 | |||
| 1770 | Ga0496106_0093856 | |||
| 1771 | Ga0496106_0189468 | |||
| 1772 | Ga0496106_0233893 | |||
| 1773 | Ga0496107_0023841 | |||
| 1774 | Ga0496107_0049396 | |||
| 1775 | Ga0496107_0067139 | |||
| 1776 | Ga0496107_0071765 | |||
| 1777 | Ga0496107_0111355 | |||
| 1778 | Ga0496107_0221846 | |||
| 1779 | Ga0496108_0000698 | |||
| 1780 | Ga0496108_0001234 | |||
| 1781 | Ga0496108_0012413 | |||
| 1782 | Ga0496108_0149923 | |||
| 1783 | Ga0496108_0161868 | |||
| 1784 | Ga0496108_0176296 | |||
| 1785 | Ga0496109_0002525 | |||
| 1786 | Ga0496109_0019370 | |||
| 1787 | Ga0496109_0035224 | |||
| 1788 | Ga0496109_0078184 | |||
| 1789 | Ga0496109_0080957 | |||
| 1790 | Ga0496109_0428613 | |||
| 1791 | Ga0496110_0001180 | |||
| 1792 | Ga0496110_0001215 | |||
| 1793 | Ga0496110_0014100 | |||
| 1794 | Ga0496110_0017116 | |||
| 1795 | Ga0496110_0107662 | |||
| 1796 | Ga0496110_0179606 | |||
| 1797 | Ga0496110_0188286 | |||
| 1798 | Ga0496111_0007840 | |||
| 1799 | Ga0496111_0012852 | |||
| 1800 | Ga0496111_0017532 | |||
| 1801 | Ga0496111_0022493 | |||
| 1802 | Ga0496111_0040618 | |||
| 1803 | Ga0496111_0043800 | |||
| 1804 | Ga0496111_0060052 | |||
| 1805 | Ga0496112_0002582 | |||
| 1806 | Ga0496112_0004511 | |||
| 1807 | Ga0496112_0005150 | |||
| 1808 | Ga0496112_0013642 | |||
| 1809 | Ga0496112_0013939 | |||
| 1810 | Ga0496112_0014646 | |||
| 1811 | Ga0496112_0034929 | |||
| 1812 | Ga0496112_0035443 | |||
| 1813 | Ga0496112_0074443 | |||
| 1814 | Ga0496112_0117353 | |||
| 1815 | Ga0496112_0270428 | |||
| 1816 | Ga0496113_0026983 | |||
| 1817 | Ga0496113_0036387 | |||
| 1818 | Ga0496113_0038493 | |||
| 1819 | Ga0496113_0064171 | |||
| 1820 | Ga0496113_0133678 | |||
| 1821 | Ga0496113_0159605 | |||
| 1822 | Ga0496114_0002124 | |||
| 1823 | Ga0496114_0022236 | |||
| 1824 | Ga0496114_0075838 | |||
| 1825 | Ga0496114_0295014 | |||
| 1826 | Ga0496115_0014432 | |||
| 1827 | Ga0496115_0220646 | |||
| 1828 | Ga0496126_0029077 | |||
| 1829 | Ga0501031_0009137 | |||
| 1830 | Ga0501033_0008625 | |||
| 1831 | Ga0501033_0107151 | |||
| 1832 | Ga0501034_0015790 | |||
| 1833 | Ga0501036_0110009 | |||
| 1834 | Ga0501037_0011810 | |||
| 1835 | Ga0501037_0074140 | |||
| 1836 | Ga0501038_0016880 | |||
| 1837 | Ga0501038_0177958 | |||
| 1838 | Ga0501039_0134079 | |||
| 1839 | Ga0501042_0040845 | |||
| 1840 | Ga0501042_0095475 | |||
| 1841 | Ga0501046_0011715 | |||
| 1842 | Ga0501046_0150520 | |||
| 1843 | Ga0501047_0041454 | |||
| 1844 | Ga0501047_0051232 | |||
| 1845 | Ga0501047_0125596 | |||
| 1846 | Ga0501069_0045163 | |||
| 1847 | Ga0501069_0107636 | |||
| 1848 | Ga0501070_0090860 | |||
| 1849 | Ga0501070_0134002 | |||
| 1850 | Ga0501070_0313991 | |||
| 1851 | Ga0501071_0090270 | |||
| 1852 | Ga0501071_0095168 | |||
