F487440

General Info

Members Datasets Scaffolds Average Seq Length
982 771 1964 422

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2933016740|2933020336
Length 442
Sequence LNTTIQAPSNEERIQPMSPIEYEIKNTTELQHAEDAVRMGELENMRPLPRISVHAFCESEALQRVMERCGNDRRMAKVSLRITSGGIAAAANMFASAPTPNLIILETKANAASLLSELAPLAAVCDPSTKVVIIGYYNDIALYRELIRHGISEYMVQPIAMPDGLMAMASIFVDPDSEPLGRSIAFIGSKGGAGASTIAHNCAFGISNLFSTETILADLDLPYGTANIDFDQDPTQGIAEAVFAPDRLDEVFLDRLLTKCSEHLSLLAAPSLLDRAYDFDGQAFQPVLEVLQRSAPVTVLDVPHAWSEWTRSVLAAADEVVICAVPDLANLRNAKNMLDALRKLRPNDKMPHLILNQVGMPKRPEIAPSDFCEPLEIEPIAIIPFDIGLFGNAANSGRMISEIDPKSPTAETFSQLAHIVTGRVAIKKAKRGGLMGLLKRAK

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
38 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
39 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
43 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
53 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
54 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
55 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
56 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
57 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
58 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
59 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
60 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
61 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
64 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
65 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
66 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
68 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
76 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
89 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
91 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
94 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
101 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
102 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
103 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
107 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
108 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
109 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
110 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
111 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
112 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
115 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
119 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
120 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
121 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
122 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
123 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
124 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
125 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
126 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
127 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
128 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
129 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
130 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
131 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
132 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
133 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
134 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
135 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
136 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
137 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
140 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
141 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
142 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
143 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
144 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
147 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
157 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
158 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
159 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
160 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
161 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
162 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
163 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
168 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
175 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
176 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
177 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
178 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
179 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
180 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
181 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
182 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
183 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
184 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
185 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
186 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
187 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
188 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
189 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
190 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
191 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
192 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
193 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
194 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
195 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
196 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
197 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
198 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
199 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
200 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
201 2509276019 Ensifer aridi TW10 Isolate Nodule
202 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
203 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
204 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
205 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
206 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
207 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
208 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
209 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
210 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
211 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
212 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
213 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
214 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
215 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
216 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
217 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
218 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
219 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
220 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
221 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
222 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
223 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
224 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
225 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
226 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
227 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
228 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
229 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
230 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
231 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
232 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
233 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
234 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
235 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
236 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
237 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
238 2516143018 Ensifer sp. BR816 Isolate Nodule
239 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
240 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
241 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
242 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
243 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
244 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
245 2519899620 Rhizobium sp. Pop5 Isolate Nodule
246 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
247 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
248 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
249 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
250 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
251 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
252 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
253 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
254 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
255 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
256 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
257 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
258 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
259 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
260 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
261 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
262 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
263 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
264 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
265 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
266 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
267 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
268 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
269 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
270 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
271 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
272 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
273 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
274 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
275 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
276 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
277 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
278 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
279 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
280 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
281 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
282 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
283 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
284 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
285 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
286 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
287 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
288 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
289 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
290 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
291 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
292 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
293 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
294 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
295 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
296 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
297 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
298 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
299 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
300 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
301 2643221557 Ensifer sp. Root558 Isolate Unclassified
302 2643221558 Rhizobium sp. Root149 Isolate Unclassified
303 2643221568 Rhizobium sp. Root564 Isolate Unclassified
304 2643221582 Rhizobium sp. Root651 Isolate Unclassified
305 2643221599 Rhizobium sp. Root708 Isolate Unclassified
306 2643221607 Rhizobium sp. Root73 Isolate Unclassified
307 2643221610 Ensifer sp. Root74 Isolate Unclassified
308 2643221618 Ensifer sp. Root231 Isolate Unclassified
309 2643221626 Ensifer sp. Root31 Isolate Unclassified
310 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
311 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
312 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
313 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
314 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
315 2643221655 Ensifer sp. Root1252 Isolate Unclassified
316 2643221659 Ensifer sp. Root127 Isolate Unclassified
317 2643221668 Ensifer sp. Root423 Isolate Unclassified
318 2643221675 Ensifer sp. Root1298 Isolate Unclassified
319 2643221680 Ensifer sp. Root1312 Isolate Unclassified
320 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
321 2643221688 Rhizobium sp. Root482 Isolate Unclassified
322 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
323 2643221693 Rhizobium sp. Root491 Isolate Unclassified
324 2643221698 Ensifer sp. Root142 Isolate Unclassified
