F487452
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 983 | 298 | 983 | 264 |
Family's Representative Sequence
| Representative Sequence | 3300035116|Ga0373945_0046429|Ga0373945_0046429_174_1124 |
| Length | 316 |
| Sequence | LHRHPEEIAVELRSTKSRWRLSHILVALGPNLALAHSKAVLATVLPSNFGFNIMRILFIGDIFGRPGRNIVKDRLPGIVRDHSINLIIANGENSAAGFGITPALAEDLFDLNIDVITTGNHVWDKREIIDYFQMVEGNGHGPARRVLRPANYPADMPGSGVYEGMKGNVPYAVINLQGRVFMASNDDPFRTADKLLQKIQAKIILVDMHAEATSEKISLGWYLDGRVTAVVGTHTHVPTADNRVLPNGTAYVTDVGMTGPYDGVIGVKKELVVGKFLNGMPVRFEPASGDARLCAVVIDCDEQTGKAHSIERLMLS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 84 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 115 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 116 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 117 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 118 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 119 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 120 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 121 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 181 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 186 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 187 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 189 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 190 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 191 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 193 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 194 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 195 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 196 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 197 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 198 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 199 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 201 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 202 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 203 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 204 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 205 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 207 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 208 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 211 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 212 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 217 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 220 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 221 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 222 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 225 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 226 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 227 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 228 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 229 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 230 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 231 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 232 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 233 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 234 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 235 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 236 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 237 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 238 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 239 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 240 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 241 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 279 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 280 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 281 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 282 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 283 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 286 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 287 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 288 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 289 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 290 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 291 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 292 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.78 |
| Metatranscriptomes | 1.22 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.88 |
| Rhizosphere | 93.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1001133 | 3300000546 | Bacteria | 4065 |
| 2 | JGI24751J29686_10009361 | 3300002459 | Bacteria | 2013 |
| 3 | Ga0058863_11948358 | 3300004799 | Bacteria | 3043 |
| 4 | Ga0058861_12038421 | 3300004800 | Unclassified | 2346 |
| 5 | Ga0065712_10168060 | 3300005290 | Bacteria | 1260 |
| 6 | Ga0070658_10074824 | 3300005327 | Bacteria | 2777 |
| 7 | Ga0070676_10003837 | 3300005328 | Bacteria | 7889 |
| 8 | Ga0070676_10017075 | 3300005328 | Bacteria | 4012 |
| 9 | Ga0070683_100004635 | 3300005329 | Bacteria | 11354 |
| 10 | Ga0070683_100097817 | 3300005329 | Bacteria | 2761 |
| 11 | Ga0070683_100344593 | 3300005329 | Bacteria | 1419 |
| 12 | Ga0070690_100021225 | 3300005330 | Bacteria | 3962 |
| 13 | Ga0070690_100070037 | 3300005330 | Bacteria | 2277 |
| 14 | Ga0070690_100181853 | 3300005330 | Bacteria | 1453 |
| 15 | Ga0070690_100291651 | 3300005330 | Bacteria | 1167 |
| 16 | Ga0070670_100001284 | 3300005331 | Bacteria | 20024 |
| 17 | Ga0070670_100114216 | 3300005331 | Bacteria | 2328 |
| 18 | Ga0070677_10186993 | 3300005333 | Bacteria | 990 |
| 19 | Ga0068869_100030462 | 3300005334 | Bacteria | 3787 |
| 20 | Ga0068869_100067071 | 3300005334 | Bacteria | 2646 |
| 21 | Ga0070680_100007843 | 3300005336 | Bacteria | 8141 |
| 22 | Ga0070680_100089347 | 3300005336 | Bacteria | 2549 |
| 23 | Ga0070680_100137977 | 3300005336 | Bacteria | 2044 |
| 24 | Ga0070680_100218418 | 3300005336 | Bacteria | 1608 |
| 25 | Ga0070682_100005772 | 3300005337 | Bacteria | 6907 |
| 26 | Ga0070682_100057639 | 3300005337 | Bacteria | 2448 |
| 27 | Ga0068868_100006219 | 3300005338 | Bacteria | 8447 |
| 28 | Ga0068868_100009581 | 3300005338 | Bacteria | 6982 |
| 29 | Ga0068868_100054428 | 3300005338 | Bacteria | 3153 |
| 30 | Ga0068868_100073410 | 3300005338 | Bacteria | 2732 |
| 31 | Ga0068868_100090243 | 3300005338 | Unclassified | 2468 |
| 32 | Ga0070660_100000802 | 3300005339 | Bacteria | 20852 |
| 33 | Ga0070660_100059442 | 3300005339 | Bacteria | 2964 |
| 34 | Ga0070660_100105033 | 3300005339 | Bacteria | 2241 |
| 35 | Ga0070689_100007128 | 3300005340 | Bacteria | 7791 |
| 36 | Ga0070691_10091632 | 3300005341 | Bacteria | 1499 |
| 37 | Ga0070687_100011620 | 3300005343 | Bacteria | 3858 |
| 38 | Ga0070661_100033575 | 3300005344 | Bacteria | 3717 |
| 39 | Ga0070692_10134893 | 3300005345 | Bacteria | 1391 |
| 40 | Ga0070669_100135828 | 3300005353 | Bacteria | 1891 |
| 41 | Ga0070669_100192164 | 3300005353 | Bacteria | 1602 |
| 42 | Ga0070671_100203273 | 3300005355 | Bacteria | 1680 |
| 43 | Ga0070674_100253192 | 3300005356 | Bacteria | 1384 |
| 44 | Ga0070673_100116863 | 3300005364 | Bacteria | 2219 |
| 45 | Ga0070673_100213038 | 3300005364 | Bacteria | 1669 |
| 46 | Ga0070688_100000324 | 3300005365 | Bacteria | 24448 |
| 47 | Ga0070688_100100176 | 3300005365 | Bacteria | 1909 |
| 48 | Ga0070659_100049589 | 3300005366 | Bacteria | 3302 |
| 49 | Ga0070659_100061181 | 3300005366 | Bacteria | 2975 |
| 50 | Ga0070659_100365931 | 3300005366 | Bacteria | 1212 |
| 51 | Ga0070667_100259526 | 3300005367 | Bacteria | 1555 |
| 52 | Ga0070667_100552629 | 3300005367 | Bacteria | 1058 |
| 53 | Ga0070709_10006939 | 3300005434 | Bacteria | 6183 |
| 54 | Ga0070709_10022285 | 3300005434 | Bacteria | 3703 |
| 55 | Ga0070709_10030430 | 3300005434 | Unclassified | 3240 |
| 56 | Ga0070709_10037044 | 3300005434 | Bacteria | 2976 |
| 57 | Ga0070709_10078324 | 3300005434 | Bacteria | 2150 |
| 58 | Ga0070709_10087316 | 3300005434 | Bacteria | 2049 |
| 59 | Ga0070709_10104062 | 3300005434 | Unclassified | 1897 |
| 60 | Ga0070709_10121001 | 3300005434 | Bacteria | 1774 |
| 61 | Ga0070709_10480320 | 3300005434 | Bacteria | 941 |
| 62 | Ga0070714_100000060 | 3300005435 | Bacteria | 100913 |
| 63 | Ga0070714_100006809 | 3300005435 | Bacteria | 8857 |
| 64 | Ga0070714_100009371 | 3300005435 | Bacteria | 7692 |
| 65 | Ga0070714_100045952 | 3300005435 | Bacteria | 3702 |
| 66 | Ga0070714_100074082 | 3300005435 | Bacteria | 2951 |
| 67 | Ga0070714_100176484 | 3300005435 | Unclassified | 1942 |
| 68 | Ga0070714_100210467 | 3300005435 | Unclassified | 1782 |
| 69 | Ga0070714_100289739 | 3300005435 | Bacteria | 1523 |
| 70 | Ga0070714_100296418 | 3300005435 | Bacteria | 1506 |
| 71 | Ga0070714_100296486 | 3300005435 | Bacteria | 1506 |
| 72 | Ga0070714_100418040 | 3300005435 | Bacteria | 1270 |
| 73 | Ga0070714_100456793 | 3300005435 | Bacteria | 1214 |
| 74 | Ga0070714_100910826 | 3300005435 | Bacteria | 854 |
| 75 | Ga0070713_100000037 | 3300005436 | Bacteria | 85487 |
| 76 | Ga0070713_100001036 | 3300005436 | Bacteria | 17798 |
| 77 | Ga0070713_100001663 | 3300005436 | Bacteria | 14294 |
| 78 | Ga0070713_100002374 | 3300005436 | Bacteria | 12270 |
| 79 | Ga0070713_100003409 | 3300005436 | Bacteria | 10498 |
| 80 | Ga0070713_100037517 | 3300005436 | Unclassified | 3919 |
| 81 | Ga0070713_100045935 | 3300005436 | Bacteria | 3582 |
| 82 | Ga0070713_100079727 | 3300005436 | Bacteria | 2790 |
| 83 | Ga0070713_100083375 | 3300005436 | Bacteria | 2733 |
| 84 | Ga0070713_100112837 | 3300005436 | Bacteria | 2372 |
| 85 | Ga0070713_100141496 | 3300005436 | Bacteria | 2132 |
| 86 | Ga0070713_100175324 | 3300005436 | Bacteria | 1924 |
| 87 | Ga0070713_100186960 | 3300005436 | Bacteria | 1865 |
| 88 | Ga0070713_100271111 | 3300005436 | Bacteria | 1554 |
| 89 | Ga0070713_100353140 | 3300005436 | Bacteria | 1364 |
| 90 | Ga0070713_100565869 | 3300005436 | Bacteria | 1077 |
| 91 | Ga0070710_10001259 | 3300005437 | Bacteria | 12036 |
| 92 | Ga0070710_10008303 | 3300005437 | Bacteria | 5054 |
| 93 | Ga0070710_10030625 | 3300005437 | Bacteria | 2897 |
| 94 | Ga0070710_10128132 | 3300005437 | Bacteria | 1544 |
| 95 | Ga0070711_100000620 | 3300005439 | Bacteria | 18531 |
| 96 | Ga0070711_100000948 | 3300005439 | Bacteria | 15349 |
| 97 | Ga0070711_100003458 | 3300005439 | Bacteria | 9206 |
| 98 | Ga0070711_100004411 | 3300005439 | Bacteria | 8302 |
| 99 | Ga0070711_100020771 | 3300005439 | Bacteria | 4237 |
| 100 | Ga0070711_100024294 | 3300005439 | Bacteria | 3951 |
| 101 | Ga0070711_100029169 | 3300005439 | Unclassified | 3638 |
| 102 | Ga0070711_100175599 | 3300005439 | Bacteria | 1636 |
| 103 | Ga0070711_100210306 | 3300005439 | Bacteria | 1506 |
| 104 | Ga0070711_100229975 | 3300005439 | Bacteria | 1445 |
| 105 | Ga0070711_100261692 | 3300005439 | Unclassified | 1361 |
| 106 | Ga0070711_100309430 | 3300005439 | Unclassified | 1259 |
| 107 | Ga0070711_100402942 | 3300005439 | Bacteria | 1111 |
| 108 | Ga0070708_100001252 | 3300005445 | Bacteria | 19517 |
| 109 | Ga0070708_100004680 | 3300005445 | Bacteria | 10784 |
| 110 | Ga0070708_100009817 | 3300005445 | Bacteria | 7728 |
| 111 | Ga0070708_100020691 | 3300005445 | Bacteria | 5554 |
| 112 | Ga0070708_100040631 | 3300005445 | Bacteria | 4074 |
| 113 | Ga0070708_100044681 | 3300005445 | Bacteria | 3897 |
| 114 | Ga0070708_100076078 | 3300005445 | Bacteria | 3031 |
| 115 | Ga0070708_100152512 | 3300005445 | Bacteria | 2150 |
| 116 | Ga0070708_100153520 | 3300005445 | Bacteria | 2142 |
| 117 | Ga0070708_100158622 | 3300005445 | Bacteria | 2107 |
| 118 | Ga0070663_100014599 | 3300005455 | Bacteria | 5046 |
| 119 | Ga0070678_100021562 | 3300005456 | Bacteria | 4251 |
| 120 | Ga0070662_100007867 | 3300005457 | Bacteria | 6925 |
| 121 | Ga0070662_100146223 | 3300005457 | Bacteria | 1836 |
| 122 | Ga0070681_10000104 | 3300005458 | Bacteria | 62963 |
| 123 | Ga0070681_10002085 | 3300005458 | Bacteria | 18155 |
| 124 | Ga0070681_10034658 | 3300005458 | Bacteria | 5069 |
| 125 | Ga0070681_10035198 | 3300005458 | Bacteria | 5029 |
| 126 | Ga0070681_10045960 | 3300005458 | Bacteria | 4366 |
| 127 | Ga0070681_10052615 | 3300005458 | Bacteria | 4062 |
| 128 | Ga0070681_10053927 | 3300005458 | Bacteria | 4006 |
| 129 | Ga0070681_10404448 | 3300005458 | Bacteria | 1277 |
| 130 | Ga0070681_10423409 | 3300005458 | Unclassified | 1243 |
| 131 | Ga0068867_100025667 | 3300005459 | Bacteria | 4229 |
| 132 | Ga0068867_100050861 | 3300005459 | Bacteria | 3055 |
| 133 | Ga0070685_10071696 | 3300005466 | Bacteria | 2054 |
| 134 | Ga0070706_100000038 | 3300005467 | Bacteria | 150665 |
| 135 | Ga0070706_100001729 | 3300005467 | Bacteria | 22631 |
| 136 | Ga0070706_100002504 | 3300005467 | Bacteria | 18500 |
| 137 | Ga0070706_100004861 | 3300005467 | Bacteria | 12871 |
| 138 | Ga0070706_100009047 | 3300005467 | Bacteria | 9273 |
| 139 | Ga0070706_100023126 | 3300005467 | Bacteria | 5723 |
| 140 | Ga0070706_100025311 | 3300005467 | Bacteria | 5462 |
| 141 | Ga0070706_100051467 | 3300005467 | Bacteria | 3801 |
| 142 | Ga0070706_100304336 | 3300005467 | Unclassified | 1487 |
| 143 | Ga0070707_100000434 | 3300005468 | Bacteria | 41451 |
| 144 | Ga0070707_100004944 | 3300005468 | Bacteria | 12488 |
| 145 | Ga0070707_100005109 | 3300005468 | Bacteria | 12306 |
| 146 | Ga0070707_100006967 | 3300005468 | Bacteria | 10476 |
| 147 | Ga0070707_100023128 | 3300005468 | Bacteria | 5880 |
| 148 | Ga0070707_100046153 | 3300005468 | Bacteria | 4169 |
| 149 | Ga0070707_100063007 | 3300005468 | Bacteria | 3558 |
| 150 | Ga0070707_100736377 | 3300005468 | Bacteria | 949 |
| 151 | Ga0070698_100001423 | 3300005471 | Bacteria | 26489 |
| 152 | Ga0070698_100003126 | 3300005471 | Bacteria | 18238 |
| 153 | Ga0070698_100003377 | 3300005471 | Bacteria | 17558 |
| 154 | Ga0070698_100036597 | 3300005471 | Bacteria | 5068 |
| 155 | Ga0070698_100041619 | 3300005471 | Bacteria | 4716 |
| 156 | Ga0070698_100206325 | 3300005471 | Bacteria | 1900 |
| 157 | Ga0070699_100001451 | 3300005518 | Bacteria | 21740 |
| 158 | Ga0070699_100007223 | 3300005518 | Bacteria | 9664 |
| 159 | Ga0070699_100010942 | 3300005518 | Bacteria | 7847 |
| 160 | Ga0070699_100272061 | 3300005518 | Unclassified | 1516 |
| 161 | Ga0070699_100377728 | 3300005518 | Bacteria | 1279 |
| 162 | Ga0070679_100001719 | 3300005530 | Bacteria | 19749 |
| 163 | Ga0070679_100004624 | 3300005530 | Bacteria | 12705 |
| 164 | Ga0070679_100010477 | 3300005530 | Bacteria | 8795 |
| 165 | Ga0070679_100264421 | 3300005530 | Bacteria | 1675 |
| 166 | Ga0070679_100412060 | 3300005530 | Bacteria | 1297 |
| 167 | Ga0070684_100003436 | 3300005535 | Bacteria | 11890 |
| 168 | Ga0070684_100016314 | 3300005535 | Bacteria | 6069 |
| 169 | Ga0070684_100230180 | 3300005535 | Bacteria | 1692 |
| 170 | Ga0070684_100426253 | 3300005535 | Bacteria | 1225 |
| 171 | Ga0070697_100000006 | 3300005536 | Bacteria | 226483 |
| 172 | Ga0070697_100000353 | 3300005536 | Bacteria | 36186 |
| 173 | Ga0070697_100000656 | 3300005536 | Bacteria | 26071 |
| 174 | Ga0070697_100001791 | 3300005536 | Bacteria | 16388 |
| 175 | Ga0070697_100002182 | 3300005536 | Bacteria | 15011 |
| 176 | Ga0070697_100003316 | 3300005536 | Bacteria | 12369 |
| 177 | Ga0070697_100005151 | 3300005536 | Bacteria | 10038 |
| 178 | Ga0070697_100008447 | 3300005536 | Bacteria | 8035 |
| 179 | Ga0070697_100046258 | 3300005536 | Bacteria | 3527 |
| 180 | Ga0070697_100046837 | 3300005536 | Bacteria | 3505 |
| 181 | Ga0070697_100243012 | 3300005536 | Bacteria | 1538 |
| 182 | Ga0070697_100380274 | 3300005536 | Bacteria | 1223 |
| 183 | Ga0068853_100026560 | 3300005539 | Bacteria | 4862 |
| 184 | Ga0068853_100076866 | 3300005539 | Bacteria | 2916 |
| 185 | Ga0068853_100082946 | 3300005539 | Bacteria | 2808 |
| 186 | Ga0070672_100049512 | 3300005543 | Bacteria | 3269 |
| 187 | Ga0070672_100668756 | 3300005543 | Bacteria | 908 |
| 188 | Ga0070695_100079374 | 3300005545 | Bacteria | 2166 |
| 189 | Ga0070696_100004493 | 3300005546 | Bacteria | 9313 |
| 190 | Ga0070696_100288433 | 3300005546 | Bacteria | 1253 |
| 191 | Ga0070693_100020544 | 3300005547 | Bacteria | 3484 |
| 192 | Ga0070693_100045664 | 3300005547 | Bacteria | 2484 |
| 193 | Ga0070693_100068857 | 3300005547 | Bacteria | 2078 |
| 194 | Ga0070693_100143587 | 3300005547 | Bacteria | 1505 |
| 195 | Ga0070704_100106680 | 3300005549 | Bacteria | 2123 |
| 196 | Ga0068855_100000238 | 3300005563 | Bacteria | 69719 |
| 197 | Ga0068855_100000770 | 3300005563 | Bacteria | 39493 |
| 198 | Ga0068855_100017711 | 3300005563 | Bacteria | 8565 |
| 199 | Ga0068855_100087134 | 3300005563 | Bacteria | 3609 |
| 200 | Ga0068855_100145735 | 3300005563 | Bacteria | 2696 |
| 201 | Ga0068855_100153502 | 3300005563 | Bacteria | 2617 |
| 202 | Ga0068855_100245965 | 3300005563 | Bacteria | 1996 |
| 203 | Ga0068855_100327964 | 3300005563 | Bacteria | 1690 |
| 204 | Ga0068855_100356410 | 3300005563 | Unclassified | 1610 |
| 205 | Ga0068855_100580780 | 3300005563 | Bacteria | 1210 |
| 206 | Ga0070664_100004949 | 3300005564 | Bacteria | 10672 |
| 207 | Ga0070664_100057595 | 3300005564 | Bacteria | 3303 |
| 208 | Ga0070664_100284704 | 3300005564 | Bacteria | 1491 |