| 1853 | Ga0501072_0007684 | |||
| 1854 | Ga0501072_0036634 | |||
| 1855 | Ga0501072_0040431 | |||
| 1856 | Ga0501072_0082509 | |||
| 1857 | Ga0501073_0015219 | |||
| 1858 | Ga0501074_0200058 | |||
| 1859 | Ga0501075_0008636 | |||
| 1860 | Ga0501075_0119966 | |||
| 1861 | Ga0501075_0128522 | |||
| 1862 | Ga0501077_0003311 | |||
| 1863 | Ga0501077_0049674 | |||
| 1864 | Ga0501079_0143176 | |||
| 1865 | Ga0501079_0186676 | |||
| 1866 | Ga0501080_0016224 | |||
| 1867 | Ga0501080_0083170 | |||
| 1868 | Ga0501080_0213246 | |||
| 1869 | Ga0501081_0010251 | |||
| 1870 | Ga0501083_0052405 | |||
| 1871 | Ga0501083_0106316 | |||
| 1872 | Ga0501035_0019348 | |||
| 1873 | Ga0501044_0027158 | |||
| 1874 | Ga0501045_0042253 | |||
| 1875 | nmdc:mga03683_2479_c1 | |||
| 1876 | nmdc:mga0yw44_3015_c1 | |||
| 1877 | nmdc:mga0k408_8682_c1 | |||
| 1878 | nmdc:mga06z11_33998_c1 | |||
| 1879 | nmdc:mga06z11_38208_c1 | |||
| 1880 | nmdc:mga05p37_111_c2 | |||
| 1881 | nmdc:mga05p37_2840_c2 | |||
| 1882 | nmdc:mga05p37_349124_c1 | |||
| 1883 | nmdc:mga05p37_38591_c1 | |||
| 1884 | nmdc:mga05p37_6754_c1 | |||
| 1885 | nmdc:mga05p37_71975_c1 | |||
| 1886 | nmdc:mga09592_137_c1 | |||
| 1887 | nmdc:mga09592_14833_c1 | |||
| 1888 | nmdc:mga09592_186_c1 | |||
| 1889 | nmdc:mga0qj67_189_c1 | |||
| 1890 | nmdc:mga0qj67_26591_c1 | |||
| 1891 | nmdc:mga0qj67_3744_c1 | |||
| 1892 | nmdc:mga0qj67_86350_c1 | |||
| 1893 | nmdc:mga06r32_107166_c1 | |||
| 1894 | nmdc:mga06r32_4386_c1 | |||
| 1895 | nmdc:mga06r32_84426_c1 | |||
| 1896 | nmdc:mga08y16_1052_c1 | |||
| 1897 | nmdc:mga08y16_128385_c1 | |||
| 1898 | nmdc:mga08y16_16548_c1 | |||
| 1899 | nmdc:mga08y16_4695_c1 | |||
| 1900 | nmdc:mga08y16_88116_c1 | |||
| 1901 | nmdc:mga08y16_91249_c1 | |||
| 1902 | nmdc:mga0n895_29540_c1 | |||
| 1903 | nmdc:mga0n895_6052_c1 | |||
| 1904 | nmdc:mga0rr50_200588_c1 | |||
| 1905 | nmdc:mga0rr50_324395_c1 | |||
| 1906 | nmdc:mga08x19_18_c1 | |||
| 1907 | nmdc:mga0a205_2281_c1 | |||
| 1908 | nmdc:mga0a205_3471_c1 | |||
| 1909 | Ga0495601_0000014 | |||
| 1910 | Ga0495601_0000114 | |||
| 1911 | Ga0495601_0003125 | |||
| 1912 | Ga0495601_0003240 | |||
| 1913 | Ga0495601_0005625 | |||
| 1914 | Ga0495601_0007472 | |||
| 1915 | Ga0495601_0013583 | |||
| 1916 | Ga0495601_0070554 | |||
| 1917 | Ga0495601_0075227 | |||
| 1918 | Ga0495601_0112810 | |||
| 1919 | Ga0495601_0114131 | |||
| 1920 | Ga0495612_0000014 | |||
| 1921 | Ga0495612_0001226 | |||
| 1922 | Ga0495612_0002041 | |||
| 1923 | Ga0495612_0016843 | |||
| 1924 | Ga0495655_0000761 | |||
| 1925 | Ga0495655_0002639 | |||
| 1926 | Ga0495595_0000209 | |||
| 1927 | Ga0495595_0000388 | |||
| 1928 | Ga0495595_0003019 | |||
| 1929 | Ga0495595_0004730 | |||
| 1930 | Ga0495595_0021769 | |||
| 1931 | Ga0495595_0033113 | |||
| 1932 | Ga0495619_0000006 | |||