325 2643221712 Ensifer sp. Root258 Isolate Unclassified
326 2643221718 Rhizobium sp. Root268 Isolate Unclassified
327 2643221719 Rhizobium sp. Root274 Isolate Unclassified
328 2643221723 Ensifer sp. Root278 Isolate Unclassified
329 2643221726 Ensifer sp. Root954 Isolate Unclassified
330 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
331 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
332 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
333 2718217882 Rhizobium sp. N741 Isolate Nodule
334 2718217927 Rhizobium sp. N324 Isolate Nodule
335 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
336 2718218009 Rhizobium sp. N561 Isolate Nodule
337 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
338 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
339 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
340 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
341 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
342 2718218363 Rhizobium sp. N113 Isolate Nodule
343 2718218365 Rhizobium sp. N731 Isolate Nodule
344 2718218366 Rhizobium sp. N621 Isolate Nodule
345 2718218423 Rhizobium sp. N941 Isolate Nodule
346 2721755514 Rhizobium sp. N6212 Isolate Nodule
347 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
348 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
349 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
350 2721755809 Rhizobium sp. N541 Isolate Nodule
351 2721755810 Rhizobium sp. N871 Isolate Nodule
352 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
353 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
354 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
355 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
356 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
357 2728369365 Rhizobium sp. N1341 Isolate Nodule
358 2728369397 Rhizobium sp. N1314 Isolate Nodule
359 2738541293 Rhizobium sp. GV031 Isolate Unclassified
360 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
361 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
362 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
363 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
364 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
365 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
366 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
367 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
368 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
369 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
370 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
371 2791355256 Rhizobium sp. M10 Isolate Nodule
372 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
373 2791355260 Rhizobium sp. L9 Isolate Nodule
374 2791355261 Rhizobium sp. J15 Isolate Nodule
375 2791355262 Rhizobium sp. M1 Isolate Nodule
376 2791355263 Rhizobium chutanense C5 Isolate Nodule
377 2791355264 Rhizobium sp. S9 Isolate Nodule
378 2791355265 Rhizobium sp. H4 Isolate Nodule
379 2791355266 Rhizobium sp. L43 Isolate Nodule
380 2791355267 Rhizobium sp. L18 Isolate Nodule
381 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
382 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
383 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
384 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
385 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
386 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
387 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
388 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
389 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
390 2802429633 Rhizobium anhuiense J3 Isolate Nodule
391 2802429634 Rhizobium anhuiense S10 Isolate Nodule
392 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
393 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
394 2802429637 Rhizobium anhuiense C15 Isolate Nodule
395 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
396 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
397 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
398 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
399 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
400 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
401 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
402 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
403 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
404 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
405 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
406 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
407 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
408 2838048938 Rhizobium pisi 27/80 Isolate Nodule
409 2838061910 Rhizobium phaseoli L15 Isolate Nodule
410 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
411 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
412 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
413 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
414 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
415 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
416 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
417 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
418 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
419 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
420 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
421 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
422 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
423 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
424 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
425 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
426 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
427 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
428 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
429 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
430 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
431 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
432 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
433 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
434 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
435 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
436 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
437 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
438 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
439 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
440 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
441 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
442 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
443 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
444 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
445 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
446 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
447 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
448 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
449 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
450 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
451 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
452 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
453 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
454 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
455 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
456 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
457 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
458 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
459 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
460 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
461 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
462 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
463 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
464 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
465 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
466 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
467 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
468 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
469 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
470 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
471 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
472 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
473 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
474 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
475 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
476 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
477 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
478 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
479 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
480 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
481 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
482 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
483 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
484 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
485 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
486 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
487 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
488 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
489 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
490 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
491 2844163670 Ensifer sp. 1H6 Isolate Unclassified
492 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
493 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
494 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
495 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
496 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
497 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
498 2854911287 Brucella lupini LUP21 Isolate Unclassified
499 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
500 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
501 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
502 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
503 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
504 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
505 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
506 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
507 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
508 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
509 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
510 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
511 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
512 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
513 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
514 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
515 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
516 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
517 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
518 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
519 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
520 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
521 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
522 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
523 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
524 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
525 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
526 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
527 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
528 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
529 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
530 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
531 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
532 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
533 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
534 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
535 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
536 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
537 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
538 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
539 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
540 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
541 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
542 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
543 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
544 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
545 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
546 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
547 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
548 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
549 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
550 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
551 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