| 209 | Ga0068857_100000113 | 3300005577 | Bacteria | 48281 |
| 210 | Ga0068857_100000432 | 3300005577 | Bacteria | 29617 |
| 211 | Ga0068857_100030346 | 3300005577 | Bacteria | 4774 |
| 212 | Ga0068857_100034290 | 3300005577 | Bacteria | 4489 |
| 213 | Ga0068857_100084219 | 3300005577 | Bacteria | 2841 |
| 214 | Ga0068857_100151267 | 3300005577 | Bacteria | 2103 |
| 215 | Ga0068857_100327278 | 3300005577 | Bacteria | 1416 |
| 216 | Ga0068854_100001797 | 3300005578 | Bacteria | 13076 |
| 217 | Ga0068854_100275860 | 3300005578 | Bacteria | 1352 |
| 218 | Ga0068854_100343750 | 3300005578 | Bacteria | 1219 |
| 219 | Ga0068856_100000096 | 3300005614 | Bacteria | 83677 |
| 220 | Ga0068856_100000243 | 3300005614 | Bacteria | 59277 |
| 221 | Ga0068856_100000305 | 3300005614 | Bacteria | 53825 |
| 222 | Ga0068856_100033818 | 3300005614 | Bacteria | 5006 |
| 223 | Ga0068856_100036461 | 3300005614 | Bacteria | 4821 |
| 224 | Ga0068856_100037127 | 3300005614 | Bacteria | 4779 |
| 225 | Ga0068856_100057632 | 3300005614 | Bacteria | 3835 |
| 226 | Ga0068856_100163222 | 3300005614 | Bacteria | 2239 |
| 227 | Ga0068856_100172849 | 3300005614 | Bacteria | 2173 |
| 228 | Ga0068856_100260540 | 3300005614 | Unclassified | 1749 |
| 229 | Ga0068856_100311400 | 3300005614 | Bacteria | 1592 |
| 230 | Ga0070702_100052923 | 3300005615 | Bacteria | 2330 |
| 231 | Ga0068852_100036346 | 3300005616 | Unclassified | 4120 |
| 232 | Ga0068852_100078088 | 3300005616 | Bacteria | 2928 |
| 233 | Ga0068852_100118358 | 3300005616 | Bacteria | 2420 |
| 234 | Ga0068852_100321911 | 3300005616 | Bacteria | 1502 |
| 235 | Ga0068859_100002165 | 3300005617 | Bacteria | 19967 |
| 236 | Ga0068859_100042731 | 3300005617 | Bacteria | 4553 |
| 237 | Ga0068859_100341998 | 3300005617 | Bacteria | 1590 |
| 238 | Ga0068859_100408396 | 3300005617 | Bacteria | 1454 |
| 239 | Ga0068864_100014466 | 3300005618 | Bacteria | 6554 |
| 240 | Ga0068864_100016673 | 3300005618 | Bacteria | 6122 |
| 241 | Ga0068864_100048061 | 3300005618 | Bacteria | 3667 |
| 242 | Ga0068864_100049877 | 3300005618 | Bacteria | 3602 |
| 243 | Ga0068866_10004147 | 3300005718 | Bacteria | 5943 |
| 244 | Ga0068866_10022795 | 3300005718 | Bacteria | 2903 |
| 245 | Ga0068866_10050018 | 3300005718 | Bacteria | 2121 |
| 246 | Ga0068861_100113945 | 3300005719 | Bacteria | 2170 |
| 247 | Ga0068851_10003975 | 3300005834 | Bacteria | 6624 |
| 248 | Ga0068851_10010200 | 3300005834 | Bacteria | 4379 |
| 249 | Ga0068851_10052956 | 3300005834 | Bacteria | 2065 |
| 250 | Ga0068870_10012650 | 3300005840 | Bacteria | 3948 |
| 251 | Ga0068870_10022256 | 3300005840 | Bacteria | 3112 |
| 252 | Ga0068863_100010652 | 3300005841 | Bacteria | 8925 |
| 253 | Ga0068863_100036962 | 3300005841 | Bacteria | 4649 |
| 254 | Ga0068858_100007172 | 3300005842 | Bacteria | 10813 |
| 255 | Ga0068858_100049365 | 3300005842 | Bacteria | 3897 |
| 256 | Ga0068858_100080573 | 3300005842 | Bacteria | 3025 |
| 257 | Ga0068858_100112600 | 3300005842 | Bacteria | 2541 |
| 258 | Ga0068858_100375574 | 3300005842 | Unclassified | 1364 |
| 259 | Ga0068860_100017206 | 3300005843 | Bacteria | 7048 |
| 260 | Ga0068860_100088983 | 3300005843 | Bacteria | 2939 |
| 261 | Ga0068860_100116329 | 3300005843 | Bacteria | 2558 |
| 262 | Ga0068860_100352285 | 3300005843 | Bacteria | 1449 |
| 263 | Ga0068860_100583698 | 3300005843 | Bacteria | 1122 |
| 264 | Ga0068862_100029494 | 3300005844 | Unclassified | 4623 |
| 265 | Ga0068862_100033899 | 3300005844 | Bacteria | 4319 |
| 266 | Ga0068862_100120541 | 3300005844 | Bacteria | 2311 |
| 267 | Ga0070717_10001269 | 3300006028 | Bacteria | 17254 |
| 268 | Ga0070717_10001355 | 3300006028 | Bacteria | 16847 |
| 269 | Ga0070717_10006992 | 3300006028 | Bacteria | 8348 |
| 270 | Ga0070717_10011082 | 3300006028 | Bacteria | 6833 |
| 271 | Ga0070717_10012374 | 3300006028 | Bacteria | 6504 |
| 272 | Ga0070717_10018677 | 3300006028 | Bacteria | 5421 |
| 273 | Ga0070717_10022350 | 3300006028 | Unclassified | 4997 |
| 274 | Ga0070717_10025940 | 3300006028 | Bacteria | 4671 |
| 275 | Ga0070717_10040600 | 3300006028 | Bacteria | 3790 |
| 276 | Ga0070717_10049675 | 3300006028 | Bacteria | 3444 |
| 277 | Ga0070717_10053823 | 3300006028 | Bacteria | 3318 |
| 278 | Ga0070717_10060782 | 3300006028 | Unclassified | 3129 |
| 279 | Ga0070717_10110676 | 3300006028 | Unclassified | 2342 |
| 280 | Ga0070717_10127647 | 3300006028 | Bacteria | 2184 |
| 281 | Ga0070717_10129298 | 3300006028 | Bacteria | 2171 |
| 282 | Ga0070717_10220711 | 3300006028 | Unclassified | 1666 |
| 283 | Ga0070717_10252334 | 3300006028 | Bacteria | 1559 |
| 284 | Ga0070717_10257901 | 3300006028 | Bacteria | 1542 |
| 285 | Ga0070717_10259840 | 3300006028 | Bacteria | 1536 |
| 286 | Ga0070717_10273993 | 3300006028 | Bacteria | 1495 |
| 287 | Ga0070717_10305490 | 3300006028 | Unclassified | 1415 |
| 288 | Ga0070717_10566614 | 3300006028 | Unclassified | 1029 |
| 289 | Ga0070715_10004939 | 3300006163 | Bacteria | 4419 |
| 290 | Ga0070715_10010431 | 3300006163 | Bacteria | 3312 |
| 291 | Ga0070716_100001188 | 3300006173 | Bacteria | 11472 |
| 292 | Ga0070716_100015187 | 3300006173 | Unclassified | 3951 |
| 293 | Ga0070716_100016018 | 3300006173 | Bacteria | 3864 |
| 294 | Ga0070716_100020877 | 3300006173 | Bacteria | 3444 |
| 295 | Ga0070716_100048212 | 3300006173 | Unclassified | 2407 |
| 296 | Ga0070716_100146633 | 3300006173 | Unclassified | 1513 |
| 297 | Ga0070716_100211478 | 3300006173 | Bacteria | 1296 |
| 298 | Ga0070716_100356636 | 3300006173 | Bacteria | 1037 |
| 299 | Ga0070716_100443128 | 3300006173 | Bacteria | 945 |
| 300 | Ga0070712_100000010 | 3300006175 | Bacteria | 143560 |
| 301 | Ga0070712_100000853 | 3300006175 | Bacteria | 18139 |
| 302 | Ga0070712_100001607 | 3300006175 | Bacteria | 13809 |
| 303 | Ga0070712_100003139 | 3300006175 | Bacteria | 10178 |
| 304 | Ga0070712_100004072 | 3300006175 | Bacteria | 8973 |
| 305 | Ga0070712_100005197 | 3300006175 | Bacteria | 8047 |
| 306 | Ga0070712_100015289 | 3300006175 | Bacteria | 4937 |
| 307 | Ga0070712_100023121 | 3300006175 | Bacteria | 4102 |
| 308 | Ga0070712_100111071 | 3300006175 | Unclassified | 2046 |
| 309 | Ga0070712_100204364 | 3300006175 | Bacteria | 1554 |
| 310 | Ga0070712_100298760 | 3300006175 | Bacteria | 1302 |
| 311 | Ga0097621_100000022 | 3300006237 | Bacteria | 85005 |
| 312 | Ga0097621_100002166 | 3300006237 | Bacteria | 13443 |
| 313 | Ga0097621_100054796 | 3300006237 | Unclassified | 3254 |
| 314 | Ga0068871_100000401 | 3300006358 | Bacteria | 30136 |
| 315 | Ga0068871_100000478 | 3300006358 | Bacteria | 27397 |
| 316 | Ga0068871_100001634 | 3300006358 | Bacteria | 15100 |
| 317 | Ga0068871_100012481 | 3300006358 | Bacteria | 6267 |
| 318 | Ga0075428_100043757 | 3300006844 | Bacteria | 4923 |
| 319 | Ga0075429_100034596 | 3300006880 | Bacteria | 4391 |
| 320 | Ga0068865_100366366 | 3300006881 | Bacteria | 1171 |
| 321 | Ga0068865_100413274 | 3300006881 | Bacteria | 1108 |
| 322 | Ga0068865_100434269 | 3300006881 | Bacteria | 1082 |
| 323 | Ga0075436_100005023 | 3300006914 | Bacteria | 9092 |
| 324 | Ga0075436_100068139 | 3300006914 | Unclassified | 2459 |
| 325 | Ga0075436_100123941 | 3300006914 | Bacteria | 1810 |
| 326 | Ga0097620_100002165 | 3300006931 | Bacteria | 19967 |
| 327 | Ga0097620_100042732 | 3300006931 | Bacteria | 4553 |
| 328 | Ga0097620_100341947 | 3300006931 | Bacteria | 1590 |
| 329 | Ga0097620_100408353 | 3300006931 | Bacteria | 1454 |
| 330 | Ga0075435_100060985 | 3300007076 | Bacteria | 3059 |
| 331 | Ga0075435_100120643 | 3300007076 | Unclassified | 2188 |
| 332 | Ga0099794_10169107 | 3300007265 | Bacteria | 1114 |
| 333 | Ga0105250_10067574 | 3300009092 | Bacteria | 1442 |
| 334 | Ga0105240_10016218 | 3300009093 | Bacteria | 10096 |
| 335 | Ga0105240_10029357 | 3300009093 | Bacteria | 7166 |
| 336 | Ga0105240_10047329 | 3300009093 | Bacteria | 5442 |
| 337 | Ga0105240_10068952 | 3300009093 | Bacteria | 4379 |
| 338 | Ga0105240_10076743 | 3300009093 | Unclassified | 4119 |
| 339 | Ga0105240_10081807 | 3300009093 | Bacteria | 3967 |
| 340 | Ga0105240_10332602 | 3300009093 | Bacteria | 1728 |
| 341 | Ga0105240_10499335 | 3300009093 | Unclassified | 1353 |
| 342 | Ga0105245_10001938 | 3300009098 | Bacteria | 18801 |
| 343 | Ga0105245_10003931 | 3300009098 | Bacteria | 13217 |
| 344 | Ga0105245_10015594 | 3300009098 | Bacteria | 6627 |
| 345 | Ga0105245_10067885 | 3300009098 | Bacteria | 3230 |
| 346 | Ga0105245_10470443 | 3300009098 | Bacteria | 1268 |
| 347 | Ga0105247_10033932 | 3300009101 | Bacteria | 3107 |
| 348 | Ga0105247_10090735 | 3300009101 | Unclassified | 1939 |
| 349 | Ga0114129_10342869 | 3300009147 | Bacteria | 1981 |
| 350 | Ga0105243_10035619 | 3300009148 | Bacteria | 3859 |
| 351 | Ga0105241_10002924 | 3300009174 | Bacteria | 12754 |
| 352 | Ga0105241_10010624 | 3300009174 | Bacteria | 6751 |
| 353 | Ga0105241_10015386 | 3300009174 | Bacteria | 5603 |
| 354 | Ga0105241_10123962 | 3300009174 | Bacteria | 2084 |
| 355 | Ga0105241_10180419 | 3300009174 | Bacteria | 1751 |
| 356 | Ga0105241_10202572 | 3300009174 | Unclassified | 1659 |
| 357 | Ga0105242_10007431 | 3300009176 | Bacteria | 8435 |
| 358 | Ga0105242_10071878 | 3300009176 | Unclassified | 2872 |
| 359 | Ga0105242_10099348 | 3300009176 | Bacteria | 2463 |
| 360 | Ga0105242_10195570 | 3300009176 | Bacteria | 1793 |
| 361 | Ga0105248_10033388 | 3300009177 | Bacteria | 5748 |
| 362 | Ga0105248_10056174 | 3300009177 | Bacteria | 4416 |
| 363 | Ga0105248_10149281 | 3300009177 | Bacteria | 2637 |
| 364 | Ga0105248_10296583 | 3300009177 | Bacteria | 1820 |
| 365 | Ga0105237_10048488 | 3300009545 | Unclassified | 4270 |
| 366 | Ga0105237_10069800 | 3300009545 | Unclassified | 3509 |
| 367 | Ga0105237_10078171 | 3300009545 | Unclassified | 3298 |
| 368 | Ga0105237_10185899 | 3300009545 | Bacteria | 2078 |
| 369 | Ga0105237_10375315 | 3300009545 | Bacteria | 1427 |
| 370 | Ga0105237_10512137 | 3300009545 | Bacteria | 1207 |
| 371 | Ga0105237_10574885 | 3300009545 | Bacteria | 1134 |
| 372 | Ga0105238_10000644 | 3300009551 | Bacteria | 36743 |
| 373 | Ga0105238_10026343 | 3300009551 | Bacteria | 5927 |
| 374 | Ga0105238_10028879 | 3300009551 | Bacteria | 5649 |
| 375 | Ga0105238_10087928 | 3300009551 | Bacteria | 3094 |
| 376 | Ga0105238_10437052 | 3300009551 | Bacteria | 1305 |
| 377 | Ga0105249_10240596 | 3300009553 | Bacteria | 1789 |
| 378 | Ga0105239_10131415 | 3300010375 | Bacteria | 2785 |
| 379 | Ga0105239_10165289 | 3300010375 | Bacteria | 2474 |
| 380 | Ga0105239_10167565 | 3300010375 | Bacteria | 2456 |
| 381 | Ga0105246_10136449 | 3300011119 | Bacteria | 1839 |
| 382 | Ga0157373_10003491 | 3300013100 | Bacteria | 11888 |
| 383 | Ga0157373_10004886 | 3300013100 | Bacteria | 10089 |
| 384 | Ga0157373_10026739 | 3300013100 | Bacteria | 4165 |
| 385 | Ga0157373_10083664 | 3300013100 | Bacteria | 2249 |
| 386 | Ga0157371_10002263 | 3300013102 | Bacteria | 18560 |
| 387 | Ga0157371_10082681 | 3300013102 | Unclassified | 2274 |
| 388 | Ga0157371_10168627 | 3300013102 | Bacteria | 1564 |
| 389 | Ga0157371_10198595 | 3300013102 | Bacteria | 1437 |
| 390 | Ga0157370_10014896 | 3300013104 | Bacteria | 7931 |
| 391 | Ga0157370_10086651 | 3300013104 | Bacteria | 2942 |
| 392 | Ga0157370_10142216 | 3300013104 | Unclassified | 2236 |
| 393 | Ga0157369_10000034 | 3300013105 | Bacteria | 200710 |
| 394 | Ga0157369_10000786 | 3300013105 | Bacteria | 40894 |
| 395 | Ga0157369_10028869 | 3300013105 | Bacteria | 6136 |
| 396 | Ga0157369_10030338 | 3300013105 | Bacteria | 5964 |
| 397 | Ga0157369_10036369 | 3300013105 | Bacteria | 5395 |
| 398 | Ga0157369_10056220 | 3300013105 | Bacteria | 4247 |
| 399 | Ga0157369_10078967 | 3300013105 | Bacteria | 3525 |
| 400 | Ga0157369_10171846 | 3300013105 | Bacteria | 2283 |
| 401 | Ga0157369_10180195 | 3300013105 | Bacteria | 2223 |
| 402 | Ga0157369_10433028 | 3300013105 | Bacteria | 1363 |
| 403 | Ga0157369_10540275 | 3300013105 | Bacteria | 1205 |
| 404 | Ga0157374_10000052 | 3300013296 | Bacteria | 125138 |
| 405 | Ga0157374_10001074 | 3300013296 | Bacteria | 23713 |
| 406 | Ga0157374_10037641 | 3300013296 | Bacteria | 4442 |
| 407 | Ga0157374_10056435 | 3300013296 | Bacteria | 3666 |
| 408 | Ga0157374_10136419 | 3300013296 | Unclassified | 2379 |
| 409 | Ga0157374_10146951 | 3300013296 | Bacteria | 2290 |
| 410 | Ga0157374_10279409 | 3300013296 | Bacteria | 1648 |
| 411 | Ga0157378_10000227 | 3300013297 | Bacteria | 54885 |
| 412 | Ga0157378_10000764 | 3300013297 | Bacteria | 29926 |
| 413 | Ga0157378_10003664 | 3300013297 | Bacteria | 13615 |
| 414 | Ga0157378_10006776 | 3300013297 | Bacteria | 10003 |
| 415 | Ga0157378_10156963 | 3300013297 | Bacteria | 2125 |
| 416 | Ga0157378_10240087 | 3300013297 | Bacteria | 1730 |
| 417 | Ga0163162_10011916 | 3300013306 | Bacteria | 8478 |
| 418 | Ga0163162_10137660 | 3300013306 | Bacteria | 2553 |
| 419 | Ga0163162_10512783 | 3300013306 | Bacteria | 1329 |
| 420 | Ga0157372_10001472 | 3300013307 | Bacteria | 25548 |
| 421 | Ga0157372_10001995 | 3300013307 | Bacteria | 22167 |
| 422 | Ga0157372_10002166 | 3300013307 | Bacteria | 21379 |
| 423 | Ga0157372_10014707 | 3300013307 | Bacteria | 8374 |
| 424 | Ga0157372_10016205 | 3300013307 | Bacteria | 7997 |
| 425 | Ga0157372_10022908 | 3300013307 | Bacteria | 6763 |
| 426 | Ga0157372_10034354 | 3300013307 | Bacteria | 5573 |
| 427 | Ga0157372_10036371 | 3300013307 | Bacteria | 5426 |
| 428 | Ga0157372_10088229 | 3300013307 | Bacteria | 3521 |
| 429 | Ga0157372_10105039 | 3300013307 | Bacteria | 3230 |
| 430 | Ga0157372_10118467 | 3300013307 | Unclassified | 3038 |
| 431 | Ga0157372_10178253 | 3300013307 | Bacteria | 2460 |
| 432 | Ga0157372_10262633 | 3300013307 | Bacteria | 2005 |
| 433 | Ga0157372_10961393 | 3300013307 | Unclassified | 990 |
| 434 | Ga0157375_10177951 | 3300013308 | Bacteria | 2278 |
| 435 | Ga0163163_10007470 | 3300014325 | Bacteria | 9645 |
| 436 | Ga0163163_10030293 | 3300014325 | Bacteria | 5212 |
| 437 | Ga0163163_10032223 | 3300014325 | Bacteria | 5062 |
| 438 | Ga0182008_10103465 | 3300014497 | Bacteria | 1408 |
| 439 | Ga0157377_10001902 | 3300014745 | Bacteria | 9148 |
| 440 | Ga0157377_10121451 | 3300014745 | Bacteria | 1584 |
| 441 | Ga0157379_10006003 | 3300014968 | Bacteria | 10470 |
| 442 | Ga0157379_10030951 | 3300014968 | Bacteria | 4767 |
| 443 | Ga0157379_10184343 | 3300014968 | Unclassified | 1886 |
| 444 | Ga0157376_10006922 | 3300014969 | Bacteria | 8036 |
| 445 | Ga0157376_10016053 | 3300014969 | Bacteria | 5674 |
| 446 | Ga0157376_10112787 | 3300014969 | Unclassified | 2396 |
| 447 | Ga0157376_10364971 | 3300014969 | Bacteria | 1386 |
| 448 | Ga0163161_10001086 | 3300017792 | Bacteria | 20609 |
| 449 | Ga0206350_11446456 | 3300020080 | Bacteria | 895 |
| 450 | Ga0213872_10003667 | 3300021361 | Bacteria | 8413 |
| 451 | Ga0213872_10010363 | 3300021361 | Bacteria | 4441 |
| 452 | Ga0213872_10015651 | 3300021361 | Bacteria | 3525 |
| 453 | Ga0213874_10001758 | 3300021377 | Unclassified | 4553 |
| 454 | Ga0213874_10065778 | 3300021377 | Unclassified | 1146 |
| 455 | Ga0213876_10153075 | 3300021384 | Bacteria | 1226 |
| 456 | Ga0213875_10030852 | 3300021388 | Bacteria | 2537 |
| 457 | Ga0224570_100055 | 3300022730 | Bacteria | 5938 |
| 458 | Ga0224572_1000977 | 3300024225 | Bacteria | 3938 |
| 459 | Ga0224572_1002033 | 3300024225 | Bacteria | 3179 |
| 460 | Ga0224572_1010090 | 3300024225 | Bacteria | 1771 |
| 461 | Ga0228598_1000089 | 3300024227 | Bacteria | 14670 |
| 462 | Ga0228598_1008520 | 3300024227 | Bacteria | 2068 |
| 463 | Ga0228598_1008675 | 3300024227 | Bacteria | 2048 |
| 464 | Ga0207656_10025805 | 3300025321 | Bacteria | 2389 |
| 465 | Ga0207682_10045188 | 3300025893 | Bacteria | 1807 |
| 466 | Ga0207692_10000836 | 3300025898 | Bacteria | 11035 |
| 467 | Ga0207692_10004455 | 3300025898 | Bacteria | 5547 |
| 468 | Ga0207692_10011811 | 3300025898 | Bacteria | 3732 |
| 469 | Ga0207692_10135553 | 3300025898 | Bacteria | 1395 |
| 470 | Ga0207692_10154770 | 3300025898 | Bacteria | 1316 |
| 471 | Ga0207692_10241471 | 3300025898 | Bacteria | 1079 |
| 472 | Ga0207688_10002577 | 3300025901 | Bacteria | 9803 |
| 473 | Ga0207680_10041332 | 3300025903 | Bacteria | 2689 |
| 474 | Ga0207647_10019921 | 3300025904 | Bacteria | 4504 |
| 475 | Ga0207647_10076277 | 3300025904 | Bacteria | 2016 |
| 476 | Ga0207685_10006742 | 3300025905 | Bacteria | 3152 |
| 477 | Ga0207685_10049821 | 3300025905 | Bacteria | 1611 |
| 478 | Ga0207685_10065744 | 3300025905 | Unclassified | 1453 |
| 479 | Ga0207699_10005574 | 3300025906 | Bacteria | 6039 |
| 480 | Ga0207699_10015443 | 3300025906 | Bacteria | 3967 |
| 481 | Ga0207699_10042891 | 3300025906 | Bacteria | 2624 |
| 482 | Ga0207699_10154867 | 3300025906 | Bacteria | 1520 |
| 483 | Ga0207699_10213308 | 3300025906 | Bacteria | 1314 |
| 484 | Ga0207699_10300912 | 3300025906 | Bacteria | 1120 |
| 485 | Ga0207699_10369721 | 3300025906 | Bacteria | 1016 |
| 486 | Ga0207699_10389705 | 3300025906 | Unclassified | 990 |
| 487 | Ga0207645_10000273 | 3300025907 | Bacteria | 42696 |
| 488 | Ga0207645_10020001 | 3300025907 | Bacteria | 4383 |