| 1933 | Ga0495619_0000201 | |||
| 1934 | Ga0495619_0000206 | |||
| 1935 | Ga0495619_0000722 | |||
| 1936 | Ga0495619_0006050 | |||
| 1937 | Ga0495619_0006889 | |||
| 1938 | Ga0495619_0013349 | |||
| 1939 | Ga0495619_0019963 | |||
| 1940 | Ga0495619_0061651 | |||
| 1941 | Ga0495619_0079231 | |||
| 1942 | Ga0500643_004738 | |||
| 1943 | Ga0500644_0000868 | |||
| 1944 | Ga0500566_0063148 | |||
| 1945 | Ga0500566_0116592 | |||
| 1946 | Ga0500641_0009044 | |||
| 1947 | Ga0500641_0042002 | |||
| 1948 | Ga0500593_034322 | |||
| 1949 | Ga0500595_000001 | |||
| 1950 | Ga0500652_002348 | |||
| 1951 | Ga0500616_0000001 | |||
| 1952 | Ga0500616_0004491 | |||
| 1953 | Ga0500616_0011353 | |||
| 1954 | Ga0500616_0075126 | |||
| 1955 | Ga0500645_002616 | |||
| 1956 | Ga0501082_0000101 | |||
| 1957 | Ga0501082_0057559 | |||
| 1958 | Ga0530510_0010924 | |||
| 1959 | Ga0530510_0022984 | |||
| 1960 | Ga0530510_0037126 | |||
| 1961 | Ga0530510_0293664 | |||
| 1962 | 2643758102 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7rnp-assembly2.cif.gz_B | engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9_h275e with 4-cl-trp non-covalently bound | 0.9565 | 19 | 393 |
| 5ey5-assembly1.cif.gz_D | lbcats | 0.9528 | 18 | 392 |
| 5t6m-assembly1.cif.gz_B | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9521 | 18 | 394 |
| 6amh-assembly2.cif.gz_D | engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb4d11 with ser bound as e(aex1) | 0.9513 | 18 | 394 |
| 6ami-assembly1.cif.gz_B | engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb4d11 with trp non-covalently bound | 0.9507 | 18 | 395 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P14671_91_282_3.40.50.1100 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9515 | 30 | 212 | 3.40.50.1100 |
| af_Q60179_217_401_3.40.50.1100 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9407 | 216 | 395 | 3.40.50.1100 |
| af_Q60179_69_392_3.40.50.1100 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9378 | 67 | 387 | 3.40.50.1100 |
| 2o2jA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.931 | 27 | 213 | 3.40.50.1100 |
| af_P43283_44_197_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.931 | 63 | 208 | 3.60.21.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-G5SXB3-F1-model_v4 | tryptophan synthase (EC 4.2.1.20) | 1.002 | 118 | 182 |
GO:0004834
GO:0005737 |
| AF-A0A836TG84-F1-model_v4 | tryptophan synthase (EC 4.2.1.20) | 0.9843 | 119 | 201 |
GO:0004834
GO:0005737 |
| AF-A0A354XLP7-F1-model_v4 | tryptophan synthase (EC 4.2.1.20) | 0.9736 | 90 | 186 |
GO:0004834
GO:0005737 |
| AF-A0A2N8GT80-F1-model_v4 | deleted | 0.9732 | 88 | 197 |
|
| AF-A0A836TG84-F1-model_v4 | tryptophan synthase (EC 4.2.1.20) | 0.9727 | 119 | 201 |
GO:0004834
GO:0005737 |