552 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
553 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
554 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
555 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
556 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
557 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
558 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
559 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
560 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
561 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
562 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
563 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
564 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
565 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
566 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
567 2933599457 Rhizobium phaseoli M3 Isolate Nodule
568 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
569 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
570 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
571 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
572 2936381700 Rhizobium chutanense C16 Isolate Unclassified
573 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
574 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
575 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
576 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
577 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
578 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
579 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
580 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
581 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
582 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
583 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
584 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
585 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
586 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
587 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
588 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
589 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
590 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
591 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
592 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
593 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
594 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
595 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
596 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
597 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
598 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
599 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
600 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
601 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
602 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
603 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
604 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
605 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
606 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
607 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
608 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
609 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
610 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
611 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
612 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
613 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
614 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
615 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
616 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
617 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
618 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
619 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
620 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
621 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
622 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
623 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
624 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
625 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
626 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
627 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
628 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
629 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
630 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
631 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
632 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
633 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
634 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
635 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
636 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
637 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
638 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
639 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
640 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
641 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
642 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
643 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
644 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
645 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
646 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
647 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
648 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
649 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
650 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
651 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
652 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
653 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
654 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
655 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
656 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
657 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
658 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
659 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
660 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
661 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
662 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
663 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
664 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
665 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
666 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
667 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
668 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
669 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
670 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
671 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
672 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
673 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
674 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
675 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
676 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
677 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
678 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
679 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
680 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
681 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
682 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
683 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
684 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
685 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
686 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
687 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
688 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
689 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
690 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
691 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
692 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
693 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
694 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
695 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
696 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
697 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
698 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
699 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
700 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
701 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
702 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
703 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
704 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
705 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
706 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
707 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
708 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
709 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
710 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
711 2996887358 Rhizobium sp. R711 Isolate Nodule
712 2996893221 Rhizobium sp. R635 Isolate Nodule
713 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
714 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
715 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
716 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
717 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
718 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
719 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
720 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
721 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
722 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
723 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
724 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
725 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
726 8005258706 Rhizobium sp. R693 Isolate Nodule
727 8005275841 Rhizobium sp. N4311 Isolate Nodule
728 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
729 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
730 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
731 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
732 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
733 8005321885 Rhizobium sp. R72 Isolate Nodule
734 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
735 8005382845 Rhizobium sp. R634 Isolate Nodule
736 8005395548 Rhizobium sp. R339 Isolate Nodule
737 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
738 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
739 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
740 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
741 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
742 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
743 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
744 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
745 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
746 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
747 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
748 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
749 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
750 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
751 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
752 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
753 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
754 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
755 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
756 8018176218 Rhizobium sp. N122 Isolate Nodule
757 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
758 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
759 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
760 8024501048 Rhizobium sp. H4 Isolate Nodule
761 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
762 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
763 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
764 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
765 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
766 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
767 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
768 8056382006 Rhizobium croatiense 13T Isolate Nodule
769 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
770 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
771 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 41.34
Metatranscriptomes 0.1
Isolates 58.55

Biome Distribution

Category Percentage (%)
Aerial Root 0.41
Bulb 0
Endosphere 17.82
Nodule 44.7
Rhizoplane 1.73
Rhizosphere 17.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000671 3300001979 Bacteria 14823
2 JGI25155J39150_1000110 3300002704 Bacteria 43893