| 489 | Ga0207643_10039543 | 3300025908 | Bacteria | 2653 |
| 490 | Ga0207705_10255548 | 3300025909 | Bacteria | 1337 |
| 491 | Ga0207684_10000008 | 3300025910 | Bacteria | 601602 |
| 492 | Ga0207684_10000129 | 3300025910 | Bacteria | 138143 |
| 493 | Ga0207684_10000677 | 3300025910 | Bacteria | 40393 |
| 494 | Ga0207684_10004879 | 3300025910 | Bacteria | 12535 |
| 495 | Ga0207684_10010433 | 3300025910 | Bacteria | 8178 |
| 496 | Ga0207684_10098685 | 3300025910 | Bacteria | 2494 |
| 497 | Ga0207684_10177942 | 3300025910 | Unclassified | 1834 |
| 498 | Ga0207684_10262908 | 3300025910 | Unclassified | 1489 |
| 499 | Ga0207654_10002620 | 3300025911 | Bacteria | 9128 |
| 500 | Ga0207654_10038356 | 3300025911 | Bacteria | 2688 |
| 501 | Ga0207654_10169580 | 3300025911 | Bacteria | 1416 |
| 502 | Ga0207707_10000496 | 3300025912 | Bacteria | 40443 |
| 503 | Ga0207707_10001602 | 3300025912 | Bacteria | 20874 |
| 504 | Ga0207707_10013616 | 3300025912 | Bacteria | 7093 |
| 505 | Ga0207707_10013650 | 3300025912 | Bacteria | 7084 |
| 506 | Ga0207707_10017593 | 3300025912 | Bacteria | 6234 |
| 507 | Ga0207707_10046004 | 3300025912 | Unclassified | 3801 |
| 508 | Ga0207707_10064435 | 3300025912 | Unclassified | 3190 |
| 509 | Ga0207707_10070875 | 3300025912 | Bacteria | 3037 |
| 510 | Ga0207707_10103774 | 3300025912 | Unclassified | 2485 |
| 511 | Ga0207707_10372176 | 3300025912 | Bacteria | 1229 |
| 512 | Ga0207695_10021651 | 3300025913 | Bacteria | 7329 |
| 513 | Ga0207695_10021896 | 3300025913 | Bacteria | 7277 |
| 514 | Ga0207695_10022507 | 3300025913 | Bacteria | 7151 |
| 515 | Ga0207695_10026035 | 3300025913 | Bacteria | 6535 |
| 516 | Ga0207695_10057525 | 3300025913 | Bacteria | 4039 |
| 517 | Ga0207695_10110079 | 3300025913 | Unclassified | 2735 |
| 518 | Ga0207695_10125998 | 3300025913 | Bacteria | 2523 |
| 519 | Ga0207695_10190748 | 3300025913 | Bacteria | 1967 |
| 520 | Ga0207695_10259304 | 3300025913 | Bacteria | 1636 |
| 521 | Ga0207671_10140271 | 3300025914 | Unclassified | 1862 |
| 522 | Ga0207671_10330708 | 3300025914 | Bacteria | 1207 |
| 523 | Ga0207693_10000004 | 3300025915 | Bacteria | 193261 |
| 524 | Ga0207693_10000029 | 3300025915 | Bacteria | 118724 |
| 525 | Ga0207693_10000985 | 3300025915 | Bacteria | 25547 |
| 526 | Ga0207693_10005725 | 3300025915 | Bacteria | 10319 |
| 527 | Ga0207693_10010392 | 3300025915 | Bacteria | 7558 |
| 528 | Ga0207693_10015396 | 3300025915 | Bacteria | 6136 |
| 529 | Ga0207693_10023355 | 3300025915 | Bacteria | 4911 |
| 530 | Ga0207693_10028716 | 3300025915 | Bacteria | 4396 |
| 531 | Ga0207693_10086647 | 3300025915 | Bacteria | 2454 |
| 532 | Ga0207693_10109362 | 3300025915 | Bacteria | 2168 |
| 533 | Ga0207693_10228336 | 3300025915 | Bacteria | 1462 |
| 534 | Ga0207693_10338491 | 3300025915 | Bacteria | 1178 |
| 535 | Ga0207663_10006013 | 3300025916 | Bacteria | 6170 |
| 536 | Ga0207663_10014560 | 3300025916 | Bacteria | 4311 |
| 537 | Ga0207663_10023177 | 3300025916 | Bacteria | 3558 |
| 538 | Ga0207663_10030476 | 3300025916 | Unclassified | 3183 |
| 539 | Ga0207663_10063236 | 3300025916 | Bacteria | 2356 |
| 540 | Ga0207663_10226343 | 3300025916 | Unclassified | 1364 |
| 541 | Ga0207663_10380112 | 3300025916 | Bacteria | 1076 |
| 542 | Ga0207660_10001588 | 3300025917 | Bacteria | 15243 |
| 543 | Ga0207660_10034630 | 3300025917 | Bacteria | 3501 |
| 544 | Ga0207660_10161004 | 3300025917 | Unclassified | 1731 |
| 545 | Ga0207660_10204382 | 3300025917 | Bacteria | 1544 |
| 546 | Ga0207662_10011575 | 3300025918 | Bacteria | 4899 |
| 547 | Ga0207657_10006409 | 3300025919 | Bacteria | 12210 |
| 548 | Ga0207657_10020387 | 3300025919 | Bacteria | 6265 |
| 549 | Ga0207657_10021886 | 3300025919 | Bacteria | 6004 |
| 550 | Ga0207649_10004928 | 3300025920 | Bacteria | 7216 |
| 551 | Ga0207652_10045080 | 3300025921 | Bacteria | 3758 |
| 552 | Ga0207652_10128419 | 3300025921 | Bacteria | 2259 |
| 553 | Ga0207652_10228957 | 3300025921 | Bacteria | 1675 |
| 554 | Ga0207652_10295294 | 3300025921 | Unclassified | 1462 |
| 555 | Ga0207652_10666291 | 3300025921 | Bacteria | 930 |
| 556 | Ga0207646_10000192 | 3300025922 | Bacteria | 83182 |
| 557 | Ga0207646_10001274 | 3300025922 | Bacteria | 31519 |
| 558 | Ga0207646_10003352 | 3300025922 | Bacteria | 18172 |
| 559 | Ga0207646_10005288 | 3300025922 | Bacteria | 13605 |
| 560 | Ga0207646_10008896 | 3300025922 | Bacteria | 10001 |
| 561 | Ga0207646_10012851 | 3300025922 | Bacteria | 8025 |
| 562 | Ga0207646_10025076 | 3300025922 | Bacteria | 5457 |
| 563 | Ga0207646_10031161 | 3300025922 | Bacteria | 4829 |
| 564 | Ga0207646_10035668 | 3300025922 | Bacteria | 4492 |
| 565 | Ga0207646_10590910 | 3300025922 | Bacteria | 997 |
| 566 | Ga0207681_10066824 | 3300025923 | Bacteria | 2490 |
| 567 | Ga0207694_10002382 | 3300025924 | Bacteria | 15376 |
| 568 | Ga0207650_10000036 | 3300025925 | Bacteria | 214579 |
| 569 | Ga0207650_10003223 | 3300025925 | Bacteria | 11245 |
| 570 | Ga0207687_10006171 | 3300025927 | Bacteria | 7931 |
| 571 | Ga0207687_10029492 | 3300025927 | Bacteria | 3691 |
| 572 | Ga0207687_10150790 | 3300025927 | Bacteria | 1774 |
| 573 | Ga0207687_10247391 | 3300025927 | Bacteria | 1416 |
| 574 | Ga0207700_10000173 | 3300025928 | Bacteria | 38581 |
| 575 | Ga0207700_10000428 | 3300025928 | Bacteria | 24716 |
| 576 | Ga0207700_10008211 | 3300025928 | Bacteria | 6451 |
| 577 | Ga0207700_10009584 | 3300025928 | Bacteria | 6062 |
| 578 | Ga0207700_10023665 | 3300025928 | Bacteria | 4241 |
| 579 | Ga0207700_10032067 | 3300025928 | Unclassified | 3742 |
| 580 | Ga0207700_10056627 | 3300025928 | Bacteria | 2952 |
| 581 | Ga0207700_10074471 | 3300025928 | Bacteria | 2627 |
| 582 | Ga0207700_10099463 | 3300025928 | Bacteria | 2316 |
| 583 | Ga0207700_10124197 | 3300025928 | Unclassified | 2097 |
| 584 | Ga0207700_10126471 | 3300025928 | Unclassified | 2080 |
| 585 | Ga0207700_10135710 | 3300025928 | Bacteria | 2015 |
| 586 | Ga0207700_10151898 | 3300025928 | Bacteria | 1914 |
| 587 | Ga0207700_10253931 | 3300025928 | Unclassified | 1503 |
| 588 | Ga0207700_10290386 | 3300025928 | Bacteria | 1409 |
| 589 | Ga0207700_10303786 | 3300025928 | Unclassified | 1379 |
| 590 | Ga0207664_10000017 | 3300025929 | Bacteria | 230967 |
| 591 | Ga0207664_10003989 | 3300025929 | Bacteria | 9945 |
| 592 | Ga0207664_10033597 | 3300025929 | Bacteria | 3942 |
| 593 | Ga0207664_10042383 | 3300025929 | Bacteria | 3552 |
| 594 | Ga0207664_10079865 | 3300025929 | Bacteria | 2657 |
| 595 | Ga0207664_10104893 | 3300025929 | Unclassified | 2341 |
| 596 | Ga0207664_10183739 | 3300025929 | Unclassified | 1796 |
| 597 | Ga0207664_10184474 | 3300025929 | Bacteria | 1793 |
| 598 | Ga0207664_10244383 | 3300025929 | Bacteria | 1564 |
| 599 | Ga0207644_10050621 | 3300025931 | Bacteria | 2978 |
| 600 | Ga0207706_10000165 | 3300025933 | Bacteria | 73590 |
| 601 | Ga0207706_10000697 | 3300025933 | Bacteria | 35077 |
| 602 | Ga0207706_10634283 | 3300025933 | Bacteria | 916 |
| 603 | Ga0207686_10075110 | 3300025934 | Bacteria | 2187 |
| 604 | Ga0207686_10220321 | 3300025934 | Bacteria | 1370 |
| 605 | Ga0207670_10017570 | 3300025936 | Bacteria | 4325 |
| 606 | Ga0207704_10023509 | 3300025938 | Bacteria | 3323 |
| 607 | Ga0207704_10320897 | 3300025938 | Bacteria | 1195 |
| 608 | Ga0207665_10000574 | 3300025939 | Bacteria | 24696 |
| 609 | Ga0207665_10006271 | 3300025939 | Bacteria | 7893 |
| 610 | Ga0207665_10015745 | 3300025939 | Bacteria | 4963 |
| 611 | Ga0207665_10024235 | 3300025939 | Unclassified | 4000 |
| 612 | Ga0207665_10055857 | 3300025939 | Bacteria | 2665 |
| 613 | Ga0207665_10069262 | 3300025939 | Bacteria | 2405 |
| 614 | Ga0207665_10123730 | 3300025939 | Unclassified | 1829 |
| 615 | Ga0207665_10159131 | 3300025939 | Bacteria | 1623 |
| 616 | Ga0207691_10012852 | 3300025940 | Bacteria | 8014 |
| 617 | Ga0207711_10056108 | 3300025941 | Bacteria | 3384 |
| 618 | Ga0207711_10063010 | 3300025941 | Bacteria | 3199 |
| 619 | Ga0207689_10011276 | 3300025942 | Bacteria | 7670 |
| 620 | Ga0207689_10038232 | 3300025942 | Bacteria | 3976 |
| 621 | Ga0207689_10058924 | 3300025942 | Bacteria | 3159 |
| 622 | Ga0207661_10000527 | 3300025944 | Bacteria | 24587 |
| 623 | Ga0207661_10084577 | 3300025944 | Bacteria | 2628 |
| 624 | Ga0207661_10132826 | 3300025944 | Bacteria | 2134 |
| 625 | Ga0207661_10136623 | 3300025944 | Bacteria | 2106 |
| 626 | Ga0207661_10255053 | 3300025944 | Bacteria | 1560 |
| 627 | Ga0207679_10000234 | 3300025945 | Bacteria | 42709 |
| 628 | Ga0207667_10000996 | 3300025949 | Bacteria | 36261 |
| 629 | Ga0207667_10009402 | 3300025949 | Bacteria | 11513 |
| 630 | Ga0207667_10017575 | 3300025949 | Bacteria | 8043 |
| 631 | Ga0207667_10042095 | 3300025949 | Bacteria | 4857 |
| 632 | Ga0207667_10046556 | 3300025949 | Bacteria | 4592 |
| 633 | Ga0207667_10052321 | 3300025949 | Unclassified | 4301 |
| 634 | Ga0207667_10109678 | 3300025949 | Bacteria | 2846 |
| 635 | Ga0207667_10110734 | 3300025949 | Bacteria | 2832 |
| 636 | Ga0207667_10175955 | 3300025949 | Unclassified | 2198 |
| 637 | Ga0207651_10104937 | 3300025960 | Bacteria | 2106 |
| 638 | Ga0207712_10166043 | 3300025961 | Bacteria | 1721 |
| 639 | Ga0207668_10041204 | 3300025972 | Bacteria | 3120 |
| 640 | Ga0207640_10002918 | 3300025981 | Bacteria | 9185 |
| 641 | Ga0207640_10043256 | 3300025981 | Bacteria | 2878 |
| 642 | Ga0207640_10146219 | 3300025981 | Bacteria | 1730 |
| 643 | Ga0207640_10312142 | 3300025981 | Bacteria | 1248 |
| 644 | Ga0207640_10352437 | 3300025981 | Unclassified | 1183 |
| 645 | Ga0207640_10389088 | 3300025981 | Bacteria | 1132 |
| 646 | Ga0207658_10101197 | 3300025986 | Bacteria | 2257 |
| 647 | Ga0207677_10004359 | 3300026023 | Bacteria | 7581 |
| 648 | Ga0207677_10007078 | 3300026023 | Bacteria | 6174 |
| 649 | Ga0207677_10047949 | 3300026023 | Bacteria | 2872 |
| 650 | Ga0207677_10048703 | 3300026023 | Unclassified | 2855 |
| 651 | Ga0207703_10011133 | 3300026035 | Bacteria | 7004 |
| 652 | Ga0207703_10027168 | 3300026035 | Unclassified | 4507 |
| 653 | Ga0207639_10004383 | 3300026041 | Bacteria | 9525 |
| 654 | Ga0207639_10018888 | 3300026041 | Bacteria | 4907 |
| 655 | Ga0207639_10076063 | 3300026041 | Bacteria | 2642 |
| 656 | Ga0207639_10136695 | 3300026041 | Bacteria | 2037 |
| 657 | Ga0207639_10754401 | 3300026041 | Bacteria | 905 |
| 658 | Ga0207678_10000543 | 3300026067 | Bacteria | 34457 |
| 659 | Ga0207678_10002291 | 3300026067 | Bacteria | 17332 |
| 660 | Ga0207702_10000917 | 3300026078 | Bacteria | 30463 |
| 661 | Ga0207702_10001294 | 3300026078 | Bacteria | 25044 |
| 662 | Ga0207702_10001832 | 3300026078 | Bacteria | 20917 |
| 663 | Ga0207702_10030455 | 3300026078 | Unclassified | 4497 |
| 664 | Ga0207702_10036473 | 3300026078 | Unclassified | 4113 |
| 665 | Ga0207702_10055492 | 3300026078 | Bacteria | 3360 |
| 666 | Ga0207702_10138909 | 3300026078 | Bacteria | 2196 |
| 667 | Ga0207702_10442719 | 3300026078 | Bacteria | 1259 |
| 668 | Ga0207702_10510745 | 3300026078 | Bacteria | 1172 |
| 669 | Ga0207641_10000009 | 3300026088 | Bacteria | 407901 |
| 670 | Ga0207641_10007711 | 3300026088 | Bacteria | 8949 |
| 671 | Ga0207641_10028376 | 3300026088 | Bacteria | 4625 |
| 672 | Ga0207641_10220514 | 3300026088 | Bacteria | 1758 |
| 673 | Ga0207641_10433896 | 3300026088 | Bacteria | 1267 |
| 674 | Ga0207648_10001467 | 3300026089 | Bacteria | 25947 |
| 675 | Ga0207648_10078452 | 3300026089 | Bacteria | 2881 |
| 676 | Ga0207676_10000092 | 3300026095 | Bacteria | 80704 |
| 677 | Ga0207676_10079240 | 3300026095 | Bacteria | 2663 |
| 678 | Ga0207676_10146724 | 3300026095 | Bacteria | 2027 |
| 679 | Ga0207676_10151563 | 3300026095 | Bacteria | 1997 |
| 680 | Ga0207674_10000016 | 3300026116 | Bacteria | 182470 |
| 681 | Ga0207674_10001595 | 3300026116 | Bacteria | 29202 |
| 682 | Ga0207674_10003232 | 3300026116 | Bacteria | 20063 |
| 683 | Ga0207674_10047700 | 3300026116 | Bacteria | 4389 |
| 684 | Ga0207674_10176538 | 3300026116 | Bacteria | 2088 |
| 685 | Ga0207675_100510758 | 3300026118 | Bacteria | 1197 |
| 686 | Ga0207675_100645625 | 3300026118 | Bacteria | 1064 |
| 687 | Ga0207683_10000359 | 3300026121 | Bacteria | 41891 |
| 688 | Ga0207698_10011854 | 3300026142 | Bacteria | 5676 |
| 689 | Ga0207698_10066818 | 3300026142 | Bacteria | 2832 |
| 690 | Ga0207698_10155380 | 3300026142 | Bacteria | 1992 |
| 691 | Ga0207698_10296572 | 3300026142 | Bacteria | 1503 |
| 692 | Ga0207698_10392678 | 3300026142 | Unclassified | 1323 |
| 693 | Ga0207698_10878836 | 3300026142 | Bacteria | 903 |
| 694 | Ga0265356_1000162 | 3300028017 | Bacteria | 12140 |
| 695 | Ga0265355_1004774 | 3300028036 | Unclassified | 1029 |
| 696 | Ga0268266_10018145 | 3300028379 | Bacteria | 5998 |
| 697 | Ga0268265_10032921 | 3300028380 | Bacteria | 3763 |
| 698 | Ga0268264_10055629 | 3300028381 | Bacteria | 3307 |
| 699 | Ga0268264_10284363 | 3300028381 | Bacteria | 1551 |
| 700 | Ga0268264_10327992 | 3300028381 | Bacteria | 1450 |
| 701 | Ga0268264_10749307 | 3300028381 | Bacteria | 973 |
| 702 | Ga0265334_10016857 | 3300028573 | Bacteria | 3021 |
| 703 | Ga0265318_10003005 | 3300028577 | Bacteria | 8709 |
| 704 | Ga0265338_10028115 | 3300028800 | Bacteria | 5619 |
| 705 | Ga0265338_10029543 | 3300028800 | Bacteria | 5429 |
| 706 | Ga0265338_10034925 | 3300028800 | Bacteria | 4846 |
| 707 | Ga0265338_10041360 | 3300028800 | Unclassified | 4311 |
| 708 | Ga0265338_10174800 | 3300028800 | Bacteria | 1643 |
| 709 | Ga0265762_1001567 | 3300030760 | Bacteria | 4161 |
| 710 | Ga0265762_1002908 | 3300030760 | Bacteria | 3060 |
| 711 | Ga0265762_1005112 | 3300030760 | Bacteria | 2348 |
| 712 | Ga0265760_10002726 | 3300031090 | Bacteria | 5168 |
| 713 | Ga0265760_10003481 | 3300031090 | Bacteria | 4570 |
| 714 | Ga0265760_10004804 | 3300031090 | Bacteria | 3872 |
| 715 | Ga0265760_10009647 | 3300031090 | Bacteria | 2757 |
| 716 | Ga0265760_10010933 | 3300031090 | Bacteria | 2593 |
| 717 | Ga0265760_10030200 | 3300031090 | Unclassified | 1595 |
| 718 | Ga0265330_10000856 | 3300031235 | Bacteria | 18976 |
| 719 | Ga0265332_10047116 | 3300031238 | Bacteria | 1855 |
| 720 | Ga0265328_10012831 | 3300031239 | Bacteria | 3330 |
| 721 | Ga0265325_10000587 | 3300031241 | Bacteria | 26508 |
| 722 | Ga0265325_10032379 | 3300031241 | Unclassified | 2791 |
| 723 | Ga0265329_10006567 | 3300031242 | Bacteria | 4604 |
| 724 | Ga0265340_10010293 | 3300031247 | Bacteria | 5004 |
| 725 | Ga0265340_10067538 | 3300031247 | Bacteria | 1699 |
| 726 | Ga0265339_10005863 | 3300031249 | Bacteria | 8145 |
| 727 | Ga0265339_10033204 | 3300031249 | Bacteria | 2907 |
| 728 | Ga0265339_10063453 | 3300031249 | Bacteria | 1984 |
| 729 | Ga0265339_10091731 | 3300031249 | Bacteria | 1591 |
| 730 | Ga0265339_10110786 | 3300031249 | Unclassified | 1420 |
| 731 | Ga0265316_10000922 | 3300031344 | Bacteria | 32070 |
| 732 | Ga0265316_10022666 | 3300031344 | Bacteria | 5288 |
| 733 | Ga0265313_10014732 | 3300031595 | Bacteria | 4601 |
| 734 | Ga0265313_10016258 | 3300031595 | Bacteria | 4286 |
| 735 | Ga0265314_10195327 | 3300031711 | Bacteria | 1200 |
| 736 | Ga0265342_10000544 | 3300031712 | Bacteria | 40018 |
| 737 | Ga0316214_1003861 | 3300033545 | Bacteria | 1905 |
| 738 | Ga0373926_0021249 | 3300035083 | Unclassified | 2246 |
| 739 | Ga0373934_0009342 | 3300035086 | Bacteria | 3671 |
| 740 | Ga0373944_0012417 | 3300035089 | Bacteria | 2347 |
| 741 | Ga0373944_0055282 | 3300035089 | Bacteria | 1260 |
| 742 | Ga0373923_0015084 | 3300035111 | Bacteria | 2912 |
| 743 | Ga0373923_0084605 | 3300035111 | Unclassified | 1380 |
| 744 | Ga0373936_0007163 | 3300035113 | Bacteria | 4198 |
| 745 | Ga0373936_0024521 | 3300035113 | Bacteria | 2355 |
| 746 | Ga0373936_0104169 | 3300035113 | Unclassified | 1199 |
| 747 | Ga0373939_0132934 | 3300035114 | Bacteria | 890 |
| 748 | Ga0373945_0000605 | 3300035116 | Bacteria | 10294 |
| 749 | Ga0373945_0010902 | 3300035116 | Bacteria | 2998 |
| 750 | Ga0373945_0016207 | 3300035116 | Unclassified | 2511 |
| 751 | Ga0373945_0046429 | 3300035116 | Bacteria | 1585 |
| 752 | Ga0373945_0147216 | 3300035116 | Bacteria | 952 |
| 753 | Ga0373956_0003888 | 3300035119 | Bacteria | 6004 |
| 754 | Ga0373957_0005941 | 3300035120 | Bacteria | 3818 |
| 755 | Ga0373943_0000062 | 3300035170 | Bacteria | 37301 |
| 756 | Ga0373943_0005454 | 3300035170 | Bacteria | 5723 |
| 757 | Ga0373943_0017035 | 3300035170 | Unclassified | 3322 |
| 758 | Ga0373943_0025789 | 3300035170 | Bacteria | 2749 |
| 759 | Ga0373946_0030210 | 3300035171 | Bacteria | 2162 |
| 760 | Ga0373946_0033005 | 3300035171 | Bacteria | 2081 |
| 761 | Ga0373946_0077409 | 3300035171 | Bacteria | 1450 |
| 762 | Ga0373955_0111267 | 3300035172 | Bacteria | 1583 |
| 763 | Ga0373942_0027177 | 3300035207 | Bacteria | 1487 |
| 764 | Ga0373961_0085071 | 3300035241 | Bacteria | 1001 |
| 765 | Ga0373924_0000147 | 3300035410 | Bacteria | 20622 |
| 766 | Ga0373931_0042741 | 3300035691 | Bacteria | 2384 |
| 767 | Ga0373931_0093921 | 3300035691 | Bacteria | 1676 |
| 768 | Ga0373931_0123830 | 3300035691 | Bacteria | 1480 |
| 769 | Ga0373931_0261774 | 3300035691 | Bacteria | 1055 |
| 770 | Ga0373935_0007678 | 3300035692 | Bacteria | 6463 |