3 JGI25156J39149_1000192 3300002705 Bacteria 44040
4 JGI25162J39368_1000302 3300002737 Bacteria 45304
5 JGI25162J39368_1000517 3300002737 Bacteria 28879
6 JGI25154J39366_1000196 3300002738 Bacteria 44040
7 JGI25158J39367_1000816 3300002739 Bacteria 5942
8 JGI25157J39369_1000228 3300002741 Bacteria 44040
9 JGI25152J39213_1002972 3300002773 Bacteria 6028
10 JGI25152J39213_1003171 3300002773 Bacteria 5730
11 JGI25150J39212_1000266 3300002774 Bacteria 27840
12 JGI25159J45721_1000023 3300002987 Bacteria 116643
13 JGI25159J45721_1000516 3300002987 Bacteria 17666
14 JGI25159J45721_1002611 3300002987 Bacteria 6742
15 JGI25151J46595_10000355 3300003187 Bacteria 48795
16 JGI25151J46595_10000660 3300003187 Bacteria 29371
17 JGI25151J46595_10001587 3300003187 Bacteria 15099
18 JGI25151J46595_10004733 3300003187 Bacteria 7150
19 JGI25151J46595_10032371 3300003187 Bacteria 2028
20 JGI25165J46597_1000720 3300003214 Bacteria 25923
21 JGI25165J46597_1001110 3300003214 Bacteria 17044
22 JGI25153J46596_10006110 3300003215 Bacteria 6176
23 JGI25153J46596_10013215 3300003215 Bacteria 3506
24 JGI25160J50197_1000044 3300003354 Bacteria 145379
25 JGI25160J50197_1000061 3300003354 Bacteria 116643
26 JGI25160J50197_1002094 3300003354 Bacteria 9482
27 JGI25160J50197_1007103 3300003354 Bacteria 4422
28 JGI25161J50226_1000028 3300003374 Bacteria 145379
29 JGI25161J50226_1000078 3300003374 Bacteria 83416
30 JGI25161J50226_1000200 3300003374 Bacteria 39159
31 Ga0006562J51391_1010447 3300003578 Bacteria 6410
32 Ga0055526_1003112 3300003771 Bacteria 10753
33 Ga0055526_1003438 3300003771 Bacteria 10050
34 Ga0055526_1004162 3300003771 Bacteria 8804
35 Ga0055526_1005073 3300003771 Bacteria 7684
36 Ga0055524_1000734 3300003775 Bacteria 22502
37 Ga0055524_1001341 3300003775 Bacteria 14355
38 Ga0055524_1005972 3300003775 Bacteria 5352
39 Ga0055524_1017452 3300003775 Bacteria 2532
40 Ga0055536_1005844 3300003781 Bacteria 5910
41 Ga0055528_1000113 3300003790 Bacteria 65323
42 Ga0055528_1001190 3300003790 Bacteria 16795
43 Ga0055528_1018092 3300003790 Bacteria 2405
44 Ga0055528_1021616 3300003790 Bacteria 2034
45 Ga0055540_1000959 3300003792 Bacteria 18731
46 Ga0055540_1007329 3300003792 Bacteria 4188
47 Ga0055531_10002502 3300003794 Bacteria 12245
48 Ga0058692_1002467 3300003856 Bacteria 6179
49 Ga0055543_1000054 3300004625 Bacteria 104176
50 Ga0055543_1000504 3300004625 Bacteria 22457
51 Ga0055543_1000706 3300004625 Bacteria 17005
52 Ga0055543_1001119 3300004625 Bacteria 11519
53 Ga0065165_1000047 3300005262 Bacteria 197811
54 Ga0065165_1000318 3300005262 Bacteria 78352
55 Ga0065165_1004566 3300005262 Bacteria 8455
56 Ga0065165_1007013 3300005262 Bacteria 5684
57 Ga0065165_1017674 3300005262 Bacteria 2616
58 Ga0070670_100000105 3300005331 Bacteria 77938
59 Ga0070665_100008033 3300005548 Bacteria 10686
60 Ga0070665_100023549 3300005548 Bacteria 6200
61 Ga0070665_100026253 3300005548 Bacteria 5866
62 Ga0068855_100236817 3300005563 Bacteria 2041
63 Ga0068854_100082778 3300005578 Bacteria 2372
64 Ga0068852_100091585 3300005616 Bacteria 2721
65 Ga0075365_10002190 3300006038 Bacteria 9415
66 Ga0075365_10078493 3300006038 Bacteria 2232
67 Ga0075368_10000802 3300006042 Bacteria 9657
68 Ga0075364_10000011 3300006051 Bacteria 62606
69 Ga0075364_10015575 3300006051 Bacteria 4717
70 Ga0075369_10002838 3300006186 Bacteria 6241
71 Ga0075369_10014524 3300006186 Bacteria 3147
72 Ga0075366_10001209 3300006195 Bacteria 12817
73 Ga0075366_10055986 3300006195 Bacteria 2342
74 Ga0075370_10009148 3300006353 Bacteria 5129
75 Ga0075370_10009887 3300006353 Bacteria 4970
76 Ga0079104_1000082 3300006946 Bacteria 137722
77 Ga0079104_1000972 3300006946 Bacteria 22433
78 Ga0079104_1008692 3300006946 Bacteria 3517
79 Ga0099826_10000075 3300006948 Bacteria 52009
80 Ga0099826_10027969 3300006948 Bacteria 4133
81 Ga0105251_10005604 3300009011 Bacteria 8166
82 Ga0105240_10002912 3300009093 Bacteria 27002
83 Ga0105237_10008844 3300009545 Bacteria 10857
84 Ga0123341_1000642 3300009765 Bacteria 22722
85 Ga0123342_1004326 3300009766 Bacteria 21741
86 Ga0123342_1007872 3300009766 Bacteria 13807
87 Ga0105239_10075793 3300010375 Bacteria 3699
88 Ga0105246_10024918 3300011119 Bacteria 3894
89 Ga0157373_10001761 3300013100 Bacteria 16478
90 Ga0157371_10000004 3300013102 Bacteria 512593
91 Ga0157370_10001712 3300013104 Bacteria 27010
92 Ga0157370_10048920 3300013104 Bacteria 4049
93 Ga0157369_10057864 3300013105 Bacteria 4181
94 Ga0171463_1001 3300013249 Bacteria 1406070
95 Ga0182008_10042839 3300014497 Bacteria 2254
96 Ga0182007_10004193 3300015262 Bacteria 6593
97 Ga0182005_1005158 3300015265 Bacteria 4111
98 Ga0183363_1185 3300015690 Bacteria 13404
99 Ga0214544_1005567 3300021320 Bacteria 24246
100 Ga0214542_1004334 3300021321 Bacteria 28262
101 Ga0214542_1018682 3300021321 Bacteria 5766
102 Ga0214543_1004000 3300021327 Bacteria 28246
103 Ga0214543_1005580 3300021327 Bacteria 22983
104 Ga0228711_1000006 3300022739 Bacteria 202437
105 Ga0228710_1000004 3300022740 Bacteria 250560
106 Ga0209435_100087 3300025206 Bacteria 44093
107 Ga0209436_100022 3300025208 Bacteria 96695
108 Ga0209436_100213 3300025208 Bacteria 26862
109 Ga0209436_110964 3300025208 Bacteria 1623
110 Ga0209437_100050 3300025233 Bacteria 394010
111 Ga0209437_100205 3300025233 Bacteria 115669
112 Ga0207425_1000052 3300025245 Bacteria 162123
113 Ga0207425_1007331 3300025245 Bacteria 2921
114 Ga0207425_1010491 3300025245 Bacteria 2253
115 Ga0209646_1000285 3300025246 Bacteria 44093
116 Ga0209026_1000347 3300025250 Bacteria 44093
117 Ga0209677_100223 3300025253 Bacteria 40538
118 Ga0209759_1000482 3300025256 Bacteria 44093
119 Ga0209129_1000066 3300025258 Bacteria 226820
120 Ga0209129_1000141 3300025258 Bacteria 119150
121 Ga0209129_1001039 3300025258 Bacteria 16421
122 Ga0209129_1001233 3300025258 Bacteria 14657
123 Ga0209129_1001336 3300025258 Bacteria 13945
124 Ga0209129_1002179 3300025258 Bacteria 9864
125 Ga0209129_1002224 3300025258 Bacteria 9715
126 Ga0209233_1000037 3300025261 Bacteria 554620
127 Ga0209233_1000187 3300025261 Bacteria 133091
128 Ga0209233_1000232 3300025261 Bacteria 96361
129 Ga0209673_1000024 3300025273 Bacteria 409632
130 Ga0209673_1000911 3300025273 Bacteria 37766
131 Ga0209673_1001370 3300025273 Bacteria 23982
132 Ga0209673_1001606 3300025273 Bacteria 19790
133 Ga0209673_1002065 3300025273 Bacteria 15151
134 Ga0209673_1002866 3300025273 Bacteria 10986
135 Ga0209673_1003320 3300025273 Bacteria 9625
136 Ga0209673_1004509 3300025273 Bacteria 7418
137 Ga0209130_1000002 3300025284 Bacteria 722648
138 Ga0209130_1000005 3300025284 Bacteria 599620
139 Ga0209130_1000093 3300025284 Bacteria 145707
140 Ga0209130_1006003 3300025284 Bacteria 4045
141 Ga0209676_1002635 3300025292 Bacteria 12233
142 Ga0209025_1000060 3300025294 Bacteria 305017
143 Ga0209025_1000144 3300025294 Bacteria 181446
144 Ga0209025_1000274 3300025294 Bacteria 119322
145 Ga0209025_1000275 3300025294 Bacteria 119220
146 Ga0209025_1000377 3300025294 Bacteria 92728
147 Ga0209025_1000832 3300025294 Bacteria 49004
148 Ga0209025_1004510 3300025294 Bacteria 12026
149 Ga0209025_1006318 3300025294 Bacteria 9249
150 Ga0209564_1000262 3300025295 Bacteria 112256
151 Ga0209564_1000590 3300025295 Bacteria 57280
152 Ga0209564_1001583 3300025295 Bacteria 22240
153 Ga0209564_1014300 3300025295 Bacteria 3311
154 Ga0209564_1017679 3300025295 Bacteria 2764
155 Ga0209758_1000229 3300025297 Bacteria 119657
156 Ga0209758_1000383 3300025297 Bacteria 76487
157 Ga0209758_1000971 3300025297 Bacteria 38600
158 Ga0209758_1001494 3300025297 Bacteria 27240
159 Ga0209758_1001499 3300025297 Bacteria 27145
160 Ga0209758_1001505 3300025297 Bacteria 27113
161 Ga0209758_1003461 3300025297 Bacteria 14311
162 Ga0209050_1006578 3300025298 Bacteria 6828
163 Ga0209256_1000715 3300025299 Bacteria 44055
164 Ga0209256_1000741 3300025299 Bacteria 42804
165 Ga0209256_1000868 3300025299 Bacteria 37527
166 Ga0209256_1001683 3300025299 Bacteria 21428
167 Ga0209256_1003279 3300025299 Bacteria 11560
168 Ga0209256_1014343 3300025299 Bacteria 2859
169 Ga0207426_1000012 3300025302 Bacteria 730942
170 Ga0207426_1000013 3300025302 Bacteria 721897
171 Ga0207426_1000015 3300025302 Bacteria 599316
172 Ga0207426_1000142 3300025302 Bacteria 194023
173 Ga0207426_1002277 3300025302 Bacteria 12665
174 Ga0209051_1000170 3300025303 Bacteria 119026
175 Ga0209051_1000768 3300025303 Bacteria 34059
176 Ga0209051_1003314 3300025303 Bacteria 10663
177 Ga0209051_1005690 3300025303 Bacteria 7198
178 Ga0209051_1005899 3300025303 Bacteria 7031
179 Ga0209051_1006189 3300025303 Bacteria 6785
180 Ga0209257_1001590 3300025304 Bacteria 26075
181 Ga0209257_1001982 3300025304 Bacteria 22011
182 Ga0209257_1005446 3300025304 Bacteria 8933
183 Ga0207695_10000036 3300025913 Bacteria 477897
184 Ga0207671_10003518 3300025914 Bacteria 15549
185 Ga0207681_10184815 3300025923 Bacteria 1590
186 Ga0207650_10000302 3300025925 Bacteria 48702
187 Ga0207711_10096634 3300025941 Bacteria 2607
188 Ga0207668_10175730 3300025972 Bacteria 1684
189 Ga0207698_10069979 3300026142 Bacteria 2778
190 Ga0209281_1000043 3300027111 Bacteria 341543
191 Ga0209281_1000102 3300027111 Bacteria 221665
192 Ga0209281_1002419 3300027111 Bacteria 7545
193 Ga0209371_1000009 3300027312 Bacteria 963030
194 Ga0209371_1000306 3300027312 Bacteria 54622
195 Ga0209282_1000013 3300027666 Bacteria 215053
196 Ga0209282_1000145 3300027666 Bacteria 41539
197 Ga0209813_10000777 3300027866 Bacteria 7240
198 Ga0268266_10006467 3300028379 Bacteria 10725
199 Ga0268266_10026837 3300028379 Bacteria 4901
200 Ga0268266_10046495 3300028379 Bacteria 3716
201 Ga0307515_10000029 3300028794 Bacteria 365410
202 Ga0307515_10000448 3300028794 Bacteria 98768
203 Ga0307515_10005232 3300028794 Bacteria 26381
204 Ga0307515_10019917 3300028794 Bacteria 12023
205 Ga0307515_10173484 3300028794 Bacteria 2137
206 Ga0268256_1000010 3300030500 Bacteria 963034
207 Ga0268256_1000751 3300030500 Bacteria 23733
208 Ga0307513_10000259 3300031456 Bacteria 76155
209 Ga0307513_10057450 3300031456 Bacteria 4144
210 Ga0307408_100061817 3300031548 Bacteria 2735
211 Ga0307405_10000589 3300031731 Bacteria 13936
212 Ga0307406_10004489 3300031901 Bacteria 7598
213 Ga0307412_10166755 3300031911 Bacteria 1643
214 Ga0315914_1000004 3300031967 Bacteria 288534
215 Ga0315913_1000055 3300033430 Bacteria 58182
216 Ga0315915_1000003 3300033464 Bacteria 407996
217 Ga0373946_0056875 3300035171 Bacteria 1653
218 Ga0373927_0000562 3300035695 Bacteria 28305
219 Ga0395905_0048405 3300037471 Bacteria 3984
220 Ga0439436_0024353 3300041404 Bacteria 1788
221 Ga0451845_0258408 3300041501 Bacteria 2476
222 Ga0451847_0245130 3300041503 Bacteria 1658
223 Ga0439449_0012226 3300042007 Bacteria 3227
224 Ga0439449_0019773 3300042007 Bacteria 2524
225 Ga0439457_018684 3300042014 Bacteria 1540
226 Ga0439462_0007440 3300042015 Bacteria 2741
227 Ga0466965_0044238 3300044683 Bacteria 2200
228 Ga0466963_0103545 3300044694 Bacteria 1950
229 Ga0466970_0002736 3300044765 Bacteria 8522
230 Ga0495617_018010 3300046452 Bacteria 2388
231 Ga0495592_0095690 3300046454 Bacteria 2123
232 Ga0495629_0090193 3300046459 Bacteria 2138
233 Ga0495638_0000566 3300046460 Bacteria 41838
234 Ga0495638_0034598 3300046460 Bacteria 3225
235 Ga0495638_0049284 3300046460 Bacteria 2633
236 Ga0495605_0002376 3300046474 Bacteria 11684
237 Ga0495662_0048493 3300046476 Bacteria 2051
238 Ga0495584_0068276 3300046491 Bacteria 1786
239 Ga0495596_0031299 3300046500 Bacteria 2126
240 Ga0495607_0023706 3300046501 Bacteria 3838
241 Ga0495607_0070511 3300046501 Bacteria 1953
242 Ga0495583_0012862 3300046506 Bacteria 4706
243 Ga0495583_0083159 3300046506 Bacteria 1388
244 Ga0495606_0003236 3300046507 Bacteria 17503
245 Ga0495606_0014595 3300046507 Bacteria 6114
246 Ga0495606_0017263 3300046507 Bacteria 5466
247 Ga0495610_0002136 3300046512 Bacteria 16832
248 Ga0495610_0004503 3300046512 Bacteria 10267
249 Ga0495610_0019568 3300046512 Bacteria 3783
250 Ga0495620_0033408 3300046515 Bacteria 2335
251 Ga0495620_0097304 3300046515 Bacteria 1176
252 Ga0495631_0005279 3300046518 Bacteria 6788
253 Ga0495631_0082069 3300046518 Bacteria 1390
254 Ga0495632_0003607 3300046519 Bacteria 10888
255 Ga0495643_0004568 3300046522 Bacteria 9640
256 Ga0495643_0016056 3300046522 Bacteria 4407
257 Ga0495643_0023194 3300046522 Bacteria 3530
258 Ga0495643_0024856 3300046522 Bacteria 3395
259 Ga0495644_0053316 3300046523 Bacteria 1519
260 Ga0495648_0011431 3300046524 Bacteria 6688
261 Ga0495648_0029990 3300046524 Bacteria 3603
262 Ga0495654_0000314 3300046530 Bacteria 42570
263 Ga0495654_0032018 3300046530 Bacteria 2667
264 Ga0495609_0051061 3300046538 Bacteria 1842
265 Ga0495633_0020794 3300046558 Bacteria 3295
266 Ga0495633_0039313 3300046558 Bacteria 2258
267 Ga0495633_0049746 3300046558 Bacteria 1977
268 Ga0495633_0082979 3300046558 Bacteria 1491
269 Ga0495656_0003978 3300046615 Bacteria 5022
270 Ga0495668_0049605 3300046616 Bacteria 2328
271 Ga0495668_0086411 3300046616 Bacteria 1720
272 Ga0495668_0113487 3300046616 Bacteria 1482