| 771 | Ga0373935_0019568 | 3300035692 | Bacteria | 4127 |
| 772 | Ga0373935_0047270 | 3300035692 | Bacteria | 2721 |
| 773 | Ga0373935_0138998 | 3300035692 | Bacteria | 1639 |
| 774 | Ga0373935_0380071 | 3300035692 | Unclassified | 1011 |
| 775 | Ga0373927_0000697 | 3300035695 | Bacteria | 25696 |
| 776 | Ga0373927_0022735 | 3300035695 | Unclassified | 4106 |
| 777 | Ga0373927_0040029 | 3300035695 | Unclassified | 3041 |
| 778 | Ga0373927_0044797 | 3300035695 | Unclassified | 2862 |
| 779 | Ga0373933_0025322 | 3300035724 | Bacteria | 3402 |
| 780 | Ga0373933_0140287 | 3300035724 | Bacteria | 1526 |
| 781 | Ga0373947_0001762 | 3300035725 | Bacteria | 13250 |
| 782 | Ga0373947_0007266 | 3300035725 | Bacteria | 6417 |
| 783 | Ga0373947_0044621 | 3300035725 | Bacteria | 2650 |
| 784 | Ga0373947_0174587 | 3300035725 | Bacteria | 1396 |
| 785 | Ga0373947_0205383 | 3300035725 | Bacteria | 1290 |
| 786 | Ga0373947_0276709 | 3300035725 | Bacteria | 1115 |
| 787 | Ga0373937_0000199 | 3300036401 | Bacteria | 58972 |
| 788 | Ga0373937_0026535 | 3300036401 | Bacteria | 5234 |
| 789 | Ga0373937_0031985 | 3300036401 | Bacteria | 4770 |
| 790 | Ga0373937_0247429 | 3300036401 | Bacteria | 1680 |
| 791 | Ga0373937_0408538 | 3300036401 | Bacteria | 1288 |
| 792 | Ga0373937_0473462 | 3300036401 | Unclassified | 1190 |
| 793 | Ga0373925_0001775 | 3300037068 | Bacteria | 18009 |
| 794 | Ga0373925_0002053 | 3300037068 | Bacteria | 16595 |
| 795 | Ga0373925_0011238 | 3300037068 | Bacteria | 6494 |
| 796 | Ga0373925_0013350 | 3300037068 | Bacteria | 5945 |
| 797 | Ga0373925_0030691 | 3300037068 | Bacteria | 3946 |
| 798 | Ga0373925_0163702 | 3300037068 | Bacteria | 1753 |
| 799 | Ga0373925_0243473 | 3300037068 | Bacteria | 1441 |
| 800 | Ga0373925_0342746 | 3300037068 | Bacteria | 1212 |
| 801 | Ga0373925_0579914 | 3300037068 | Bacteria | 923 |
| 802 | Ga0395900_0108226 | 3300037418 | Unclassified | 2856 |
| 803 | Ga0395898_0028972 | 3300037466 | Bacteria | 5550 |
| 804 | Ga0395898_0049498 | 3300037466 | Bacteria | 4117 |
| 805 | Ga0395905_0646779 | 3300037471 | Bacteria | 959 |
| 806 | Ga0436364_0461878 | 3300037853 | Unclassified | 1174 |
| 807 | Ga0436364_0496890 | 3300037853 | Bacteria | 7248 |
| 808 | Ga0436365_0674223 | 3300039437 | Bacteria | 2662 |
| 809 | Ga0436360_0151269 | 3300039438 | Bacteria | 4765 |
| 810 | Ga0436360_0232969 | 3300039438 | Bacteria | 8884 |
| 811 | Ga0436361_0095620 | 3300039447 | Bacteria | 3007 |
| 812 | Ga0436361_0788453 | 3300039447 | Bacteria | 15739 |
| 813 | Ga0436361_0846651 | 3300039447 | Bacteria | 1130 |
| 814 | Ga0436361_0962723 | 3300039447 | Bacteria | 26082 |
| 815 | Ga0436361_1170545 | 3300039447 | Bacteria | 4992 |
| 816 | Ga0436363_0575896 | 3300039450 | Bacteria | 9060 |
| 817 | Ga0436363_0584167 | 3300039450 | Unclassified | 2289 |
| 818 | Ga0436363_0673976 | 3300039450 | Bacteria | 1626 |
| 819 | Ga0436363_1024259 | 3300039450 | Bacteria | 1071 |
| 820 | Ga0436362_0069449 | 3300039453 | Bacteria | 7173 |
| 821 | Ga0436362_0434675 | 3300039453 | Unclassified | 1070 |
| 822 | Ga0451577_0000157 | 3300042876 | Bacteria | 151953 |
| 823 | Ga0451577_0081279 | 3300042876 | Bacteria | 2890 |
| 824 | Ga0451577_0093462 | 3300042876 | Bacteria | 2686 |
| 825 | Ga0453683_0075237 | 3300044673 | Bacteria | 2114 |
| 826 | Ga0453683_0290937 | 3300044673 | Bacteria | 1044 |
| 827 | Ga0466966_0280084 | 3300044684 | Bacteria | 1003 |
| 828 | Ga0466963_0005107 | 3300044694 | Bacteria | 7667 |
| 829 | Ga0466963_0043245 | 3300044694 | Bacteria | 2961 |
| 830 | Ga0466963_0123961 | 3300044694 | Unclassified | 1780 |
| 831 | Ga0466963_0301884 | 3300044694 | Bacteria | 1126 |
| 832 | Ga0453684_0000324 | 3300044712 | Bacteria | 201431 |
| 833 | Ga0453684_1058121 | 3300044712 | Bacteria | 860 |
| 834 | Ga0466959_0087349 | 3300045049 | Bacteria | 2243 |
| 835 | Ga0451576_0041454 | 3300045051 | Bacteria | 4867 |
| 836 | Ga0451576_0081559 | 3300045051 | Unclassified | 3364 |
| 837 | Ga0451576_0205633 | 3300045051 | Bacteria | 2056 |
| 838 | Ga0451576_0819938 | 3300045051 | Bacteria | 977 |
| 839 | Ga0466967_0003579 | 3300045976 | Bacteria | 10194 |
| 840 | Ga0466967_0082774 | 3300045976 | Bacteria | 2901 |
| 841 | Ga0466967_0199035 | 3300045976 | Bacteria | 1897 |
| 842 | Ga0466967_0222027 | 3300045976 | Unclassified | 1796 |
| 843 | Ga0466967_0265648 | 3300045976 | Bacteria | 1642 |
| 844 | Ga0495629_0021734 | 3300046459 | Bacteria | 4578 |
| 845 | Ga0495629_0217435 | 3300046459 | Bacteria | 1319 |
| 846 | Ga0495651_0009841 | 3300046462 | Bacteria | 7350 |
| 847 | Ga0495651_0140485 | 3300046462 | Bacteria | 1752 |
| 848 | Ga0495580_0000204 | 3300046472 | Bacteria | 45607 |
| 849 | Ga0495580_0000264 | 3300046472 | Bacteria | 41999 |
| 850 | Ga0495580_0000349 | 3300046472 | Bacteria | 37675 |
| 851 | Ga0495580_0001787 | 3300046472 | Bacteria | 18892 |
| 852 | Ga0495580_0008710 | 3300046472 | Bacteria | 8042 |
| 853 | Ga0495580_0010802 | 3300046472 | Bacteria | 7090 |
| 854 | Ga0495580_0014895 | 3300046472 | Bacteria | 5890 |
| 855 | Ga0495580_0032412 | 3300046472 | Bacteria | 3772 |
| 856 | Ga0495580_0044577 | 3300046472 | Bacteria | 3154 |
| 857 | Ga0495580_0047967 | 3300046472 | Bacteria | 3027 |
| 858 | Ga0495580_0056017 | 3300046472 | Unclassified | 2777 |
| 859 | Ga0495580_0135683 | 3300046472 | Bacteria | 1706 |
| 860 | Ga0495580_0143534 | 3300046472 | Bacteria | 1655 |
| 861 | Ga0495580_0241953 | 3300046472 | Bacteria | 1237 |
| 862 | Ga0495582_0000791 | 3300046473 | Bacteria | 17527 |
| 863 | Ga0495582_0008953 | 3300046473 | Bacteria | 5523 |
| 864 | Ga0495582_0067127 | 3300046473 | Bacteria | 1982 |
| 865 | Ga0495639_0038918 | 3300046475 | Unclassified | 2137 |
| 866 | Ga0495664_0010671 | 3300046477 | Bacteria | 5158 |
| 867 | Ga0495664_0046400 | 3300046477 | Unclassified | 2578 |
| 868 | Ga0495594_0027749 | 3300046499 | Bacteria | 3052 |
| 869 | Ga0495594_0061106 | 3300046499 | Bacteria | 2085 |
| 870 | Ga0495628_0078360 | 3300046516 | Bacteria | 2570 |
| 871 | Ga0495628_0082992 | 3300046516 | Bacteria | 2489 |
| 872 | Ga0495630_0080010 | 3300046517 | Unclassified | 2465 |
| 873 | Ga0495630_0616610 | 3300046517 | Bacteria | 831 |
| 874 | Ga0495666_0019788 | 3300046526 | Unclassified | 3338 |
| 875 | Ga0495652_0335160 | 3300046529 | Bacteria | 1088 |
| 876 | Ga0495665_0011868 | 3300046531 | Bacteria | 4717 |
| 877 | Ga0495665_0053485 | 3300046531 | Unclassified | 2135 |
| 878 | Ga0495665_0057929 | 3300046531 | Unclassified | 2045 |
| 879 | Ga0495665_0111789 | 3300046531 | Unclassified | 1433 |
| 880 | Ga0495640_0356864 | 3300046533 | Bacteria | 902 |
| 881 | Ga0495586_0048859 | 3300046535 | Bacteria | 2287 |
| 882 | Ga0495586_0061255 | 3300046535 | Bacteria | 2048 |
| 883 | Ga0495587_0110202 | 3300046536 | Bacteria | 1582 |
| 884 | Ga0495587_0113660 | 3300046536 | Bacteria | 1554 |
| 885 | Ga0495645_0096399 | 3300046543 | Bacteria | 2108 |
| 886 | Ga0495667_0324634 | 3300046559 | Unclassified | 974 |
| 887 | Ga0495625_0325291 | 3300046660 | Bacteria | 978 |
| 888 | Ga0495635_0204676 | 3300046663 | Unclassified | 1338 |
| 889 | Ga0495657_0307194 | 3300046675 | Bacteria | 945 |
| 890 | Ga0495599_0100695 | 3300046678 | Bacteria | 1801 |
| 891 | Ga0495623_0054381 | 3300046679 | Bacteria | 2526 |
| 892 | Ga0495658_0007432 | 3300046683 | Bacteria | 5421 |
| 893 | Ga0495658_0029953 | 3300046683 | Bacteria | 2951 |
| 894 | Ga0495658_0353374 | 3300046683 | Bacteria | 934 |
| 895 | Ga0495669_0031535 | 3300046684 | Bacteria | 2328 |
| 896 | Ga0495669_0047925 | 3300046684 | Bacteria | 1910 |
| 897 | Ga0495669_0161947 | 3300046684 | Bacteria | 1062 |
| 898 | Ga0495669_0201649 | 3300046684 | Bacteria | 951 |
| 899 | Ga0495624_0069750 | 3300046690 | Bacteria | 2189 |
| 900 | Ga0495624_0236825 | 3300046690 | Unclassified | 1105 |
| 901 | Ga0495581_0013470 | 3300047315 | Bacteria | 4743 |
| 902 | Ga0495581_0029574 | 3300047315 | Bacteria | 3175 |
| 903 | Ga0495581_0123505 | 3300047315 | Bacteria | 1507 |
| 904 | Ga0495581_0244084 | 3300047315 | Bacteria | 1050 |
| 905 | Ga0495604_0036261 | 3300047317 | Bacteria | 3888 |
| 906 | Ga0495604_0094719 | 3300047317 | Bacteria | 2207 |
| 907 | Ga0495674_0019591 | 3300047319 | Bacteria | 6277 |
| 908 | Ga0495674_0020727 | 3300047319 | Bacteria | 6086 |
| 909 | Ga0495674_0045930 | 3300047319 | Bacteria | 3878 |
| 910 | Ga0495674_0154358 | 3300047319 | Bacteria | 1924 |
| 911 | Ga0495674_0270575 | 3300047319 | Bacteria | 1394 |
| 912 | Ga0495676_0164089 | 3300047321 | Bacteria | 1569 |
| 913 | Ga0495675_0044359 | 3300047444 | Unclassified | 2833 |
| 914 | Ga0495675_0119721 | 3300047444 | Unclassified | 1640 |
| 915 | Ga0495684_0112258 | 3300047471 | Unclassified | 2055 |
| 916 | Ga0495684_0114347 | 3300047471 | Bacteria | 2035 |
| 917 | Ga0495684_0215554 | 3300047471 | Unclassified | 1410 |
| 918 | Ga0495686_0002162 | 3300047472 | Bacteria | 19173 |
| 919 | Ga0495593_0096598 | 3300047673 | Bacteria | 1518 |
| 920 | Ga0495602_0025434 | 3300048088 | Bacteria | 5729 |
| 921 | Ga0495602_0049501 | 3300048088 | Bacteria | 3764 |
| 922 | Ga0495614_0133357 | 3300048089 | Bacteria | 1100 |
| 923 | Ga0496100_0131907 | 3300048903 | Bacteria | 1761 |
| 924 | Ga0496101_0163023 | 3300048904 | Bacteria | 1711 |
| 925 | Ga0496102_0005655 | 3300048905 | Bacteria | 10609 |
| 926 | Ga0496102_0357795 | 3300048905 | Bacteria | 1374 |
| 927 | Ga0496103_0000974 | 3300048906 | Bacteria | 20261 |
| 928 | Ga0496103_0009469 | 3300048906 | Bacteria | 5768 |
| 929 | Ga0496103_0118062 | 3300048906 | Bacteria | 1689 |
| 930 | Ga0496104_0013808 | 3300048907 | Bacteria | 7286 |
| 931 | Ga0496104_0020277 | 3300048907 | Bacteria | 6092 |
| 932 | Ga0496104_0116658 | 3300048907 | Bacteria | 2562 |
| 933 | Ga0496104_0152054 | 3300048907 | Bacteria | 2221 |
| 934 | Ga0496104_0316652 | 3300048907 | Bacteria | 1473 |
| 935 | Ga0496104_0559479 | 3300048907 | Unclassified | 1054 |
| 936 | Ga0496105_0103843 | 3300048908 | Bacteria | 2347 |
| 937 | Ga0496105_0359445 | 3300048908 | Bacteria | 1162 |
| 938 | Ga0496107_0033203 | 3300048910 | Bacteria | 3692 |
| 939 | Ga0496107_0275615 | 3300048910 | Bacteria | 1252 |
| 940 | Ga0496108_0000477 | 3300048911 | Bacteria | 32062 |
| 941 | Ga0496108_0382796 | 3300048911 | Bacteria | 1228 |
| 942 | Ga0496109_0000020 | 3300048912 | Bacteria | 189962 |
| 943 | Ga0496109_0027873 | 3300048912 | Bacteria | 5049 |
| 944 | Ga0496109_0248454 | 3300048912 | Bacteria | 1675 |
| 945 | Ga0496109_0498144 | 3300048912 | Bacteria | 1150 |
| 946 | Ga0496109_0729969 | 3300048912 | Bacteria | 928 |
| 947 | Ga0496110_0004805 | 3300048913 | Bacteria | 10525 |
| 948 | Ga0496110_0031429 | 3300048913 | Bacteria | 4581 |
| 949 | Ga0496110_0130179 | 3300048913 | Bacteria | 2272 |
| 950 | Ga0496111_0028169 | 3300048914 | Bacteria | 3979 |
| 951 | Ga0496111_0291942 | 3300048914 | Bacteria | 1209 |
| 952 | Ga0496111_0444141 | 3300048914 | Bacteria | 957 |
| 953 | Ga0496112_0000402 | 3300048915 | Bacteria | 28279 |
| 954 | Ga0496112_0002357 | 3300048915 | Bacteria | 15176 |
| 955 | Ga0496112_0013108 | 3300048915 | Bacteria | 7650 |
| 956 | Ga0496112_0064959 | 3300048915 | Bacteria | 3602 |
| 957 | Ga0496112_0138641 | 3300048915 | Bacteria | 2402 |
| 958 | Ga0496112_0195828 | 3300048915 | Bacteria | 1981 |
| 959 | Ga0496112_0291631 | 3300048915 | Bacteria | 1577 |
| 960 | Ga0496112_0295265 | 3300048915 | Bacteria | 1566 |
| 961 | Ga0496112_0444787 | 3300048915 | Unclassified | 1234 |
| 962 | Ga0496112_0504415 | 3300048915 | Bacteria | 1145 |
| 963 | Ga0496113_0000340 | 3300048916 | Bacteria | 22214 |
| 964 | Ga0496113_0031949 | 3300048916 | Bacteria | 3824 |
| 965 | Ga0496113_0097364 | 3300048916 | Unclassified | 2276 |
| 966 | Ga0496113_0471256 | 3300048916 | Bacteria | 1009 |
| 967 | Ga0496114_0151687 | 3300048917 | Bacteria | 2011 |
| 968 | Ga0496115_0004190 | 3300048918 | Bacteria | 10425 |
| 969 | Ga0496115_0031991 | 3300048918 | Bacteria | 4149 |
| 970 | Ga0496115_0461849 | 3300048918 | Unclassified | 1024 |
| 971 | Ga0496126_0014680 | 3300048929 | Bacteria | 7907 |
| 972 | Ga0501073_0105252 | 3300049589 | Bacteria | 1958 |
| 973 | nmdc:mga09592_29197_c1 | 3300050508 | Bacteria | 4586 |
| 974 | nmdc:mga0n895_233_c1 | 3300050512 | Bacteria | 35314 |
| 975 | nmdc:mga0rr50_133795_c1 | 3300050513 | Bacteria | 1988 |
| 976 | nmdc:mga08x19_2121_c1 | 3300050514 | Bacteria | 12128 |
| 977 | nmdc:mga08x19_2456_c1 | 3300050514 | Bacteria | 11272 |
| 978 | nmdc:mga08x19_5912_c1 | 3300050514 | Bacteria | 7235 |
| 979 | nmdc:mga08x19_66516_c1 | 3300050514 | Bacteria | 2342 |
| 980 | Ga0495601_0008130 | 3300053077 | Bacteria | 6187 |
| 981 | Ga0495601_0098456 | 3300053077 | Bacteria | 1887 |
| 982 | Ga0495601_0265815 | 3300053077 | Bacteria | 1119 |
| 983 | Ga0495612_0193600 | 3300053078 | Bacteria | 895 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005536 | Ga0070697_100000006 | Ga0070697_100000006126 | 236 |
| 2 | 3300049589 | Ga0501073_0105252 | Ga0501073_0105252_1223_1945 | 237 |
| 3 | 3300025922 | Ga0207646_10000192 | Ga0207646_1000019234 | 240 |
| 4 | 3300005355 | Ga0070671_100203273 | Ga0070671_1002032732 | 244 |
| 5 | 3300009177 | Ga0105248_10296583 | Ga0105248_102965831 | 244 |
| 6 | 3300014969 | Ga0157376_10016053 | Ga0157376_100160532 | 244 |
| 7 | 3300046533 | Ga0495640_0356864 | Ga0495640_0356864_28_768 | 244 |
| 8 | 3300048904 | Ga0496101_0163023 | Ga0496101_0163023_477_1211 | 244 |
| 9 | 3300048912 | Ga0496109_0248454 | Ga0496109_0248454_444_1178 | 244 |
| 10 | 3300048913 | Ga0496110_0130179 | Ga0496110_0130179_998_1732 | 244 |
| 11 | 3300048914 | Ga0496111_0291942 | Ga0496111_0291942_398_1132 | 244 |
| 12 | 3300048915 | Ga0496112_0291631 | Ga0496112_0291631_820_1554 | 244 |
| 13 | 3300048918 | Ga0496115_0031991 | Ga0496115_0031991_2351_3085 | 244 |
| 14 | 3300005435 | Ga0070714_100006809 | Ga0070714_1000068094 | 246 |
| 15 | 3300005436 | Ga0070713_100003409 | Ga0070713_1000034093 | 246 |
| 16 | 3300006028 | Ga0070717_10022350 | Ga0070717_100223504 | 246 |
| 17 | 3300025928 | Ga0207700_10032067 | Ga0207700_100320674 | 246 |
| 18 | 3300025929 | Ga0207664_10104893 | Ga0207664_101048932 | 246 |
| 19 | 3300005434 | Ga0070709_10078324 | Ga0070709_100783243 | 247 |
| 20 | 3300025906 | Ga0207699_10300912 | Ga0207699_103009121 | 247 |
| 21 | 3300025928 | Ga0207700_10303786 | Ga0207700_103037861 | 247 |
| 22 | 3300013296 | Ga0157374_10056435 | Ga0157374_100564354 | 248 |
| 23 | 3300021361 | Ga0213872_10015651 | Ga0213872_100156513 | 248 |
| 24 | 3300042876 | Ga0451577_0093462 | Ga0451577_0093462_1911_2657 | 248 |
| 25 | 3300046459 | Ga0495629_0217435 | Ga0495629_0217435_525_1271 | 248 |
| 26 | 3300048929 | Ga0496126_0014680 | Ga0496126_0014680_296_1042 | 248 |
| 27 | 3300048906 | Ga0496103_0118062 | Ga0496103_0118062_436_1188 | 250 |
| 28 | 3300005536 | Ga0070697_100380274 | Ga0070697_1003802742 | 253 |
| 29 | 3300006028 | Ga0070717_10011082 | Ga0070717_100110823 | 253 |
| 30 | 3300006173 | Ga0070716_100356636 | Ga0070716_1003566361 | 253 |
| 31 | 3300007076 | Ga0075435_100060985 | Ga0075435_1000609852 | 253 |
| 32 | 3300025910 | Ga0207684_10177942 | Ga0207684_101779422 | 254 |
| 33 | 3300005436 | Ga0070713_100079727 | Ga0070713_1000797271 | 255 |
| 34 | 3300005445 | Ga0070708_100153520 | Ga0070708_1001535202 | 255 |
| 35 | 3300005467 | Ga0070706_100000038 | Ga0070706_1000000382 | 255 |
| 36 | 3300005467 | Ga0070706_100051467 | Ga0070706_1000514673 | 255 |
| 37 | 3300005468 | Ga0070707_100063007 | Ga0070707_1000630073 | 255 |
| 38 | 3300005471 | Ga0070698_100041619 | Ga0070698_1000416194 | 255 |
| 39 | 3300005518 | Ga0070699_100010942 | Ga0070699_1000109423 | 255 |
| 40 | 3300005536 | Ga0070697_100003316 | Ga0070697_1000033165 | 255 |
| 41 | 3300006028 | Ga0070717_10129298 | Ga0070717_101292982 | 255 |
| 42 | 3300025922 | Ga0207646_10005288 | Ga0207646_100052888 | 255 |
| 43 | 3300025922 | Ga0207646_10012851 | Ga0207646_100128514 | 255 |
| 44 | 3300044673 | Ga0453683_0290937 | Ga0453683_0290937_222_1019 | 256 |
| 45 | 3300005336 | Ga0070680_100218418 | Ga0070680_1002184182 | 257 |
| 46 | 3300005467 | Ga0070706_100001729 | Ga0070706_10000172931 | 257 |
| 47 | 3300005471 | Ga0070698_100001423 | Ga0070698_10000142310 | 257 |
| 48 | 3300005536 | Ga0070697_100001791 | Ga0070697_10000179111 | 257 |
| 49 | 3300005536 | Ga0070697_100002182 | Ga0070697_1000021829 | 257 |
| 50 | 3300005536 | Ga0070697_100046837 | Ga0070697_1000468373 | 257 |
| 51 | 3300005546 | Ga0070696_100004493 | Ga0070696_1000044938 | 257 |
| 52 | 3300006028 | Ga0070717_10127647 | Ga0070717_101276472 | 257 |
| 53 | 3300006173 | Ga0070716_100146633 | Ga0070716_1001466332 | 257 |
| 54 | 3300006844 | Ga0075428_100043757 | Ga0075428_1000437575 | 257 |
| 55 | 3300006880 | Ga0075429_100034596 | Ga0075429_1000345965 | 257 |
| 56 | 3300009147 | Ga0114129_10342869 | Ga0114129_103428691 | 257 |
| 57 | 3300013105 | Ga0157369_10030338 | Ga0157369_100303385 | 257 |
| 58 | 3300021388 | Ga0213875_10030852 | Ga0213875_100308522 | 257 |
| 59 | 3300025912 | Ga0207707_10372176 | Ga0207707_103721761 | 257 |
| 60 | 3300025929 | Ga0207664_10184474 | Ga0207664_101844743 | 257 |
| 61 | 3300025939 | Ga0207665_10055857 | Ga0207665_100558572 | 257 |
| 62 | 3300037418 | Ga0395900_0108226 | Ga0395900_0108226_1591_2364 | 257 |
| 63 | 3300037466 | Ga0395898_0049498 | Ga0395898_0049498_575_1348 | 257 |
| 64 | 3300037853 | Ga0436364_0496890 | Ga0436364_0496890_6237_7016 | 257 |
| 65 | 3300046499 | Ga0495594_0061106 | Ga0495594_0061106_568_1356 | 257 |
| 66 | 3300050508 | nmdc:mga09592_29197_c1 | nmdc:mga09592_29197_c1_256_1053 | 257 |
| 67 | 3300005445 | Ga0070708_100152512 | Ga0070708_1001525123 | 259 |
| 68 | 3300005445 | Ga0070708_100158622 | Ga0070708_1001586223 | 259 |
| 69 | 3300005467 | Ga0070706_100023126 | Ga0070706_1000231264 | 259 |
| 70 | 3300005468 | Ga0070707_100000434 | Ga0070707_10000043430 | 259 |
| 71 | 3300005468 | Ga0070707_100006967 | Ga0070707_1000069675 | 259 |
| 72 | 3300005471 | Ga0070698_100003377 | Ga0070698_1000033776 | 259 |
| 73 | 3300005471 | Ga0070698_100036597 | Ga0070698_1000365973 | 259 |
| 74 | 3300005471 | Ga0070698_100206325 | Ga0070698_1002063252 | 259 |
| 75 | 3300005518 | Ga0070699_100272061 | Ga0070699_1002720613 | 259 |
| 76 | 3300005536 | Ga0070697_100008447 | Ga0070697_1000084478 | 259 |
| 77 | 3300006028 | Ga0070717_10040600 | Ga0070717_100406005 | 259 |
| 78 | 3300007265 | Ga0099794_10169107 | Ga0099794_101691072 | 259 |
| 79 | 3300025910 | Ga0207684_10000008 | Ga0207684_1000000845 | 259 |
| 80 | 3300025910 | Ga0207684_10004879 | Ga0207684_100048795 | 259 |
| 81 | 3300025922 | Ga0207646_10001274 | Ga0207646_1000127411 | 259 |
| 82 | 3300025939 | Ga0207665_10159131 | Ga0207665_101591312 | 259 |
| 83 | 3300005549 | Ga0070704_100106680 | Ga0070704_1001066802 | 260 |
| 84 | 3300025910 | Ga0207684_10000129 | Ga0207684_10000129122 | 260 |
| 85 | 3300035120 | Ga0373957_0005941 | Ga0373957_0005941_1652_2437 | 261 |
| 86 | 3300005547 | Ga0070693_100045664 | Ga0070693_1000456643 | 262 |
| 87 | 3300005563 | Ga0068855_100087134 | Ga0068855_1000871343 | 262 |
| 88 | 3300005563 | Ga0068855_100245965 | Ga0068855_1002459652 | 262 |
| 89 | 3300005578 | Ga0068854_100343750 | Ga0068854_1003437501 | 262 |
| 90 | 3300005614 | Ga0068856_100037127 | Ga0068856_1000371272 | 262 |
| 91 | 3300005614 | Ga0068856_100311400 | Ga0068856_1003114002 | 262 |
| 92 | 3300006028 | Ga0070717_10220711 | Ga0070717_102207111 | 262 |
| 93 | 3300009093 | Ga0105240_10332602 | Ga0105240_103326022 | 262 |
| 94 | 3300009545 | Ga0105237_10512137 | Ga0105237_105121371 | 262 |
| 95 | 3300009551 | Ga0105238_10026343 | Ga0105238_100263432 | 262 |
| 96 | 3300013104 | Ga0157370_10014896 | Ga0157370_100148964 | 262 |
| 97 | 3300013105 | Ga0157369_10056220 | Ga0157369_100562203 | 262 |
| 98 | 3300013105 | Ga0157369_10433028 | Ga0157369_104330282 | 262 |
| 99 | 3300013307 | Ga0157372_10036371 | Ga0157372_100363713 | 262 |
| 100 | 3300013307 | Ga0157372_10178253 | Ga0157372_101782532 | 262 |
| 101 | 3300025913 | Ga0207695_10022507 | Ga0207695_100225073 | 262 |
| 102 | 3300025913 | Ga0207695_10259304 | Ga0207695_102593042 | 262 |
| 103 | 3300025949 | Ga0207667_10109678 | Ga0207667_101096782 | 262 |
| 104 | 3300025981 | Ga0207640_10312142 | Ga0207640_103121421 | 262 |
| 105 | 3300026041 | Ga0207639_10754401 | Ga0207639_107544011 | 262 |
| 106 | 3300026078 | Ga0207702_10138909 | Ga0207702_101389092 | 262 |
| 107 | 3300026142 | Ga0207698_10878836 | Ga0207698_108788361 | 262 |
| 108 | 3300037471 | Ga0395905_0646779 | Ga0395905_0646779_149_940 | 262 |
| 109 | 3300044694 | Ga0466963_0043245 | Ga0466963_0043245_2042_2830 | 262 |
| 110 | 3300045049 | Ga0466959_0087349 | Ga0466959_0087349_370_1158 | 262 |
| 111 | 3300046526 | Ga0495666_0019788 | Ga0495666_0019788_2181_2969 | 262 |
| 112 | 3300002459 | JGI24751J29686_10009361 | JGI24751J29686_100093612 | 263 |
| 113 | 3300005327 | Ga0070658_10074824 | Ga0070658_100748243 | 263 |
| 114 | 3300005328 | Ga0070676_10003837 | Ga0070676_100038373 | 263 |
| 115 | 3300005328 | Ga0070676_10017075 | Ga0070676_100170752 | 263 |
| 116 | 3300005329 | Ga0070683_100004635 | Ga0070683_1000046353 | 263 |
| 117 | 3300005329 | Ga0070683_100097817 | Ga0070683_1000978172 | 263 |
| 118 | 3300005329 | Ga0070683_100344593 | Ga0070683_1003445931 | 263 |
| 119 | 3300005330 | Ga0070690_100021225 | Ga0070690_1000212253 | 263 |
| 120 | 3300005330 | Ga0070690_100070037 | Ga0070690_1000700372 | 263 |
| 121 | 3300005330 | Ga0070690_100181853 | Ga0070690_1001818531 | 263 |
| 122 | 3300005330 | Ga0070690_100291651 | Ga0070690_1002916512 | 263 |
| 123 | 3300005331 | Ga0070670_100001284 | Ga0070670_1000012844 | 263 |
| 124 | 3300005331 | Ga0070670_100114216 | Ga0070670_1001142162 | 263 |
| 125 | 3300005333 | Ga0070677_10186993 | Ga0070677_101869931 | 263 |
| 126 | 3300005334 | Ga0068869_100030462 | Ga0068869_1000304623 | 263 |
| 127 | 3300005334 | Ga0068869_100067071 | Ga0068869_1000670712 | 263 |
| 128 | 3300005336 | Ga0070680_100089347 | Ga0070680_1000893471 | 263 |
| 129 | 3300005336 | Ga0070680_100137977 | Ga0070680_1001379772 | 263 |
| 130 | 3300005337 | Ga0070682_100005772 | Ga0070682_1000057726 | 263 |
| 131 | 3300005337 | Ga0070682_100057639 | Ga0070682_1000576392 | 263 |
| 132 | 3300005338 | Ga0068868_100006219 | Ga0068868_1000062197 | 263 |
| 133 | 3300005338 | Ga0068868_100009581 | Ga0068868_1000095818 | 263 |
| 134 | 3300005338 | Ga0068868_100073410 | Ga0068868_1000734102 | 263 |
| 135 | 3300005338 | Ga0068868_100090243 | Ga0068868_1000902432 | 263 |
| 136 | 3300005339 | Ga0070660_100000802 | Ga0070660_10000080211 | 263 |
| 137 | 3300005339 | Ga0070660_100059442 | Ga0070660_1000594423 | 263 |
| 138 | 3300005340 | Ga0070689_100007128 | Ga0070689_1000071286 | 263 |
| 139 | 3300005341 | Ga0070691_10091632 | Ga0070691_100916321 | 263 |
| 140 | 3300005343 | Ga0070687_100011620 | Ga0070687_1000116203 | 263 |
| 141 | 3300005344 | Ga0070661_100033575 | Ga0070661_1000335752 | 263 |
| 142 | 3300005353 | Ga0070669_100135828 | Ga0070669_1001358282 | 263 |
| 143 | 3300005353 | Ga0070669_100192164 | Ga0070669_1001921642 | 263 |
| 144 | 3300005356 | Ga0070674_100253192 | Ga0070674_1002531921 | 263 |
| 145 | 3300005364 | Ga0070673_100116863 | Ga0070673_1001168633 | 263 |
| 146 | 3300005364 | Ga0070673_100213038 | Ga0070673_1002130382 | 263 |
| 147 | 3300005365 | Ga0070688_100000324 | Ga0070688_1000003245 | 263 |
| 148 | 3300005365 | Ga0070688_100100176 | Ga0070688_1001001761 | 263 |
| 149 | 3300005366 | Ga0070659_100049589 | Ga0070659_1000495893 | 263 |
| 150 | 3300005366 | Ga0070659_100061181 | Ga0070659_1000611813 | 263 |
| 151 | 3300005367 | Ga0070667_100259526 | Ga0070667_1002595262 | 263 |
| 152 | 3300005367 | Ga0070667_100552629 | Ga0070667_1005526292 | 263 |
| 153 | 3300005434 | Ga0070709_10006939 | Ga0070709_100069393 | 263 |
| 154 | 3300005434 | Ga0070709_10022285 | Ga0070709_100222852 | 263 |
| 155 | 3300005434 | Ga0070709_10030430 | Ga0070709_100304301 | 263 |
| 156 | 3300005434 | Ga0070709_10037044 | Ga0070709_100370442 | 263 |
| 157 | 3300005434 | Ga0070709_10087316 | Ga0070709_100873162 | 263 |
| 158 | 3300005434 | Ga0070709_10104062 | Ga0070709_101040622 | 263 |
| 159 | 3300005434 | Ga0070709_10480320 | Ga0070709_104803201 | 263 |
| 160 | 3300005435 | Ga0070714_100000060 | Ga0070714_10000006090 | 263 |
| 161 | 3300005435 | Ga0070714_100176484 | Ga0070714_1001764842 | 263 |
| 162 | 3300005435 | Ga0070714_100210467 | Ga0070714_1002104672 | 263 |
| 163 | 3300005435 | Ga0070714_100289739 | Ga0070714_1002897392 | 263 |
| 164 | 3300005435 | Ga0070714_100296418 | Ga0070714_1002964182 | 263 |
| 165 | 3300005435 | Ga0070714_100296486 | Ga0070714_1002964861 | 263 |
| 166 | 3300005435 | Ga0070714_100418040 | Ga0070714_1004180401 | 263 |
| 167 | 3300005435 | Ga0070714_100456793 | Ga0070714_1004567932 | 263 |
| 168 | 3300005436 | Ga0070713_100000037 | Ga0070713_1000000377 | 263 |
| 169 | 3300005436 | Ga0070713_100001036 | Ga0070713_1000010366 | 263 |
| 170 | 3300005436 | Ga0070713_100002374 | Ga0070713_1000023747 | 263 |
| 171 | 3300005436 | Ga0070713_100037517 | Ga0070713_1000375172 | 263 |
| 172 | 3300005436 | Ga0070713_100045935 | Ga0070713_1000459352 | 263 |
| 173 | 3300005436 | Ga0070713_100083375 | Ga0070713_1000833752 | 263 |
| 174 | 3300005436 | Ga0070713_100141496 | Ga0070713_1001414962 | 263 |
| 175 | 3300005436 | Ga0070713_100175324 | Ga0070713_1001753242 | 263 |
| 176 | 3300005436 | Ga0070713_100186960 | Ga0070713_1001869601 | 263 |
| 177 | 3300005437 | Ga0070710_10001259 | Ga0070710_100012594 | 263 |
| 178 | 3300005437 | Ga0070710_10008303 | Ga0070710_100083032 | 263 |
| 179 | 3300005437 | Ga0070710_10030625 | Ga0070710_100306252 | 263 |
| 180 | 3300005437 | Ga0070710_10128132 | Ga0070710_101281321 | 263 |
| 181 | 3300005439 | Ga0070711_100000620 | Ga0070711_1000006207 | 263 |
| 182 | 3300005439 | Ga0070711_100000948 | Ga0070711_1000009485 | 263 |
| 183 | 3300005439 | Ga0070711_100004411 | Ga0070711_1000044113 | 263 |
| 184 | 3300005439 | Ga0070711_100020771 | Ga0070711_1000207714 | 263 |
| 185 | 3300005439 | Ga0070711_100024294 | Ga0070711_1000242943 | 263 |
| 186 | 3300005439 | Ga0070711_100029169 | Ga0070711_1000291693 | 263 |
| 187 | 3300005439 | Ga0070711_100175599 | Ga0070711_1001755991 | 263 |
| 188 | 3300005439 | Ga0070711_100261692 | Ga0070711_1002616922 | 263 |
| 189 | 3300005439 | Ga0070711_100402942 | Ga0070711_1004029421 | 263 |
| 190 | 3300005445 | Ga0070708_100004680 | Ga0070708_1000046804 | 263 |
| 191 | 3300005445 | Ga0070708_100020691 | Ga0070708_1000206913 | 263 |
| 192 | 3300005445 | Ga0070708_100040631 | Ga0070708_1000406312 | 263 |
| 193 | 3300005445 | Ga0070708_100044681 | Ga0070708_1000446814 | 263 |
| 194 | 3300005445 | Ga0070708_100076078 | Ga0070708_1000760783 | 263 |
| 195 | 3300005455 | Ga0070663_100014599 | Ga0070663_1000145992 | 263 |
| 196 | 3300005456 | Ga0070678_100021562 | Ga0070678_1000215623 | 263 |
| 197 | 3300005457 | Ga0070662_100007867 | Ga0070662_1000078672 | 263 |
| 198 | 3300005457 | Ga0070662_100146223 | Ga0070662_1001462232 | 263 |
| 199 | 3300005458 | Ga0070681_10000104 | Ga0070681_1000010453 | 263 |
| 200 | 3300005458 | Ga0070681_10034658 | Ga0070681_100346582 | 263 |
| 201 | 3300005458 | Ga0070681_10035198 | Ga0070681_100351982 | 263 |
| 202 | 3300005459 | Ga0068867_100025667 | Ga0068867_1000256672 | 263 |
| 203 | 3300005459 | Ga0068867_100050861 | Ga0068867_1000508612 | 263 |
| 204 | 3300005466 | Ga0070685_10071696 | Ga0070685_100716962 | 263 |
| 205 | 3300005467 | Ga0070706_100002504 | Ga0070706_10000250415 | 263 |
| 206 | 3300005467 | Ga0070706_100025311 | Ga0070706_1000253113 | 263 |
| 207 | 3300005467 | Ga0070706_100304336 | Ga0070706_1003043362 | 263 |
| 208 | 3300005468 | Ga0070707_100023128 | Ga0070707_1000231281 | 263 |
| 209 | 3300005468 | Ga0070707_100046153 | Ga0070707_1000461535 | 263 |
| 210 | 3300005468 | Ga0070707_100736377 | Ga0070707_1007363771 | 263 |
| 211 | 3300005518 | Ga0070699_100007223 | Ga0070699_1000072232 | 263 |
| 212 | 3300005518 | Ga0070699_100377728 | Ga0070699_1003777282 | 263 |
| 213 | 3300005530 | Ga0070679_100001719 | Ga0070679_1000017195 | 263 |
| 214 | 3300005530 | Ga0070679_100264421 | Ga0070679_1002644212 | 263 |
| 215 | 3300005530 | Ga0070679_100412060 | Ga0070679_1004120602 | 263 |
| 216 | 3300005535 | Ga0070684_100003436 | Ga0070684_1000034366 | 263 |
| 217 | 3300005535 | Ga0070684_100426253 | Ga0070684_1004262531 | 263 |
| 218 | 3300005536 | Ga0070697_100000353 | Ga0070697_10000035334 | 263 |
| 219 | 3300005536 | Ga0070697_100005151 | Ga0070697_1000051515 | 263 |
| 220 | 3300005536 | Ga0070697_100046258 | Ga0070697_1000462584 | 263 |
| 221 | 3300005539 | Ga0068853_100026560 | Ga0068853_1000265602 | 263 |
| 222 | 3300005539 | Ga0068853_100076866 | Ga0068853_1000768663 | 263 |
| 223 | 3300005543 | Ga0070672_100049512 | Ga0070672_1000495122 | 263 |
| 224 | 3300005543 | Ga0070672_100668756 | Ga0070672_1006687561 | 263 |
| 225 | 3300005545 | Ga0070695_100079374 | Ga0070695_1000793742 | 263 |
| 226 | 3300005546 | Ga0070696_100288433 | Ga0070696_1002884332 | 263 |
| 227 | 3300005547 | Ga0070693_100143587 | Ga0070693_1001435871 | 263 |
| 228 | 3300005563 | Ga0068855_100000238 | Ga0068855_1000002388 | 263 |
| 229 | 3300005563 | Ga0068855_100000770 | Ga0068855_10000077010 | 263 |
| 230 | 3300005563 | Ga0068855_100017711 | Ga0068855_1000177115 | 263 |
| 231 | 3300005563 | Ga0068855_100580780 | Ga0068855_1005807802 | 263 |
| 232 | 3300005564 | Ga0070664_100004949 | Ga0070664_1000049499 | 263 |
| 233 | 3300005564 | Ga0070664_100057595 | Ga0070664_1000575953 | 263 |
| 234 | 3300005564 | Ga0070664_100284704 | Ga0070664_1002847042 | 263 |
| 235 | 3300005577 | Ga0068857_100000113 | Ga0068857_10000011336 | 263 |
| 236 | 3300005577 | Ga0068857_100034290 | Ga0068857_1000342903 | 263 |
| 237 | 3300005577 | Ga0068857_100327278 | Ga0068857_1003272781 | 263 |
| 238 | 3300005578 | Ga0068854_100001797 | Ga0068854_1000017975 | 263 |
| 239 | 3300005578 | Ga0068854_100275860 | Ga0068854_1002758602 | 263 |
| 240 | 3300005614 | Ga0068856_100000096 | Ga0068856_10000009631 | 263 |
| 241 | 3300005614 | Ga0068856_100000305 | Ga0068856_10000030524 | 263 |
| 242 | 3300005614 | Ga0068856_100036461 | Ga0068856_1000364612 | 263 |
| 243 | 3300005614 | Ga0068856_100057632 | Ga0068856_1000576322 | 263 |
| 244 | 3300005614 | Ga0068856_100172849 | Ga0068856_1001728492 | 263 |
| 245 | 3300005614 | Ga0068856_100260540 | Ga0068856_1002605402 | 263 |
| 246 | 3300005615 | Ga0070702_100052923 | Ga0070702_1000529232 | 263 |
| 247 | 3300005616 | Ga0068852_100036346 | Ga0068852_1000363463 | 263 |
| 248 | 3300005616 | Ga0068852_100118358 | Ga0068852_1001183582 | 263 |
| 249 | 3300005616 | Ga0068852_100321911 | Ga0068852_1003219112 | 263 |
| 250 | 3300005617 | Ga0068859_100002165 | Ga0068859_1000021655 | 263 |
| 251 | 3300005617 | Ga0068859_100042731 | Ga0068859_1000427313 | 263 |
| 252 | 3300005617 | Ga0068859_100341998 | Ga0068859_1003419982 | 263 |
| 253 | 3300005618 | Ga0068864_100014466 | Ga0068864_1000144664 | 263 |
| 254 | 3300005618 | Ga0068864_100048061 | Ga0068864_1000480613 | 263 |
| 255 | 3300005618 | Ga0068864_100049877 | Ga0068864_1000498773 | 263 |
| 256 | 3300005718 | Ga0068866_10004147 | Ga0068866_100041474 | 263 |
| 257 | 3300005718 | Ga0068866_10022795 | Ga0068866_100227952 | 263 |
| 258 | 3300005718 | Ga0068866_10050018 | Ga0068866_100500182 | 263 |
| 259 | 3300005834 | Ga0068851_10003975 | Ga0068851_100039755 | 263 |
| 260 | 3300005834 | Ga0068851_10010200 | Ga0068851_100102002 | 263 |
| 261 | 3300005834 | Ga0068851_10052956 | Ga0068851_100529561 | 263 |
| 262 | 3300005840 | Ga0068870_10012650 | Ga0068870_100126502 | 263 |
| 263 | 3300005840 | Ga0068870_10022256 | Ga0068870_100222562 | 263 |
| 264 | 3300005841 | Ga0068863_100010652 | Ga0068863_1000106522 | 263 |
| 265 | 3300005842 | Ga0068858_100007172 | Ga0068858_1000071729 | 263 |
| 266 | 3300005842 | Ga0068858_100049365 | Ga0068858_1000493652 | 263 |
| 267 | 3300005842 | Ga0068858_100080573 | Ga0068858_1000805732 | 263 |
| 268 | 3300005842 | Ga0068858_100112600 | Ga0068858_1001126002 | 263 |
| 269 | 3300005842 | Ga0068858_100375574 | Ga0068858_1003755741 | 263 |
| 270 | 3300005843 | Ga0068860_100017206 | Ga0068860_1000172063 | 263 |
| 271 | 3300005843 | Ga0068860_100088983 | Ga0068860_1000889833 | 263 |
| 272 | 3300005843 | Ga0068860_100116329 | Ga0068860_1001163293 | 263 |
| 273 | 3300005843 | Ga0068860_100352285 | Ga0068860_1003522852 | 263 |
| 274 | 3300005843 | Ga0068860_100583698 | Ga0068860_1005836981 | 263 |
| 275 | 3300005844 | Ga0068862_100029494 | Ga0068862_1000294941 | 263 |
| 276 | 3300005844 | Ga0068862_100033899 | Ga0068862_1000338993 | 263 |
| 277 | 3300005844 | Ga0068862_100120541 | Ga0068862_1001205412 | 263 |
| 278 | 3300006028 | Ga0070717_10001269 | Ga0070717_100012697 | 263 |
| 279 | 3300006028 | Ga0070717_10001355 | Ga0070717_1000135515 | 263 |
| 280 | 3300006028 | Ga0070717_10012374 | Ga0070717_100123744 | 263 |
| 281 | 3300006028 | Ga0070717_10018677 | Ga0070717_100186774 | 263 |
| 282 | 3300006028 | Ga0070717_10025940 | Ga0070717_100259405 | 263 |
| 283 | 3300006028 | Ga0070717_10053823 | Ga0070717_100538233 | 263 |
| 284 | 3300006028 | Ga0070717_10060782 | Ga0070717_100607823 | 263 |
| 285 | 3300006028 | Ga0070717_10110676 | Ga0070717_101106762 | 263 |
| 286 | 3300006028 | Ga0070717_10252334 | Ga0070717_102523342 | 263 |
| 287 | 3300006028 | Ga0070717_10259840 | Ga0070717_102598403 | 263 |
| 288 | 3300006028 | Ga0070717_10273993 | Ga0070717_102739931 | 263 |
| 289 | 3300006028 | Ga0070717_10305490 | Ga0070717_103054902 | 263 |
| 290 | 3300006163 | Ga0070715_10004939 | Ga0070715_100049393 | 263 |
| 291 | 3300006163 | Ga0070715_10010431 | Ga0070715_100104313 | 263 |
| 292 | 3300006173 | Ga0070716_100001188 | Ga0070716_1000011883 | 263 |
| 293 | 3300006173 | Ga0070716_100015187 | Ga0070716_1000151873 | 263 |
| 294 | 3300006173 | Ga0070716_100016018 | Ga0070716_1000160182 | 263 |
| 295 | 3300006173 | Ga0070716_100020877 | Ga0070716_1000208772 | 263 |
| 296 | 3300006173 | Ga0070716_100048212 | Ga0070716_1000482122 | 263 |
| 297 | 3300006173 | Ga0070716_100211478 | Ga0070716_1002114782 | 263 |
| 298 | 3300006175 | Ga0070712_100000010 | Ga0070712_10000001069 | 263 |
| 299 | 3300006175 | Ga0070712_100000853 | Ga0070712_1000008537 | 263 |