273 Ga0495625_0016237 3300046660 Bacteria 5864
274 Ga0495625_0062476 3300046660 Bacteria 2632
275 Ga0495625_0147839 3300046660 Bacteria 1581
276 Ga0495588_0001058 3300046674 Bacteria 11943
277 Ga0495657_0052730 3300046675 Bacteria 2725
278 Ga0495658_0068182 3300046683 Bacteria 2059
279 Ga0495624_0062087 3300046690 Bacteria 2339
280 Ga0495649_0032013 3300046694 Bacteria 2899
281 Ga0495681_0007095 3300047470 Bacteria 7229
282 Ga0495686_0002334 3300047472 Bacteria 18121
283 Ga0495686_0012332 3300047472 Bacteria 5983
284 Ga0495686_0028737 3300047472 Bacteria 3620
285 Ga0495686_0036324 3300047472 Bacteria 3162
286 Ga0495686_0082331 3300047472 Bacteria 1964
287 Ga0495615_0014424 3300048090 Bacteria 1670
288 Ga0495615_0018096 3300048090 Bacteria 1546
289 Ga0495626_0080051 3300048091 Bacteria 1453
290 Ga0496100_0041710 3300048903 Bacteria 2927
291 Ga0496102_0024411 3300048905 Bacteria 5374
292 Ga0496103_0016030 3300048906 Bacteria 4470
293 Ga0496106_0002238 3300048909 Bacteria 14427
294 Ga0496110_0327696 3300048913 Bacteria 1395
295 Ga0496112_0119992 3300048915 Bacteria 2600
296 Ga0496113_0046183 3300048916 Bacteria 3233
297 Ga0496114_0197105 3300048917 Bacteria 1763
298 Ga0496116_0000395 3300048919 Bacteria 63403
299 Ga0496116_0001740 3300048919 Bacteria 23718
300 Ga0496116_0020581 3300048919 Bacteria 5008
301 Ga0496116_0022634 3300048919 Bacteria 4704
302 Ga0496116_0023641 3300048919 Bacteria 4571
303 Ga0496116_0072721 3300048919 Bacteria 2172
304 Ga0496117_0000002 3300048920 Bacteria 2483758
305 Ga0496117_0002038 3300048920 Bacteria 26746
306 Ga0496117_0002089 3300048920 Bacteria 26294
307 Ga0496117_0012495 3300048920 Bacteria 7475
308 Ga0496117_0030530 3300048920 Bacteria 4133
309 Ga0496118_0002110 3300048921 Bacteria 27869
310 Ga0496118_0004517 3300048921 Bacteria 16444
311 Ga0496118_0022502 3300048921 Bacteria 5507
312 Ga0496119_0005965 3300048922 Bacteria 11454
313 Ga0496119_0063337 3300048922 Bacteria 2200
314 Ga0496120_0001226 3300048923 Bacteria 32437
315 Ga0496121_0000001 3300048924 Bacteria 1830318
316 Ga0496121_0000426 3300048924 Bacteria 82870
317 Ga0496121_0002514 3300048924 Bacteria 27846
318 Ga0496121_0021073 3300048924 Bacteria 6406
319 Ga0496121_0031495 3300048924 Bacteria 4844
320 Ga0496121_0063000 3300048924 Bacteria 3033
321 Ga0496121_0073269 3300048924 Bacteria 2745
322 Ga0496122_0000001 3300048925 Bacteria 1827766
323 Ga0496122_0000018 3300048925 Bacteria 426350
324 Ga0496122_0000321 3300048925 Bacteria 105353
325 Ga0496122_0008035 3300048925 Bacteria 11518
326 Ga0496122_0037023 3300048925 Bacteria 3935
327 Ga0496122_0061092 3300048925 Bacteria 2769
328 Ga0496122_0071173 3300048925 Bacteria 2479
329 Ga0496122_0120385 3300048925 Bacteria 1694
330 Ga0496123_0000001 3300048926 Bacteria 1831497
331 Ga0496123_0000015 3300048926 Bacteria 426088
332 Ga0496123_0000454 3300048926 Bacteria 72735
333 Ga0496123_0007215 3300048926 Bacteria 10544
334 Ga0496123_0037778 3300048926 Bacteria 3404
335 Ga0496123_0038920 3300048926 Bacteria 3333
336 Ga0496123_0052011 3300048926 Bacteria 2722
337 Ga0496123_0052985 3300048926 Bacteria 2686
338 Ga0496124_0000178 3300048927 Bacteria 126118
339 Ga0496124_0000558 3300048927 Bacteria 63070
340 Ga0496124_0004819 3300048927 Bacteria 15528
341 Ga0496124_0011523 3300048927 Bacteria 8825
342 Ga0496124_0012361 3300048927 Bacteria 8430
343 Ga0496124_0022854 3300048927 Bacteria 5725
344 Ga0496124_0026740 3300048927 Bacteria 5197
345 Ga0496124_0028588 3300048927 Bacteria 4986
346 Ga0496124_0045920 3300048927 Bacteria 3743
347 Ga0496124_0096720 3300048927 Bacteria 2398
348 Ga0496124_0188960 3300048927 Bacteria 1578
349 Ga0496125_0000001 3300048928 Bacteria 1766138
350 Ga0496125_0000628 3300048928 Bacteria 59302
351 Ga0496125_0002093 3300048928 Bacteria 26849
352 Ga0496125_0025877 3300048928 Bacteria 5363
353 Ga0496125_0026712 3300048928 Bacteria 5249
354 Ga0496126_0000378 3300048929 Bacteria 92187
355 Ga0496126_0001701 3300048929 Bacteria 32688
356 Ga0496126_0005535 3300048929 Bacteria 14379
357 Ga0496126_0142966 3300048929 Bacteria 2057
358 Ga0496126_0149571 3300048929 Bacteria 2002
359 Ga0496126_0160176 3300048929 Bacteria 1923
360 Ga0495682_0028852 3300049460 Bacteria 2055
361 Ga0501031_0019357 3300049568 Bacteria 4435
362 Ga0501033_0000260 3300049570 Bacteria 50590
363 Ga0501034_0019971 3300049571 Bacteria 6842
364 Ga0501038_0022763 3300049574 Bacteria 5610
365 Ga0501080_0050966 3300049742 Bacteria 3851
366 Ga0501080_0330254 3300049742 Bacteria 1379
367 Ga0501035_0001529 3300049822 Bacteria 23577
368 nmdc:mga03683_16502_c1 3300050489 Bacteria 2775
369 nmdc:mga00v17_17238_c1 3300050491 Bacteria 4084
370 nmdc:mga00v17_47_c1 3300050491 Bacteria 77934
371 nmdc:mga00v17_71_c1 3300050491 Bacteria 60964
372 nmdc:mga0yw44_19401_c1 3300050492 Bacteria 3749
373 nmdc:mga0yw44_66659_c1 3300050492 Bacteria 2222
374 nmdc:mga0k408_6901_c1 3300050493 Bacteria 6060
375 nmdc:mga06z11_11692_c1 3300050494 Bacteria 3793
376 nmdc:mga06z11_22119_c1 3300050494 Bacteria 2965
377 nmdc:mga04h51_745_c1 3300050495 Bacteria 7521
378 nmdc:mga07m45_31791_c1 3300050496 Bacteria 2925
379 nmdc:mga0sz30_1214_c1 3300050516 Bacteria 9237
380 Ga0500578_0004631 3300053086 Bacteria 9578
381 Ga0500578_0009746 3300053086 Bacteria 6239
382 Ga0500644_0020737 3300053088 Bacteria 1959
383 Ga0500560_000072 3300053107 Bacteria 9691
384 Ga0500572_006394 3300053111 Bacteria 2695
385 Ga0500594_0002289 3300053118 Bacteria 4150
386 Ga0500608_009888 3300053122 Bacteria 4072
387 Ga0500608_029119 3300053122 Bacteria 2611
388 Ga0500618_000203 3300053125 Bacteria 47421
389 Ga0500618_001422 3300053125 Bacteria 10688
390 Ga0500618_001766 3300053125 Bacteria 9153
391 Ga0500618_006648 3300053125 Bacteria 3370
392 Ga0500618_007055 3300053125 Bacteria 3238
393 Ga0500658_0000327 3300053134 Bacteria 21066
394 Ga0500559_0004885 3300053136 Bacteria 6254
395 Ga0500561_0000124 3300053137 Bacteria 14851
396 Ga0500568_0001169 3300053139 Bacteria 17543
397 Ga0500590_003223 3300053148 Bacteria 7467
398 Ga0500616_0000437 3300053153 Bacteria 55094
399 Ga0500616_0002500 3300053153 Bacteria 15220
400 Ga0500616_0006023 3300053153 Bacteria 8063
401 Ga0500622_0000189 3300053156 Bacteria 65129
402 Ga0500622_0002842 3300053156 Bacteria 12134
403 Ga0500624_000680 3300053157 Bacteria 8644
404 Ga0500634_0066380 3300053161 Bacteria 1901
405 Ga0500636_0000036 3300053177 Bacteria 71714
406 Ga0500636_0000887 3300053177 Bacteria 16055
407 Ga0500636_0069358 3300053177 Bacteria 2046
408 2933020336 2933016740 Bacteria 6355406
409 2509112189 2508501122 Bacteria 6292184
410 2509379528 2509276019 Bacteria 6802256
411 2509388979 2509276021 Bacteria 7634384
412 2509444569 2509276033 Bacteria 7180565
413 2510135684 2510065019 Bacteria 6903379
414 2510307112 2510065057 Bacteria 6649661
415 2510838876 2510461069 Bacteria 5505000
416 2510897157 2510461076 Bacteria 8618824
417 2511136842 2510917022 Bacteria 6504556
418 2511168911 2510917026 Bacteria 7046020
419 2511185308 2510917028 Bacteria 6185411
420 2511200506 2510917030 Bacteria 7460662
421 2511498742 2511231052 Bacteria 6974333
422 2512534878 2512047086 Bacteria 6850303
423 2512973294 2512875026 Bacteria 6861065
424 2513570845 2513237084 Bacteria 7231967
425 2513574940 2513237085 Bacteria 7695351
426 2513587887 2513237086 Bacteria 7265287
427 2513595631 2513237088 Bacteria 6927906
428 2513603649 2513237089 Bacteria 6553624
429 2513619417 2513237091 Bacteria 6900273
430 2513633724 2513237093 Bacteria 7545552
431 2513707571 2513237103 Bacteria 7647401
432 2513865344 2513237138 Bacteria 7368160
433 2513886015 2513237140 Bacteria 7076289
434 2513904353 2513237143 Bacteria 6664116
435 2513911013 2513237144 Bacteria 7530820
436 2513924321 2513237146 Bacteria 7166346
437 2513983355 2513237156 Bacteria 6402557
438 2513996286 2513237159 Bacteria 6810126
439 2514005889 2513237160 Bacteria 6650282
440 2514024100 2513237162 Bacteria 7468464
441 2515114848 2515075009 Bacteria 7288508
442 2515607181 2515154107 Bacteria 6795637
443 2515635795 2515154113 Bacteria 7807172
444 2515641409 2515154114 Bacteria 7848616
445 2515659298 2515154116 Bacteria 7552979
446 2515741167 2515154134 Bacteria 7220242
447 2516204933 2516143018 Bacteria 6951533
448 2516895020 2516653046 Bacteria 6989037
449 2517038467 2516653077 Bacteria 7555578
450 2517078742 2516653085 Bacteria 7346596
451 2517097484 2517093000 Bacteria 7412387
452 2517408940 2517287029 Bacteria 6905599
453 2517571703 2517487022 Bacteria 7227575
454 2520379166 2519899620 Bacteria 6499161
455 2524452568 2524023207 Bacteria 6813453
456 2524461856 2524023209 Bacteria 6679728
457 2530648329 2529292951 Bacteria 6916614
458 2535514559 2534681796 Bacteria 7146037
459 2537877356 2537561587 Bacteria 5425293
460 2551675993 2551306084 Bacteria 8942552
461 2551682876 2551306084 Bacteria 8942552
462 2551689917 2551306085 Bacteria 7347181
463 2551694587 2551306086 Bacteria 6843938
464 2551699439 2551306087 Bacteria 7351905
465 2551721926 2551306090 Bacteria 7953713
466 2551726553 2551306091 Bacteria 7086830
467 2551742815 2551306093 Bacteria 7064773
468 2554246253 2554235003 Bacteria 5877155
469 2558865237 2558860100 Bacteria 8458965
470 2558865926 2558860100 Bacteria 8458965
471 2559293475 2558860242 Bacteria 5568029
472 2561467882 2558860983 Bacteria 4133860
473 2585164457 2582581283 Bacteria 6030556
474 2585201299 2582581294 Bacteria 6626667
475 2585223274 2582581298 Bacteria 7315509
476 2585230964 2582581299 Bacteria 6518058
477 2585256439 2582581304 Bacteria 5831370
478 2585264756 2582581306 Bacteria 6450535
479 2585273473 2582581307 Bacteria 6597605
480 2585283563 2582581308 Bacteria 7413247
481 2585328186 2582581315 Bacteria 7318924
482 2585330597 2582581316 Bacteria 7774528
483 2585386175 2582581865 Bacteria 6644329
484 2585394788 2582581866 Bacteria 6859583
485 2585399118 2582581867 Bacteria 7184437
486 2585523943 2585427526 Bacteria 7258840
487 2585536033 2585427527 Bacteria 7273426
488 2585542087 2585427528 Bacteria 6842387
489 2585546130 2585427529 Bacteria 7395659
490 2585556639 2585427530 Bacteria 7383882
491 2585563998 2585427531 Bacteria 6992870
492 2585818732 2585427590 Bacteria 6824633
493 2585840703 2585427593 Bacteria 7141551
494 2585843679 2585427594 Bacteria 6180594
495 2585900333 2585427608 Bacteria 6544331
496 2585909294 2585427609 Bacteria 6667127
497 2585998446 2585427633 Bacteria 6413184
498 2586003009 2585427634 Bacteria 6455027
499 2587984604 2585428125 Bacteria 6662905
500 2599332441 2599185156 Bacteria 5403036
501 2599419721 2599185170 Bacteria 7295545
502 2599604357 2599185210 Bacteria 5624189
503 2599718731 2599185236 Bacteria 6875203
504 2600196666 2599185352 Bacteria 7228948
505 2600376726 2600254933 Bacteria 4750527
506 2601609506 2600255279 Bacteria 5605316
507 2601746281 2600255308 Bacteria 5611129
508 2616293946 2615840624 Bacteria 6557588
509 2616311172 2615840626 Bacteria 7921970
510 2616556094 2615840698 Bacteria 7319877
511 2617380707 2617270742 Bacteria 6808054
512 2643805662 2643221557 Bacteria 7184309
513 2643812534 2643221558 Bacteria 5460675
514 2643857542 2643221568 Bacteria 5187270
515 2643920633 2643221582 Bacteria 5804683
516 2644004402 2643221599 Bacteria 6292121
517 2644051586 2643221607 Bacteria 6314006
518 2644065837 2643221610 Bacteria 7480339
519 2644103914 2643221618 Bacteria 7717186
520 2644144795 2643221626 Bacteria 8069654
521 2644191200 2643221634 Bacteria 6705461
522 2644200084 2643221636 Bacteria 6583769
523 2644207236 2643221637 Bacteria 5345260
524 2644237678 2643221643 Bacteria 5749658
525 2644298227 2643221653 Bacteria 4569637
526 2644306844 2643221655 Bacteria 7722067
527 2644331035 2643221659 Bacteria 7890716
528 2644380142 2643221668 Bacteria 7306521
529 2644417168 2643221675 Bacteria 7473456
530 2644450564 2643221680 Bacteria 7473610
531 2644480455 2643221686 Bacteria 6310811
532 2644495451 2643221688 Bacteria 5260751
533 2644498815 2643221689 Bacteria 6042950
534 2644519558 2643221693 Bacteria 5513853
535 2644541254 2643221698 Bacteria 7756764
536 2644612455 2643221712 Bacteria 7729434
537 2644650884 2643221718 Bacteria 5345506
538 2644656479 2643221719 Bacteria 4568197
539 2644671349 2643221723 Bacteria 7095460
540 2644693011 2643221726 Bacteria 7455827
541 2657682697 2657244999 Bacteria 5946535
542 2671115820 2667528174 Bacteria 6435400
543 2692319682 2690316117 Bacteria 6800650
544 2719183347 2718217882 Bacteria 6556348
545 2719388107 2718217927 Bacteria 6972593
546 2719667730 2718217997 Bacteria 6740740
547 2719734064 2718218009 Bacteria 6478651
548 2720494150 2718218199 Bacteria 6740745
549 2720615613 2718218232 Bacteria 6720332
550 2720622396 2718218233 Bacteria 6662049
551 2720633750 2718218235 Bacteria 6630699
552 2720777450 2718218269 Bacteria 6906114
553 2721149459 2718218363 Bacteria 6524337
554 2721160862 2718218365 Bacteria 6274507
555 2721166296 2718218366 Bacteria 6425255
556 2721401740 2718218423 Bacteria 6438183
557 2722842466 2721755514 Bacteria 6424414
558 2723029047 2721755556 Bacteria 6745503