| 300 | 3300006175 | Ga0070712_100001607 | Ga0070712_1000016077 | 263 |
| 301 | 3300006175 | Ga0070712_100003139 | Ga0070712_1000031392 | 263 |
| 302 | 3300006175 | Ga0070712_100004072 | Ga0070712_1000040725 | 263 |
| 303 | 3300006175 | Ga0070712_100005197 | Ga0070712_1000051975 | 263 |
| 304 | 3300006175 | Ga0070712_100023121 | Ga0070712_1000231213 | 263 |
| 305 | 3300006175 | Ga0070712_100111071 | Ga0070712_1001110712 | 263 |
| 306 | 3300006237 | Ga0097621_100000022 | Ga0097621_10000002252 | 263 |
| 307 | 3300006237 | Ga0097621_100002166 | Ga0097621_1000021662 | 263 |
| 308 | 3300006237 | Ga0097621_100054796 | Ga0097621_1000547962 | 263 |
| 309 | 3300006358 | Ga0068871_100000401 | Ga0068871_10000040116 | 263 |
| 310 | 3300006358 | Ga0068871_100000478 | Ga0068871_1000004789 | 263 |
| 311 | 3300006358 | Ga0068871_100001634 | Ga0068871_10000163412 | 263 |
| 312 | 3300006358 | Ga0068871_100012481 | Ga0068871_1000124817 | 263 |
| 313 | 3300006881 | Ga0068865_100366366 | Ga0068865_1003663662 | 263 |
| 314 | 3300006881 | Ga0068865_100413274 | Ga0068865_1004132741 | 263 |
| 315 | 3300006914 | Ga0075436_100068139 | Ga0075436_1000681392 | 263 |
| 316 | 3300006914 | Ga0075436_100123941 | Ga0075436_1001239412 | 263 |
| 317 | 3300006931 | Ga0097620_100002165 | Ga0097620_1000021655 | 263 |
| 318 | 3300006931 | Ga0097620_100042732 | Ga0097620_1000427323 | 263 |
| 319 | 3300006931 | Ga0097620_100341947 | Ga0097620_1003419472 | 263 |
| 320 | 3300007076 | Ga0075435_100120643 | Ga0075435_1001206433 | 263 |
| 321 | 3300009092 | Ga0105250_10067574 | Ga0105250_100675742 | 263 |
| 322 | 3300009093 | Ga0105240_10016218 | Ga0105240_100162185 | 263 |
| 323 | 3300009093 | Ga0105240_10029357 | Ga0105240_100293574 | 263 |
| 324 | 3300009093 | Ga0105240_10047329 | Ga0105240_100473293 | 263 |
| 325 | 3300009093 | Ga0105240_10076743 | Ga0105240_100767434 | 263 |
| 326 | 3300009098 | Ga0105245_10001938 | Ga0105245_100019386 | 263 |
| 327 | 3300009098 | Ga0105245_10003931 | Ga0105245_1000393112 | 263 |
| 328 | 3300009098 | Ga0105245_10470443 | Ga0105245_104704432 | 263 |
| 329 | 3300009101 | Ga0105247_10033932 | Ga0105247_100339323 | 263 |
| 330 | 3300009148 | Ga0105243_10035619 | Ga0105243_100356192 | 263 |
| 331 | 3300009174 | Ga0105241_10002924 | Ga0105241_100029244 | 263 |
| 332 | 3300009174 | Ga0105241_10010624 | Ga0105241_100106244 | 263 |
| 333 | 3300009174 | Ga0105241_10015386 | Ga0105241_100153862 | 263 |
| 334 | 3300009174 | Ga0105241_10123962 | Ga0105241_101239622 | 263 |
| 335 | 3300009174 | Ga0105241_10180419 | Ga0105241_101804192 | 263 |
| 336 | 3300009176 | Ga0105242_10007431 | Ga0105242_100074315 | 263 |
| 337 | 3300009176 | Ga0105242_10071878 | Ga0105242_100718783 | 263 |
| 338 | 3300009176 | Ga0105242_10099348 | Ga0105242_100993482 | 263 |
| 339 | 3300009176 | Ga0105242_10195570 | Ga0105242_101955702 | 263 |
| 340 | 3300009177 | Ga0105248_10033388 | Ga0105248_100333886 | 263 |
| 341 | 3300009177 | Ga0105248_10056174 | Ga0105248_100561743 | 263 |
| 342 | 3300009545 | Ga0105237_10048488 | Ga0105237_100484883 | 263 |
| 343 | 3300009545 | Ga0105237_10069800 | Ga0105237_100698003 | 263 |
| 344 | 3300009545 | Ga0105237_10078171 | Ga0105237_100781711 | 263 |
| 345 | 3300009545 | Ga0105237_10185899 | Ga0105237_101858993 | 263 |
| 346 | 3300009545 | Ga0105237_10574885 | Ga0105237_105748851 | 263 |
| 347 | 3300009551 | Ga0105238_10000644 | Ga0105238_100006443 | 263 |
| 348 | 3300009551 | Ga0105238_10028879 | Ga0105238_100288796 | 263 |
| 349 | 3300009553 | Ga0105249_10240596 | Ga0105249_102405961 | 263 |
| 350 | 3300010375 | Ga0105239_10131415 | Ga0105239_101314152 | 263 |
| 351 | 3300010375 | Ga0105239_10167565 | Ga0105239_101675652 | 263 |
| 352 | 3300011119 | Ga0105246_10136449 | Ga0105246_101364491 | 263 |
| 353 | 3300013100 | Ga0157373_10003491 | Ga0157373_100034913 | 263 |
| 354 | 3300013100 | Ga0157373_10004886 | Ga0157373_100048866 | 263 |
| 355 | 3300013100 | Ga0157373_10083664 | Ga0157373_100836642 | 263 |
| 356 | 3300013102 | Ga0157371_10002263 | Ga0157371_1000226311 | 263 |
| 357 | 3300013102 | Ga0157371_10168627 | Ga0157371_101686272 | 263 |
| 358 | 3300013102 | Ga0157371_10198595 | Ga0157371_101985952 | 263 |
| 359 | 3300013104 | Ga0157370_10142216 | Ga0157370_101422163 | 263 |
| 360 | 3300013105 | Ga0157369_10000034 | Ga0157369_10000034147 | 263 |
| 361 | 3300013105 | Ga0157369_10036369 | Ga0157369_100363695 | 263 |
| 362 | 3300013105 | Ga0157369_10078967 | Ga0157369_100789673 | 263 |
| 363 | 3300013105 | Ga0157369_10171846 | Ga0157369_101718462 | 263 |
| 364 | 3300013105 | Ga0157369_10540275 | Ga0157369_105402752 | 263 |
| 365 | 3300013296 | Ga0157374_10000052 | Ga0157374_1000005295 | 263 |
| 366 | 3300013296 | Ga0157374_10001074 | Ga0157374_100010741 | 263 |
| 367 | 3300013296 | Ga0157374_10136419 | Ga0157374_101364192 | 263 |
| 368 | 3300013296 | Ga0157374_10279409 | Ga0157374_102794092 | 263 |
| 369 | 3300013297 | Ga0157378_10000227 | Ga0157378_1000022715 | 263 |
| 370 | 3300013297 | Ga0157378_10000764 | Ga0157378_100007648 | 263 |
| 371 | 3300013297 | Ga0157378_10003664 | Ga0157378_100036645 | 263 |
| 372 | 3300013297 | Ga0157378_10006776 | Ga0157378_100067765 | 263 |
| 373 | 3300013297 | Ga0157378_10240087 | Ga0157378_102400871 | 263 |
| 374 | 3300013306 | Ga0163162_10011916 | Ga0163162_100119162 | 263 |
| 375 | 3300013306 | Ga0163162_10137660 | Ga0163162_101376602 | 263 |
| 376 | 3300013307 | Ga0157372_10001472 | Ga0157372_1000147214 | 263 |
| 377 | 3300013307 | Ga0157372_10001995 | Ga0157372_100019957 | 263 |
| 378 | 3300013307 | Ga0157372_10002166 | Ga0157372_1000216617 | 263 |
| 379 | 3300013307 | Ga0157372_10014707 | Ga0157372_100147076 | 263 |
| 380 | 3300013307 | Ga0157372_10016205 | Ga0157372_100162053 | 263 |
| 381 | 3300013307 | Ga0157372_10022908 | Ga0157372_100229084 | 263 |
| 382 | 3300013307 | Ga0157372_10105039 | Ga0157372_101050393 | 263 |
| 383 | 3300013307 | Ga0157372_10118467 | Ga0157372_101184672 | 263 |
| 384 | 3300013308 | Ga0157375_10177951 | Ga0157375_101779512 | 263 |
| 385 | 3300014325 | Ga0163163_10007470 | Ga0163163_100074708 | 263 |
| 386 | 3300014325 | Ga0163163_10030293 | Ga0163163_100302935 | 263 |
| 387 | 3300014497 | Ga0182008_10103465 | Ga0182008_101034651 | 263 |
| 388 | 3300014745 | Ga0157377_10001902 | Ga0157377_100019028 | 263 |
| 389 | 3300014745 | Ga0157377_10121451 | Ga0157377_101214511 | 263 |
| 390 | 3300014968 | Ga0157379_10006003 | Ga0157379_100060033 | 263 |
| 391 | 3300014968 | Ga0157379_10030951 | Ga0157379_100309512 | 263 |
| 392 | 3300014969 | Ga0157376_10006922 | Ga0157376_100069226 | 263 |
| 393 | 3300014969 | Ga0157376_10112787 | Ga0157376_101127873 | 263 |
| 394 | 3300014969 | Ga0157376_10364971 | Ga0157376_103649711 | 263 |
| 395 | 3300017792 | Ga0163161_10001086 | Ga0163161_100010865 | 263 |
| 396 | 3300021377 | Ga0213874_10065778 | Ga0213874_100657782 | 263 |
| 397 | 3300022730 | Ga0224570_100055 | Ga0224570_1000552 | 263 |
| 398 | 3300024225 | Ga0224572_1000977 | Ga0224572_10009774 | 263 |
| 399 | 3300024225 | Ga0224572_1002033 | Ga0224572_10020331 | 263 |
| 400 | 3300024225 | Ga0224572_1010090 | Ga0224572_10100902 | 263 |
| 401 | 3300024227 | Ga0228598_1000089 | Ga0228598_10000896 | 263 |
| 402 | 3300024227 | Ga0228598_1008520 | Ga0228598_10085202 | 263 |
| 403 | 3300024227 | Ga0228598_1008675 | Ga0228598_10086752 | 263 |
| 404 | 3300025321 | Ga0207656_10025805 | Ga0207656_100258052 | 263 |
| 405 | 3300025893 | Ga0207682_10045188 | Ga0207682_100451882 | 263 |
| 406 | 3300025898 | Ga0207692_10000836 | Ga0207692_100008366 | 263 |
| 407 | 3300025898 | Ga0207692_10004455 | Ga0207692_100044554 | 263 |
| 408 | 3300025898 | Ga0207692_10011811 | Ga0207692_100118113 | 263 |
| 409 | 3300025898 | Ga0207692_10241471 | Ga0207692_102414712 | 263 |
| 410 | 3300025901 | Ga0207688_10002577 | Ga0207688_100025777 | 263 |
| 411 | 3300025903 | Ga0207680_10041332 | Ga0207680_100413322 | 263 |
| 412 | 3300025904 | Ga0207647_10019921 | Ga0207647_100199214 | 263 |
| 413 | 3300025904 | Ga0207647_10076277 | Ga0207647_100762772 | 263 |
| 414 | 3300025905 | Ga0207685_10006742 | Ga0207685_100067423 | 263 |
| 415 | 3300025905 | Ga0207685_10049821 | Ga0207685_100498211 | 263 |
| 416 | 3300025905 | Ga0207685_10065744 | Ga0207685_100657442 | 263 |
| 417 | 3300025906 | Ga0207699_10005574 | Ga0207699_100055747 | 263 |
| 418 | 3300025906 | Ga0207699_10015443 | Ga0207699_100154432 | 263 |
| 419 | 3300025906 | Ga0207699_10042891 | Ga0207699_100428913 | 263 |
| 420 | 3300025906 | Ga0207699_10154867 | Ga0207699_101548672 | 263 |
| 421 | 3300025906 | Ga0207699_10369721 | Ga0207699_103697211 | 263 |
| 422 | 3300025906 | Ga0207699_10389705 | Ga0207699_103897051 | 263 |
| 423 | 3300025907 | Ga0207645_10000273 | Ga0207645_1000027319 | 263 |
| 424 | 3300025907 | Ga0207645_10020001 | Ga0207645_100200014 | 263 |
| 425 | 3300025908 | Ga0207643_10039543 | Ga0207643_100395432 | 263 |
| 426 | 3300025909 | Ga0207705_10255548 | Ga0207705_102555482 | 263 |
| 427 | 3300025910 | Ga0207684_10010433 | Ga0207684_100104334 | 263 |
| 428 | 3300025910 | Ga0207684_10262908 | Ga0207684_102629082 | 263 |
| 429 | 3300025911 | Ga0207654_10002620 | Ga0207654_100026206 | 263 |
| 430 | 3300025911 | Ga0207654_10038356 | Ga0207654_100383561 | 263 |
| 431 | 3300025911 | Ga0207654_10169580 | Ga0207654_101695801 | 263 |
| 432 | 3300025912 | Ga0207707_10000496 | Ga0207707_1000049631 | 263 |
| 433 | 3300025912 | Ga0207707_10013650 | Ga0207707_100136505 | 263 |
| 434 | 3300025912 | Ga0207707_10017593 | Ga0207707_100175934 | 263 |
| 435 | 3300025913 | Ga0207695_10021896 | Ga0207695_100218962 | 263 |
| 436 | 3300025913 | Ga0207695_10026035 | Ga0207695_100260352 | 263 |
| 437 | 3300025913 | Ga0207695_10110079 | Ga0207695_101100792 | 263 |
| 438 | 3300025914 | Ga0207671_10140271 | Ga0207671_101402712 | 263 |
| 439 | 3300025914 | Ga0207671_10330708 | Ga0207671_103307082 | 263 |
| 440 | 3300025915 | Ga0207693_10000004 | Ga0207693_100000046 | 263 |
| 441 | 3300025915 | Ga0207693_10000029 | Ga0207693_1000002976 | 263 |
| 442 | 3300025915 | Ga0207693_10000985 | Ga0207693_100009857 | 263 |
| 443 | 3300025915 | Ga0207693_10005725 | Ga0207693_100057252 | 263 |
| 444 | 3300025915 | Ga0207693_10010392 | Ga0207693_100103925 | 263 |
| 445 | 3300025915 | Ga0207693_10015396 | Ga0207693_100153964 | 263 |
| 446 | 3300025915 | Ga0207693_10086647 | Ga0207693_100866472 | 263 |
| 447 | 3300025915 | Ga0207693_10338491 | Ga0207693_103384912 | 263 |
| 448 | 3300025916 | Ga0207663_10006013 | Ga0207663_100060135 | 263 |
| 449 | 3300025916 | Ga0207663_10014560 | Ga0207663_100145604 | 263 |
| 450 | 3300025916 | Ga0207663_10030476 | Ga0207663_100304762 | 263 |
| 451 | 3300025916 | Ga0207663_10063236 | Ga0207663_100632362 | 263 |
| 452 | 3300025916 | Ga0207663_10226343 | Ga0207663_102263431 | 263 |
| 453 | 3300025917 | Ga0207660_10034630 | Ga0207660_100346302 | 263 |
| 454 | 3300025918 | Ga0207662_10011575 | Ga0207662_100115753 | 263 |
| 455 | 3300025919 | Ga0207657_10006409 | Ga0207657_1000640911 | 263 |
| 456 | 3300025919 | Ga0207657_10021886 | Ga0207657_100218862 | 263 |
| 457 | 3300025920 | Ga0207649_10004928 | Ga0207649_100049283 | 263 |
| 458 | 3300025921 | Ga0207652_10128419 | Ga0207652_101284191 | 263 |
| 459 | 3300025921 | Ga0207652_10228957 | Ga0207652_102289572 | 263 |
| 460 | 3300025921 | Ga0207652_10666291 | Ga0207652_106662911 | 263 |
| 461 | 3300025922 | Ga0207646_10025076 | Ga0207646_100250765 | 263 |
| 462 | 3300025922 | Ga0207646_10031161 | Ga0207646_100311614 | 263 |
| 463 | 3300025922 | Ga0207646_10035668 | Ga0207646_100356682 | 263 |
| 464 | 3300025922 | Ga0207646_10590910 | Ga0207646_105909101 | 263 |
| 465 | 3300025923 | Ga0207681_10066824 | Ga0207681_100668242 | 263 |
| 466 | 3300025924 | Ga0207694_10002382 | Ga0207694_100023826 | 263 |
| 467 | 3300025925 | Ga0207650_10000036 | Ga0207650_1000003660 | 263 |
| 468 | 3300025927 | Ga0207687_10029492 | Ga0207687_100294922 | 263 |
| 469 | 3300025928 | Ga0207700_10000173 | Ga0207700_1000017321 | 263 |
| 470 | 3300025928 | Ga0207700_10000428 | Ga0207700_1000042812 | 263 |
| 471 | 3300025928 | Ga0207700_10009584 | Ga0207700_100095844 | 263 |
| 472 | 3300025928 | Ga0207700_10023665 | Ga0207700_100236656 | 263 |
| 473 | 3300025928 | Ga0207700_10056627 | Ga0207700_100566272 | 263 |
| 474 | 3300025928 | Ga0207700_10099463 | Ga0207700_100994632 | 263 |
| 475 | 3300025928 | Ga0207700_10126471 | Ga0207700_101264712 | 263 |
| 476 | 3300025928 | Ga0207700_10151898 | Ga0207700_101518982 | 263 |
| 477 | 3300025928 | Ga0207700_10290386 | Ga0207700_102903862 | 263 |
| 478 | 3300025929 | Ga0207664_10000017 | Ga0207664_10000017206 | 263 |
| 479 | 3300025929 | Ga0207664_10079865 | Ga0207664_100798652 | 263 |
| 480 | 3300025929 | Ga0207664_10183739 | Ga0207664_101837391 | 263 |
| 481 | 3300025929 | Ga0207664_10244383 | Ga0207664_102443832 | 263 |
| 482 | 3300025931 | Ga0207644_10050621 | Ga0207644_100506212 | 263 |
| 483 | 3300025933 | Ga0207706_10000165 | Ga0207706_1000016545 | 263 |
| 484 | 3300025933 | Ga0207706_10000697 | Ga0207706_1000069712 | 263 |
| 485 | 3300025934 | Ga0207686_10075110 | Ga0207686_100751102 | 263 |
| 486 | 3300025936 | Ga0207670_10017570 | Ga0207670_100175703 | 263 |
| 487 | 3300025938 | Ga0207704_10320897 | Ga0207704_103208972 | 263 |
| 488 | 3300025939 | Ga0207665_10000574 | Ga0207665_100005743 | 263 |
| 489 | 3300025939 | Ga0207665_10006271 | Ga0207665_100062713 | 263 |
| 490 | 3300025939 | Ga0207665_10024235 | Ga0207665_100242352 | 263 |
| 491 | 3300025939 | Ga0207665_10069262 | Ga0207665_100692623 | 263 |
| 492 | 3300025939 | Ga0207665_10123730 | Ga0207665_101237303 | 263 |
| 493 | 3300025940 | Ga0207691_10012852 | Ga0207691_100128525 | 263 |
| 494 | 3300025941 | Ga0207711_10056108 | Ga0207711_100561083 | 263 |
| 495 | 3300025941 | Ga0207711_10063010 | Ga0207711_100630102 | 263 |
| 496 | 3300025942 | Ga0207689_10011276 | Ga0207689_100112762 | 263 |
| 497 | 3300025942 | Ga0207689_10038232 | Ga0207689_100382324 | 263 |
| 498 | 3300025942 | Ga0207689_10058924 | Ga0207689_100589243 | 263 |
| 499 | 3300025944 | Ga0207661_10000527 | Ga0207661_100005273 | 263 |
| 500 | 3300025944 | Ga0207661_10084577 | Ga0207661_100845771 | 263 |
| 501 | 3300025944 | Ga0207661_10136623 | Ga0207661_101366231 | 263 |
| 502 | 3300025944 | Ga0207661_10255053 | Ga0207661_102550532 | 263 |
| 503 | 3300025945 | Ga0207679_10000234 | Ga0207679_1000023437 | 263 |
| 504 | 3300025949 | Ga0207667_10000996 | Ga0207667_1000099613 | 263 |
| 505 | 3300025949 | Ga0207667_10009402 | Ga0207667_100094022 | 263 |
| 506 | 3300025949 | Ga0207667_10042095 | Ga0207667_100420954 | 263 |
| 507 | 3300025949 | Ga0207667_10046556 | Ga0207667_100465562 | 263 |
| 508 | 3300025949 | Ga0207667_10175955 | Ga0207667_101759551 | 263 |
| 509 | 3300025960 | Ga0207651_10104937 | Ga0207651_101049372 | 263 |
| 510 | 3300025961 | Ga0207712_10166043 | Ga0207712_101660432 | 263 |
| 511 | 3300025972 | Ga0207668_10041204 | Ga0207668_100412042 | 263 |
| 512 | 3300025981 | Ga0207640_10002918 | Ga0207640_100029184 | 263 |
| 513 | 3300025981 | Ga0207640_10043256 | Ga0207640_100432561 | 263 |
| 514 | 3300025981 | Ga0207640_10146219 | Ga0207640_101462192 | 263 |
| 515 | 3300025981 | Ga0207640_10389088 | Ga0207640_103890881 | 263 |
| 516 | 3300025986 | Ga0207658_10101197 | Ga0207658_101011972 | 263 |
| 517 | 3300026023 | Ga0207677_10004359 | Ga0207677_100043592 | 263 |
| 518 | 3300026023 | Ga0207677_10007078 | Ga0207677_100070785 | 263 |
| 519 | 3300026023 | Ga0207677_10047949 | Ga0207677_100479492 | 263 |
| 520 | 3300026023 | Ga0207677_10048703 | Ga0207677_100487032 | 263 |
| 521 | 3300026035 | Ga0207703_10011133 | Ga0207703_100111333 | 263 |
| 522 | 3300026035 | Ga0207703_10027168 | Ga0207703_100271682 | 263 |
| 523 | 3300026041 | Ga0207639_10004383 | Ga0207639_100043832 | 263 |
| 524 | 3300026041 | Ga0207639_10018888 | Ga0207639_100188883 | 263 |
| 525 | 3300026041 | Ga0207639_10136695 | Ga0207639_101366952 | 263 |
| 526 | 3300026067 | Ga0207678_10000543 | Ga0207678_100005439 | 263 |
| 527 | 3300026067 | Ga0207678_10002291 | Ga0207678_100022912 | 263 |
| 528 | 3300026078 | Ga0207702_10000917 | Ga0207702_1000091714 | 263 |
| 529 | 3300026078 | Ga0207702_10001294 | Ga0207702_1000129416 | 263 |
| 530 | 3300026078 | Ga0207702_10001832 | Ga0207702_1000183211 | 263 |
| 531 | 3300026078 | Ga0207702_10030455 | Ga0207702_100304552 | 263 |
| 532 | 3300026078 | Ga0207702_10036473 | Ga0207702_100364733 | 263 |
| 533 | 3300026078 | Ga0207702_10510745 | Ga0207702_105107452 | 263 |
| 534 | 3300026088 | Ga0207641_10000009 | Ga0207641_1000000946 | 263 |
| 535 | 3300026088 | Ga0207641_10007711 | Ga0207641_100077112 | 263 |
| 536 | 3300026088 | Ga0207641_10433896 | Ga0207641_104338962 | 263 |
| 537 | 3300026089 | Ga0207648_10001467 | Ga0207648_100014674 | 263 |
| 538 | 3300026089 | Ga0207648_10078452 | Ga0207648_100784523 | 263 |
| 539 | 3300026095 | Ga0207676_10000092 | Ga0207676_1000009222 | 263 |
| 540 | 3300026095 | Ga0207676_10151563 | Ga0207676_101515633 | 263 |
| 541 | 3300026116 | Ga0207674_10000016 | Ga0207674_10000016112 | 263 |
| 542 | 3300026116 | Ga0207674_10001595 | Ga0207674_1000159511 | 263 |
| 543 | 3300026118 | Ga0207675_100510758 | Ga0207675_1005107582 | 263 |
| 544 | 3300026121 | Ga0207683_10000359 | Ga0207683_1000035919 | 263 |
| 545 | 3300026142 | Ga0207698_10011854 | Ga0207698_100118543 | 263 |
| 546 | 3300026142 | Ga0207698_10155380 | Ga0207698_101553802 | 263 |
| 547 | 3300026142 | Ga0207698_10296572 | Ga0207698_102965721 | 263 |
| 548 | 3300028017 | Ga0265356_1000162 | Ga0265356_10001625 | 263 |
| 549 | 3300028036 | Ga0265355_1004774 | Ga0265355_10047741 | 263 |
| 550 | 3300028379 | Ga0268266_10018145 | Ga0268266_100181452 | 263 |
| 551 | 3300028380 | Ga0268265_10032921 | Ga0268265_100329213 | 263 |
| 552 | 3300028381 | Ga0268264_10055629 | Ga0268264_100556292 | 263 |
| 553 | 3300028381 | Ga0268264_10284363 | Ga0268264_102843632 | 263 |
| 554 | 3300028381 | Ga0268264_10327992 | Ga0268264_103279921 | 263 |
| 555 | 3300028381 | Ga0268264_10749307 | Ga0268264_107493071 | 263 |
| 556 | 3300028800 | Ga0265338_10028115 | Ga0265338_100281154 | 263 |
| 557 | 3300028800 | Ga0265338_10034925 | Ga0265338_100349252 | 263 |
| 558 | 3300028800 | Ga0265338_10041360 | Ga0265338_100413603 | 263 |
| 559 | 3300028800 | Ga0265338_10174800 | Ga0265338_101748002 | 263 |
| 560 | 3300030760 | Ga0265762_1001567 | Ga0265762_10015672 | 263 |
| 561 | 3300030760 | Ga0265762_1002908 | Ga0265762_10029082 | 263 |
| 562 | 3300030760 | Ga0265762_1005112 | Ga0265762_10051122 | 263 |
| 563 | 3300031090 | Ga0265760_10002726 | Ga0265760_100027263 | 263 |
| 564 | 3300031090 | Ga0265760_10003481 | Ga0265760_100034812 | 263 |
| 565 | 3300031090 | Ga0265760_10004804 | Ga0265760_100048042 | 263 |
| 566 | 3300031090 | Ga0265760_10010933 | Ga0265760_100109332 | 263 |
| 567 | 3300031090 | Ga0265760_10030200 | Ga0265760_100302001 | 263 |
| 568 | 3300031241 | Ga0265325_10032379 | Ga0265325_100323792 | 263 |
| 569 | 3300031247 | Ga0265340_10067538 | Ga0265340_100675382 | 263 |
| 570 | 3300031249 | Ga0265339_10033204 | Ga0265339_100332042 | 263 |
| 571 | 3300031249 | Ga0265339_10091731 | Ga0265339_100917311 | 263 |
| 572 | 3300031249 | Ga0265339_10110786 | Ga0265339_101107862 | 263 |
| 573 | 3300031344 | Ga0265316_10022666 | Ga0265316_100226662 | 263 |
| 574 | 3300031711 | Ga0265314_10195327 | Ga0265314_101953272 | 263 |
| 575 | 3300033545 | Ga0316214_1003861 | Ga0316214_10038612 | 263 |
| 576 | 3300035083 | Ga0373926_0021249 | Ga0373926_0021249_617_1408 | 263 |
| 577 | 3300035086 | Ga0373934_0009342 | Ga0373934_0009342_2780_3571 | 263 |
| 578 | 3300035089 | Ga0373944_0012417 | Ga0373944_0012417_1236_2027 | 263 |
| 579 | 3300035111 | Ga0373923_0084605 | Ga0373923_0084605_224_1015 | 263 |
| 580 | 3300035113 | Ga0373936_0007163 | Ga0373936_0007163_1048_1839 | 263 |
| 581 | 3300035113 | Ga0373936_0024521 | Ga0373936_0024521_1048_1839 | 263 |
| 582 | 3300035113 | Ga0373936_0104169 | Ga0373936_0104169_360_1151 | 263 |
| 583 | 3300035114 | Ga0373939_0132934 | Ga0373939_0132934_48_839 | 263 |
| 584 | 3300035116 | Ga0373945_0010902 | Ga0373945_0010902_160_951 | 263 |
| 585 | 3300035116 | Ga0373945_0016207 | Ga0373945_0016207_1437_2228 | 263 |
| 586 | 3300035116 | Ga0373945_0147216 | Ga0373945_0147216_15_806 | 263 |
| 587 | 3300035170 | Ga0373943_0000062 | Ga0373943_0000062_8552_9343 | 263 |
| 588 | 3300035170 | Ga0373943_0005454 | Ga0373943_0005454_518_1309 | 263 |
| 589 | 3300035170 | Ga0373943_0017035 | Ga0373943_0017035_2503_3294 | 263 |
| 590 | 3300035171 | Ga0373946_0030210 | Ga0373946_0030210_177_968 | 263 |
| 591 | 3300035172 | Ga0373955_0111267 | Ga0373955_0111267_253_1044 | 263 |
| 592 | 3300035207 | Ga0373942_0027177 | Ga0373942_0027177_628_1419 | 263 |
| 593 | 3300035241 | Ga0373961_0085071 | Ga0373961_0085071_196_987 | 263 |
| 594 | 3300035691 | Ga0373931_0042741 | Ga0373931_0042741_517_1308 | 263 |
| 595 | 3300035691 | Ga0373931_0093921 | Ga0373931_0093921_798_1589 | 263 |
| 596 | 3300035691 | Ga0373931_0123830 | Ga0373931_0123830_254_1045 | 263 |
| 597 | 3300035691 | Ga0373931_0261774 | Ga0373931_0261774_57_848 | 263 |
| 598 | 3300035692 | Ga0373935_0007678 | Ga0373935_0007678_210_1001 | 263 |
| 599 | 3300035692 | Ga0373935_0380071 | Ga0373935_0380071_69_860 | 263 |
| 600 | 3300035695 | Ga0373927_0000697 | Ga0373927_0000697_23470_24261 | 263 |
| 601 | 3300035695 | Ga0373927_0022735 | Ga0373927_0022735_488_1279 | 263 |
| 602 | 3300035695 | Ga0373927_0040029 | Ga0373927_0040029_956_1747 | 263 |
| 603 | 3300035695 | Ga0373927_0044797 | Ga0373927_0044797_298_1089 | 263 |
| 604 | 3300035724 | Ga0373933_0025322 | Ga0373933_0025322_2486_3277 | 263 |
| 605 | 3300035724 | Ga0373933_0140287 | Ga0373933_0140287_662_1453 | 263 |
| 606 | 3300035725 | Ga0373947_0001762 | Ga0373947_0001762_11227_12018 | 263 |
| 607 | 3300035725 | Ga0373947_0007266 | Ga0373947_0007266_4380_5171 | 263 |
| 608 | 3300035725 | Ga0373947_0174587 | Ga0373947_0174587_453_1244 | 263 |
| 609 | 3300035725 | Ga0373947_0276709 | Ga0373947_0276709_115_906 | 263 |
| 610 | 3300036401 | Ga0373937_0031985 | Ga0373937_0031985_1889_2680 | 263 |
| 611 | 3300036401 | Ga0373937_0247429 | Ga0373937_0247429_764_1555 | 263 |
| 612 | 3300037068 | Ga0373925_0001775 | Ga0373925_0001775_3286_4077 | 263 |
| 613 | 3300037068 | Ga0373925_0002053 | Ga0373925_0002053_9463_10254 | 263 |
| 614 | 3300037068 | Ga0373925_0013350 | Ga0373925_0013350_4364_5155 | 263 |
| 615 | 3300037068 | Ga0373925_0163702 | Ga0373925_0163702_751_1542 | 263 |
| 616 | 3300037068 | Ga0373925_0243473 | Ga0373925_0243473_447_1238 | 263 |
| 617 | 3300037068 | Ga0373925_0579914 | Ga0373925_0579914_17_808 | 263 |
| 618 | 3300037853 | Ga0436364_0461878 | Ga0436364_0461878_70_861 | 263 |
| 619 | 3300039450 | Ga0436363_0584167 | Ga0436363_0584167_1018_1809 | 263 |
| 620 | 3300039450 | Ga0436363_0673976 | Ga0436363_0673976_440_1231 | 263 |
| 621 | 3300039450 | Ga0436363_1024259 | Ga0436363_1024259_86_877 | 263 |
| 622 | 3300039453 | Ga0436362_0434675 | Ga0436362_0434675_151_942 | 263 |
| 623 | 3300045051 | Ga0451576_0819938 | Ga0451576_0819938_142_933 | 263 |
| 624 | 3300045976 | Ga0466967_0265648 | Ga0466967_0265648_585_1376 | 263 |
| 625 | 3300046462 | Ga0495651_0140485 | Ga0495651_0140485_106_897 | 263 |
| 626 | 3300046472 | Ga0495580_0000204 | Ga0495580_0000204_39184_39975 | 263 |
| 627 | 3300046472 | Ga0495580_0000349 | Ga0495580_0000349_7089_7880 | 263 |
| 628 | 3300046472 | Ga0495580_0001787 | Ga0495580_0001787_7844_8635 | 263 |
| 629 | 3300046472 | Ga0495580_0008710 | Ga0495580_0008710_1095_1886 | 263 |
| 630 | 3300046472 | Ga0495580_0010802 | Ga0495580_0010802_5701_6492 | 263 |
| 631 | 3300046472 | Ga0495580_0014895 | Ga0495580_0014895_3945_4736 | 263 |
| 632 | 3300046472 | Ga0495580_0032412 | Ga0495580_0032412_1128_1919 | 263 |
| 633 | 3300046472 | Ga0495580_0044577 | Ga0495580_0044577_780_1571 | 263 |
| 634 | 3300046472 | Ga0495580_0047967 | Ga0495580_0047967_1356_2147 | 263 |
| 635 | 3300046472 | Ga0495580_0056017 | Ga0495580_0056017_1296_2087 | 263 |
| 636 | 3300046472 | Ga0495580_0143534 | Ga0495580_0143534_62_853 | 263 |
| 637 | 3300046472 | Ga0495580_0241953 | Ga0495580_0241953_413_1204 | 263 |
| 638 | 3300046473 | Ga0495582_0008953 | Ga0495582_0008953_1625_2416 | 263 |
| 639 | 3300046475 | Ga0495639_0038918 | Ga0495639_0038918_1031_1822 | 263 |
| 640 | 3300046477 | Ga0495664_0010671 | Ga0495664_0010671_1606_2397 | 263 |
| 641 | 3300046516 | Ga0495628_0078360 | Ga0495628_0078360_736_1527 | 263 |
| 642 | 3300046517 | Ga0495630_0080010 | Ga0495630_0080010_1305_2096 | 263 |
| 643 | 3300046517 | Ga0495630_0616610 | Ga0495630_0616610_30_821 | 263 |
| 644 | 3300046531 | Ga0495665_0053485 | Ga0495665_0053485_1113_1904 | 263 |
| 645 | 3300046531 | Ga0495665_0057929 | Ga0495665_0057929_683_1474 | 263 |
| 646 | 3300046536 | Ga0495587_0113660 | Ga0495587_0113660_228_1019 | 263 |
| 647 | 3300046543 | Ga0495645_0096399 | Ga0495645_0096399_177_968 | 263 |
| 648 | 3300046678 | Ga0495599_0100695 | Ga0495599_0100695_360_1151 | 263 |
| 649 | 3300046683 | Ga0495658_0353374 | Ga0495658_0353374_117_908 | 263 |
| 650 | 3300046690 | Ga0495624_0069750 | Ga0495624_0069750_1246_2037 | 263 |
| 651 | 3300046690 | Ga0495624_0236825 | Ga0495624_0236825_113_904 | 263 |
| 652 | 3300047317 | Ga0495604_0094719 | Ga0495604_0094719_137_928 | 263 |
| 653 | 3300047319 | Ga0495674_0019591 | Ga0495674_0019591_492_1283 | 263 |
| 654 | 3300047319 | Ga0495674_0045930 | Ga0495674_0045930_1437_2228 | 263 |
| 655 | 3300047319 | Ga0495674_0154358 | Ga0495674_0154358_67_858 | 263 |
| 656 | 3300047319 | Ga0495674_0270575 | Ga0495674_0270575_58_849 | 263 |
| 657 | 3300047321 | Ga0495676_0164089 | Ga0495676_0164089_585_1376 | 263 |
| 658 | 3300047471 | Ga0495684_0112258 | Ga0495684_0112258_556_1347 | 263 |
| 659 | 3300048088 | Ga0495602_0025434 | Ga0495602_0025434_1213_2004 | 263 |
| 660 | 3300048088 | Ga0495602_0049501 | Ga0495602_0049501_827_1618 | 263 |
| 661 | 3300048089 | Ga0495614_0133357 | Ga0495614_0133357_177_968 | 263 |
| 662 | 3300048905 | Ga0496102_0005655 | Ga0496102_0005655_8013_8804 | 263 |
| 663 | 3300048906 | Ga0496103_0000974 | Ga0496103_0000974_18712_19503 | 263 |
| 664 | 3300048907 | Ga0496104_0116658 | Ga0496104_0116658_783_1574 | 263 |
| 665 | 3300048907 | Ga0496104_0152054 | Ga0496104_0152054_1047_1838 | 263 |
| 666 | 3300048910 | Ga0496107_0033203 | Ga0496107_0033203_855_1646 | 263 |
| 667 | 3300048911 | Ga0496108_0000477 | Ga0496108_0000477_18327_19118 | 263 |
| 668 | 3300048911 | Ga0496108_0382796 | Ga0496108_0382796_377_1168 | 263 |
| 669 | 3300048912 | Ga0496109_0000020 | Ga0496109_0000020_179589_180380 | 263 |
| 670 | 3300048912 | Ga0496109_0729969 | Ga0496109_0729969_44_835 | 263 |
| 671 | 3300048913 | Ga0496110_0004805 | Ga0496110_0004805_5047_5838 | 263 |
| 672 | 3300048914 | Ga0496111_0444141 | Ga0496111_0444141_56_847 | 263 |
| 673 | 3300048915 | Ga0496112_0000402 | Ga0496112_0000402_24020_24811 | 263 |
| 674 | 3300048915 | Ga0496112_0002357 | Ga0496112_0002357_5145_5936 | 263 |
| 675 | 3300048915 | Ga0496112_0195828 | Ga0496112_0195828_1105_1896 | 263 |
| 676 | 3300048915 | Ga0496112_0295265 | Ga0496112_0295265_25_816 | 263 |
| 677 | 3300048915 | Ga0496112_0444787 | Ga0496112_0444787_316_1107 | 263 |
| 678 | 3300048915 | Ga0496112_0504415 | Ga0496112_0504415_328_1119 | 263 |
| 679 | 3300048916 | Ga0496113_0031949 | Ga0496113_0031949_2973_3764 | 263 |
| 680 | 3300048916 | Ga0496113_0471256 | Ga0496113_0471256_173_964 | 263 |
| 681 | 3300048918 | Ga0496115_0461849 | Ga0496115_0461849_108_899 | 263 |
| 682 | 3300050514 | nmdc:mga08x19_2121_c1 | nmdc:mga08x19_2121_c1_5940_6746 | 263 |
| 683 | 3300050514 | nmdc:mga08x19_2456_c1 | nmdc:mga08x19_2456_c1_8317_9108 | 263 |
| 684 | 3300050514 | nmdc:mga08x19_66516_c1 | nmdc:mga08x19_66516_c1_577_1368 | 263 |
| 685 | 3300053078 | Ga0495612_0193600 | Ga0495612_0193600_84_875 | 263 |
| 686 | 3300005435 | Ga0070714_100074082 | Ga0070714_1000740822 | 264 |
| 687 | 3300005436 | Ga0070713_100271111 | Ga0070713_1002711112 | 264 |
| 688 | 3300005439 | Ga0070711_100210306 | Ga0070711_1002103062 | 264 |
| 689 | 3300005445 | Ga0070708_100001252 | Ga0070708_10000125212 | 264 |
| 690 | 3300005445 | Ga0070708_100009817 | Ga0070708_1000098173 | 264 |
| 691 | 3300005467 | Ga0070706_100004861 | Ga0070706_1000048614 | 264 |
| 692 | 3300005467 | Ga0070706_100009047 | Ga0070706_1000090474 | 264 |
| 693 | 3300005468 | Ga0070707_100004944 | Ga0070707_1000049448 | 264 |
| 694 | 3300005468 | Ga0070707_100005109 | Ga0070707_1000051095 | 264 |
| 695 | 3300005471 | Ga0070698_100003126 | Ga0070698_1000031268 | 264 |
| 696 | 3300005518 | Ga0070699_100001451 | Ga0070699_1000014516 | 264 |
| 697 | 3300005536 | Ga0070697_100000656 | Ga0070697_10000065617 | 264 |
| 698 | 3300005536 | Ga0070697_100243012 | Ga0070697_1002430122 | 264 |
| 699 | 3300006914 | Ga0075436_100005023 | Ga0075436_1000050235 | 264 |
| 700 | 3300013306 | Ga0163162_10512783 | Ga0163162_105127832 | 264 |
| 701 | 3300013307 | Ga0157372_10262633 | Ga0157372_102626332 | 264 |
| 702 | 3300013307 | Ga0157372_10961393 | Ga0157372_109613931 | 264 |
| 703 | 3300014968 | Ga0157379_10184343 | Ga0157379_101843432 | 264 |
| 704 | 3300021377 | Ga0213874_10001758 | Ga0213874_100017582 | 264 |
| 705 | 3300021384 | Ga0213876_10153075 | Ga0213876_101530752 | 264 |
| 706 | 3300025910 | Ga0207684_10000677 | Ga0207684_100006778 | 264 |
| 707 | 3300025910 | Ga0207684_10098685 | Ga0207684_100986853 | 264 |
| 708 | 3300025916 | Ga0207663_10380112 | Ga0207663_103801121 | 264 |
| 709 | 3300025922 | Ga0207646_10003352 | Ga0207646_100033528 | 264 |
| 710 | 3300025922 | Ga0207646_10008896 | Ga0207646_100088965 | 264 |
| 711 | 3300025928 | Ga0207700_10253931 | Ga0207700_102539312 | 264 |
| 712 | 3300025929 | Ga0207664_10033597 | Ga0207664_100335973 | 264 |
| 713 | 3300026088 | Ga0207641_10028376 | Ga0207641_100283762 | 264 |
| 714 | 3300031090 | Ga0265760_10009647 | Ga0265760_100096473 | 264 |
| 715 | 3300039437 | Ga0436365_0674223 | Ga0436365_0674223_332_1126 | 264 |
| 716 | 3300039450 | Ga0436363_0575896 | Ga0436363_0575896_5620_6414 | 264 |
| 717 | 3300039453 | Ga0436362_0069449 | Ga0436362_0069449_402_1196 | 264 |
| 718 | 3300044684 | Ga0466966_0280084 | Ga0466966_0280084_194_988 | 264 |
| 719 | 3300045051 | Ga0451576_0081559 | Ga0451576_0081559_893_1687 | 264 |
| 720 | 3300047472 | Ga0495686_0002162 | Ga0495686_0002162_9760_10554 | 264 |
| 721 | 3300050512 | nmdc:mga0n895_233_c1 | nmdc:mga0n895_233_c1_34320_35114 | 264 |
| 722 | 3300050513 | nmdc:mga0rr50_133795_c1 | nmdc:mga0rr50_133795_c1_31_825 | 264 |
| 723 | 3300050514 | nmdc:mga08x19_5912_c1 | nmdc:mga08x19_5912_c1_1674_2468 | 264 |
| 724 | 3300004799 | Ga0058863_11948358 | Ga0058863_119483582 | 265 |
| 725 | 3300004800 | Ga0058861_12038421 | Ga0058861_120384211 | 265 |
| 726 | 3300005290 | Ga0065712_10168060 | Ga0065712_101680602 | 265 |
| 727 | 3300005336 | Ga0070680_100007843 | Ga0070680_1000078433 | 265 |
| 728 | 3300005338 | Ga0068868_100054428 | Ga0068868_1000544282 | 265 |
| 729 | 3300005339 | Ga0070660_100105033 | Ga0070660_1001050332 | 265 |
| 730 | 3300005345 | Ga0070692_10134893 | Ga0070692_101348931 | 265 |
| 731 | 3300005366 | Ga0070659_100365931 | Ga0070659_1003659312 | 265 |
| 732 | 3300005434 | Ga0070709_10121001 | Ga0070709_101210012 | 265 |
| 733 | 3300005435 | Ga0070714_100009371 | Ga0070714_1000093712 | 265 |
| 734 | 3300005435 | Ga0070714_100045952 | Ga0070714_1000459522 | 265 |
| 735 | 3300005435 | Ga0070714_100910826 | Ga0070714_1009108261 | 265 |
| 736 | 3300005436 | Ga0070713_100112837 | Ga0070713_1001128372 | 265 |
| 737 | 3300005436 | Ga0070713_100353140 | Ga0070713_1003531402 | 265 |
| 738 | 3300005436 | Ga0070713_100565869 | Ga0070713_1005658691 | 265 |
| 739 | 3300005439 | Ga0070711_100003458 | Ga0070711_1000034586 | 265 |
| 740 | 3300005439 | Ga0070711_100229975 | Ga0070711_1002299752 | 265 |
| 741 | 3300005439 | Ga0070711_100309430 | Ga0070711_1003094301 | 265 |
| 742 | 3300005458 | Ga0070681_10002085 | Ga0070681_1000208516 | 265 |
| 743 | 3300005458 | Ga0070681_10045960 | Ga0070681_100459602 | 265 |
| 744 | 3300005458 | Ga0070681_10052615 | Ga0070681_100526153 | 265 |
| 745 | 3300005458 | Ga0070681_10053927 | Ga0070681_100539273 | 265 |
| 746 | 3300005458 | Ga0070681_10404448 | Ga0070681_104044482 | 265 |
| 747 | 3300005458 | Ga0070681_10423409 | Ga0070681_104234091 | 265 |
| 748 | 3300005530 | Ga0070679_100004624 | Ga0070679_10000462410 | 265 |
| 749 | 3300005530 | Ga0070679_100010477 | Ga0070679_1000104772 | 265 |
| 750 | 3300005535 | Ga0070684_100016314 | Ga0070684_1000163144 | 265 |
| 751 | 3300005535 | Ga0070684_100230180 | Ga0070684_1002301801 | 265 |
| 752 | 3300005539 | Ga0068853_100082946 | Ga0068853_1000829463 | 265 |
| 753 | 3300005547 | Ga0070693_100020544 | Ga0070693_1000205442 | 265 |
| 754 | 3300005547 | Ga0070693_100068857 | Ga0070693_1000688572 | 265 |
| 755 | 3300005563 | Ga0068855_100145735 | Ga0068855_1001457352 | 265 |
| 756 | 3300005563 | Ga0068855_100153502 | Ga0068855_1001535022 | 265 |
| 757 | 3300005563 | Ga0068855_100327964 | Ga0068855_1003279642 | 265 |
| 758 | 3300005563 | Ga0068855_100356410 | Ga0068855_1003564102 | 265 |
| 759 | 3300005577 | Ga0068857_100000432 | Ga0068857_10000043214 | 265 |
| 760 | 3300005577 | Ga0068857_100030346 | Ga0068857_1000303463 | 265 |
| 761 | 3300005577 | Ga0068857_100084219 | Ga0068857_1000842193 | 265 |
| 762 | 3300005577 | Ga0068857_100151267 | Ga0068857_1001512672 | 265 |
| 763 | 3300005614 | Ga0068856_100000243 | Ga0068856_10000024337 | 265 |
| 764 | 3300005614 | Ga0068856_100163222 | Ga0068856_1001632222 | 265 |
| 765 | 3300005616 | Ga0068852_100078088 | Ga0068852_1000780882 | 265 |
| 766 | 3300005617 | Ga0068859_100408396 | Ga0068859_1004083962 | 265 |
| 767 | 3300005618 | Ga0068864_100016673 | Ga0068864_1000166733 | 265 |
| 768 | 3300005719 | Ga0068861_100113945 | Ga0068861_1001139452 | 265 |
| 769 | 3300005841 | Ga0068863_100036962 | Ga0068863_1000369623 | 265 |
| 770 | 3300006028 | Ga0070717_10049675 | Ga0070717_100496752 | 265 |
| 771 | 3300006028 | Ga0070717_10257901 | Ga0070717_102579012 | 265 |
| 772 | 3300006173 | Ga0070716_100443128 | Ga0070716_1004431281 | 265 |
| 773 | 3300006175 | Ga0070712_100015289 | Ga0070712_1000152893 | 265 |
| 774 | 3300006175 | Ga0070712_100204364 | Ga0070712_1002043641 | 265 |