559 2723562664 2721755684 Bacteria 6859907
560 2723569357 2721755685 Bacteria 6704835
561 2724040554 2721755809 Bacteria 6438790
562 2724046820 2721755810 Bacteria 6479005
563 2724092057 2721755819 Bacteria 6906405
564 2724106622 2721755822 Bacteria 6726041
565 2724112430 2721755823 Bacteria 6752556
566 2725949652 2724679232 Bacteria 7646494
567 2730109983 2728369352 Bacteria 6745171
568 2730166582 2728369365 Bacteria 6555560
569 2730300494 2728369397 Bacteria 6274511
570 2738800754 2738541293 Bacteria 7065685
571 2738946675 2738541317 Bacteria 5340176
572 2739037336 2738541333 Bacteria 7106503
573 2753460057 2751185821 Bacteria 6189929
574 2766067146 2765235942 Bacteria 7445910
575 2776915965 2775507049 Bacteria 6284736
576 2778179522 2775507266 Bacteria 7392367
577 2792583509 2791355082 Bacteria 5973319
578 2792624551 2791355091 Bacteria 6135441
579 2792630705 2791355092 Bacteria 6248105
580 2792643414 2791355094 Bacteria 7011481
581 2793283731 2791355253 Bacteria 5171699
582 2793298475 2791355256 Bacteria 6798008
583 2793315685 2791355259 Bacteria 7254731
584 2793323468 2791355260 Bacteria 6598818
585 2793327586 2791355261 Bacteria 6661293
586 2793335657 2791355262 Bacteria 6774204
587 2793341051 2791355263 Bacteria 6872478
588 2793350272 2791355264 Bacteria 6429314
589 2793354787 2791355265 Bacteria 6539969
590 2793358516 2791355266 Bacteria 7116587
591 2793368968 2791355267 Bacteria 7222458
592 2802721223 2802428858 Bacteria 6636079
593 2802724536 2802428859 Bacteria 6667919
594 2802729797 2802428860 Bacteria 6525526
595 2802737143 2802428861 Bacteria 6534206
596 2802746844 2802428862 Bacteria 6633353
597 2802751760 2802428863 Bacteria 6410669
598 2804753919 2802429268 Bacteria 6094027
599 2805928892 2802429605 Bacteria 6875453
600 2805934513 2802429606 Bacteria 6346811
601 2806047063 2802429633 Bacteria 7341974
602 2806054938 2802429634 Bacteria 7083200
603 2806061834 2802429635 Bacteria 7650140
604 2806069643 2802429636 Bacteria 7597525
605 2806075986 2802429637 Bacteria 7067217
606 2808986754 2808606387 Bacteria 5697198
607 2819244192 2818991272 Bacteria 4622173
608 2819556828 2818991439 Bacteria 6907412
609 2819608864 2818991448 Bacteria 6772224
610 2819643290 2818991453 Bacteria 7181617
611 2819685837 2818991461 Bacteria 7026071
612 2821123246 2821123053 Bacteria 7836056
613 2837651515 2837651117 Bacteria 3772164
614 2838020957 2838016132 Bacteria 6577831
615 2838026860 2838022645 Bacteria 6494267
616 2838033970 2838029111 Bacteria 6603031
617 2838039746 2838035591 Bacteria 7166484
618 2838044841 2838042994 Bacteria 6046894
619 2838052894 2838048938 Bacteria 6044578
620 2838064687 2838061910 Bacteria 6794874
621 2838070536 2838068647 Bacteria 6208656
622 2838074773 2838074704 Bacteria 6785777
623 2838664024 2838661181 Bacteria 7385261
624 2838672516 2838668709 Bacteria 6671819
625 2838677563 2838675328 Bacteria 4909118
626 2838685599 2838680041 Bacteria 6545511
627 2838689825 2838686498 Bacteria 7807632
628 2838695945 2838694306 Bacteria 6853137
629 2838705161 2838701080 Bacteria 6669771
630 2838713344 2838707686 Bacteria 6619912
631 2838716452 2838714209 Bacteria 5525906
632 2838719748 2838719591 Bacteria 5523910
633 2838727203 2838724970 Bacteria 4908691
634 2838731479 2838729681 Bacteria 7400765
635 2838739731 2838736955 Bacteria 5760694
636 2838744420 2838742623 Bacteria 7396178
637 2841844145 2841840854 Bacteria 5761912
638 2841846679 2841846520 Bacteria 5345850
639 2841852960 2841851746 Bacteria 7532261
640 2841860791 2841859092 Bacteria 5436171
641 2841869108 2841864319 Bacteria 6742987
642 2842082578 2842077413 Bacteria 6508645
643 2842112733 2842110456 Bacteria 7656360
644 2842123863 2842118031 Bacteria 7033875
645 2842127292 2842124991 Bacteria 5346824
646 2842132456 2842130223 Bacteria 4909145
647 2842143866 2842140634 Bacteria 5759631
648 2842150155 2842146304 Bacteria 5957337
649 2842152375 2842152218 Bacteria 4908957
650 2842160287 2842156927 Bacteria 6894975
651 2842165735 2842163707 Bacteria 6916235
652 2842172697 2842170452 Bacteria 5525737
653 2842175994 2842175837 Bacteria 4908771
654 2842184047 2842180545 Bacteria 6888678
655 2842189559 2842187318 Bacteria 5524014
656 2842196349 2842192696 Bacteria 6147454
657 2842202423 2842198810 Bacteria 6608673
658 2842208926 2842205361 Bacteria 6340321
659 2842213873 2842211629 Bacteria 5523832
660 2842219411 2842217011 Bacteria 7497767
661 2842224509 2842224351 Bacteria 5524473
662 2842231629 2842229732 Bacteria 7475766
663 2842242918 2842237096 Bacteria 6620661
664 2842245902 2842243621 Bacteria 7421798
665 2842254841 2842250916 Bacteria 6579627
666 2842260280 2842257432 Bacteria 7401195
667 2842267168 2842264693 Bacteria 6472963
668 2842273691 2842271015 Bacteria 7807131
669 2842282384 2842278818 Bacteria 6340002
670 2842290075 2842285085 Bacteria 6011953
671 2842296991 2842291075 Bacteria 7076806
672 2842299922 2842298080 Bacteria 6123127
673 2842308457 2842304105 Bacteria 7023636
674 2842312239 2842311132 Bacteria 6616990
675 2842321833 2842317721 Bacteria 6793725
676 2842344641 2842341865 Bacteria 7003929
677 2842359556 2842357229 Bacteria 6485165
678 2842367784 2842363717 Bacteria 6844742
679 2842376015 2842370503 Bacteria 7038661
680 2842383225 2842377471 Bacteria 7140707
681 2842390358 2842384541 Bacteria 7057858
682 2842397826 2842395702 Bacteria 6780583
683 2842407685 2842402390 Bacteria 6681310
684 2842414316 2842409023 Bacteria 6687331
685 2842420824 2842415677 Bacteria 6596907
686 2842424150 2842422224 Bacteria 6239196
687 2842431136 2842428310 Bacteria 6767288
688 2842437471 2842434925 Bacteria 6502746
689 2842444286 2842441272 Bacteria 6769273
690 2842451287 2842447887 Bacteria 6754142
691 2842465279 2842462802 Bacteria 6588055
692 2842472252 2842469257 Bacteria 6752936
693 2842480716 2842475841 Bacteria 6603183
694 2842487240 2842482326 Bacteria 7212537
695 2842494123 2842489311 Bacteria 6620893
696 2842501232 2842495871 Bacteria 6820686
697 2842507241 2842502639 Bacteria 6604161
698 2842514514 2842509118 Bacteria 6850950
699 2842517576 2842515876 Bacteria 5436280
700 2842521244 2842521101 Bacteria 6569494
701 2842922709 2842922631 Bacteria 5824079
702 2844164864 2844163670 Bacteria 7266046
703 2844456573 2844454524 Bacteria 7952546
704 2847421094 2847417321 Bacteria 6913799
705 2848995931 2848992105 Bacteria 6810864
706 2850079310 2850079185 Bacteria 6848280
707 2852387880 2852387548 Bacteria 8025568
708 2854900843 2854896431 Bacteria 5869725
709 2854913838 2854911287 Bacteria 5582813
710 2854918871 2854916844 Bacteria 5725939
711 2855827654 2855825444 Bacteria 6785811
712 2855843030 2855839649 Bacteria 7135830
713 2855877648 2855872281 Bacteria 6964271
714 2857520869 2857516855 Bacteria 7787325
715 2857533802 2857531043 Bacteria 6754041
716 2858801986 2858800743 Bacteria 6603254
717 2891374810 2891373044 Bacteria 5202277
718 2896386109 2896384573 Bacteria 7700774
719 2899794381 2899792073 Bacteria 4926588
720 2899805871 2899803654 Bacteria 5577784
721 2899845764 2899845264 Bacteria 5672268
722 2913298495 2913295892 Bacteria 6333755
723 2913311967 2913308742 Bacteria 5350706
724 2915983240 2915980308 Bacteria 6624279
725 2915991723 2915986958 Bacteria 6739310
726 2915994222 2915993759 Bacteria 7016183
727 2916002919 2916000859 Bacteria 6865702
728 2916009722 2916007675 Bacteria 6898660
729 2916015135 2916014648 Bacteria 6946486
730 2916022375 2916021584 Bacteria 6854472
731 2916032247 2916028427 Bacteria 6748433
732 2916036081 2916035215 Bacteria 6755766
733 2916042329 2916041962 Bacteria 6820487
734 2916050054 2916048683 Bacteria 6543552
735 2916059041 2916055098 Bacteria 6758838
736 2916063551 2916061851 Bacteria 6737736
737 2916072379 2916068649 Bacteria 6943657
738 2916078535 2916076590 Bacteria 6596108
739 2919101847 2919100787 Bacteria 7710546
740 2919116669 2919114240 Bacteria 5700270
741 2919166472 2919166419 Bacteria 4952238
742 2919172463 2919171160 Bacteria 6499771
743 2919408343 2919408235 Bacteria 6149349
744 2920764036 2920760137 Bacteria 7427611
745 2920822712 2920822456 Bacteria 6897201
746 2921203487 2921201388 Bacteria 6926299
747 2921209263 2921208531 Bacteria 6745326
748 2921237637 2921237296 Bacteria 6876710
749 2921245115 2921244191 Bacteria 6568419
750 2921256236 2921250672 Bacteria 6677771
751 2921258718 2921257292 Bacteria 6808382
752 2921268197 2921263974 Bacteria 6864552
753 2921284621 2921282425 Bacteria 6826397
754 2921290012 2921289301 Bacteria 7316391
755 2921298463 2921296804 Bacteria 7176999
756 2923556163 2923556063 Bacteria 6793593
757 2924144659 2924144063 Bacteria 6883928
758 2924151878 2924150972 Bacteria 7169444
759 2924164777 2924158325 Bacteria 7188855
760 2924166414 2924165586 Bacteria 7260590
761 2924179696 2924172951 Bacteria 6749356
762 2924180430 2924179722 Bacteria 6843264
763 2924186794 2924186466 Bacteria 6876637
764 2924196258 2924193448 Bacteria 6955718
765 2924207153 2924200457 Bacteria 6757188
766 2924210692 2924207177 Bacteria 6917007
767 2924216009 2924214083 Bacteria 7080103
768 2924222702 2924221636 Bacteria 7113495
769 2924229578 2924228884 Bacteria 6633132
770 2926754678 2926754445 Bacteria 5964435
771 2926761846 2926760298 Bacteria 5505990
772 2929138662 2929138655 Bacteria 5810547
773 2933007022 2933006813 Bacteria 4912075
774 2933015387 2933011516 Bacteria 5439334
775 2933574906 2933570622 Bacteria 7023390
776 2933588378 2933586486 Bacteria 7667493
777 2933594224 2933594066 Bacteria 5594265
778 2933601341 2933599457 Bacteria 5858799
779 2935899963 2935894831 Bacteria 6620579
780 2935902340 2935901341 Bacteria 7341747
781 2936369526 2936367885 Bacteria 7324495
782 2936380267 2936375103 Bacteria 6652732
783 2936385276 2936381700 Bacteria 7006523
784 2936998832 2936996657 Bacteria 6298727
785 2937009372 2937002841 Bacteria 6934057
786 2937016003 2937009748 Bacteria 6746052
787 2937019982 2937016420 Bacteria 6782579
788 2937025578 2937023124 Bacteria 6815156
789 2937032481 2937029754 Bacteria 6424026
790 2937039144 2937036028 Bacteria 6846469
791 2937044713 2937042894 Bacteria 6741576
792 2937050425 2937049772 Bacteria 6757901
793 2937060729 2937056579 Bacteria 7107896
794 2937065736 2937063883 Bacteria 7199456
795 2937071763 2937071275 Bacteria 6984483
796 2937084015 2937078374 Bacteria 6610289
797 2937087372 2937084907 Bacteria 6618516
798 2937092303 2937091812 Bacteria 6979387
799 2937106347 2937098957 Bacteria 7249374
800 2937106829 2937106411 Bacteria 6947143
801 2937115973 2937113482 Bacteria 6505872
802 2937125419 2937119839 Bacteria 6597547
803 2937129194 2937126314 Bacteria 6771275
804 2941504149 2941499720 Bacteria 7599444
805 2957378109 2957375807 Bacteria 6425588
806 2957388094 2957382221 Bacteria 6737050
807 2957394293 2957388812 Bacteria 6778072
808 2957401602 2957395598 Bacteria 6822399
809 2957404991 2957402308 Bacteria 6741770
810 2957411908 2957408893 Bacteria 6558585
811 2957417170 2957415311 Bacteria 6991633
812 2957432974 2957430029 Bacteria 7022557
813 2957439272 2957437181 Bacteria 6568994
814 2957446607 2957443900 Bacteria 6869977
815 2957452295 2957450854 Bacteria 6765715
816 2957458250 2957457609 Bacteria 6967680
817 2957465127 2957464669 Bacteria 6568877
818 2957477934 2957471148 Bacteria 6797643
819 2957484118 2957478035 Bacteria 6756658
820 2957487009 2957484790 Bacteria 6703082
821 2957493879 2957491536 Bacteria 6695180
822 2957505457 2957498199 Bacteria 7126688
823 2957506160 2957505466 Bacteria 7253085
824 2960584681 2960584000 Bacteria 6864594
825 2960593076 2960591022 Bacteria 6622873
826 2960601208 2960597568 Bacteria 6550735
827 2960610830 2960603979 Bacteria 6898737
828 2960612243 2960610863 Bacteria 6691244
829 2960620288 2960617483 Bacteria 6727748
830 2960625983 2960624210 Bacteria 6875384
831 2960635465 2960631154 Bacteria 6732508
832 2960638588 2960637947 Bacteria 7296468
833 2960645918 2960645483 Bacteria 7211087
834 2960658734 2960652885 Bacteria 7083688
835 2960663118 2960660292 Bacteria 7041660
836 2960673474 2960667422 Bacteria 6763020
837 2960680606 2960674078 Bacteria 6609048
838 2960683847 2960680706 Bacteria 6624464
839 2960689262 2960687367 Bacteria 6535474
840 2960697080 2960693952 Bacteria 6749742
841 2964612221 2964607997 Bacteria 7101408
842 2964616404 2964615318 Bacteria 6809089
843 2964623956 2964621998 Bacteria 6834995
844 2964632078 2964628898 Bacteria 7083044
845 2964640437 2964636051 Bacteria 7091832
846 2964649510 2964643177 Bacteria 6820887
847 2964655913 2964649959 Bacteria 6675118
848 2964658227 2964656573 Bacteria 7100150
849 2964667459 2964663802 Bacteria 7019362
850 2964674965 2964670856 Bacteria 6851364
851 2964678842 2964678106 Bacteria 6792020
852 2964686811 2964685014 Bacteria 6839111
853 2964692240 2964691889 Bacteria 6802758
854 2964702327 2964698721 Bacteria 6765331
855 2964708175 2964705432 Bacteria 7114648
856 2964717455 2964712639 Bacteria 6695970
857 2964720017 2964719344 Bacteria 7286602
858 2967667680 2967664464 Bacteria 6948836
859 2967672085 2967671571 Bacteria 7021409
860 2967679137 2967678726 Bacteria 7264382
861 2967688361 2967686174 Bacteria 6678622
862 2967695727 2967693043 Bacteria 6804451
863 2967703275 2967699805 Bacteria 6854538
864 2967711293 2967706974 Bacteria 7186053
865 2967720648 2967714385 Bacteria 7000047
866 2967728542 2967721400 Bacteria 7073753
867 2967733906 2967728569 Bacteria 6641507
868 2967741600 2967735183 Bacteria 6827012
869 2967748899 2967742019 Bacteria 6794534
870 2967755085 2967748971 Bacteria 6733771
871 2967756408 2967755722 Bacteria 6814706
872 2967765360 2967762386 Bacteria 6923502
873 2967775874 2967769361 Bacteria 6587838
874 2967777374 2967775926 Bacteria 6738189
875 2970020097 2970019648 Bacteria 7072033
876 2970028852 2970026789 Bacteria 6785236
877 2970036205 2970033650 Bacteria 7118744
878 2970047506 2970040964 Bacteria 6731123
879 2970054257 2970047711 Bacteria 7088379
880 2970061516 2970054988 Bacteria 6611507
881 2970062244 2970061556 Bacteria 7099761
882 2970074355 2970068827 Bacteria 7123112
883 2970080272 2970076120 Bacteria 6697332
884 2970087613 2970082768 Bacteria 6183754
885 2970089759 2970088815 Bacteria 6933825
886 2970097884 2970095765 Bacteria 6936963
887 2970104349 2970102677 Bacteria 6812532
888 2970111766 2970109326 Bacteria 6863976
889 2970121976 2970116247 Bacteria 6501857
890 2970122869 2970122695 Bacteria 6625855
891 2970132297 2970129317 Bacteria 6806560
892 2970137772 2970136068 Bacteria 7207982
893 2970145394 2970143518 Bacteria 6446480
894 2970156648 2970149975 Bacteria 6779706
895 2970157756 2970156795 Bacteria 7168044
896 2970170252 2970164137 Bacteria 6861252
897 2970174584 2970170962 Bacteria 6876229
898 2970184346 2970177841 Bacteria 6768001
899 2970185264 2970184632 Bacteria 7054431
900 2970198805 2970191845 Bacteria 7032787
901 2977522252 2977516862 Bacteria 6940108
902 2977525655 2977523885 Bacteria 6960446
903 2977530809 2977530762 Bacteria 6951399
904 2977540720 2977537788 Bacteria 6929320
905 2977546836 2977544691 Bacteria 6875412
906 2977558228 2977551784 Bacteria 7125765
907 2977560651 2977558990 Bacteria 6863948
908 2977568782 2977565890 Bacteria 6901543
909 2977579270 2977572785 Bacteria 6763888
910 2977582588 2977579622 Bacteria 6772100
911 2978972863 2978969890 Bacteria 5400756
912 2979092888 2979089926 Bacteria 5670289
913 2979099723 2979095461 Bacteria 5669583
914 2979104857 2979100975 Bacteria 5423623
915 2984513343 2984509177 Bacteria 5274802
916 2984520288 2984518228 Bacteria 5277463
917 2984539586 2984537506 Bacteria 5277481
918 2984601812 2984601300 Bacteria 5455244
919 2989351984 2989349275 Bacteria 6349068
920 2989774559 2989771324 Bacteria 5605128
921 2989776815 2989776772 Bacteria 4843317
922 2996887950 2996887358 Bacteria 5795980
923 2996897614 2996893221 Bacteria 5823108
924 3003931327 3003930520 Bacteria 5667563
925 3005410650 3005409236 Bacteria 7188837
926 3005423282 3005416602 Bacteria 7064308
927 3005450111 3005445848 Bacteria 6906074
928 3005456317 3005452660 Bacteria 5889319
929 639646083 639633055 Bacteria 7751309
930 643827653 643692032 Bacteria 6891900
931 648741846 648276728 Bacteria 6968865
932 650738712 650716007 Bacteria 5573770
933 8003572259 8003570095 Bacteria 5747666
934 8003995609 8003992118 Bacteria 7266902
935 8004003375 8003999396 Bacteria 7063185
936 8005247901 8005246636 Bacteria 4933972
937 8005261484 8005258706 Bacteria 6184835
938 8005278309 8005275841 Bacteria 6929066
939 8005282657 8005282627 Bacteria 6675747
940 8005291633 8005289223 Bacteria 6634003
941 8005305494 8005301065 Bacteria 6614431
942 8005310270 8005307578 Bacteria 7395396
943 8005315609 8005314921 Bacteria 7072929
944 8005322477 8005321885 Bacteria 5795980
945 8005378083 8005376324 Bacteria 6590079
946 8005384093 8005382845 Bacteria 6732062
947 8005399629 8005395548 Bacteria 6806915
948 8005433778 8005430974 Bacteria 6689030
949 8005465544 8005460587 Bacteria 7157962
950 8005484482 8005484373 Bacteria 6297373
951 8005498127 8005497431 Bacteria 6477605
952 8005543216 8005542996 Bacteria 7077758
953 8005559994 8005556819 Bacteria 6908598
954 8005564511 8005563573 Bacteria 7153261
955 8005571198 8005570704 Bacteria 6957481
956 8005619336 8005619151 Bacteria 7030230
957 8005627901 8005626139 Bacteria 6534237
958 8005647403 8005645114 Bacteria 6950293
959 8005661511 8005658619 Bacteria 4500593
960 8005669535 8005668836 Bacteria 6953162
961 8005687442 8005682033 Bacteria 6726518
962 8005692753 8005688590 Bacteria 6610080
963 8005701442 8005695170 Bacteria 6912330
964 8018132552 8018127388 Bacteria 7351159
965 8018153942 8018150411 Bacteria 5549903
966 8018167588 8018163183 Bacteria 7277977
967 8018176601 8018176218 Bacteria 6896178
968 8023681253 8023680758 Bacteria 7729763
969 8024481916 8024479707 Bacteria 6954785
970 8024488576 8024486573 Bacteria 6540512
971 8024506352 8024501048 Bacteria 6427847
972 8045866147 8045864390 Bacteria 5043873
973 8046768665 8046767195 Bacteria 7547379
974 8049296512 8049293176 Bacteria 6128433
975 8054461031 8054460903 Bacteria 4872905
976 8054558745 8054558443 Bacteria 5204801
977 8055433849 8055431914 Bacteria 4551896
978 8056381171 8056375014 Bacteria 7006639
979 8056382664 8056382006 Bacteria 6408074
980 8056878667 8056875544 Bacteria 4355797
981 8057582441 8057575449 Bacteria 7367519
982 8057878682 8057874678 Bacteria 7494653
983 JGI24740J21852_10000671
984 JGI25155J39150_1000110
985 JGI25156J39149_1000192
986 JGI25162J39368_1000302
987 JGI25162J39368_1000517
988 JGI25154J39366_1000196
989 JGI25158J39367_1000816
990 JGI25157J39369_1000228
991 JGI25152J39213_1002972
992 JGI25152J39213_1003171
993 JGI25150J39212_1000266
994 JGI25159J45721_1000023
995 JGI25159J45721_1000516
996 JGI25159J45721_1002611
997 JGI25151J46595_10000355
998 JGI25151J46595_10000660
999 JGI25151J46595_10001587
1000 JGI25151J46595_10004733
1001 JGI25151J46595_10032371
1002 JGI25165J46597_1000720
1003 JGI25165J46597_1001110
1004 JGI25153J46596_10006110
1005 JGI25153J46596_10013215
1006 JGI25160J50197_1000044
1007 JGI25160J50197_1000061
1008 JGI25160J50197_1002094
1009 JGI25160J50197_1007103
1010 JGI25161J50226_1000028
1011 JGI25161J50226_1000078
1012 JGI25161J50226_1000200
1013 Ga0006562J51391_1010447
1014 Ga0055526_1003112
1015 Ga0055526_1003438
1016 Ga0055526_1004162
1017 Ga0055526_1005073
1018 Ga0055524_1000734
1019 Ga0055524_1001341
1020 Ga0055524_1005972
1021 Ga0055524_1017452
1022 Ga0055536_1005844
1023 Ga0055528_1000113
1024 Ga0055528_1001190
1025 Ga0055528_1018092
1026 Ga0055528_1021616
1027 Ga0055540_1000959
1028 Ga0055540_1007329
1029 Ga0055531_10002502
1030 Ga0058692_1002467
1031 Ga0055543_1000054
1032 Ga0055543_1000504
1033 Ga0055543_1000706
1034 Ga0055543_1001119
1035 Ga0065165_1000047
1036 Ga0065165_1000318
1037 Ga0065165_1004566
1038 Ga0065165_1007013
1039 Ga0065165_1017674
1040 Ga0070670_100000105
1041 Ga0070665_100008033
1042 Ga0070665_100023549
1043 Ga0070665_100026253
1044 Ga0068855_100236817
1045 Ga0068854_100082778
1046 Ga0068852_100091585
1047 Ga0075365_10002190
1048 Ga0075365_10078493
1049 Ga0075368_10000802
1050 Ga0075364_10000011
1051 Ga0075364_10015575
1052 Ga0075369_10002838
1053 Ga0075369_10014524
1054 Ga0075366_10001209
1055 Ga0075366_10055986
1056 Ga0075370_10009148
1057 Ga0075370_10009887
1058 Ga0079104_1000082
1059 Ga0079104_1000972
1060 Ga0079104_1008692
1061 Ga0099826_10000075
1062 Ga0099826_10027969
1063 Ga0105251_10005604
1064 Ga0105240_10002912
1065 Ga0105237_10008844
1066 Ga0123341_1000642
1067 Ga0123342_1004326
1068 Ga0123342_1007872
1069 Ga0105239_10075793
1070 Ga0105246_10024918
1071 Ga0157373_10001761
1072 Ga0157371_10000004
1073 Ga0157370_10001712
1074 Ga0157370_10048920
1075 Ga0157369_10057864
1076 Ga0171463_1001
1077 Ga0182008_10042839
1078 Ga0182007_10004193
1079 Ga0182005_1005158
1080 Ga0183363_1185
1081 Ga0214544_1005567
1082 Ga0214542_1004334
1083 Ga0214542_1018682
1084 Ga0214543_1004000
1085 Ga0214543_1005580
1086 Ga0228711_1000006
1087 Ga0228710_1000004
1088 Ga0209435_100087
1089 Ga0209436_100022
1090 Ga0209436_100213
1091 Ga0209436_110964
1092 Ga0209437_100050
1093 Ga0209437_100205
1094 Ga0207425_1000052
1095 Ga0207425_1007331
1096 Ga0207425_1010491
1097 Ga0209646_1000285
1098 Ga0209026_1000347
1099 Ga0209677_100223
1100 Ga0209759_1000482
1101 Ga0209129_1000066
1102 Ga0209129_1000141
1103 Ga0209129_1001039
1104 Ga0209129_1001233
1105 Ga0209129_1001336
1106 Ga0209129_1002179
1107 Ga0209129_1002224
1108 Ga0209233_1000037
1109 Ga0209233_1000187
1110 Ga0209233_1000232
1111 Ga0209673_1000024
1112 Ga0209673_1000911
1113 Ga0209673_1001370
1114 Ga0209673_1001606
1115 Ga0209673_1002065
1116 Ga0209673_1002866
1117 Ga0209673_1003320
1118 Ga0209673_1004509
1119 Ga0209130_1000002
1120 Ga0209130_1000005
1121 Ga0209130_1000093
1122 Ga0209130_1006003
1123 Ga0209676_1002635
1124 Ga0209025_1000060
1125 Ga0209025_1000144
1126 Ga0209025_1000274
1127 Ga0209025_1000275
1128 Ga0209025_1000377
1129 Ga0209025_1000832
1130 Ga0209025_1004510
1131 Ga0209025_1006318
1132 Ga0209564_1000262
1133 Ga0209564_1000590
1134 Ga0209564_1001583
1135 Ga0209564_1014300
1136 Ga0209564_1017679
1137 Ga0209758_1000229
1138 Ga0209758_1000383
1139 Ga0209758_1000971
1140 Ga0209758_1001494
1141 Ga0209758_1001499
1142 Ga0209758_1001505
1143 Ga0209758_1003461
1144 Ga0209050_1006578
1145 Ga0209256_1000715
1146 Ga0209256_1000741
1147 Ga0209256_1000868
1148 Ga0209256_1001683
1149 Ga0209256_1003279
1150 Ga0209256_1014343
1151 Ga0207426_1000012
1152 Ga0207426_1000013
1153 Ga0207426_1000015
1154 Ga0207426_1000142
1155 Ga0207426_1002277
1156 Ga0209051_1000170
1157 Ga0209051_1000768
1158 Ga0209051_1003314
1159 Ga0209051_1005690
1160 Ga0209051_1005899
1161 Ga0209051_1006189
1162 Ga0209257_1001590
1163 Ga0209257_1001982
1164 Ga0209257_1005446
1165 Ga0207695_10000036
1166 Ga0207671_10003518
1167 Ga0207681_10184815
1168 Ga0207650_10000302
1169 Ga0207711_10096634
1170 Ga0207668_10175730
1171 Ga0207698_10069979
1172 Ga0209281_1000043
1173 Ga0209281_1000102
1174 Ga0209281_1002419
1175 Ga0209371_1000009
1176 Ga0209371_1000306
1177 Ga0209282_1000013
1178 Ga0209282_1000145
1179 Ga0209813_10000777
1180 Ga0268266_10006467
1181 Ga0268266_10026837
1182 Ga0268266_10046495
1183 Ga0307515_10000029
1184 Ga0307515_10000448
1185 Ga0307515_10005232
1186 Ga0307515_10019917
1187 Ga0307515_10173484
1188 Ga0268256_1000010
1189 Ga0268256_1000751
1190 Ga0307513_10000259
1191 Ga0307513_10057450
1192 Ga0307408_100061817
1193 Ga0307405_10000589
1194 Ga0307406_10004489
1195 Ga0307412_10166755
1196 Ga0315914_1000004
1197 Ga0315913_1000055
1198 Ga0315915_1000003
1199 Ga0373946_0056875
1200 Ga0373927_0000562
1201 Ga0395905_0048405
1202 Ga0439436_0024353
1203 Ga0451845_0258408
1204 Ga0451847_0245130
1205 Ga0439449_0012226
1206 Ga0439449_0019773
1207 Ga0439457_018684
1208 Ga0439462_0007440
1209 Ga0466965_0044238
1210 Ga0466963_0103545
1211 Ga0466970_0002736
1212 Ga0495617_018010
1213 Ga0495592_0095690
1214 Ga0495629_0090193
1215 Ga0495638_0000566
1216 Ga0495638_0034598
1217 Ga0495638_0049284
1218 Ga0495605_0002376
1219 Ga0495662_0048493
1220 Ga0495584_0068276
1221 Ga0495596_0031299
1222 Ga0495607_0023706
1223 Ga0495607_0070511
1224 Ga0495583_0012862
1225 Ga0495583_0083159
1226 Ga0495606_0003236
1227 Ga0495606_0014595
1228 Ga0495606_0017263
1229 Ga0495610_0002136
1230 Ga0495610_0004503
1231 Ga0495610_0019568
1232 Ga0495620_0033408
1233 Ga0495620_0097304
1234 Ga0495631_0005279
1235 Ga0495631_0082069
1236 Ga0495632_0003607
1237 Ga0495643_0004568
1238 Ga0495643_0016056
1239 Ga0495643_0023194
1240 Ga0495643_0024856
1241 Ga0495644_0053316
1242 Ga0495648_0011431
1243 Ga0495648_0029990
1244 Ga0495654_0000314
1245 Ga0495654_0032018
1246 Ga0495609_0051061
1247 Ga0495633_0020794
1248 Ga0495633_0039313
1249 Ga0495633_0049746
1250 Ga0495633_0082979
1251 Ga0495656_0003978
1252 Ga0495668_0049605
1253 Ga0495668_0086411
1254 Ga0495668_0113487
1255 Ga0495625_0016237
1256 Ga0495625_0062476
1257 Ga0495625_0147839
1258 Ga0495588_0001058
1259 Ga0495657_0052730
1260 Ga0495658_0068182
1261 Ga0495624_0062087
1262 Ga0495649_0032013
1263 Ga0495681_0007095
1264 Ga0495686_0002334
1265 Ga0495686_0012332
1266 Ga0495686_0028737
1267 Ga0495686_0036324
1268 Ga0495686_0082331
1269 Ga0495615_0014424
1270 Ga0495615_0018096
1271 Ga0495626_0080051
1272 Ga0496100_0041710
1273 Ga0496102_0024411
1274 Ga0496103_0016030
1275 Ga0496106_0002238
1276 Ga0496110_0327696
1277 Ga0496112_0119992
1278 Ga0496113_0046183
1279 Ga0496114_0197105
1280 Ga0496116_0000395
1281 Ga0496116_0001740
1282 Ga0496116_0020581
1283 Ga0496116_0022634
1284 Ga0496116_0023641
1285 Ga0496116_0072721
1286 Ga0496117_0000002
1287 Ga0496117_0002038
1288 Ga0496117_0002089
1289 Ga0496117_0012495
1290 Ga0496117_0030530
1291 Ga0496118_0002110
1292 Ga0496118_0004517
1293 Ga0496118_0022502
1294 Ga0496119_0005965
1295 Ga0496119_0063337
1296 Ga0496120_0001226
1297 Ga0496121_0000001
1298 Ga0496121_0000426
1299 Ga0496121_0002514
1300 Ga0496121_0021073
1301 Ga0496121_0031495
1302 Ga0496121_0063000
1303 Ga0496121_0073269
1304 Ga0496122_0000001
1305 Ga0496122_0000018
1306 Ga0496122_0000321
1307 Ga0496122_0008035
1308 Ga0496122_0037023
1309 Ga0496122_0061092
1310 Ga0496122_0071173
1311 Ga0496122_0120385
1312 Ga0496123_0000001
1313 Ga0496123_0000015
1314 Ga0496123_0000454
1315 Ga0496123_0007215
1316 Ga0496123_0037778
1317 Ga0496123_0038920
1318 Ga0496123_0052011
1319 Ga0496123_0052985
1320 Ga0496124_0000178
1321 Ga0496124_0000558
1322 Ga0496124_0004819
1323 Ga0496124_0011523
1324 Ga0496124_0012361
1325 Ga0496124_0022854
1326 Ga0496124_0026740
1327 Ga0496124_0028588
1328 Ga0496124_0045920
1329 Ga0496124_0096720
1330 Ga0496124_0188960
1331 Ga0496125_0000001
1332 Ga0496125_0000628
1333 Ga0496125_0002093
1334 Ga0496125_0025877
1335 Ga0496125_0026712
1336 Ga0496126_0000378
1337 Ga0496126_0001701
1338 Ga0496126_0005535
1339 Ga0496126_0142966
1340 Ga0496126_0149571
1341 Ga0496126_0160176
1342 Ga0495682_0028852
1343 Ga0501031_0019357
1344 Ga0501033_0000260
1345 Ga0501034_0019971
1346 Ga0501038_0022763
1347 Ga0501080_0050966
1348 Ga0501080_0330254
1349 Ga0501035_0001529
1350 nmdc:mga03683_16502_c1
1351 nmdc:mga00v17_17238_c1
1352 nmdc:mga00v17_47_c1
1353 nmdc:mga00v17_71_c1
1354 nmdc:mga0yw44_19401_c1
1355 nmdc:mga0yw44_66659_c1
1356 nmdc:mga0k408_6901_c1
1357 nmdc:mga06z11_11692_c1
1358 nmdc:mga06z11_22119_c1
1359 nmdc:mga04h51_745_c1
1360 nmdc:mga07m45_31791_c1
1361 nmdc:mga0sz30_1214_c1
1362 Ga0500578_0004631
1363 Ga0500578_0009746
1364 Ga0500644_0020737
1365 Ga0500560_000072
1366 Ga0500572_006394
1367 Ga0500594_0002289
1368 Ga0500608_009888
1369 Ga0500608_029119
1370 Ga0500618_000203
1371 Ga0500618_001422
1372 Ga0500618_001766
1373 Ga0500618_006648
1374 Ga0500618_007055
1375 Ga0500658_0000327
1376 Ga0500559_0004885
1377 Ga0500561_0000124
1378 Ga0500568_0001169
1379 Ga0500590_003223
1380 Ga0500616_0000437
1381 Ga0500616_0002500
1382 Ga0500616_0006023
1383 Ga0500622_0000189
1384 Ga0500622_0002842
1385 Ga0500624_000680
1386 Ga0500634_0066380
1387 Ga0500636_0000036
1388 Ga0500636_0000887
1389 Ga0500636_0069358
1390 2933020336
1391 2509112189
1392 2509379528
1393 2509388979
1394 2509444569
1395 2510135684
1396 2510307112
1397 2510838876
1398 2510897157
1399 2511136842
1400 2511168911
1401 2511185308
1402 2511200506
1403 2511498742
1404 2512534878
1405 2512973294
1406 2513570845
1407 2513574940
1408 2513587887
1409 2513595631
1410 2513603649
1411 2513619417
1412 2513633724
1413 2513707571
1414 2513865344
1415 2513886015
1416 2513904353
1417 2513911013
1418 2513924321
1419 2513983355
1420 2513996286
1421 2514005889
1422 2514024100
1423 2515114848
1424 2515607181
1425 2515635795
1426 2515641409
1427 2515659298
1428 2515741167
1429 2516204933
1430 2516895020
1431 2517038467
1432 2517078742
1433 2517097484
1434 2517408940
1435 2517571703
1436 2520379166
1437 2524452568
1438 2524461856
1439 2530648329
1440 2535514559
1441 2537877356
1442 2551675993
1443 2551682876
1444 2551689917
1445 2551694587
1446 2551699439
1447 2551721926
1448 2551726553
1449 2551742815
1450 2554246253
1451 2558865237
1452 2558865926
1453 2559293475
1454 2561467882
1455 2585164457
1456 2585201299
1457 2585223274
1458 2585230964
1459 2585256439
1460 2585264756
1461 2585273473
1462 2585283563
1463 2585328186
1464 2585330597
1465 2585386175
1466 2585394788
1467 2585399118
1468 2585523943
1469 2585536033
1470 2585542087
1471 2585546130
1472 2585556639
1473 2585563998
1474 2585818732
1475 2585840703
1476 2585843679
1477 2585900333
1478 2585909294
1479 2585998446
1480 2586003009
1481 2587984604
1482 2599332441
1483 2599419721
1484 2599604357
1485 2599718731
1486 2600196666
1487 2600376726
1488 2601609506
1489 2601746281
1490 2616293946
1491 2616311172
1492 2616556094
1493 2617380707
1494 2643805662
1495 2643812534
1496 2643857542
1497 2643920633
1498 2644004402
1499 2644051586
1500 2644065837
1501 2644103914
1502 2644144795
1503 2644191200
1504 2644200084
1505 2644207236
1506 2644237678
1507 2644298227
1508 2644306844
1509 2644331035
1510 2644380142
1511 2644417168
1512 2644450564
1513 2644480455
1514 2644495451
1515 2644498815
1516 2644519558
1517 2644541254
1518 2644612455
1519 2644650884
1520 2644656479
1521 2644671349
1522 2644693011
1523 2657682697
1524 2671115820
1525 2692319682
1526 2719183347
1527 2719388107
1528 2719667730
1529 2719734064
1530 2720494150
1531 2720615613
1532 2720622396
1533 2720633750
1534 2720777450
1535 2721149459
1536 2721160862
1537 2721166296
1538 2721401740
1539 2722842466
1540 2723029047
1541 2723562664
1542 2723569357
1543 2724040554
1544 2724046820
1545 2724092057
1546 2724106622
1547 2724112430
1548 2725949652
1549 2730109983
1550 2730166582
1551 2730300494
1552 2738800754
1553 2738946675
1554 2739037336
1555 2753460057
1556 2766067146
1557 2776915965
1558 2778179522
1559 2792583509
1560 2792624551
1561 2792630705
1562 2792643414
1563 2793283731
1564 2793298475
1565 2793315685
1566 2793323468
1567 2793327586
1568 2793335657
1569 2793341051
1570 2793350272
1571 2793354787
1572 2793358516
1573 2793368968
1574 2802721223
1575 2802724536
1576 2802729797
1577 2802737143
1578 2802746844
1579 2802751760
1580 2804753919
1581 2805928892
1582 2805934513
1583 2806047063
1584 2806054938
1585 2806061834
1586 2806069643
1587 2806075986
1588 2808986754
1589 2819244192
1590 2819556828
1591 2819608864
1592 2819643290
1593 2819685837
1594 2821123246
1595 2837651515
1596 2838020957
1597 2838026860
1598 2838033970
1599 2838039746
1600 2838044841
1601 2838052894
1602 2838064687
1603 2838070536
1604 2838074773
1605 2838664024
1606 2838672516
1607 2838677563
1608 2838685599
1609 2838689825
1610 2838695945
1611 2838705161
1612 2838713344
1613 2838716452
1614 2838719748
1615 2838727203
1616 2838731479
1617 2838739731
1618 2838744420
1619 2841844145
1620 2841846679
1621 2841852960
1622 2841860791
1623 2841869108
1624 2842082578
1625 2842112733
1626 2842123863
1627 2842127292
1628 2842132456
1629 2842143866
1630 2842150155
1631 2842152375
1632 2842160287
1633 2842165735
1634 2842172697
1635 2842175994
1636 2842184047
1637 2842189559
1638 2842196349
1639 2842202423
1640 2842208926
1641 2842213873
1642 2842219411
1643 2842224509
1644 2842231629
1645 2842242918
1646 2842245902
1647 2842254841
1648 2842260280
1649 2842267168
1650 2842273691
1651 2842282384
1652 2842290075
1653 2842296991
1654 2842299922
1655 2842308457
1656 2842312239
1657 2842321833
1658 2842344641
1659 2842359556
1660 2842367784
1661 2842376015
1662 2842383225
1663 2842390358
1664 2842397826
1665 2842407685
1666 2842414316
1667 2842420824
1668 2842424150
1669 2842431136
1670 2842437471
1671 2842444286
1672 2842451287
1673 2842465279
1674 2842472252
1675 2842480716
1676 2842487240
1677 2842494123
1678 2842501232
1679 2842507241
1680 2842514514
1681 2842517576
1682 2842521244
1683 2842922709
1684 2844164864
1685 2844456573
1686 2847421094
1687 2848995931
1688 2850079310
1689 2852387880
1690 2854900843
1691 2854913838
1692 2854918871
1693 2855827654
1694 2855843030
1695 2855877648
1696 2857520869
1697 2857533802
1698 2858801986
1699 2891374810
1700 2896386109
1701 2899794381
1702 2899805871
1703 2899845764
1704 2913298495
1705 2913311967
1706 2915983240
1707 2915991723
1708 2915994222
1709 2916002919
1710 2916009722
1711 2916015135
1712 2916022375
1713 2916032247
1714 2916036081
1715 2916042329
1716 2916050054
1717 2916059041
1718 2916063551
1719 2916072379
1720 2916078535
1721 2919101847
1722 2919116669
1723 2919166472
1724 2919172463
1725 2919408343
1726 2920764036
1727 2920822712
1728 2921203487
1729 2921209263
1730 2921237637
1731 2921245115
1732 2921256236
1733 2921258718
1734 2921268197
1735 2921284621
1736 2921290012
1737 2921298463
1738 2923556163
1739 2924144659
1740 2924151878
1741 2924164777
1742 2924166414
1743 2924179696
1744 2924180430
1745 2924186794
1746 2924196258
1747 2924207153
1748 2924210692
1749 2924216009
1750 2924222702
1751 2924229578
1752 2926754678
1753 2926761846
1754 2929138662
1755 2933007022
1756 2933015387
1757 2933574906
1758 2933588378
1759 2933594224
1760 2933601341
1761 2935899963
1762 2935902340
1763 2936369526
1764 2936380267
1765 2936385276
1766 2936998832
1767 2937009372
1768 2937016003
1769 2937019982
1770 2937025578
1771 2937032481
1772 2937039144
1773 2937044713
1774 2937050425
1775 2937060729
1776 2937065736
1777 2937071763
1778 2937084015
1779 2937087372
1780 2937092303
1781 2937106347
1782 2937106829
1783 2937115973
1784 2937125419
1785 2937129194
1786 2941504149
1787 2957378109
1788 2957388094
1789 2957394293
1790 2957401602
1791 2957404991
1792 2957411908
1793 2957417170
1794 2957432974
1795 2957439272
1796 2957446607
1797 2957452295
1798 2957458250
1799 2957465127
1800 2957477934
1801 2957484118
1802 2957487009
1803 2957493879
1804 2957505457
1805 2957506160
1806 2960584681
1807 2960593076
1808 2960601208
1809 2960610830
1810 2960612243
1811 2960620288
1812 2960625983
1813 2960635465
1814 2960638588
1815 2960645918
1816 2960658734
1817 2960663118
1818 2960673474
1819 2960680606
1820 2960683847
1821 2960689262
1822 2960697080
1823 2964612221
1824 2964616404
1825 2964623956
1826 2964632078
1827 2964640437
1828 2964649510
1829 2964655913
1830 2964658227
1831 2964667459
1832 2964674965
1833 2964678842
1834 2964686811
1835 2964692240
1836 2964702327
1837 2964708175
1838 2964717455
1839 2964720017
1840 2967667680
1841 2967672085
1842 2967679137
1843 2967688361
1844 2967695727
1845 2967703275
1846 2967711293
1847 2967720648
1848 2967728542
1849 2967733906
1850 2967741600
1851 2967748899
1852 2967755085
1853 2967756408
1854 2967765360
1855 2967775874
1856 2967777374
1857 2970020097
1858 2970028852
1859 2970036205
1860 2970047506
1861 2970054257
1862 2970061516
1863 2970062244
1864 2970074355
1865 2970080272
1866 2970087613
1867 2970089759
1868 2970097884
1869 2970104349
1870 2970111766
1871 2970121976
1872 2970122869
1873 2970132297
1874 2970137772
1875 2970145394
1876 2970156648
1877 2970157756
1878 2970170252
1879 2970174584
1880 2970184346
1881 2970185264
1882 2970198805
1883 2977522252
1884 2977525655
1885 2977530809
1886 2977540720
1887 2977546836
1888 2977558228
1889 2977560651
1890 2977568782
1891 2977579270
1892 2977582588
1893 2978972863
1894 2979092888
1895 2979099723
1896 2979104857
1897 2984513343
1898 2984520288
1899 2984539586
1900 2984601812
1901 2989351984
1902 2989774559
1903 2989776815
1904 2996887950
1905 2996897614
1906 3003931327
1907 3005410650
1908 3005423282
1909 3005450111
1910 3005456317
1911 639646083
1912 643827653
1913 648741846
1914 650738712
1915 8003572259
1916 8003995609
1917 8004003375
1918 8005247901
1919 8005261484
1920 8005278309
1921 8005282657
1922 8005291633
1923 8005305494
1924 8005310270
1925 8005315609
1926 8005322477
1927 8005378083
1928 8005384093
1929 8005399629
1930 8005433778
1931 8005465544
1932 8005484482
1933 8005498127
1934 8005543216
1935 8005559994
1936 8005564511
1937 8005571198
1938 8005619336
1939 8005627901
1940 8005647403
1941 8005661511
1942 8005669535
1943 8005687442
1944 8005692753
1945 8005701442
1946 8018132552
1947 8018153942
1948 8018167588
1949 8018176601
1950 8023681253
1951 8024481916
1952 8024488576
1953 8024506352
1954 8045866147
1955 8046768665
1956 8049296512
1957 8054461031
1958 8054558745
1959 8055433849
1960 8056381171
1961 8056382664
1962 8056878667
1963 8057582441
1964 8057878682

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4myr-assembly4.cif.gz_D crystal structure of a putative cpae2 pilus assembly protein (cpae2) from sinorhizobium meliloti 1021 at 2.72 a resolution (psi community target, shapiro) 0.9658 34 154
4n0p-assembly5.cif.gz_E crystal structure of a pilus assembly protein cpae (cc_2943) from caulobacter crescentus cb15 at 1.75 a resolution (psi community target, shapiro) 0.9606 32 154
4n0p-assembly2.cif.gz_B crystal structure of a pilus assembly protein cpae (cc_2943) from caulobacter crescentus cb15 at 1.75 a resolution (psi community target, shapiro) 0.9593 28 156
4n0p-assembly5.cif.gz_E crystal structure of a pilus assembly protein cpae (cc_2943) from caulobacter crescentus cb15 at 1.75 a resolution (psi community target, shapiro) 0.9531 32 154
4myr-assembly4.cif.gz_D crystal structure of a putative cpae2 pilus assembly protein (cpae2) from sinorhizobium meliloti 1021 at 2.72 a resolution (psi community target, shapiro) 0.9505 34 154
ID Description Score Start End Superfamily
4n0pE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9606 32 154 3.40.50.2300
4n0pE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9531 32 154 3.40.50.2300
4myrD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9126 34 154 3.40.50.2300
4myrD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8977 34 154 3.40.50.2300
3ea0B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8896 163 399 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A354EQA3-F1-model_v4 Pilus assembly protein CpaE 0.9697 26 140
AF-A0A528N414-F1-model_v4 CtpF protein 0.9637 28 117
AF-A0A436E944-F1-model_v4 CtpF protein 0.9578 185 394 GO:0005524
GO:0005829
GO:0009898
GO:0016887
GO:0051782
AF-A0A2J0YSI0-F1-model_v4 CtpF protein 0.9564 261 389 GO:0005524
GO:0005829
GO:0009898
GO:0016887
GO:0051782
AF-A0A528N414-F1-model_v4 CtpF protein 0.9534 28 117

Map