| 775 | 3300006175 | Ga0070712_100298760 | Ga0070712_1002987602 | 265 |
| 776 | 3300006881 | Ga0068865_100434269 | Ga0068865_1004342691 | 265 |
| 777 | 3300006931 | Ga0097620_100408353 | Ga0097620_1004083532 | 265 |
| 778 | 3300009093 | Ga0105240_10068952 | Ga0105240_100689524 | 265 |
| 779 | 3300009093 | Ga0105240_10081807 | Ga0105240_100818072 | 265 |
| 780 | 3300009093 | Ga0105240_10499335 | Ga0105240_104993352 | 265 |
| 781 | 3300009098 | Ga0105245_10015594 | Ga0105245_100155943 | 265 |
| 782 | 3300009098 | Ga0105245_10067885 | Ga0105245_100678852 | 265 |
| 783 | 3300009101 | Ga0105247_10090735 | Ga0105247_100907351 | 265 |
| 784 | 3300009174 | Ga0105241_10202572 | Ga0105241_102025721 | 265 |
| 785 | 3300009177 | Ga0105248_10149281 | Ga0105248_101492811 | 265 |
| 786 | 3300009545 | Ga0105237_10375315 | Ga0105237_103753152 | 265 |
| 787 | 3300009551 | Ga0105238_10087928 | Ga0105238_100879283 | 265 |
| 788 | 3300009551 | Ga0105238_10437052 | Ga0105238_104370522 | 265 |
| 789 | 3300010375 | Ga0105239_10165289 | Ga0105239_101652892 | 265 |
| 790 | 3300013100 | Ga0157373_10026739 | Ga0157373_100267393 | 265 |
| 791 | 3300013102 | Ga0157371_10082681 | Ga0157371_100826812 | 265 |
| 792 | 3300013104 | Ga0157370_10086651 | Ga0157370_100866512 | 265 |
| 793 | 3300013105 | Ga0157369_10000786 | Ga0157369_1000078614 | 265 |
| 794 | 3300013105 | Ga0157369_10028869 | Ga0157369_100288694 | 265 |
| 795 | 3300013105 | Ga0157369_10180195 | Ga0157369_101801952 | 265 |
| 796 | 3300013296 | Ga0157374_10037641 | Ga0157374_100376412 | 265 |
| 797 | 3300013296 | Ga0157374_10146951 | Ga0157374_101469512 | 265 |
| 798 | 3300013297 | Ga0157378_10156963 | Ga0157378_101569632 | 265 |
| 799 | 3300013307 | Ga0157372_10034354 | Ga0157372_100343543 | 265 |
| 800 | 3300013307 | Ga0157372_10088229 | Ga0157372_100882292 | 265 |
| 801 | 3300014325 | Ga0163163_10032223 | Ga0163163_100322235 | 265 |
| 802 | 3300020080 | Ga0206350_11446456 | Ga0206350_114464561 | 265 |
| 803 | 3300021361 | Ga0213872_10003667 | Ga0213872_100036675 | 265 |
| 804 | 3300021361 | Ga0213872_10010363 | Ga0213872_100103635 | 265 |
| 805 | 3300025898 | Ga0207692_10135553 | Ga0207692_101355532 | 265 |
| 806 | 3300025898 | Ga0207692_10154770 | Ga0207692_101547702 | 265 |
| 807 | 3300025912 | Ga0207707_10001602 | Ga0207707_1000160217 | 265 |
| 808 | 3300025912 | Ga0207707_10013616 | Ga0207707_100136165 | 265 |
| 809 | 3300025912 | Ga0207707_10064435 | Ga0207707_100644352 | 265 |
| 810 | 3300025912 | Ga0207707_10070875 | Ga0207707_100708752 | 265 |
| 811 | 3300025912 | Ga0207707_10103774 | Ga0207707_101037742 | 265 |
| 812 | 3300025913 | Ga0207695_10021651 | Ga0207695_100216514 | 265 |
| 813 | 3300025913 | Ga0207695_10125998 | Ga0207695_101259982 | 265 |
| 814 | 3300025913 | Ga0207695_10190748 | Ga0207695_101907482 | 265 |
| 815 | 3300025915 | Ga0207693_10023355 | Ga0207693_100233553 | 265 |
| 816 | 3300025915 | Ga0207693_10028716 | Ga0207693_100287163 | 265 |
| 817 | 3300025915 | Ga0207693_10109362 | Ga0207693_101093622 | 265 |
| 818 | 3300025915 | Ga0207693_10228336 | Ga0207693_102283361 | 265 |
| 819 | 3300025916 | Ga0207663_10023177 | Ga0207663_100231773 | 265 |
| 820 | 3300025917 | Ga0207660_10001588 | Ga0207660_100015883 | 265 |
| 821 | 3300025917 | Ga0207660_10161004 | Ga0207660_101610042 | 265 |
| 822 | 3300025917 | Ga0207660_10204382 | Ga0207660_102043822 | 265 |
| 823 | 3300025919 | Ga0207657_10020387 | Ga0207657_100203874 | 265 |
| 824 | 3300025921 | Ga0207652_10045080 | Ga0207652_100450802 | 265 |
| 825 | 3300025921 | Ga0207652_10295294 | Ga0207652_102952942 | 265 |
| 826 | 3300025925 | Ga0207650_10003223 | Ga0207650_100032239 | 265 |
| 827 | 3300025927 | Ga0207687_10006171 | Ga0207687_100061714 | 265 |
| 828 | 3300025927 | Ga0207687_10247391 | Ga0207687_102473911 | 265 |
| 829 | 3300025928 | Ga0207700_10074471 | Ga0207700_100744712 | 265 |
| 830 | 3300025929 | Ga0207664_10003989 | Ga0207664_100039894 | 265 |
| 831 | 3300025929 | Ga0207664_10042383 | Ga0207664_100423832 | 265 |
| 832 | 3300025933 | Ga0207706_10634283 | Ga0207706_106342831 | 265 |
| 833 | 3300025934 | Ga0207686_10220321 | Ga0207686_102203211 | 265 |
| 834 | 3300025938 | Ga0207704_10023509 | Ga0207704_100235093 | 265 |
| 835 | 3300025939 | Ga0207665_10015745 | Ga0207665_100157453 | 265 |
| 836 | 3300025944 | Ga0207661_10132826 | Ga0207661_101328262 | 265 |
| 837 | 3300025949 | Ga0207667_10017575 | Ga0207667_100175754 | 265 |
| 838 | 3300025949 | Ga0207667_10052321 | Ga0207667_100523214 | 265 |
| 839 | 3300025949 | Ga0207667_10110734 | Ga0207667_101107343 | 265 |
| 840 | 3300025981 | Ga0207640_10352437 | Ga0207640_103524372 | 265 |
| 841 | 3300026041 | Ga0207639_10076063 | Ga0207639_100760632 | 265 |
| 842 | 3300026078 | Ga0207702_10055492 | Ga0207702_100554922 | 265 |
| 843 | 3300026078 | Ga0207702_10442719 | Ga0207702_104427192 | 265 |
| 844 | 3300026088 | Ga0207641_10220514 | Ga0207641_102205142 | 265 |
| 845 | 3300026095 | Ga0207676_10079240 | Ga0207676_100792402 | 265 |
| 846 | 3300026095 | Ga0207676_10146724 | Ga0207676_101467242 | 265 |
| 847 | 3300026116 | Ga0207674_10003232 | Ga0207674_1000323216 | 265 |
| 848 | 3300026116 | Ga0207674_10047700 | Ga0207674_100477003 | 265 |
| 849 | 3300026116 | Ga0207674_10176538 | Ga0207674_101765382 | 265 |
| 850 | 3300026118 | Ga0207675_100645625 | Ga0207675_1006456251 | 265 |
| 851 | 3300026142 | Ga0207698_10066818 | Ga0207698_100668182 | 265 |
| 852 | 3300026142 | Ga0207698_10392678 | Ga0207698_103926782 | 265 |
| 853 | 3300028573 | Ga0265334_10016857 | Ga0265334_100168572 | 265 |
| 854 | 3300028577 | Ga0265318_10003005 | Ga0265318_100030057 | 265 |
| 855 | 3300028800 | Ga0265338_10029543 | Ga0265338_100295434 | 265 |
| 856 | 3300031235 | Ga0265330_10000856 | Ga0265330_1000085616 | 265 |
| 857 | 3300031238 | Ga0265332_10047116 | Ga0265332_100471162 | 265 |
| 858 | 3300031239 | Ga0265328_10012831 | Ga0265328_100128312 | 265 |
| 859 | 3300031241 | Ga0265325_10000587 | Ga0265325_100005874 | 265 |
| 860 | 3300031242 | Ga0265329_10006567 | Ga0265329_100065674 | 265 |
| 861 | 3300031247 | Ga0265340_10010293 | Ga0265340_100102936 | 265 |
| 862 | 3300031249 | Ga0265339_10005863 | Ga0265339_100058633 | 265 |
| 863 | 3300031249 | Ga0265339_10063453 | Ga0265339_100634533 | 265 |
| 864 | 3300031344 | Ga0265316_10000922 | Ga0265316_100009224 | 265 |
| 865 | 3300031595 | Ga0265313_10014732 | Ga0265313_100147325 | 265 |
| 866 | 3300031595 | Ga0265313_10016258 | Ga0265313_100162583 | 265 |
| 867 | 3300031712 | Ga0265342_10000544 | Ga0265342_1000054427 | 265 |
| 868 | 3300035089 | Ga0373944_0055282 | Ga0373944_0055282_48_845 | 265 |
| 869 | 3300035111 | Ga0373923_0015084 | Ga0373923_0015084_409_1206 | 265 |
| 870 | 3300035116 | Ga0373945_0000605 | Ga0373945_0000605_7362_8159 | 265 |
| 871 | 3300035170 | Ga0373943_0025789 | Ga0373943_0025789_1709_2506 | 265 |
| 872 | 3300035171 | Ga0373946_0033005 | Ga0373946_0033005_1015_1812 | 265 |
| 873 | 3300035410 | Ga0373924_0000147 | Ga0373924_0000147_17113_17910 | 265 |
| 874 | 3300035692 | Ga0373935_0019568 | Ga0373935_0019568_3038_3835 | 265 |
| 875 | 3300035725 | Ga0373947_0044621 | Ga0373947_0044621_343_1140 | 265 |
| 876 | 3300036401 | Ga0373937_0000199 | Ga0373937_0000199_51684_52481 | 265 |
| 877 | 3300036401 | Ga0373937_0408538 | Ga0373937_0408538_142_945 | 265 |
| 878 | 3300036401 | Ga0373937_0473462 | Ga0373937_0473462_260_1057 | 265 |
| 879 | 3300037466 | Ga0395898_0028972 | Ga0395898_0028972_3331_4128 | 265 |
| 880 | 3300039438 | Ga0436360_0151269 | Ga0436360_0151269_3890_4687 | 265 |
| 881 | 3300039438 | Ga0436360_0232969 | Ga0436360_0232969_2739_3536 | 265 |
| 882 | 3300039447 | Ga0436361_0095620 | Ga0436361_0095620_275_1072 | 265 |
| 883 | 3300039447 | Ga0436361_0846651 | Ga0436361_0846651_114_947 | 265 |
| 884 | 3300039447 | Ga0436361_0962723 | Ga0436361_0962723_21598_22395 | 265 |
| 885 | 3300039447 | Ga0436361_1170545 | Ga0436361_1170545_167_964 | 265 |
| 886 | 3300042876 | Ga0451577_0000157 | Ga0451577_0000157_145585_146382 | 265 |
| 887 | 3300042876 | Ga0451577_0081279 | Ga0451577_0081279_1442_2272 | 265 |
| 888 | 3300044673 | Ga0453683_0075237 | Ga0453683_0075237_1278_2075 | 265 |
| 889 | 3300044694 | Ga0466963_0005107 | Ga0466963_0005107_2843_3670 | 265 |
| 890 | 3300044694 | Ga0466963_0123961 | Ga0466963_0123961_656_1453 | 265 |
| 891 | 3300044694 | Ga0466963_0301884 | Ga0466963_0301884_219_1016 | 265 |
| 892 | 3300044712 | Ga0453684_0000324 | Ga0453684_0000324_160664_161461 | 265 |
| 893 | 3300044712 | Ga0453684_1058121 | Ga0453684_1058121_27_824 | 265 |
| 894 | 3300045051 | Ga0451576_0041454 | Ga0451576_0041454_1913_2710 | 265 |
| 895 | 3300045051 | Ga0451576_0205633 | Ga0451576_0205633_304_1107 | 265 |
| 896 | 3300045976 | Ga0466967_0003579 | Ga0466967_0003579_6651_7448 | 265 |
| 897 | 3300045976 | Ga0466967_0082774 | Ga0466967_0082774_314_1111 | 265 |
| 898 | 3300045976 | Ga0466967_0199035 | Ga0466967_0199035_752_1579 | 265 |
| 899 | 3300045976 | Ga0466967_0222027 | Ga0466967_0222027_629_1426 | 265 |
| 900 | 3300046462 | Ga0495651_0009841 | Ga0495651_0009841_4817_5614 | 265 |
| 901 | 3300046472 | Ga0495580_0135683 | Ga0495580_0135683_719_1522 | 265 |
| 902 | 3300046473 | Ga0495582_0067127 | Ga0495582_0067127_815_1618 | 265 |
| 903 | 3300046477 | Ga0495664_0046400 | Ga0495664_0046400_1323_2126 | 265 |
| 904 | 3300046516 | Ga0495628_0082992 | Ga0495628_0082992_627_1424 | 265 |
| 905 | 3300046529 | Ga0495652_0335160 | Ga0495652_0335160_237_1034 | 265 |
| 906 | 3300046531 | Ga0495665_0011868 | Ga0495665_0011868_2910_3707 | 265 |
| 907 | 3300046531 | Ga0495665_0111789 | Ga0495665_0111789_489_1292 | 265 |
| 908 | 3300046535 | Ga0495586_0061255 | Ga0495586_0061255_815_1618 | 265 |
| 909 | 3300046536 | Ga0495587_0110202 | Ga0495587_0110202_486_1283 | 265 |
| 910 | 3300046559 | Ga0495667_0324634 | Ga0495667_0324634_11_811 | 265 |
| 911 | 3300046663 | Ga0495635_0204676 | Ga0495635_0204676_204_1001 | 265 |
| 912 | 3300046675 | Ga0495657_0307194 | Ga0495657_0307194_124_927 | 265 |
| 913 | 3300046679 | Ga0495623_0054381 | Ga0495623_0054381_905_1702 | 265 |
| 914 | 3300046684 | Ga0495669_0031535 | Ga0495669_0031535_524_1321 | 265 |
| 915 | 3300046684 | Ga0495669_0047925 | Ga0495669_0047925_238_1041 | 265 |
| 916 | 3300046684 | Ga0495669_0161947 | Ga0495669_0161947_63_866 | 265 |
| 917 | 3300047315 | Ga0495581_0013470 | Ga0495581_0013470_3759_4562 | 265 |
| 918 | 3300047315 | Ga0495581_0029574 | Ga0495581_0029574_1794_2591 | 265 |
| 919 | 3300047317 | Ga0495604_0036261 | Ga0495604_0036261_144_941 | 265 |
| 920 | 3300047444 | Ga0495675_0044359 | Ga0495675_0044359_1354_2157 | 265 |
| 921 | 3300047444 | Ga0495675_0119721 | Ga0495675_0119721_342_1139 | 265 |
| 922 | 3300047471 | Ga0495684_0114347 | Ga0495684_0114347_207_1010 | 265 |
| 923 | 3300047471 | Ga0495684_0215554 | Ga0495684_0215554_406_1209 | 265 |
| 924 | 3300047673 | Ga0495593_0096598 | Ga0495593_0096598_311_1108 | 265 |
| 925 | 3300048905 | Ga0496102_0357795 | Ga0496102_0357795_385_1182 | 265 |
| 926 | 3300048906 | Ga0496103_0009469 | Ga0496103_0009469_606_1403 | 265 |
| 927 | 3300048907 | Ga0496104_0013808 | Ga0496104_0013808_5501_6298 | 265 |
| 928 | 3300048907 | Ga0496104_0020277 | Ga0496104_0020277_2791_3588 | 265 |
| 929 | 3300048907 | Ga0496104_0316652 | Ga0496104_0316652_45_842 | 265 |
| 930 | 3300048907 | Ga0496104_0559479 | Ga0496104_0559479_106_903 | 265 |
| 931 | 3300048908 | Ga0496105_0103843 | Ga0496105_0103843_280_1077 | 265 |
| 932 | 3300048908 | Ga0496105_0359445 | Ga0496105_0359445_227_1024 | 265 |
| 933 | 3300048910 | Ga0496107_0275615 | Ga0496107_0275615_175_978 | 265 |
| 934 | 3300048912 | Ga0496109_0027873 | Ga0496109_0027873_3296_4099 | 265 |
| 935 | 3300048912 | Ga0496109_0498144 | Ga0496109_0498144_311_1108 | 265 |
| 936 | 3300048913 | Ga0496110_0031429 | Ga0496110_0031429_2726_3523 | 265 |
| 937 | 3300048914 | Ga0496111_0028169 | Ga0496111_0028169_1810_2607 | 265 |
| 938 | 3300048915 | Ga0496112_0013108 | Ga0496112_0013108_4981_5778 | 265 |
| 939 | 3300048915 | Ga0496112_0064959 | Ga0496112_0064959_790_1587 | 265 |
| 940 | 3300048915 | Ga0496112_0138641 | Ga0496112_0138641_1555_2352 | 265 |
| 941 | 3300048916 | Ga0496113_0000340 | Ga0496113_0000340_15953_16750 | 265 |
| 942 | 3300048916 | Ga0496113_0097364 | Ga0496113_0097364_803_1600 | 265 |
| 943 | 3300053077 | Ga0495601_0008130 | Ga0495601_0008130_265_1062 | 265 |
| 944 | 3300053077 | Ga0495601_0098456 | Ga0495601_0098456_36_833 | 265 |
| 945 | 3300005436 | Ga0070713_100001663 | Ga0070713_10000166310 | 266 |
| 946 | 3300006028 | Ga0070717_10006992 | Ga0070717_100069924 | 266 |
| 947 | 3300006028 | Ga0070717_10566614 | Ga0070717_105666141 | 266 |
| 948 | 3300025906 | Ga0207699_10213308 | Ga0207699_102133082 | 266 |
| 949 | 3300025912 | Ga0207707_10046004 | Ga0207707_100460042 | 266 |
| 950 | 3300025913 | Ga0207695_10057525 | Ga0207695_100575251 | 266 |
| 951 | 3300025928 | Ga0207700_10124197 | Ga0207700_101241972 | 266 |
| 952 | 3300035116 | Ga0373945_0046429 | Ga0373945_0046429_174_1124 | 266 |
| 953 | 3300035171 | Ga0373946_0077409 | Ga0373946_0077409_126_947 | 266 |
| 954 | 3300035692 | Ga0373935_0047270 | Ga0373935_0047270_1517_2338 | 266 |
| 955 | 3300035692 | Ga0373935_0138998 | Ga0373935_0138998_252_1202 | 266 |
| 956 | 3300035725 | Ga0373947_0205383 | Ga0373947_0205383_312_1133 | 266 |
| 957 | 3300037068 | Ga0373925_0011238 | Ga0373925_0011238_3899_4720 | 266 |
| 958 | 3300037068 | Ga0373925_0342746 | Ga0373925_0342746_90_1040 | 266 |
| 959 | 3300046459 | Ga0495629_0021734 | Ga0495629_0021734_1830_2780 | 266 |
| 960 | 3300046472 | Ga0495580_0000264 | Ga0495580_0000264_16511_17461 | 266 |
| 961 | 3300046473 | Ga0495582_0000791 | Ga0495582_0000791_4942_5892 | 266 |
| 962 | 3300046535 | Ga0495586_0048859 | Ga0495586_0048859_1082_1903 | 266 |
| 963 | 3300046683 | Ga0495658_0007432 | Ga0495658_0007432_2181_3131 | 266 |
| 964 | 3300047315 | Ga0495581_0244084 | Ga0495581_0244084_55_1005 | 266 |
| 965 | 3300047319 | Ga0495674_0020727 | Ga0495674_0020727_1354_2175 | 266 |
| 966 | 3300048903 | Ga0496100_0131907 | Ga0496100_0131907_636_1457 | 266 |
| 967 | 3300048917 | Ga0496114_0151687 | Ga0496114_0151687_207_1028 | 266 |
| 968 | 3300048918 | Ga0496115_0004190 | Ga0496115_0004190_2529_3350 | 266 |
| 969 | 3300053077 | Ga0495601_0265815 | Ga0495601_0265815_73_894 | 266 |
| 970 | 3300000546 | LJNas_1001133 | LJNas_10011333 | 268 |
| 971 | 3300005614 | Ga0068856_100033818 | Ga0068856_1000338182 | 268 |
| 972 | 3300025927 | Ga0207687_10150790 | Ga0207687_101507901 | 268 |
| 973 | 3300025928 | Ga0207700_10008211 | Ga0207700_100082115 | 268 |
| 974 | 3300025928 | Ga0207700_10135710 | Ga0207700_101357102 | 268 |
| 975 | 3300035119 | Ga0373956_0003888 | Ga0373956_0003888_2891_3703 | 268 |
| 976 | 3300036401 | Ga0373937_0026535 | Ga0373937_0026535_513_1325 | 268 |
| 977 | 3300037068 | Ga0373925_0030691 | Ga0373925_0030691_1945_2757 | 268 |
| 978 | 3300039447 | Ga0436361_0788453 | Ga0436361_0788453_11466_12317 | 268 |
| 979 | 3300046499 | Ga0495594_0027749 | Ga0495594_0027749_1341_2153 | 268 |
| 980 | 3300046660 | Ga0495625_0325291 | Ga0495625_0325291_91_936 | 268 |
| 981 | 3300046683 | Ga0495658_0029953 | Ga0495658_0029953_1861_2673 | 268 |
| 982 | 3300046684 | Ga0495669_0201649 | Ga0495669_0201649_16_861 | 268 |
| 983 | 3300047315 | Ga0495581_0123505 | Ga0495581_0123505_313_1125 | 268 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4b2o-assembly1.cif.gz_D | crystal structure of bacillus subtilis ymdb, a global regulator of late adaptive responses. | 0.9675 | 4 | 268 |
| 1t70-assembly3.cif.gz_E | crystal structure of a novel phosphatase from deinococcus radiodurans | 0.9599 | 4 | 268 |
| 2cv9-assembly1.cif.gz_A | crystal structure of a hypothetical protein from thermus thermophilus hb8 | 0.9557 | 4 | 268 |
| 1t70-assembly3.cif.gz_E | crystal structure of a novel phosphatase from deinococcus radiodurans | 0.9526 | 4 | 268 |
| 2cv9-assembly1.cif.gz_A | crystal structure of a hypothetical protein from thermus thermophilus hb8 | 0.9483 | 4 | 268 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4b2oD00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.9675 | 4 | 268 | 3.60.21.10 |
| 2z06B00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.963 | 4 | 268 | 3.60.21.10 |
| 2z06B00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.9556 | 4 | 268 | 3.60.21.10 |
| 4b2oD00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.9424 | 4 | 268 | 3.60.21.10 |
| 1t71A00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.905 | 1 | 268 | 3.60.21.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A661BEZ6-F1-model_v4 | Metallophosphoesterase | 0.9925 | 153 | 267 |
GO:0004113
|
| AF-A0A3C0WKN2-F1-model_v4 | Metallophosphoesterase | 0.9915 | 169 | 267 |
GO:0004113
|
| AF-A0A5B9ECD6-F1-model_v4 | TIGR00282 family metallophosphoesterase | 0.9913 | 4 | 268 |
GO:0004113
GO:0046872 |
| AF-A0A7V5CTE9-F1-model_v4 | Metallophosphoesterase | 0.9903 | 4 | 158 |
GO:0004113
|
| AF-X1P5I1-F1-model_v4 | Metallophosphoesterase | 0.9892 | 154 | 268 |
GO:0004113
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar