F487452

General Info

Members Datasets Scaffolds Average Seq Length
983 298 983 264

Family's Representative Sequence

Representative Sequence 3300035116|Ga0373945_0046429|Ga0373945_0046429_174_1124
Length 316
Sequence LHRHPEEIAVELRSTKSRWRLSHILVALGPNLALAHSKAVLATVLPSNFGFNIMRILFIGDIFGRPGRNIVKDRLPGIVRDHSINLIIANGENSAAGFGITPALAEDLFDLNIDVITTGNHVWDKREIIDYFQMVEGNGHGPARRVLRPANYPADMPGSGVYEGMKGNVPYAVINLQGRVFMASNDDPFRTADKLLQKIQAKIILVDMHAEATSEKISLGWYLDGRVTAVVGTHTHVPTADNRVLPNGTAYVTDVGMTGPYDGVIGVKKELVVGKFLNGMPVRFEPASGDARLCAVVIDCDEQTGKAHSIERLMLS

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
115 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
118 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
119 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
120 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
181 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
186 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
187 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
188 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
191 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
192 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
193 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
194 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
195 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
196 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
197 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
198 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
199 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
200 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
201 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
202 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
203 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
204 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
205 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
207 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
208 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
209 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
210 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
211 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
212 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
213 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
214 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
215 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
216 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
218 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
220 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
228 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
229 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
230 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
231 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
232 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
234 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
235 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
236 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
237 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
238 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
239 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
240 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
241 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
242 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
243 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
244 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
245 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
246 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
247 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
248 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
249 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
250 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
251 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
252 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
253 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
254 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
255 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
256 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
257 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
258 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
259 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
260 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
261 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
262 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
263 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
264 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
265 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
266 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
267 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
268 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
269 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
270 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
271 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
272 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
273 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
274 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
275 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
276 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
277 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
278 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
279 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
280 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
281 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
282 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
283 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
284 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
285 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
286 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
287 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
288 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
289 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
290 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
291 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
292 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
293 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
294 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
295 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
296 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
297 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
298 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.78
Metatranscriptomes 1.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.88
Rhizosphere 93.79
Stem 0
Stem Tuber 0
Unclassified 1.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1001133 3300000546 Bacteria 4065
2 JGI24751J29686_10009361 3300002459 Bacteria 2013
3 Ga0058863_11948358 3300004799 Bacteria 3043
4 Ga0058861_12038421 3300004800 Unclassified 2346
5 Ga0065712_10168060 3300005290 Bacteria 1260
6 Ga0070658_10074824 3300005327 Bacteria 2777
7 Ga0070676_10003837 3300005328 Bacteria 7889
8 Ga0070676_10017075 3300005328 Bacteria 4012
9 Ga0070683_100004635 3300005329 Bacteria 11354
10 Ga0070683_100097817 3300005329 Bacteria 2761
11 Ga0070683_100344593 3300005329 Bacteria 1419
12 Ga0070690_100021225 3300005330 Bacteria 3962
13 Ga0070690_100070037 3300005330 Bacteria 2277
14 Ga0070690_100181853 3300005330 Bacteria 1453
15 Ga0070690_100291651 3300005330 Bacteria 1167
16 Ga0070670_100001284 3300005331 Bacteria 20024
17 Ga0070670_100114216 3300005331 Bacteria 2328
18 Ga0070677_10186993 3300005333 Bacteria 990
19 Ga0068869_100030462 3300005334 Bacteria 3787
20 Ga0068869_100067071 3300005334 Bacteria 2646
21 Ga0070680_100007843 3300005336 Bacteria 8141
22 Ga0070680_100089347 3300005336 Bacteria 2549
23 Ga0070680_100137977 3300005336 Bacteria 2044
24 Ga0070680_100218418 3300005336 Bacteria 1608
25 Ga0070682_100005772 3300005337 Bacteria 6907
26 Ga0070682_100057639 3300005337 Bacteria 2448
27 Ga0068868_100006219 3300005338 Bacteria 8447
28 Ga0068868_100009581 3300005338 Bacteria 6982
29 Ga0068868_100054428 3300005338 Bacteria 3153
30 Ga0068868_100073410 3300005338 Bacteria 2732
31 Ga0068868_100090243 3300005338 Unclassified 2468
32 Ga0070660_100000802 3300005339 Bacteria 20852
33 Ga0070660_100059442 3300005339 Bacteria 2964
34 Ga0070660_100105033 3300005339 Bacteria 2241
35 Ga0070689_100007128 3300005340 Bacteria 7791
36 Ga0070691_10091632 3300005341 Bacteria 1499
37 Ga0070687_100011620 3300005343 Bacteria 3858
38 Ga0070661_100033575 3300005344 Bacteria 3717
39 Ga0070692_10134893 3300005345 Bacteria 1391
40 Ga0070669_100135828 3300005353 Bacteria 1891
41 Ga0070669_100192164 3300005353 Bacteria 1602
42 Ga0070671_100203273 3300005355 Bacteria 1680
43 Ga0070674_100253192 3300005356 Bacteria 1384
44 Ga0070673_100116863 3300005364 Bacteria 2219
45 Ga0070673_100213038 3300005364 Bacteria 1669
46 Ga0070688_100000324 3300005365 Bacteria 24448
47 Ga0070688_100100176 3300005365 Bacteria 1909
48 Ga0070659_100049589 3300005366 Bacteria 3302
49 Ga0070659_100061181 3300005366 Bacteria 2975
50 Ga0070659_100365931 3300005366 Bacteria 1212
51 Ga0070667_100259526 3300005367 Bacteria 1555
52 Ga0070667_100552629 3300005367 Bacteria 1058
53 Ga0070709_10006939 3300005434 Bacteria 6183
54 Ga0070709_10022285 3300005434 Bacteria 3703
55 Ga0070709_10030430 3300005434 Unclassified 3240
56 Ga0070709_10037044 3300005434 Bacteria 2976
57 Ga0070709_10078324 3300005434 Bacteria 2150
58 Ga0070709_10087316 3300005434 Bacteria 2049
59 Ga0070709_10104062 3300005434 Unclassified 1897
60 Ga0070709_10121001 3300005434 Bacteria 1774
61 Ga0070709_10480320 3300005434 Bacteria 941
62 Ga0070714_100000060 3300005435 Bacteria 100913
63 Ga0070714_100006809 3300005435 Bacteria 8857
64 Ga0070714_100009371 3300005435 Bacteria 7692
65 Ga0070714_100045952 3300005435 Bacteria 3702
66 Ga0070714_100074082 3300005435 Bacteria 2951
67 Ga0070714_100176484 3300005435 Unclassified 1942
68 Ga0070714_100210467 3300005435 Unclassified 1782
69 Ga0070714_100289739 3300005435 Bacteria 1523
70 Ga0070714_100296418 3300005435 Bacteria 1506
71 Ga0070714_100296486 3300005435 Bacteria 1506
72 Ga0070714_100418040 3300005435 Bacteria 1270
73 Ga0070714_100456793 3300005435 Bacteria 1214
74 Ga0070714_100910826 3300005435 Bacteria 854
75 Ga0070713_100000037 3300005436 Bacteria 85487
76 Ga0070713_100001036 3300005436 Bacteria 17798
77 Ga0070713_100001663 3300005436 Bacteria 14294
78 Ga0070713_100002374 3300005436 Bacteria 12270
79 Ga0070713_100003409 3300005436 Bacteria 10498
80 Ga0070713_100037517 3300005436 Unclassified 3919
81 Ga0070713_100045935 3300005436 Bacteria 3582
82 Ga0070713_100079727 3300005436 Bacteria 2790
83 Ga0070713_100083375 3300005436 Bacteria 2733
84 Ga0070713_100112837 3300005436 Bacteria 2372
85 Ga0070713_100141496 3300005436 Bacteria 2132
86 Ga0070713_100175324 3300005436 Bacteria 1924
87 Ga0070713_100186960 3300005436 Bacteria 1865
88 Ga0070713_100271111 3300005436 Bacteria 1554
89 Ga0070713_100353140 3300005436 Bacteria 1364
90 Ga0070713_100565869 3300005436 Bacteria 1077
91 Ga0070710_10001259 3300005437 Bacteria 12036
92 Ga0070710_10008303 3300005437 Bacteria 5054
93 Ga0070710_10030625 3300005437 Bacteria 2897
94 Ga0070710_10128132 3300005437 Bacteria 1544
95 Ga0070711_100000620 3300005439 Bacteria 18531
96 Ga0070711_100000948 3300005439 Bacteria 15349
97 Ga0070711_100003458 3300005439 Bacteria 9206
98 Ga0070711_100004411 3300005439 Bacteria 8302
99 Ga0070711_100020771 3300005439 Bacteria 4237
100 Ga0070711_100024294 3300005439 Bacteria 3951
101 Ga0070711_100029169 3300005439 Unclassified 3638
102 Ga0070711_100175599 3300005439 Bacteria 1636
103 Ga0070711_100210306 3300005439 Bacteria 1506
104 Ga0070711_100229975 3300005439 Bacteria 1445
105 Ga0070711_100261692 3300005439 Unclassified 1361
106 Ga0070711_100309430 3300005439 Unclassified 1259
107 Ga0070711_100402942 3300005439 Bacteria 1111
108 Ga0070708_100001252 3300005445 Bacteria 19517
109 Ga0070708_100004680 3300005445 Bacteria 10784
110 Ga0070708_100009817 3300005445 Bacteria 7728
111 Ga0070708_100020691 3300005445 Bacteria 5554
112 Ga0070708_100040631 3300005445 Bacteria 4074
113 Ga0070708_100044681 3300005445 Bacteria 3897
114 Ga0070708_100076078 3300005445 Bacteria 3031
115 Ga0070708_100152512 3300005445 Bacteria 2150
116 Ga0070708_100153520 3300005445 Bacteria 2142
117 Ga0070708_100158622 3300005445 Bacteria 2107
118 Ga0070663_100014599 3300005455 Bacteria 5046
119 Ga0070678_100021562 3300005456 Bacteria 4251
120 Ga0070662_100007867 3300005457 Bacteria 6925
121 Ga0070662_100146223 3300005457 Bacteria 1836
122 Ga0070681_10000104 3300005458 Bacteria 62963
123 Ga0070681_10002085 3300005458 Bacteria 18155
124 Ga0070681_10034658 3300005458 Bacteria 5069
125 Ga0070681_10035198 3300005458 Bacteria 5029
126 Ga0070681_10045960 3300005458 Bacteria 4366
127 Ga0070681_10052615 3300005458 Bacteria 4062
128 Ga0070681_10053927 3300005458 Bacteria 4006
129 Ga0070681_10404448 3300005458 Bacteria 1277
130 Ga0070681_10423409 3300005458 Unclassified 1243
131 Ga0068867_100025667 3300005459 Bacteria 4229
132 Ga0068867_100050861 3300005459 Bacteria 3055
133 Ga0070685_10071696 3300005466 Bacteria 2054
134 Ga0070706_100000038 3300005467 Bacteria 150665
135 Ga0070706_100001729 3300005467 Bacteria 22631
136 Ga0070706_100002504 3300005467 Bacteria 18500
137 Ga0070706_100004861 3300005467 Bacteria 12871
138 Ga0070706_100009047 3300005467 Bacteria 9273
139 Ga0070706_100023126 3300005467 Bacteria 5723
140 Ga0070706_100025311 3300005467 Bacteria 5462
141 Ga0070706_100051467 3300005467 Bacteria 3801
142 Ga0070706_100304336 3300005467 Unclassified 1487
143 Ga0070707_100000434 3300005468 Bacteria 41451
144 Ga0070707_100004944 3300005468 Bacteria 12488
145 Ga0070707_100005109 3300005468 Bacteria 12306
146 Ga0070707_100006967 3300005468 Bacteria 10476
147 Ga0070707_100023128 3300005468 Bacteria 5880
148 Ga0070707_100046153 3300005468 Bacteria 4169
149 Ga0070707_100063007 3300005468 Bacteria 3558
150 Ga0070707_100736377 3300005468 Bacteria 949
151 Ga0070698_100001423 3300005471 Bacteria 26489
152 Ga0070698_100003126 3300005471 Bacteria 18238
153 Ga0070698_100003377 3300005471 Bacteria 17558
154 Ga0070698_100036597 3300005471 Bacteria 5068
155 Ga0070698_100041619 3300005471 Bacteria 4716
156 Ga0070698_100206325 3300005471 Bacteria 1900
157 Ga0070699_100001451 3300005518 Bacteria 21740
158 Ga0070699_100007223 3300005518 Bacteria 9664
159 Ga0070699_100010942 3300005518 Bacteria 7847
160 Ga0070699_100272061 3300005518 Unclassified 1516
161 Ga0070699_100377728 3300005518 Bacteria 1279
162 Ga0070679_100001719 3300005530 Bacteria 19749
163 Ga0070679_100004624 3300005530 Bacteria 12705
164 Ga0070679_100010477 3300005530 Bacteria 8795
165 Ga0070679_100264421 3300005530 Bacteria 1675
166 Ga0070679_100412060 3300005530 Bacteria 1297
167 Ga0070684_100003436 3300005535 Bacteria 11890
168 Ga0070684_100016314 3300005535 Bacteria 6069
169 Ga0070684_100230180 3300005535 Bacteria 1692
170 Ga0070684_100426253 3300005535 Bacteria 1225
171 Ga0070697_100000006 3300005536 Bacteria 226483
172 Ga0070697_100000353 3300005536 Bacteria 36186
173 Ga0070697_100000656 3300005536 Bacteria 26071
174 Ga0070697_100001791 3300005536 Bacteria 16388
175 Ga0070697_100002182 3300005536 Bacteria 15011
176 Ga0070697_100003316 3300005536 Bacteria 12369
177 Ga0070697_100005151 3300005536 Bacteria 10038
178 Ga0070697_100008447 3300005536 Bacteria 8035
179 Ga0070697_100046258 3300005536 Bacteria 3527
180 Ga0070697_100046837 3300005536 Bacteria 3505
181 Ga0070697_100243012 3300005536 Bacteria 1538
182 Ga0070697_100380274 3300005536 Bacteria 1223
183 Ga0068853_100026560 3300005539 Bacteria 4862
184 Ga0068853_100076866 3300005539 Bacteria 2916
185 Ga0068853_100082946 3300005539 Bacteria 2808
186 Ga0070672_100049512 3300005543 Bacteria 3269
187 Ga0070672_100668756 3300005543 Bacteria 908
188 Ga0070695_100079374 3300005545 Bacteria 2166
189 Ga0070696_100004493 3300005546 Bacteria 9313
190 Ga0070696_100288433 3300005546 Bacteria 1253
191 Ga0070693_100020544 3300005547 Bacteria 3484
192 Ga0070693_100045664 3300005547 Bacteria 2484
193 Ga0070693_100068857 3300005547 Bacteria 2078
194 Ga0070693_100143587 3300005547 Bacteria 1505
195 Ga0070704_100106680 3300005549 Bacteria 2123
196 Ga0068855_100000238 3300005563 Bacteria 69719
197 Ga0068855_100000770 3300005563 Bacteria 39493
198 Ga0068855_100017711 3300005563 Bacteria 8565
199 Ga0068855_100087134 3300005563 Bacteria 3609
200 Ga0068855_100145735 3300005563 Bacteria 2696
201 Ga0068855_100153502 3300005563 Bacteria 2617
202 Ga0068855_100245965 3300005563 Bacteria 1996
203 Ga0068855_100327964 3300005563 Bacteria 1690
204 Ga0068855_100356410 3300005563 Unclassified 1610
205 Ga0068855_100580780 3300005563 Bacteria 1210
206 Ga0070664_100004949 3300005564 Bacteria 10672
207 Ga0070664_100057595 3300005564 Bacteria 3303
208 Ga0070664_100284704 3300005564 Bacteria 1491
209 Ga0068857_100000113 3300005577 Bacteria 48281
210 Ga0068857_100000432 3300005577 Bacteria 29617
211 Ga0068857_100030346 3300005577 Bacteria 4774
212 Ga0068857_100034290 3300005577 Bacteria 4489
213 Ga0068857_100084219 3300005577 Bacteria 2841
214 Ga0068857_100151267 3300005577 Bacteria 2103
215 Ga0068857_100327278 3300005577 Bacteria 1416
216 Ga0068854_100001797 3300005578 Bacteria 13076
217 Ga0068854_100275860 3300005578 Bacteria 1352
218 Ga0068854_100343750 3300005578 Bacteria 1219
219 Ga0068856_100000096 3300005614 Bacteria 83677
220 Ga0068856_100000243 3300005614 Bacteria 59277
221 Ga0068856_100000305 3300005614 Bacteria 53825
222 Ga0068856_100033818 3300005614 Bacteria 5006
223 Ga0068856_100036461 3300005614 Bacteria 4821
224 Ga0068856_100037127 3300005614 Bacteria 4779
225 Ga0068856_100057632 3300005614 Bacteria 3835
226 Ga0068856_100163222 3300005614 Bacteria 2239
227 Ga0068856_100172849 3300005614 Bacteria 2173
228 Ga0068856_100260540 3300005614 Unclassified 1749
229 Ga0068856_100311400 3300005614 Bacteria 1592
230 Ga0070702_100052923 3300005615 Bacteria 2330
231 Ga0068852_100036346 3300005616 Unclassified 4120
232 Ga0068852_100078088 3300005616 Bacteria 2928
233 Ga0068852_100118358 3300005616 Bacteria 2420
234 Ga0068852_100321911 3300005616 Bacteria 1502
235 Ga0068859_100002165 3300005617 Bacteria 19967
236 Ga0068859_100042731 3300005617 Bacteria 4553
237 Ga0068859_100341998 3300005617 Bacteria 1590
238 Ga0068859_100408396 3300005617 Bacteria 1454
239 Ga0068864_100014466 3300005618 Bacteria 6554
240 Ga0068864_100016673 3300005618 Bacteria 6122
241 Ga0068864_100048061 3300005618 Bacteria 3667
242 Ga0068864_100049877 3300005618 Bacteria 3602
243 Ga0068866_10004147 3300005718 Bacteria 5943
244 Ga0068866_10022795 3300005718 Bacteria 2903
245 Ga0068866_10050018 3300005718 Bacteria 2121
246 Ga0068861_100113945 3300005719 Bacteria 2170
247 Ga0068851_10003975 3300005834 Bacteria 6624
248 Ga0068851_10010200 3300005834 Bacteria 4379
249 Ga0068851_10052956 3300005834 Bacteria 2065
250 Ga0068870_10012650 3300005840 Bacteria 3948
251 Ga0068870_10022256 3300005840 Bacteria 3112
252 Ga0068863_100010652 3300005841 Bacteria 8925
253 Ga0068863_100036962 3300005841 Bacteria 4649
254 Ga0068858_100007172 3300005842 Bacteria 10813
255 Ga0068858_100049365 3300005842 Bacteria 3897
256 Ga0068858_100080573 3300005842 Bacteria 3025
257 Ga0068858_100112600 3300005842 Bacteria 2541
258 Ga0068858_100375574 3300005842 Unclassified 1364
259 Ga0068860_100017206 3300005843 Bacteria 7048
260 Ga0068860_100088983 3300005843 Bacteria 2939
261 Ga0068860_100116329 3300005843 Bacteria 2558
262 Ga0068860_100352285 3300005843 Bacteria 1449
263 Ga0068860_100583698 3300005843 Bacteria 1122
264 Ga0068862_100029494 3300005844 Unclassified 4623
265 Ga0068862_100033899 3300005844 Bacteria 4319
266 Ga0068862_100120541 3300005844 Bacteria 2311
267 Ga0070717_10001269 3300006028 Bacteria 17254
268 Ga0070717_10001355 3300006028 Bacteria 16847
269 Ga0070717_10006992 3300006028 Bacteria 8348
270 Ga0070717_10011082 3300006028 Bacteria 6833
271 Ga0070717_10012374 3300006028 Bacteria 6504
272 Ga0070717_10018677 3300006028 Bacteria 5421
273 Ga0070717_10022350 3300006028 Unclassified 4997
274 Ga0070717_10025940 3300006028 Bacteria 4671
275 Ga0070717_10040600 3300006028 Bacteria 3790
276 Ga0070717_10049675 3300006028 Bacteria 3444
277 Ga0070717_10053823 3300006028 Bacteria 3318
278 Ga0070717_10060782 3300006028 Unclassified 3129
279 Ga0070717_10110676 3300006028 Unclassified 2342
280 Ga0070717_10127647 3300006028 Bacteria 2184
281 Ga0070717_10129298 3300006028 Bacteria 2171
282 Ga0070717_10220711 3300006028 Unclassified 1666
283 Ga0070717_10252334 3300006028 Bacteria 1559
284 Ga0070717_10257901 3300006028 Bacteria 1542
285 Ga0070717_10259840 3300006028 Bacteria 1536
286 Ga0070717_10273993 3300006028 Bacteria 1495
287 Ga0070717_10305490 3300006028 Unclassified 1415
288 Ga0070717_10566614 3300006028 Unclassified 1029
289 Ga0070715_10004939 3300006163 Bacteria 4419
290 Ga0070715_10010431 3300006163 Bacteria 3312
291 Ga0070716_100001188 3300006173 Bacteria 11472
292 Ga0070716_100015187 3300006173 Unclassified 3951
293 Ga0070716_100016018 3300006173 Bacteria 3864
294 Ga0070716_100020877 3300006173 Bacteria 3444
295 Ga0070716_100048212 3300006173 Unclassified 2407
296 Ga0070716_100146633 3300006173 Unclassified 1513
297 Ga0070716_100211478 3300006173 Bacteria 1296
298 Ga0070716_100356636 3300006173 Bacteria 1037
299 Ga0070716_100443128 3300006173 Bacteria 945
300 Ga0070712_100000010 3300006175 Bacteria 143560
301 Ga0070712_100000853 3300006175 Bacteria 18139
302 Ga0070712_100001607 3300006175 Bacteria 13809
303 Ga0070712_100003139 3300006175 Bacteria 10178
304 Ga0070712_100004072 3300006175 Bacteria 8973
305 Ga0070712_100005197 3300006175 Bacteria 8047
306 Ga0070712_100015289 3300006175 Bacteria 4937
307 Ga0070712_100023121 3300006175 Bacteria 4102
308 Ga0070712_100111071 3300006175 Unclassified 2046
309 Ga0070712_100204364 3300006175 Bacteria 1554
310 Ga0070712_100298760 3300006175 Bacteria 1302
311 Ga0097621_100000022 3300006237 Bacteria 85005
312 Ga0097621_100002166 3300006237 Bacteria 13443
313 Ga0097621_100054796 3300006237 Unclassified 3254
314 Ga0068871_100000401 3300006358 Bacteria 30136
315 Ga0068871_100000478 3300006358 Bacteria 27397
316 Ga0068871_100001634 3300006358 Bacteria 15100
317 Ga0068871_100012481 3300006358 Bacteria 6267
318 Ga0075428_100043757 3300006844 Bacteria 4923
319 Ga0075429_100034596 3300006880 Bacteria 4391
320 Ga0068865_100366366 3300006881 Bacteria 1171
321 Ga0068865_100413274 3300006881 Bacteria 1108
322 Ga0068865_100434269 3300006881 Bacteria 1082
323 Ga0075436_100005023 3300006914 Bacteria 9092
324 Ga0075436_100068139 3300006914 Unclassified 2459
325 Ga0075436_100123941 3300006914 Bacteria 1810
326 Ga0097620_100002165 3300006931 Bacteria 19967
327 Ga0097620_100042732 3300006931 Bacteria 4553
328 Ga0097620_100341947 3300006931 Bacteria 1590
329 Ga0097620_100408353 3300006931 Bacteria 1454
330 Ga0075435_100060985 3300007076 Bacteria 3059
331 Ga0075435_100120643 3300007076 Unclassified 2188
332 Ga0099794_10169107 3300007265 Bacteria 1114
333 Ga0105250_10067574 3300009092 Bacteria 1442
334 Ga0105240_10016218 3300009093 Bacteria 10096
335 Ga0105240_10029357 3300009093 Bacteria 7166
336 Ga0105240_10047329 3300009093 Bacteria 5442
337 Ga0105240_10068952 3300009093 Bacteria 4379
338 Ga0105240_10076743 3300009093 Unclassified 4119
339 Ga0105240_10081807 3300009093 Bacteria 3967
340 Ga0105240_10332602 3300009093 Bacteria 1728
341 Ga0105240_10499335 3300009093 Unclassified 1353
342 Ga0105245_10001938 3300009098 Bacteria 18801
343 Ga0105245_10003931 3300009098 Bacteria 13217
344 Ga0105245_10015594 3300009098 Bacteria 6627
345 Ga0105245_10067885 3300009098 Bacteria 3230
346 Ga0105245_10470443 3300009098 Bacteria 1268
347 Ga0105247_10033932 3300009101 Bacteria 3107
348 Ga0105247_10090735 3300009101 Unclassified 1939
349 Ga0114129_10342869 3300009147 Bacteria 1981
350 Ga0105243_10035619 3300009148 Bacteria 3859
351 Ga0105241_10002924 3300009174 Bacteria 12754
352 Ga0105241_10010624 3300009174 Bacteria 6751
353 Ga0105241_10015386 3300009174 Bacteria 5603
354 Ga0105241_10123962 3300009174 Bacteria 2084
355 Ga0105241_10180419 3300009174 Bacteria 1751
356 Ga0105241_10202572 3300009174 Unclassified 1659
357 Ga0105242_10007431 3300009176 Bacteria 8435
358 Ga0105242_10071878 3300009176 Unclassified 2872
359 Ga0105242_10099348 3300009176 Bacteria 2463
360 Ga0105242_10195570 3300009176 Bacteria 1793
361 Ga0105248_10033388 3300009177 Bacteria 5748
362 Ga0105248_10056174 3300009177 Bacteria 4416
363 Ga0105248_10149281 3300009177 Bacteria 2637
364 Ga0105248_10296583 3300009177 Bacteria 1820
365 Ga0105237_10048488 3300009545 Unclassified 4270
366 Ga0105237_10069800 3300009545 Unclassified 3509
367 Ga0105237_10078171 3300009545 Unclassified 3298
368 Ga0105237_10185899 3300009545 Bacteria 2078
369 Ga0105237_10375315 3300009545 Bacteria 1427
370 Ga0105237_10512137 3300009545 Bacteria 1207
371 Ga0105237_10574885 3300009545 Bacteria 1134
372 Ga0105238_10000644 3300009551 Bacteria 36743
373 Ga0105238_10026343 3300009551 Bacteria 5927
374 Ga0105238_10028879 3300009551 Bacteria 5649
375 Ga0105238_10087928 3300009551 Bacteria 3094
376 Ga0105238_10437052 3300009551 Bacteria 1305
377 Ga0105249_10240596 3300009553 Bacteria 1789
378 Ga0105239_10131415 3300010375 Bacteria 2785
379 Ga0105239_10165289 3300010375 Bacteria 2474
380 Ga0105239_10167565 3300010375 Bacteria 2456
381 Ga0105246_10136449 3300011119 Bacteria 1839
382 Ga0157373_10003491 3300013100 Bacteria 11888
383 Ga0157373_10004886 3300013100 Bacteria 10089
384 Ga0157373_10026739 3300013100 Bacteria 4165
385 Ga0157373_10083664 3300013100 Bacteria 2249
386 Ga0157371_10002263 3300013102 Bacteria 18560
387 Ga0157371_10082681 3300013102 Unclassified 2274
388 Ga0157371_10168627 3300013102 Bacteria 1564
389 Ga0157371_10198595 3300013102 Bacteria 1437
390 Ga0157370_10014896 3300013104 Bacteria 7931
391 Ga0157370_10086651 3300013104 Bacteria 2942
392 Ga0157370_10142216 3300013104 Unclassified 2236
393 Ga0157369_10000034 3300013105 Bacteria 200710
394 Ga0157369_10000786 3300013105 Bacteria 40894
395 Ga0157369_10028869 3300013105 Bacteria 6136
396 Ga0157369_10030338 3300013105 Bacteria 5964
397 Ga0157369_10036369 3300013105 Bacteria 5395
398 Ga0157369_10056220 3300013105 Bacteria 4247
399 Ga0157369_10078967 3300013105 Bacteria 3525
400 Ga0157369_10171846 3300013105 Bacteria 2283
401 Ga0157369_10180195 3300013105 Bacteria 2223
402 Ga0157369_10433028 3300013105 Bacteria 1363
403 Ga0157369_10540275 3300013105 Bacteria 1205
404 Ga0157374_10000052 3300013296 Bacteria 125138
405 Ga0157374_10001074 3300013296 Bacteria 23713
406 Ga0157374_10037641 3300013296 Bacteria 4442
407 Ga0157374_10056435 3300013296 Bacteria 3666
408 Ga0157374_10136419 3300013296 Unclassified 2379
409 Ga0157374_10146951 3300013296 Bacteria 2290
410 Ga0157374_10279409 3300013296 Bacteria 1648
411 Ga0157378_10000227 3300013297 Bacteria 54885
412 Ga0157378_10000764 3300013297 Bacteria 29926
413 Ga0157378_10003664 3300013297 Bacteria 13615
414 Ga0157378_10006776 3300013297 Bacteria 10003
415 Ga0157378_10156963 3300013297 Bacteria 2125
416 Ga0157378_10240087 3300013297 Bacteria 1730
417 Ga0163162_10011916 3300013306 Bacteria 8478
418 Ga0163162_10137660 3300013306 Bacteria 2553
419 Ga0163162_10512783 3300013306 Bacteria 1329
420 Ga0157372_10001472 3300013307 Bacteria 25548
421 Ga0157372_10001995 3300013307 Bacteria 22167
422 Ga0157372_10002166 3300013307 Bacteria 21379
423 Ga0157372_10014707 3300013307 Bacteria 8374
424 Ga0157372_10016205 3300013307 Bacteria 7997
425 Ga0157372_10022908 3300013307 Bacteria 6763
426 Ga0157372_10034354 3300013307 Bacteria 5573
427 Ga0157372_10036371 3300013307 Bacteria 5426
428 Ga0157372_10088229 3300013307 Bacteria 3521
429 Ga0157372_10105039 3300013307 Bacteria 3230
430 Ga0157372_10118467 3300013307 Unclassified 3038
431 Ga0157372_10178253 3300013307 Bacteria 2460
432 Ga0157372_10262633 3300013307 Bacteria 2005
433 Ga0157372_10961393 3300013307 Unclassified 990
434 Ga0157375_10177951 3300013308 Bacteria 2278
435 Ga0163163_10007470 3300014325 Bacteria 9645
436 Ga0163163_10030293 3300014325 Bacteria 5212
437 Ga0163163_10032223 3300014325 Bacteria 5062
438 Ga0182008_10103465 3300014497 Bacteria 1408
439 Ga0157377_10001902 3300014745 Bacteria 9148
440 Ga0157377_10121451 3300014745 Bacteria 1584
441 Ga0157379_10006003 3300014968 Bacteria 10470
442 Ga0157379_10030951 3300014968 Bacteria 4767
443 Ga0157379_10184343 3300014968 Unclassified 1886
444 Ga0157376_10006922 3300014969 Bacteria 8036
445 Ga0157376_10016053 3300014969 Bacteria 5674
446 Ga0157376_10112787 3300014969 Unclassified 2396
447 Ga0157376_10364971 3300014969 Bacteria 1386
448 Ga0163161_10001086 3300017792 Bacteria 20609
449 Ga0206350_11446456 3300020080 Bacteria 895
450 Ga0213872_10003667 3300021361 Bacteria 8413
451 Ga0213872_10010363 3300021361 Bacteria 4441
452 Ga0213872_10015651 3300021361 Bacteria 3525
453 Ga0213874_10001758 3300021377 Unclassified 4553
454 Ga0213874_10065778 3300021377 Unclassified 1146
455 Ga0213876_10153075 3300021384 Bacteria 1226
456 Ga0213875_10030852 3300021388 Bacteria 2537
457 Ga0224570_100055 3300022730 Bacteria 5938
458 Ga0224572_1000977 3300024225 Bacteria 3938
459 Ga0224572_1002033 3300024225 Bacteria 3179
460 Ga0224572_1010090 3300024225 Bacteria 1771
461 Ga0228598_1000089 3300024227 Bacteria 14670
462 Ga0228598_1008520 3300024227 Bacteria 2068
463 Ga0228598_1008675 3300024227 Bacteria 2048
464 Ga0207656_10025805 3300025321 Bacteria 2389
465 Ga0207682_10045188 3300025893 Bacteria 1807
466 Ga0207692_10000836 3300025898 Bacteria 11035
467 Ga0207692_10004455 3300025898 Bacteria 5547
468 Ga0207692_10011811 3300025898 Bacteria 3732
469 Ga0207692_10135553 3300025898 Bacteria 1395
470 Ga0207692_10154770 3300025898 Bacteria 1316
471 Ga0207692_10241471 3300025898 Bacteria 1079
472 Ga0207688_10002577 3300025901 Bacteria 9803
473 Ga0207680_10041332 3300025903 Bacteria 2689
474 Ga0207647_10019921 3300025904 Bacteria 4504
475 Ga0207647_10076277 3300025904 Bacteria 2016
476 Ga0207685_10006742 3300025905 Bacteria 3152
477 Ga0207685_10049821 3300025905 Bacteria 1611
478 Ga0207685_10065744 3300025905 Unclassified 1453
479 Ga0207699_10005574 3300025906 Bacteria 6039
480 Ga0207699_10015443 3300025906 Bacteria 3967
481 Ga0207699_10042891 3300025906 Bacteria 2624
482 Ga0207699_10154867 3300025906 Bacteria 1520
483 Ga0207699_10213308 3300025906 Bacteria 1314
484 Ga0207699_10300912 3300025906 Bacteria 1120
485 Ga0207699_10369721 3300025906 Bacteria 1016
486 Ga0207699_10389705 3300025906 Unclassified 990
487 Ga0207645_10000273 3300025907 Bacteria 42696
488 Ga0207645_10020001 3300025907 Bacteria 4383
489 Ga0207643_10039543 3300025908 Bacteria 2653
490 Ga0207705_10255548 3300025909 Bacteria 1337
491 Ga0207684_10000008 3300025910 Bacteria 601602
492 Ga0207684_10000129 3300025910 Bacteria 138143
493 Ga0207684_10000677 3300025910 Bacteria 40393
494 Ga0207684_10004879 3300025910 Bacteria 12535
495 Ga0207684_10010433 3300025910 Bacteria 8178
496 Ga0207684_10098685 3300025910 Bacteria 2494
497 Ga0207684_10177942 3300025910 Unclassified 1834
498 Ga0207684_10262908 3300025910 Unclassified 1489
499 Ga0207654_10002620 3300025911 Bacteria 9128
500 Ga0207654_10038356 3300025911 Bacteria 2688
501 Ga0207654_10169580 3300025911 Bacteria 1416
502 Ga0207707_10000496 3300025912 Bacteria 40443
503 Ga0207707_10001602 3300025912 Bacteria 20874
504 Ga0207707_10013616 3300025912 Bacteria 7093
505 Ga0207707_10013650 3300025912 Bacteria 7084
506 Ga0207707_10017593 3300025912 Bacteria 6234
507 Ga0207707_10046004 3300025912 Unclassified 3801
508 Ga0207707_10064435 3300025912 Unclassified 3190
509 Ga0207707_10070875 3300025912 Bacteria 3037
510 Ga0207707_10103774 3300025912 Unclassified 2485
511 Ga0207707_10372176 3300025912 Bacteria 1229
512 Ga0207695_10021651 3300025913 Bacteria 7329
513 Ga0207695_10021896 3300025913 Bacteria 7277
514 Ga0207695_10022507 3300025913 Bacteria 7151
515 Ga0207695_10026035 3300025913 Bacteria 6535
516 Ga0207695_10057525 3300025913 Bacteria 4039
517 Ga0207695_10110079 3300025913 Unclassified 2735
518 Ga0207695_10125998 3300025913 Bacteria 2523
519 Ga0207695_10190748 3300025913 Bacteria 1967
520 Ga0207695_10259304 3300025913 Bacteria 1636
521 Ga0207671_10140271 3300025914 Unclassified 1862
522 Ga0207671_10330708 3300025914 Bacteria 1207
523 Ga0207693_10000004 3300025915 Bacteria 193261
524 Ga0207693_10000029 3300025915 Bacteria 118724
525 Ga0207693_10000985 3300025915 Bacteria 25547
526 Ga0207693_10005725 3300025915 Bacteria 10319
527 Ga0207693_10010392 3300025915 Bacteria 7558
528 Ga0207693_10015396 3300025915 Bacteria 6136
529 Ga0207693_10023355 3300025915 Bacteria 4911
530 Ga0207693_10028716 3300025915 Bacteria 4396
531 Ga0207693_10086647 3300025915 Bacteria 2454
532 Ga0207693_10109362 3300025915 Bacteria 2168
533 Ga0207693_10228336 3300025915 Bacteria 1462
534 Ga0207693_10338491 3300025915 Bacteria 1178
535 Ga0207663_10006013 3300025916 Bacteria 6170
536 Ga0207663_10014560 3300025916 Bacteria 4311
537 Ga0207663_10023177 3300025916 Bacteria 3558
538 Ga0207663_10030476 3300025916 Unclassified 3183
539 Ga0207663_10063236 3300025916 Bacteria 2356
540 Ga0207663_10226343 3300025916 Unclassified 1364
541 Ga0207663_10380112 3300025916 Bacteria 1076
542 Ga0207660_10001588 3300025917 Bacteria 15243
543 Ga0207660_10034630 3300025917 Bacteria 3501
544 Ga0207660_10161004 3300025917 Unclassified 1731
545 Ga0207660_10204382 3300025917 Bacteria 1544
546 Ga0207662_10011575 3300025918 Bacteria 4899
547 Ga0207657_10006409 3300025919 Bacteria 12210
548 Ga0207657_10020387 3300025919 Bacteria 6265
549 Ga0207657_10021886 3300025919 Bacteria 6004
550 Ga0207649_10004928 3300025920 Bacteria 7216
551 Ga0207652_10045080 3300025921 Bacteria 3758
552 Ga0207652_10128419 3300025921 Bacteria 2259
553 Ga0207652_10228957 3300025921 Bacteria 1675
554 Ga0207652_10295294 3300025921 Unclassified 1462
555 Ga0207652_10666291 3300025921 Bacteria 930
556 Ga0207646_10000192 3300025922 Bacteria 83182
557 Ga0207646_10001274 3300025922 Bacteria 31519
558 Ga0207646_10003352 3300025922 Bacteria 18172
559 Ga0207646_10005288 3300025922 Bacteria 13605
560 Ga0207646_10008896 3300025922 Bacteria 10001
561 Ga0207646_10012851 3300025922 Bacteria 8025
562 Ga0207646_10025076 3300025922 Bacteria 5457
563 Ga0207646_10031161 3300025922 Bacteria 4829
564 Ga0207646_10035668 3300025922 Bacteria 4492
565 Ga0207646_10590910 3300025922 Bacteria 997
566 Ga0207681_10066824 3300025923 Bacteria 2490
567 Ga0207694_10002382 3300025924 Bacteria 15376
568 Ga0207650_10000036 3300025925 Bacteria 214579
569 Ga0207650_10003223 3300025925 Bacteria 11245
570 Ga0207687_10006171 3300025927 Bacteria 7931
571 Ga0207687_10029492 3300025927 Bacteria 3691
572 Ga0207687_10150790 3300025927 Bacteria 1774
573 Ga0207687_10247391 3300025927 Bacteria 1416
574 Ga0207700_10000173 3300025928 Bacteria 38581
575 Ga0207700_10000428 3300025928 Bacteria 24716
576 Ga0207700_10008211 3300025928 Bacteria 6451
577 Ga0207700_10009584 3300025928 Bacteria 6062
578 Ga0207700_10023665 3300025928 Bacteria 4241
579 Ga0207700_10032067 3300025928 Unclassified 3742
580 Ga0207700_10056627 3300025928 Bacteria 2952
581 Ga0207700_10074471 3300025928 Bacteria 2627
582 Ga0207700_10099463 3300025928 Bacteria 2316
583 Ga0207700_10124197 3300025928 Unclassified 2097
584 Ga0207700_10126471 3300025928 Unclassified 2080
585 Ga0207700_10135710 3300025928 Bacteria 2015
586 Ga0207700_10151898 3300025928 Bacteria 1914
587 Ga0207700_10253931 3300025928 Unclassified 1503
588 Ga0207700_10290386 3300025928 Bacteria 1409
589 Ga0207700_10303786 3300025928 Unclassified 1379
590 Ga0207664_10000017 3300025929 Bacteria 230967
591 Ga0207664_10003989 3300025929 Bacteria 9945
592 Ga0207664_10033597 3300025929 Bacteria 3942
593 Ga0207664_10042383 3300025929 Bacteria 3552
594 Ga0207664_10079865 3300025929 Bacteria 2657
595 Ga0207664_10104893 3300025929 Unclassified 2341
596 Ga0207664_10183739 3300025929 Unclassified 1796
597 Ga0207664_10184474 3300025929 Bacteria 1793
598 Ga0207664_10244383 3300025929 Bacteria 1564
599 Ga0207644_10050621 3300025931 Bacteria 2978
600 Ga0207706_10000165 3300025933 Bacteria 73590
601 Ga0207706_10000697 3300025933 Bacteria 35077
602 Ga0207706_10634283 3300025933 Bacteria 916
603 Ga0207686_10075110 3300025934 Bacteria 2187
604 Ga0207686_10220321 3300025934 Bacteria 1370
605 Ga0207670_10017570 3300025936 Bacteria 4325
606 Ga0207704_10023509 3300025938 Bacteria 3323
607 Ga0207704_10320897 3300025938 Bacteria 1195
608 Ga0207665_10000574 3300025939 Bacteria 24696
609 Ga0207665_10006271 3300025939 Bacteria 7893
610 Ga0207665_10015745 3300025939 Bacteria 4963
611 Ga0207665_10024235 3300025939 Unclassified 4000
612 Ga0207665_10055857 3300025939 Bacteria 2665
613 Ga0207665_10069262 3300025939 Bacteria 2405
614 Ga0207665_10123730 3300025939 Unclassified 1829
615 Ga0207665_10159131 3300025939 Bacteria 1623
616 Ga0207691_10012852 3300025940 Bacteria 8014
617 Ga0207711_10056108 3300025941 Bacteria 3384
618 Ga0207711_10063010 3300025941 Bacteria 3199
619 Ga0207689_10011276 3300025942 Bacteria 7670
620 Ga0207689_10038232 3300025942 Bacteria 3976
621 Ga0207689_10058924 3300025942 Bacteria 3159
622 Ga0207661_10000527 3300025944 Bacteria 24587
623 Ga0207661_10084577 3300025944 Bacteria 2628
624 Ga0207661_10132826 3300025944 Bacteria 2134
625 Ga0207661_10136623 3300025944 Bacteria 2106
626 Ga0207661_10255053 3300025944 Bacteria 1560
627 Ga0207679_10000234 3300025945 Bacteria 42709
628 Ga0207667_10000996 3300025949 Bacteria 36261
629 Ga0207667_10009402 3300025949 Bacteria 11513
630 Ga0207667_10017575 3300025949 Bacteria 8043
631 Ga0207667_10042095 3300025949 Bacteria 4857
632 Ga0207667_10046556 3300025949 Bacteria 4592
633 Ga0207667_10052321 3300025949 Unclassified 4301
634 Ga0207667_10109678 3300025949 Bacteria 2846
635 Ga0207667_10110734 3300025949 Bacteria 2832
636 Ga0207667_10175955 3300025949 Unclassified 2198
637 Ga0207651_10104937 3300025960 Bacteria 2106
638 Ga0207712_10166043 3300025961 Bacteria 1721
639 Ga0207668_10041204 3300025972 Bacteria 3120
640 Ga0207640_10002918 3300025981 Bacteria 9185
641 Ga0207640_10043256 3300025981 Bacteria 2878
642 Ga0207640_10146219 3300025981 Bacteria 1730
643 Ga0207640_10312142 3300025981 Bacteria 1248
644 Ga0207640_10352437 3300025981 Unclassified 1183
645 Ga0207640_10389088 3300025981 Bacteria 1132
646 Ga0207658_10101197 3300025986 Bacteria 2257
647 Ga0207677_10004359 3300026023 Bacteria 7581
648 Ga0207677_10007078 3300026023 Bacteria 6174
649 Ga0207677_10047949 3300026023 Bacteria 2872
650 Ga0207677_10048703 3300026023 Unclassified 2855
651 Ga0207703_10011133 3300026035 Bacteria 7004
652 Ga0207703_10027168 3300026035 Unclassified 4507
653 Ga0207639_10004383 3300026041 Bacteria 9525
654 Ga0207639_10018888 3300026041 Bacteria 4907
655 Ga0207639_10076063 3300026041 Bacteria 2642
656 Ga0207639_10136695 3300026041 Bacteria 2037
657 Ga0207639_10754401 3300026041 Bacteria 905
658 Ga0207678_10000543 3300026067 Bacteria 34457
659 Ga0207678_10002291 3300026067 Bacteria 17332
660 Ga0207702_10000917 3300026078 Bacteria 30463
661 Ga0207702_10001294 3300026078 Bacteria 25044
662 Ga0207702_10001832 3300026078 Bacteria 20917
663 Ga0207702_10030455 3300026078 Unclassified 4497
664 Ga0207702_10036473 3300026078 Unclassified 4113
665 Ga0207702_10055492 3300026078 Bacteria 3360
666 Ga0207702_10138909 3300026078 Bacteria 2196
667 Ga0207702_10442719 3300026078 Bacteria 1259
668 Ga0207702_10510745 3300026078 Bacteria 1172
669 Ga0207641_10000009 3300026088 Bacteria 407901
670 Ga0207641_10007711 3300026088 Bacteria 8949
671 Ga0207641_10028376 3300026088 Bacteria 4625
672 Ga0207641_10220514 3300026088 Bacteria 1758
673 Ga0207641_10433896 3300026088 Bacteria 1267
674 Ga0207648_10001467 3300026089 Bacteria 25947
675 Ga0207648_10078452 3300026089 Bacteria 2881
676 Ga0207676_10000092 3300026095 Bacteria 80704
677 Ga0207676_10079240 3300026095 Bacteria 2663
678 Ga0207676_10146724 3300026095 Bacteria 2027
679 Ga0207676_10151563 3300026095 Bacteria 1997
680 Ga0207674_10000016 3300026116 Bacteria 182470
681 Ga0207674_10001595 3300026116 Bacteria 29202
682 Ga0207674_10003232 3300026116 Bacteria 20063
683 Ga0207674_10047700 3300026116 Bacteria 4389
684 Ga0207674_10176538 3300026116 Bacteria 2088
685 Ga0207675_100510758 3300026118 Bacteria 1197
686 Ga0207675_100645625 3300026118 Bacteria 1064
687 Ga0207683_10000359 3300026121 Bacteria 41891
688 Ga0207698_10011854 3300026142 Bacteria 5676
689 Ga0207698_10066818 3300026142 Bacteria 2832
690 Ga0207698_10155380 3300026142 Bacteria 1992
691 Ga0207698_10296572 3300026142 Bacteria 1503
692 Ga0207698_10392678 3300026142 Unclassified 1323
693 Ga0207698_10878836 3300026142 Bacteria 903
694 Ga0265356_1000162 3300028017 Bacteria 12140
695 Ga0265355_1004774 3300028036 Unclassified 1029
696 Ga0268266_10018145 3300028379 Bacteria 5998
697 Ga0268265_10032921 3300028380 Bacteria 3763
698 Ga0268264_10055629 3300028381 Bacteria 3307
699 Ga0268264_10284363 3300028381 Bacteria 1551
700 Ga0268264_10327992 3300028381 Bacteria 1450
701 Ga0268264_10749307 3300028381 Bacteria 973
702 Ga0265334_10016857 3300028573 Bacteria 3021
703 Ga0265318_10003005 3300028577 Bacteria 8709
704 Ga0265338_10028115 3300028800 Bacteria 5619
705 Ga0265338_10029543 3300028800 Bacteria 5429
706 Ga0265338_10034925 3300028800 Bacteria 4846
707 Ga0265338_10041360 3300028800 Unclassified 4311
708 Ga0265338_10174800 3300028800 Bacteria 1643
709 Ga0265762_1001567 3300030760 Bacteria 4161
710 Ga0265762_1002908 3300030760 Bacteria 3060
711 Ga0265762_1005112 3300030760 Bacteria 2348
712 Ga0265760_10002726 3300031090 Bacteria 5168
713 Ga0265760_10003481 3300031090 Bacteria 4570
714 Ga0265760_10004804 3300031090 Bacteria 3872
715 Ga0265760_10009647 3300031090 Bacteria 2757
716 Ga0265760_10010933 3300031090 Bacteria 2593
717 Ga0265760_10030200 3300031090 Unclassified 1595
718 Ga0265330_10000856 3300031235 Bacteria 18976
719 Ga0265332_10047116 3300031238 Bacteria 1855
720 Ga0265328_10012831 3300031239 Bacteria 3330
721 Ga0265325_10000587 3300031241 Bacteria 26508
722 Ga0265325_10032379 3300031241 Unclassified 2791
723 Ga0265329_10006567 3300031242 Bacteria 4604
724 Ga0265340_10010293 3300031247 Bacteria 5004
725 Ga0265340_10067538 3300031247 Bacteria 1699
726 Ga0265339_10005863 3300031249 Bacteria 8145
727 Ga0265339_10033204 3300031249 Bacteria 2907
728 Ga0265339_10063453 3300031249 Bacteria 1984
729 Ga0265339_10091731 3300031249 Bacteria 1591
730 Ga0265339_10110786 3300031249 Unclassified 1420
731 Ga0265316_10000922 3300031344 Bacteria 32070
732 Ga0265316_10022666 3300031344 Bacteria 5288
733 Ga0265313_10014732 3300031595 Bacteria 4601
734 Ga0265313_10016258 3300031595 Bacteria 4286
735 Ga0265314_10195327 3300031711 Bacteria 1200
736 Ga0265342_10000544 3300031712 Bacteria 40018
737 Ga0316214_1003861 3300033545 Bacteria 1905
738 Ga0373926_0021249 3300035083 Unclassified 2246
739 Ga0373934_0009342 3300035086 Bacteria 3671
740 Ga0373944_0012417 3300035089 Bacteria 2347
741 Ga0373944_0055282 3300035089 Bacteria 1260
742 Ga0373923_0015084 3300035111 Bacteria 2912
743 Ga0373923_0084605 3300035111 Unclassified 1380
744 Ga0373936_0007163 3300035113 Bacteria 4198
745 Ga0373936_0024521 3300035113 Bacteria 2355
746 Ga0373936_0104169 3300035113 Unclassified 1199
747 Ga0373939_0132934 3300035114 Bacteria 890
748 Ga0373945_0000605 3300035116 Bacteria 10294
749 Ga0373945_0010902 3300035116 Bacteria 2998
750 Ga0373945_0016207 3300035116 Unclassified 2511
751 Ga0373945_0046429 3300035116 Bacteria 1585
752 Ga0373945_0147216 3300035116 Bacteria 952
753 Ga0373956_0003888 3300035119 Bacteria 6004
754 Ga0373957_0005941 3300035120 Bacteria 3818
755 Ga0373943_0000062 3300035170 Bacteria 37301
756 Ga0373943_0005454 3300035170 Bacteria 5723
757 Ga0373943_0017035 3300035170 Unclassified 3322
758 Ga0373943_0025789 3300035170 Bacteria 2749
759 Ga0373946_0030210 3300035171 Bacteria 2162
760 Ga0373946_0033005 3300035171 Bacteria 2081
761 Ga0373946_0077409 3300035171 Bacteria 1450
762 Ga0373955_0111267 3300035172 Bacteria 1583
763 Ga0373942_0027177 3300035207 Bacteria 1487
764 Ga0373961_0085071 3300035241 Bacteria 1001
765 Ga0373924_0000147 3300035410 Bacteria 20622
766 Ga0373931_0042741 3300035691 Bacteria 2384
767 Ga0373931_0093921 3300035691 Bacteria 1676
768 Ga0373931_0123830 3300035691 Bacteria 1480
769 Ga0373931_0261774 3300035691 Bacteria 1055
770 Ga0373935_0007678 3300035692 Bacteria 6463
771 Ga0373935_0019568 3300035692 Bacteria 4127
772 Ga0373935_0047270 3300035692 Bacteria 2721
773 Ga0373935_0138998 3300035692 Bacteria 1639
774 Ga0373935_0380071 3300035692 Unclassified 1011
775 Ga0373927_0000697 3300035695 Bacteria 25696
776 Ga0373927_0022735 3300035695 Unclassified 4106
777 Ga0373927_0040029 3300035695 Unclassified 3041
778 Ga0373927_0044797 3300035695 Unclassified 2862
779 Ga0373933_0025322 3300035724 Bacteria 3402
780 Ga0373933_0140287 3300035724 Bacteria 1526
781 Ga0373947_0001762 3300035725 Bacteria 13250
782 Ga0373947_0007266 3300035725 Bacteria 6417
783 Ga0373947_0044621 3300035725 Bacteria 2650
784 Ga0373947_0174587 3300035725 Bacteria 1396
785 Ga0373947_0205383 3300035725 Bacteria 1290
786 Ga0373947_0276709 3300035725 Bacteria 1115
787 Ga0373937_0000199 3300036401 Bacteria 58972
788 Ga0373937_0026535 3300036401 Bacteria 5234
789 Ga0373937_0031985 3300036401 Bacteria 4770
790 Ga0373937_0247429 3300036401 Bacteria 1680
791 Ga0373937_0408538 3300036401 Bacteria 1288
792 Ga0373937_0473462 3300036401 Unclassified 1190
793 Ga0373925_0001775 3300037068 Bacteria 18009
794 Ga0373925_0002053 3300037068 Bacteria 16595
795 Ga0373925_0011238 3300037068 Bacteria 6494
796 Ga0373925_0013350 3300037068 Bacteria 5945
797 Ga0373925_0030691 3300037068 Bacteria 3946
798 Ga0373925_0163702 3300037068 Bacteria 1753
799 Ga0373925_0243473 3300037068 Bacteria 1441
800 Ga0373925_0342746 3300037068 Bacteria 1212
801 Ga0373925_0579914 3300037068 Bacteria 923
802 Ga0395900_0108226 3300037418 Unclassified 2856
803 Ga0395898_0028972 3300037466 Bacteria 5550
804 Ga0395898_0049498 3300037466 Bacteria 4117
805 Ga0395905_0646779 3300037471 Bacteria 959
806 Ga0436364_0461878 3300037853 Unclassified 1174
807 Ga0436364_0496890 3300037853 Bacteria 7248
808 Ga0436365_0674223 3300039437 Bacteria 2662
809 Ga0436360_0151269 3300039438 Bacteria 4765
810 Ga0436360_0232969 3300039438 Bacteria 8884
811 Ga0436361_0095620 3300039447 Bacteria 3007
812 Ga0436361_0788453 3300039447 Bacteria 15739
813 Ga0436361_0846651 3300039447 Bacteria 1130
814 Ga0436361_0962723 3300039447 Bacteria 26082
815 Ga0436361_1170545 3300039447 Bacteria 4992
816 Ga0436363_0575896 3300039450 Bacteria 9060
817 Ga0436363_0584167 3300039450 Unclassified 2289
818 Ga0436363_0673976 3300039450 Bacteria 1626
819 Ga0436363_1024259 3300039450 Bacteria 1071
820 Ga0436362_0069449 3300039453 Bacteria 7173
821 Ga0436362_0434675 3300039453 Unclassified 1070
822 Ga0451577_0000157 3300042876 Bacteria 151953
823 Ga0451577_0081279 3300042876 Bacteria 2890
824 Ga0451577_0093462 3300042876 Bacteria 2686
825 Ga0453683_0075237 3300044673 Bacteria 2114
826 Ga0453683_0290937 3300044673 Bacteria 1044
827 Ga0466966_0280084 3300044684 Bacteria 1003
828 Ga0466963_0005107 3300044694 Bacteria 7667
829 Ga0466963_0043245 3300044694 Bacteria 2961
830 Ga0466963_0123961 3300044694 Unclassified 1780
831 Ga0466963_0301884 3300044694 Bacteria 1126
832 Ga0453684_0000324 3300044712 Bacteria 201431
833 Ga0453684_1058121 3300044712 Bacteria 860
834 Ga0466959_0087349 3300045049 Bacteria 2243
835 Ga0451576_0041454 3300045051 Bacteria 4867
836 Ga0451576_0081559 3300045051 Unclassified 3364
837 Ga0451576_0205633 3300045051 Bacteria 2056
838 Ga0451576_0819938 3300045051 Bacteria 977
839 Ga0466967_0003579 3300045976 Bacteria 10194
840 Ga0466967_0082774 3300045976 Bacteria 2901
841 Ga0466967_0199035 3300045976 Bacteria 1897
842 Ga0466967_0222027 3300045976 Unclassified 1796
843 Ga0466967_0265648 3300045976 Bacteria 1642
844 Ga0495629_0021734 3300046459 Bacteria 4578
845 Ga0495629_0217435 3300046459 Bacteria 1319
846 Ga0495651_0009841 3300046462 Bacteria 7350
847 Ga0495651_0140485 3300046462 Bacteria 1752
848 Ga0495580_0000204 3300046472 Bacteria 45607
849 Ga0495580_0000264 3300046472 Bacteria 41999
850 Ga0495580_0000349 3300046472 Bacteria 37675
851 Ga0495580_0001787 3300046472 Bacteria 18892
852 Ga0495580_0008710 3300046472 Bacteria 8042
853 Ga0495580_0010802 3300046472 Bacteria 7090
854 Ga0495580_0014895 3300046472 Bacteria 5890
855 Ga0495580_0032412 3300046472 Bacteria 3772
856 Ga0495580_0044577 3300046472 Bacteria 3154
857 Ga0495580_0047967 3300046472 Bacteria 3027
858 Ga0495580_0056017 3300046472 Unclassified 2777
859 Ga0495580_0135683 3300046472 Bacteria 1706
860 Ga0495580_0143534 3300046472 Bacteria 1655
861 Ga0495580_0241953 3300046472 Bacteria 1237
862 Ga0495582_0000791 3300046473 Bacteria 17527
863 Ga0495582_0008953 3300046473 Bacteria 5523
864 Ga0495582_0067127 3300046473 Bacteria 1982
865 Ga0495639_0038918 3300046475 Unclassified 2137
866 Ga0495664_0010671 3300046477 Bacteria 5158
867 Ga0495664_0046400 3300046477 Unclassified 2578
868 Ga0495594_0027749 3300046499 Bacteria 3052
869 Ga0495594_0061106 3300046499 Bacteria 2085
870 Ga0495628_0078360 3300046516 Bacteria 2570
871 Ga0495628_0082992 3300046516 Bacteria 2489
872 Ga0495630_0080010 3300046517 Unclassified 2465
873 Ga0495630_0616610 3300046517 Bacteria 831
874 Ga0495666_0019788 3300046526 Unclassified 3338
875 Ga0495652_0335160 3300046529 Bacteria 1088
876 Ga0495665_0011868 3300046531 Bacteria 4717
877 Ga0495665_0053485 3300046531 Unclassified 2135
878 Ga0495665_0057929 3300046531 Unclassified 2045
879 Ga0495665_0111789 3300046531 Unclassified 1433
880 Ga0495640_0356864 3300046533 Bacteria 902
881 Ga0495586_0048859 3300046535 Bacteria 2287
882 Ga0495586_0061255 3300046535 Bacteria 2048
883 Ga0495587_0110202 3300046536 Bacteria 1582
884 Ga0495587_0113660 3300046536 Bacteria 1554
885 Ga0495645_0096399 3300046543 Bacteria 2108
886 Ga0495667_0324634 3300046559 Unclassified 974
887 Ga0495625_0325291 3300046660 Bacteria 978
888 Ga0495635_0204676 3300046663 Unclassified 1338
889 Ga0495657_0307194 3300046675 Bacteria 945
890 Ga0495599_0100695 3300046678 Bacteria 1801
891 Ga0495623_0054381 3300046679 Bacteria 2526
892 Ga0495658_0007432 3300046683 Bacteria 5421
893 Ga0495658_0029953 3300046683 Bacteria 2951
894 Ga0495658_0353374 3300046683 Bacteria 934
895 Ga0495669_0031535 3300046684 Bacteria 2328
896 Ga0495669_0047925 3300046684 Bacteria 1910
897 Ga0495669_0161947 3300046684 Bacteria 1062
898 Ga0495669_0201649 3300046684 Bacteria 951
899 Ga0495624_0069750 3300046690 Bacteria 2189
900 Ga0495624_0236825 3300046690 Unclassified 1105
901 Ga0495581_0013470 3300047315 Bacteria 4743
902 Ga0495581_0029574 3300047315 Bacteria 3175
903 Ga0495581_0123505 3300047315 Bacteria 1507
904 Ga0495581_0244084 3300047315 Bacteria 1050
905 Ga0495604_0036261 3300047317 Bacteria 3888
906 Ga0495604_0094719 3300047317 Bacteria 2207
907 Ga0495674_0019591 3300047319 Bacteria 6277
908 Ga0495674_0020727 3300047319 Bacteria 6086
909 Ga0495674_0045930 3300047319 Bacteria 3878
910 Ga0495674_0154358 3300047319 Bacteria 1924
911 Ga0495674_0270575 3300047319 Bacteria 1394
912 Ga0495676_0164089 3300047321 Bacteria 1569
913 Ga0495675_0044359 3300047444 Unclassified 2833
914 Ga0495675_0119721 3300047444 Unclassified 1640
915 Ga0495684_0112258 3300047471 Unclassified 2055
916 Ga0495684_0114347 3300047471 Bacteria 2035
917 Ga0495684_0215554 3300047471 Unclassified 1410
918 Ga0495686_0002162 3300047472 Bacteria 19173
919 Ga0495593_0096598 3300047673 Bacteria 1518
920 Ga0495602_0025434 3300048088 Bacteria 5729
921 Ga0495602_0049501 3300048088 Bacteria 3764
922 Ga0495614_0133357 3300048089 Bacteria 1100
923 Ga0496100_0131907 3300048903 Bacteria 1761
924 Ga0496101_0163023 3300048904 Bacteria 1711
925 Ga0496102_0005655 3300048905 Bacteria 10609
926 Ga0496102_0357795 3300048905 Bacteria 1374
927 Ga0496103_0000974 3300048906 Bacteria 20261
928 Ga0496103_0009469 3300048906 Bacteria 5768
929 Ga0496103_0118062 3300048906 Bacteria 1689
930 Ga0496104_0013808 3300048907 Bacteria 7286
931 Ga0496104_0020277 3300048907 Bacteria 6092
932 Ga0496104_0116658 3300048907 Bacteria 2562
933 Ga0496104_0152054 3300048907 Bacteria 2221
934 Ga0496104_0316652 3300048907 Bacteria 1473
935 Ga0496104_0559479 3300048907 Unclassified 1054
936 Ga0496105_0103843 3300048908 Bacteria 2347
937 Ga0496105_0359445 3300048908 Bacteria 1162
938 Ga0496107_0033203 3300048910 Bacteria 3692
939 Ga0496107_0275615 3300048910 Bacteria 1252
940 Ga0496108_0000477 3300048911 Bacteria 32062
941 Ga0496108_0382796 3300048911 Bacteria 1228
942 Ga0496109_0000020 3300048912 Bacteria 189962
943 Ga0496109_0027873 3300048912 Bacteria 5049
944 Ga0496109_0248454 3300048912 Bacteria 1675
945 Ga0496109_0498144 3300048912 Bacteria 1150
946 Ga0496109_0729969 3300048912 Bacteria 928
947 Ga0496110_0004805 3300048913 Bacteria 10525
948 Ga0496110_0031429 3300048913 Bacteria 4581
949 Ga0496110_0130179 3300048913 Bacteria 2272
950 Ga0496111_0028169 3300048914 Bacteria 3979
951 Ga0496111_0291942 3300048914 Bacteria 1209
952 Ga0496111_0444141 3300048914 Bacteria 957
953 Ga0496112_0000402 3300048915 Bacteria 28279
954 Ga0496112_0002357 3300048915 Bacteria 15176
955 Ga0496112_0013108 3300048915 Bacteria 7650
956 Ga0496112_0064959 3300048915 Bacteria 3602
957 Ga0496112_0138641 3300048915 Bacteria 2402
958 Ga0496112_0195828 3300048915 Bacteria 1981
959 Ga0496112_0291631 3300048915 Bacteria 1577
960 Ga0496112_0295265 3300048915 Bacteria 1566
961 Ga0496112_0444787 3300048915 Unclassified 1234
962 Ga0496112_0504415 3300048915 Bacteria 1145
963 Ga0496113_0000340 3300048916 Bacteria 22214
964 Ga0496113_0031949 3300048916 Bacteria 3824
965 Ga0496113_0097364 3300048916 Unclassified 2276
966 Ga0496113_0471256 3300048916 Bacteria 1009
967 Ga0496114_0151687 3300048917 Bacteria 2011
968 Ga0496115_0004190 3300048918 Bacteria 10425
969 Ga0496115_0031991 3300048918 Bacteria 4149
970 Ga0496115_0461849 3300048918 Unclassified 1024
971 Ga0496126_0014680 3300048929 Bacteria 7907
972 Ga0501073_0105252 3300049589 Bacteria 1958
973 nmdc:mga09592_29197_c1 3300050508 Bacteria 4586
974 nmdc:mga0n895_233_c1 3300050512 Bacteria 35314
975 nmdc:mga0rr50_133795_c1 3300050513 Bacteria 1988
976 nmdc:mga08x19_2121_c1 3300050514 Bacteria 12128
977 nmdc:mga08x19_2456_c1 3300050514 Bacteria 11272
978 nmdc:mga08x19_5912_c1 3300050514 Bacteria 7235
979 nmdc:mga08x19_66516_c1 3300050514 Bacteria 2342
980 Ga0495601_0008130 3300053077 Bacteria 6187
981 Ga0495601_0098456 3300053077 Bacteria 1887
982 Ga0495601_0265815 3300053077 Bacteria 1119
983 Ga0495612_0193600 3300053078 Bacteria 895

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005536 Ga0070697_100000006 Ga0070697_100000006126 236
2 3300049589 Ga0501073_0105252 Ga0501073_0105252_1223_1945 237
3 3300025922 Ga0207646_10000192 Ga0207646_1000019234 240
4 3300005355 Ga0070671_100203273 Ga0070671_1002032732 244
5 3300009177 Ga0105248_10296583 Ga0105248_102965831 244
6 3300014969 Ga0157376_10016053 Ga0157376_100160532 244
7 3300046533 Ga0495640_0356864 Ga0495640_0356864_28_768 244
8 3300048904 Ga0496101_0163023 Ga0496101_0163023_477_1211 244
9 3300048912 Ga0496109_0248454 Ga0496109_0248454_444_1178 244
10 3300048913 Ga0496110_0130179 Ga0496110_0130179_998_1732 244
11 3300048914 Ga0496111_0291942 Ga0496111_0291942_398_1132 244
12 3300048915 Ga0496112_0291631 Ga0496112_0291631_820_1554 244
13 3300048918 Ga0496115_0031991 Ga0496115_0031991_2351_3085 244
14 3300005435 Ga0070714_100006809 Ga0070714_1000068094 246
15 3300005436 Ga0070713_100003409 Ga0070713_1000034093 246
16 3300006028 Ga0070717_10022350 Ga0070717_100223504 246
17 3300025928 Ga0207700_10032067 Ga0207700_100320674 246
18 3300025929 Ga0207664_10104893 Ga0207664_101048932 246
19 3300005434 Ga0070709_10078324 Ga0070709_100783243 247
20 3300025906 Ga0207699_10300912 Ga0207699_103009121 247
21 3300025928 Ga0207700_10303786 Ga0207700_103037861 247
22 3300013296 Ga0157374_10056435 Ga0157374_100564354 248
23 3300021361 Ga0213872_10015651 Ga0213872_100156513 248
24 3300042876 Ga0451577_0093462 Ga0451577_0093462_1911_2657 248
25 3300046459 Ga0495629_0217435 Ga0495629_0217435_525_1271 248
26 3300048929 Ga0496126_0014680 Ga0496126_0014680_296_1042 248
27 3300048906 Ga0496103_0118062 Ga0496103_0118062_436_1188 250
28 3300005536 Ga0070697_100380274 Ga0070697_1003802742 253
29 3300006028 Ga0070717_10011082 Ga0070717_100110823 253
30 3300006173 Ga0070716_100356636 Ga0070716_1003566361 253
31 3300007076 Ga0075435_100060985 Ga0075435_1000609852 253
32 3300025910 Ga0207684_10177942 Ga0207684_101779422 254
33 3300005436 Ga0070713_100079727 Ga0070713_1000797271 255
34 3300005445 Ga0070708_100153520 Ga0070708_1001535202 255
35 3300005467 Ga0070706_100000038 Ga0070706_1000000382 255
36 3300005467 Ga0070706_100051467 Ga0070706_1000514673 255
37 3300005468 Ga0070707_100063007 Ga0070707_1000630073 255
38 3300005471 Ga0070698_100041619 Ga0070698_1000416194 255
39 3300005518 Ga0070699_100010942 Ga0070699_1000109423 255
40 3300005536 Ga0070697_100003316 Ga0070697_1000033165 255
41 3300006028 Ga0070717_10129298 Ga0070717_101292982 255
42 3300025922 Ga0207646_10005288 Ga0207646_100052888 255
43 3300025922 Ga0207646_10012851 Ga0207646_100128514 255
44 3300044673 Ga0453683_0290937 Ga0453683_0290937_222_1019 256
45 3300005336 Ga0070680_100218418 Ga0070680_1002184182 257
46 3300005467 Ga0070706_100001729 Ga0070706_10000172931 257
47 3300005471 Ga0070698_100001423 Ga0070698_10000142310 257
48 3300005536 Ga0070697_100001791 Ga0070697_10000179111 257
49 3300005536 Ga0070697_100002182 Ga0070697_1000021829 257
50 3300005536 Ga0070697_100046837 Ga0070697_1000468373 257
51 3300005546 Ga0070696_100004493 Ga0070696_1000044938 257
52 3300006028 Ga0070717_10127647 Ga0070717_101276472 257
53 3300006173 Ga0070716_100146633 Ga0070716_1001466332 257
54 3300006844 Ga0075428_100043757 Ga0075428_1000437575 257
55 3300006880 Ga0075429_100034596 Ga0075429_1000345965 257
56 3300009147 Ga0114129_10342869 Ga0114129_103428691 257
57 3300013105 Ga0157369_10030338 Ga0157369_100303385 257
58 3300021388 Ga0213875_10030852 Ga0213875_100308522 257
59 3300025912 Ga0207707_10372176 Ga0207707_103721761 257
60 3300025929 Ga0207664_10184474 Ga0207664_101844743 257
61 3300025939 Ga0207665_10055857 Ga0207665_100558572 257
62 3300037418 Ga0395900_0108226 Ga0395900_0108226_1591_2364 257
63 3300037466 Ga0395898_0049498 Ga0395898_0049498_575_1348 257
64 3300037853 Ga0436364_0496890 Ga0436364_0496890_6237_7016 257
65 3300046499 Ga0495594_0061106 Ga0495594_0061106_568_1356 257
66 3300050508 nmdc:mga09592_29197_c1 nmdc:mga09592_29197_c1_256_1053 257
67 3300005445 Ga0070708_100152512 Ga0070708_1001525123 259
68 3300005445 Ga0070708_100158622 Ga0070708_1001586223 259
69 3300005467 Ga0070706_100023126 Ga0070706_1000231264 259
70 3300005468 Ga0070707_100000434 Ga0070707_10000043430 259
71 3300005468 Ga0070707_100006967 Ga0070707_1000069675 259
72 3300005471 Ga0070698_100003377 Ga0070698_1000033776 259
73 3300005471 Ga0070698_100036597 Ga0070698_1000365973 259
74 3300005471 Ga0070698_100206325 Ga0070698_1002063252 259
75 3300005518 Ga0070699_100272061 Ga0070699_1002720613 259
76 3300005536 Ga0070697_100008447 Ga0070697_1000084478 259
77 3300006028 Ga0070717_10040600 Ga0070717_100406005 259
78 3300007265 Ga0099794_10169107 Ga0099794_101691072 259
79 3300025910 Ga0207684_10000008 Ga0207684_1000000845 259
80 3300025910 Ga0207684_10004879 Ga0207684_100048795 259
81 3300025922 Ga0207646_10001274 Ga0207646_1000127411 259
82 3300025939 Ga0207665_10159131 Ga0207665_101591312 259
83 3300005549 Ga0070704_100106680 Ga0070704_1001066802 260
84 3300025910 Ga0207684_10000129 Ga0207684_10000129122 260
85 3300035120 Ga0373957_0005941 Ga0373957_0005941_1652_2437 261
86 3300005547 Ga0070693_100045664 Ga0070693_1000456643 262
87 3300005563 Ga0068855_100087134 Ga0068855_1000871343 262
88 3300005563 Ga0068855_100245965 Ga0068855_1002459652 262
89 3300005578 Ga0068854_100343750 Ga0068854_1003437501 262
90 3300005614 Ga0068856_100037127 Ga0068856_1000371272 262
91 3300005614 Ga0068856_100311400 Ga0068856_1003114002 262
92 3300006028 Ga0070717_10220711 Ga0070717_102207111 262
93 3300009093 Ga0105240_10332602 Ga0105240_103326022 262
94 3300009545 Ga0105237_10512137 Ga0105237_105121371 262
95 3300009551 Ga0105238_10026343 Ga0105238_100263432 262
96 3300013104 Ga0157370_10014896 Ga0157370_100148964 262
97 3300013105 Ga0157369_10056220 Ga0157369_100562203 262
98 3300013105 Ga0157369_10433028 Ga0157369_104330282 262
99 3300013307 Ga0157372_10036371 Ga0157372_100363713 262
100 3300013307 Ga0157372_10178253 Ga0157372_101782532 262
101 3300025913 Ga0207695_10022507 Ga0207695_100225073 262
102 3300025913 Ga0207695_10259304 Ga0207695_102593042 262
103 3300025949 Ga0207667_10109678 Ga0207667_101096782 262
104 3300025981 Ga0207640_10312142 Ga0207640_103121421 262
105 3300026041 Ga0207639_10754401 Ga0207639_107544011 262
106 3300026078 Ga0207702_10138909 Ga0207702_101389092 262
107 3300026142 Ga0207698_10878836 Ga0207698_108788361 262
108 3300037471 Ga0395905_0646779 Ga0395905_0646779_149_940 262
109 3300044694 Ga0466963_0043245 Ga0466963_0043245_2042_2830 262
110 3300045049 Ga0466959_0087349 Ga0466959_0087349_370_1158 262
111 3300046526 Ga0495666_0019788 Ga0495666_0019788_2181_2969 262
112 3300002459 JGI24751J29686_10009361 JGI24751J29686_100093612 263
113 3300005327 Ga0070658_10074824 Ga0070658_100748243 263
114 3300005328 Ga0070676_10003837 Ga0070676_100038373 263
115 3300005328 Ga0070676_10017075 Ga0070676_100170752 263
116 3300005329 Ga0070683_100004635 Ga0070683_1000046353 263
117 3300005329 Ga0070683_100097817 Ga0070683_1000978172 263
118 3300005329 Ga0070683_100344593 Ga0070683_1003445931 263
119 3300005330 Ga0070690_100021225 Ga0070690_1000212253 263
120 3300005330 Ga0070690_100070037 Ga0070690_1000700372 263
121 3300005330 Ga0070690_100181853 Ga0070690_1001818531 263
122 3300005330 Ga0070690_100291651 Ga0070690_1002916512 263
123 3300005331 Ga0070670_100001284 Ga0070670_1000012844 263
124 3300005331 Ga0070670_100114216 Ga0070670_1001142162 263
125 3300005333 Ga0070677_10186993 Ga0070677_101869931 263
126 3300005334 Ga0068869_100030462 Ga0068869_1000304623 263
127 3300005334 Ga0068869_100067071 Ga0068869_1000670712 263
128 3300005336 Ga0070680_100089347 Ga0070680_1000893471 263
129 3300005336 Ga0070680_100137977 Ga0070680_1001379772 263
130 3300005337 Ga0070682_100005772 Ga0070682_1000057726 263
131 3300005337 Ga0070682_100057639 Ga0070682_1000576392 263
132 3300005338 Ga0068868_100006219 Ga0068868_1000062197 263
133 3300005338 Ga0068868_100009581 Ga0068868_1000095818 263
134 3300005338 Ga0068868_100073410 Ga0068868_1000734102 263
135 3300005338 Ga0068868_100090243 Ga0068868_1000902432 263
136 3300005339 Ga0070660_100000802 Ga0070660_10000080211 263
137 3300005339 Ga0070660_100059442 Ga0070660_1000594423 263
138 3300005340 Ga0070689_100007128 Ga0070689_1000071286 263
139 3300005341 Ga0070691_10091632 Ga0070691_100916321 263
140 3300005343 Ga0070687_100011620 Ga0070687_1000116203 263
141 3300005344 Ga0070661_100033575 Ga0070661_1000335752 263
142 3300005353 Ga0070669_100135828 Ga0070669_1001358282 263
143 3300005353 Ga0070669_100192164 Ga0070669_1001921642 263
144 3300005356 Ga0070674_100253192 Ga0070674_1002531921 263
145 3300005364 Ga0070673_100116863 Ga0070673_1001168633 263
146 3300005364 Ga0070673_100213038 Ga0070673_1002130382 263
147 3300005365 Ga0070688_100000324 Ga0070688_1000003245 263
148 3300005365 Ga0070688_100100176 Ga0070688_1001001761 263
149 3300005366 Ga0070659_100049589 Ga0070659_1000495893 263
150 3300005366 Ga0070659_100061181 Ga0070659_1000611813 263
151 3300005367 Ga0070667_100259526 Ga0070667_1002595262 263
152 3300005367 Ga0070667_100552629 Ga0070667_1005526292 263
153 3300005434 Ga0070709_10006939 Ga0070709_100069393 263
154 3300005434 Ga0070709_10022285 Ga0070709_100222852 263
155 3300005434 Ga0070709_10030430 Ga0070709_100304301 263
156 3300005434 Ga0070709_10037044 Ga0070709_100370442 263
157 3300005434 Ga0070709_10087316 Ga0070709_100873162 263
158 3300005434 Ga0070709_10104062 Ga0070709_101040622 263
159 3300005434 Ga0070709_10480320 Ga0070709_104803201 263
160 3300005435 Ga0070714_100000060 Ga0070714_10000006090 263
161 3300005435 Ga0070714_100176484 Ga0070714_1001764842 263
162 3300005435 Ga0070714_100210467 Ga0070714_1002104672 263
163 3300005435 Ga0070714_100289739 Ga0070714_1002897392 263
164 3300005435 Ga0070714_100296418 Ga0070714_1002964182 263
165 3300005435 Ga0070714_100296486 Ga0070714_1002964861 263
166 3300005435 Ga0070714_100418040 Ga0070714_1004180401 263
167 3300005435 Ga0070714_100456793 Ga0070714_1004567932 263
168 3300005436 Ga0070713_100000037 Ga0070713_1000000377 263
169 3300005436 Ga0070713_100001036 Ga0070713_1000010366 263
170 3300005436 Ga0070713_100002374 Ga0070713_1000023747 263
171 3300005436 Ga0070713_100037517 Ga0070713_1000375172 263
172 3300005436 Ga0070713_100045935 Ga0070713_1000459352 263
173 3300005436 Ga0070713_100083375 Ga0070713_1000833752 263
174 3300005436 Ga0070713_100141496 Ga0070713_1001414962 263
175 3300005436 Ga0070713_100175324 Ga0070713_1001753242 263
176 3300005436 Ga0070713_100186960 Ga0070713_1001869601 263
177 3300005437 Ga0070710_10001259 Ga0070710_100012594 263
178 3300005437 Ga0070710_10008303 Ga0070710_100083032 263
179 3300005437 Ga0070710_10030625 Ga0070710_100306252 263
180 3300005437 Ga0070710_10128132 Ga0070710_101281321 263
181 3300005439 Ga0070711_100000620 Ga0070711_1000006207 263
182 3300005439 Ga0070711_100000948 Ga0070711_1000009485 263
183 3300005439 Ga0070711_100004411 Ga0070711_1000044113 263
184 3300005439 Ga0070711_100020771 Ga0070711_1000207714 263
185 3300005439 Ga0070711_100024294 Ga0070711_1000242943 263
186 3300005439 Ga0070711_100029169 Ga0070711_1000291693 263
187 3300005439 Ga0070711_100175599 Ga0070711_1001755991 263
188 3300005439 Ga0070711_100261692 Ga0070711_1002616922 263
189 3300005439 Ga0070711_100402942 Ga0070711_1004029421 263
190 3300005445 Ga0070708_100004680 Ga0070708_1000046804 263
191 3300005445 Ga0070708_100020691 Ga0070708_1000206913 263
192 3300005445 Ga0070708_100040631 Ga0070708_1000406312 263
193 3300005445 Ga0070708_100044681 Ga0070708_1000446814 263
194 3300005445 Ga0070708_100076078 Ga0070708_1000760783 263
195 3300005455 Ga0070663_100014599 Ga0070663_1000145992 263
196 3300005456 Ga0070678_100021562 Ga0070678_1000215623 263
197 3300005457 Ga0070662_100007867 Ga0070662_1000078672 263
198 3300005457 Ga0070662_100146223 Ga0070662_1001462232 263
199 3300005458 Ga0070681_10000104 Ga0070681_1000010453 263
200 3300005458 Ga0070681_10034658 Ga0070681_100346582 263
201 3300005458 Ga0070681_10035198 Ga0070681_100351982 263
202 3300005459 Ga0068867_100025667 Ga0068867_1000256672 263
203 3300005459 Ga0068867_100050861 Ga0068867_1000508612 263
204 3300005466 Ga0070685_10071696 Ga0070685_100716962 263
205 3300005467 Ga0070706_100002504 Ga0070706_10000250415 263
206 3300005467 Ga0070706_100025311 Ga0070706_1000253113 263
207 3300005467 Ga0070706_100304336 Ga0070706_1003043362 263
208 3300005468 Ga0070707_100023128 Ga0070707_1000231281 263
209 3300005468 Ga0070707_100046153 Ga0070707_1000461535 263
210 3300005468 Ga0070707_100736377 Ga0070707_1007363771 263
211 3300005518 Ga0070699_100007223 Ga0070699_1000072232 263
212 3300005518 Ga0070699_100377728 Ga0070699_1003777282 263
213 3300005530 Ga0070679_100001719 Ga0070679_1000017195 263
214 3300005530 Ga0070679_100264421 Ga0070679_1002644212 263
215 3300005530 Ga0070679_100412060 Ga0070679_1004120602 263
216 3300005535 Ga0070684_100003436 Ga0070684_1000034366 263
217 3300005535 Ga0070684_100426253 Ga0070684_1004262531 263
218 3300005536 Ga0070697_100000353 Ga0070697_10000035334 263
219 3300005536 Ga0070697_100005151 Ga0070697_1000051515 263
220 3300005536 Ga0070697_100046258 Ga0070697_1000462584 263
221 3300005539 Ga0068853_100026560 Ga0068853_1000265602 263
222 3300005539 Ga0068853_100076866 Ga0068853_1000768663 263
223 3300005543 Ga0070672_100049512 Ga0070672_1000495122 263
224 3300005543 Ga0070672_100668756 Ga0070672_1006687561 263
225 3300005545 Ga0070695_100079374 Ga0070695_1000793742 263
226 3300005546 Ga0070696_100288433 Ga0070696_1002884332 263
227 3300005547 Ga0070693_100143587 Ga0070693_1001435871 263
228 3300005563 Ga0068855_100000238 Ga0068855_1000002388 263
229 3300005563 Ga0068855_100000770 Ga0068855_10000077010 263
230 3300005563 Ga0068855_100017711 Ga0068855_1000177115 263
231 3300005563 Ga0068855_100580780 Ga0068855_1005807802 263
232 3300005564 Ga0070664_100004949 Ga0070664_1000049499 263
233 3300005564 Ga0070664_100057595 Ga0070664_1000575953 263
234 3300005564 Ga0070664_100284704 Ga0070664_1002847042 263
235 3300005577 Ga0068857_100000113 Ga0068857_10000011336 263
236 3300005577 Ga0068857_100034290 Ga0068857_1000342903 263
237 3300005577 Ga0068857_100327278 Ga0068857_1003272781 263
238 3300005578 Ga0068854_100001797 Ga0068854_1000017975 263
239 3300005578 Ga0068854_100275860 Ga0068854_1002758602 263
240 3300005614 Ga0068856_100000096 Ga0068856_10000009631 263
241 3300005614 Ga0068856_100000305 Ga0068856_10000030524 263
242 3300005614 Ga0068856_100036461 Ga0068856_1000364612 263
243 3300005614 Ga0068856_100057632 Ga0068856_1000576322 263
244 3300005614 Ga0068856_100172849 Ga0068856_1001728492 263
245 3300005614 Ga0068856_100260540 Ga0068856_1002605402 263
246 3300005615 Ga0070702_100052923 Ga0070702_1000529232 263
247 3300005616 Ga0068852_100036346 Ga0068852_1000363463 263
248 3300005616 Ga0068852_100118358 Ga0068852_1001183582 263
249 3300005616 Ga0068852_100321911 Ga0068852_1003219112 263
250 3300005617 Ga0068859_100002165 Ga0068859_1000021655 263
251 3300005617 Ga0068859_100042731 Ga0068859_1000427313 263
252 3300005617 Ga0068859_100341998 Ga0068859_1003419982 263
253 3300005618 Ga0068864_100014466 Ga0068864_1000144664 263
254 3300005618 Ga0068864_100048061 Ga0068864_1000480613 263
255 3300005618 Ga0068864_100049877 Ga0068864_1000498773 263
256 3300005718 Ga0068866_10004147 Ga0068866_100041474 263
257 3300005718 Ga0068866_10022795 Ga0068866_100227952 263
258 3300005718 Ga0068866_10050018 Ga0068866_100500182 263
259 3300005834 Ga0068851_10003975 Ga0068851_100039755 263
260 3300005834 Ga0068851_10010200 Ga0068851_100102002 263
261 3300005834 Ga0068851_10052956 Ga0068851_100529561 263
262 3300005840 Ga0068870_10012650 Ga0068870_100126502 263
263 3300005840 Ga0068870_10022256 Ga0068870_100222562 263
264 3300005841 Ga0068863_100010652 Ga0068863_1000106522 263
265 3300005842 Ga0068858_100007172 Ga0068858_1000071729 263
266 3300005842 Ga0068858_100049365 Ga0068858_1000493652 263
267 3300005842 Ga0068858_100080573 Ga0068858_1000805732 263
268 3300005842 Ga0068858_100112600 Ga0068858_1001126002 263
269 3300005842 Ga0068858_100375574 Ga0068858_1003755741 263
270 3300005843 Ga0068860_100017206 Ga0068860_1000172063 263
271 3300005843 Ga0068860_100088983 Ga0068860_1000889833 263
272 3300005843 Ga0068860_100116329 Ga0068860_1001163293 263
273 3300005843 Ga0068860_100352285 Ga0068860_1003522852 263
274 3300005843 Ga0068860_100583698 Ga0068860_1005836981 263
275 3300005844 Ga0068862_100029494 Ga0068862_1000294941 263
276 3300005844 Ga0068862_100033899 Ga0068862_1000338993 263
277 3300005844 Ga0068862_100120541 Ga0068862_1001205412 263
278 3300006028 Ga0070717_10001269 Ga0070717_100012697 263
279 3300006028 Ga0070717_10001355 Ga0070717_1000135515 263
280 3300006028 Ga0070717_10012374 Ga0070717_100123744 263
281 3300006028 Ga0070717_10018677 Ga0070717_100186774 263
282 3300006028 Ga0070717_10025940 Ga0070717_100259405 263
283 3300006028 Ga0070717_10053823 Ga0070717_100538233 263
284 3300006028 Ga0070717_10060782 Ga0070717_100607823 263
285 3300006028 Ga0070717_10110676 Ga0070717_101106762 263
286 3300006028 Ga0070717_10252334 Ga0070717_102523342 263
287 3300006028 Ga0070717_10259840 Ga0070717_102598403 263
288 3300006028 Ga0070717_10273993 Ga0070717_102739931 263
289 3300006028 Ga0070717_10305490 Ga0070717_103054902 263
290 3300006163 Ga0070715_10004939 Ga0070715_100049393 263
291 3300006163 Ga0070715_10010431 Ga0070715_100104313 263
292 3300006173 Ga0070716_100001188 Ga0070716_1000011883 263
293 3300006173 Ga0070716_100015187 Ga0070716_1000151873 263
294 3300006173 Ga0070716_100016018 Ga0070716_1000160182 263
295 3300006173 Ga0070716_100020877 Ga0070716_1000208772 263
296 3300006173 Ga0070716_100048212 Ga0070716_1000482122 263
297 3300006173 Ga0070716_100211478 Ga0070716_1002114782 263
298 3300006175 Ga0070712_100000010 Ga0070712_10000001069 263
299 3300006175 Ga0070712_100000853 Ga0070712_1000008537 263
300 3300006175 Ga0070712_100001607 Ga0070712_1000016077 263
301 3300006175 Ga0070712_100003139 Ga0070712_1000031392 263
302 3300006175 Ga0070712_100004072 Ga0070712_1000040725 263
303 3300006175 Ga0070712_100005197 Ga0070712_1000051975 263
304 3300006175 Ga0070712_100023121 Ga0070712_1000231213 263
305 3300006175 Ga0070712_100111071 Ga0070712_1001110712 263
306 3300006237 Ga0097621_100000022 Ga0097621_10000002252 263
307 3300006237 Ga0097621_100002166 Ga0097621_1000021662 263
308 3300006237 Ga0097621_100054796 Ga0097621_1000547962 263
309 3300006358 Ga0068871_100000401 Ga0068871_10000040116 263
310 3300006358 Ga0068871_100000478 Ga0068871_1000004789 263
311 3300006358 Ga0068871_100001634 Ga0068871_10000163412 263
312 3300006358 Ga0068871_100012481 Ga0068871_1000124817 263
313 3300006881 Ga0068865_100366366 Ga0068865_1003663662 263
314 3300006881 Ga0068865_100413274 Ga0068865_1004132741 263
315 3300006914 Ga0075436_100068139 Ga0075436_1000681392 263
316 3300006914 Ga0075436_100123941 Ga0075436_1001239412 263
317 3300006931 Ga0097620_100002165 Ga0097620_1000021655 263
318 3300006931 Ga0097620_100042732 Ga0097620_1000427323 263
319 3300006931 Ga0097620_100341947 Ga0097620_1003419472 263
320 3300007076 Ga0075435_100120643 Ga0075435_1001206433 263
321 3300009092 Ga0105250_10067574 Ga0105250_100675742 263
322 3300009093 Ga0105240_10016218 Ga0105240_100162185 263
323 3300009093 Ga0105240_10029357 Ga0105240_100293574 263
324 3300009093 Ga0105240_10047329 Ga0105240_100473293 263
325 3300009093 Ga0105240_10076743 Ga0105240_100767434 263
326 3300009098 Ga0105245_10001938 Ga0105245_100019386 263
327 3300009098 Ga0105245_10003931 Ga0105245_1000393112 263
328 3300009098 Ga0105245_10470443 Ga0105245_104704432 263
329 3300009101 Ga0105247_10033932 Ga0105247_100339323 263
330 3300009148 Ga0105243_10035619 Ga0105243_100356192 263
331 3300009174 Ga0105241_10002924 Ga0105241_100029244 263
332 3300009174 Ga0105241_10010624 Ga0105241_100106244 263
333 3300009174 Ga0105241_10015386 Ga0105241_100153862 263
334 3300009174 Ga0105241_10123962 Ga0105241_101239622 263
335 3300009174 Ga0105241_10180419 Ga0105241_101804192 263
336 3300009176 Ga0105242_10007431 Ga0105242_100074315 263
337 3300009176 Ga0105242_10071878 Ga0105242_100718783 263
338 3300009176 Ga0105242_10099348 Ga0105242_100993482 263
339 3300009176 Ga0105242_10195570 Ga0105242_101955702 263
340 3300009177 Ga0105248_10033388 Ga0105248_100333886 263
341 3300009177 Ga0105248_10056174 Ga0105248_100561743 263
342 3300009545 Ga0105237_10048488 Ga0105237_100484883 263
343 3300009545 Ga0105237_10069800 Ga0105237_100698003 263
344 3300009545 Ga0105237_10078171 Ga0105237_100781711 263
345 3300009545 Ga0105237_10185899 Ga0105237_101858993 263
346 3300009545 Ga0105237_10574885 Ga0105237_105748851 263
347 3300009551 Ga0105238_10000644 Ga0105238_100006443 263
348 3300009551 Ga0105238_10028879 Ga0105238_100288796 263
349 3300009553 Ga0105249_10240596 Ga0105249_102405961 263
350 3300010375 Ga0105239_10131415 Ga0105239_101314152 263
351 3300010375 Ga0105239_10167565 Ga0105239_101675652 263
352 3300011119 Ga0105246_10136449 Ga0105246_101364491 263
353 3300013100 Ga0157373_10003491 Ga0157373_100034913 263
354 3300013100 Ga0157373_10004886 Ga0157373_100048866 263
355 3300013100 Ga0157373_10083664 Ga0157373_100836642 263
356 3300013102 Ga0157371_10002263 Ga0157371_1000226311 263
357 3300013102 Ga0157371_10168627 Ga0157371_101686272 263
358 3300013102 Ga0157371_10198595 Ga0157371_101985952 263
359 3300013104 Ga0157370_10142216 Ga0157370_101422163 263
360 3300013105 Ga0157369_10000034 Ga0157369_10000034147 263
361 3300013105 Ga0157369_10036369 Ga0157369_100363695 263
362 3300013105 Ga0157369_10078967 Ga0157369_100789673 263
363 3300013105 Ga0157369_10171846 Ga0157369_101718462 263
364 3300013105 Ga0157369_10540275 Ga0157369_105402752 263
365 3300013296 Ga0157374_10000052 Ga0157374_1000005295 263
366 3300013296 Ga0157374_10001074 Ga0157374_100010741 263
367 3300013296 Ga0157374_10136419 Ga0157374_101364192 263
368 3300013296 Ga0157374_10279409 Ga0157374_102794092 263
369 3300013297 Ga0157378_10000227 Ga0157378_1000022715 263
370 3300013297 Ga0157378_10000764 Ga0157378_100007648 263
371 3300013297 Ga0157378_10003664 Ga0157378_100036645 263
372 3300013297 Ga0157378_10006776 Ga0157378_100067765 263
373 3300013297 Ga0157378_10240087 Ga0157378_102400871 263
374 3300013306 Ga0163162_10011916 Ga0163162_100119162 263
375 3300013306 Ga0163162_10137660 Ga0163162_101376602 263
376 3300013307 Ga0157372_10001472 Ga0157372_1000147214 263
377 3300013307 Ga0157372_10001995 Ga0157372_100019957 263
378 3300013307 Ga0157372_10002166 Ga0157372_1000216617 263
379 3300013307 Ga0157372_10014707 Ga0157372_100147076 263
380 3300013307 Ga0157372_10016205 Ga0157372_100162053 263
381 3300013307 Ga0157372_10022908 Ga0157372_100229084 263
382 3300013307 Ga0157372_10105039 Ga0157372_101050393 263
383 3300013307 Ga0157372_10118467 Ga0157372_101184672 263
384 3300013308 Ga0157375_10177951 Ga0157375_101779512 263
385 3300014325 Ga0163163_10007470 Ga0163163_100074708 263
386 3300014325 Ga0163163_10030293 Ga0163163_100302935 263
387 3300014497 Ga0182008_10103465 Ga0182008_101034651 263
388 3300014745 Ga0157377_10001902 Ga0157377_100019028 263
389 3300014745 Ga0157377_10121451 Ga0157377_101214511 263
390 3300014968 Ga0157379_10006003 Ga0157379_100060033 263
391 3300014968 Ga0157379_10030951 Ga0157379_100309512 263
392 3300014969 Ga0157376_10006922 Ga0157376_100069226 263
393 3300014969 Ga0157376_10112787 Ga0157376_101127873 263
394 3300014969 Ga0157376_10364971 Ga0157376_103649711 263
395 3300017792 Ga0163161_10001086 Ga0163161_100010865 263
396 3300021377 Ga0213874_10065778 Ga0213874_100657782 263
397 3300022730 Ga0224570_100055 Ga0224570_1000552 263
398 3300024225 Ga0224572_1000977 Ga0224572_10009774 263
399 3300024225 Ga0224572_1002033 Ga0224572_10020331 263
400 3300024225 Ga0224572_1010090 Ga0224572_10100902 263
401 3300024227 Ga0228598_1000089 Ga0228598_10000896 263
402 3300024227 Ga0228598_1008520 Ga0228598_10085202 263
403 3300024227 Ga0228598_1008675 Ga0228598_10086752 263
404 3300025321 Ga0207656_10025805 Ga0207656_100258052 263
405 3300025893 Ga0207682_10045188 Ga0207682_100451882 263
406 3300025898 Ga0207692_10000836 Ga0207692_100008366 263
407 3300025898 Ga0207692_10004455 Ga0207692_100044554 263
408 3300025898 Ga0207692_10011811 Ga0207692_100118113 263
409 3300025898 Ga0207692_10241471 Ga0207692_102414712 263
410 3300025901 Ga0207688_10002577 Ga0207688_100025777 263
411 3300025903 Ga0207680_10041332 Ga0207680_100413322 263
412 3300025904 Ga0207647_10019921 Ga0207647_100199214 263
413 3300025904 Ga0207647_10076277 Ga0207647_100762772 263
414 3300025905 Ga0207685_10006742 Ga0207685_100067423 263
415 3300025905 Ga0207685_10049821 Ga0207685_100498211 263
416 3300025905 Ga0207685_10065744 Ga0207685_100657442 263
417 3300025906 Ga0207699_10005574 Ga0207699_100055747 263
418 3300025906 Ga0207699_10015443 Ga0207699_100154432 263
419 3300025906 Ga0207699_10042891 Ga0207699_100428913 263
420 3300025906 Ga0207699_10154867 Ga0207699_101548672 263
421 3300025906 Ga0207699_10369721 Ga0207699_103697211 263
422 3300025906 Ga0207699_10389705 Ga0207699_103897051 263
423 3300025907 Ga0207645_10000273 Ga0207645_1000027319 263
424 3300025907 Ga0207645_10020001 Ga0207645_100200014 263
425 3300025908 Ga0207643_10039543 Ga0207643_100395432 263
426 3300025909 Ga0207705_10255548 Ga0207705_102555482 263
427 3300025910 Ga0207684_10010433 Ga0207684_100104334 263
428 3300025910 Ga0207684_10262908 Ga0207684_102629082 263
429 3300025911 Ga0207654_10002620 Ga0207654_100026206 263
430 3300025911 Ga0207654_10038356 Ga0207654_100383561 263
431 3300025911 Ga0207654_10169580 Ga0207654_101695801 263
432 3300025912 Ga0207707_10000496 Ga0207707_1000049631 263
433 3300025912 Ga0207707_10013650 Ga0207707_100136505 263
434 3300025912 Ga0207707_10017593 Ga0207707_100175934 263
435 3300025913 Ga0207695_10021896 Ga0207695_100218962 263
436 3300025913 Ga0207695_10026035 Ga0207695_100260352 263
437 3300025913 Ga0207695_10110079 Ga0207695_101100792 263
438 3300025914 Ga0207671_10140271 Ga0207671_101402712 263
439 3300025914 Ga0207671_10330708 Ga0207671_103307082 263
440 3300025915 Ga0207693_10000004 Ga0207693_100000046 263
441 3300025915 Ga0207693_10000029 Ga0207693_1000002976 263
442 3300025915 Ga0207693_10000985 Ga0207693_100009857 263
443 3300025915 Ga0207693_10005725 Ga0207693_100057252 263
444 3300025915 Ga0207693_10010392 Ga0207693_100103925 263
445 3300025915 Ga0207693_10015396 Ga0207693_100153964 263
446 3300025915 Ga0207693_10086647 Ga0207693_100866472 263
447 3300025915 Ga0207693_10338491 Ga0207693_103384912 263
448 3300025916 Ga0207663_10006013 Ga0207663_100060135 263
449 3300025916 Ga0207663_10014560 Ga0207663_100145604 263
450 3300025916 Ga0207663_10030476 Ga0207663_100304762 263
451 3300025916 Ga0207663_10063236 Ga0207663_100632362 263
452 3300025916 Ga0207663_10226343 Ga0207663_102263431 263
453 3300025917 Ga0207660_10034630 Ga0207660_100346302 263
454 3300025918 Ga0207662_10011575 Ga0207662_100115753 263
455 3300025919 Ga0207657_10006409 Ga0207657_1000640911 263
456 3300025919 Ga0207657_10021886 Ga0207657_100218862 263
457 3300025920 Ga0207649_10004928 Ga0207649_100049283 263
458 3300025921 Ga0207652_10128419 Ga0207652_101284191 263
459 3300025921 Ga0207652_10228957 Ga0207652_102289572 263
460 3300025921 Ga0207652_10666291 Ga0207652_106662911 263
461 3300025922 Ga0207646_10025076 Ga0207646_100250765 263
462 3300025922 Ga0207646_10031161 Ga0207646_100311614 263
463 3300025922 Ga0207646_10035668 Ga0207646_100356682 263
464 3300025922 Ga0207646_10590910 Ga0207646_105909101 263
465 3300025923 Ga0207681_10066824 Ga0207681_100668242 263
466 3300025924 Ga0207694_10002382 Ga0207694_100023826 263
467 3300025925 Ga0207650_10000036 Ga0207650_1000003660 263
468 3300025927 Ga0207687_10029492 Ga0207687_100294922 263
469 3300025928 Ga0207700_10000173 Ga0207700_1000017321 263
470 3300025928 Ga0207700_10000428 Ga0207700_1000042812 263
471 3300025928 Ga0207700_10009584 Ga0207700_100095844 263
472 3300025928 Ga0207700_10023665 Ga0207700_100236656 263
473 3300025928 Ga0207700_10056627 Ga0207700_100566272 263
474 3300025928 Ga0207700_10099463 Ga0207700_100994632 263
475 3300025928 Ga0207700_10126471 Ga0207700_101264712 263
476 3300025928 Ga0207700_10151898 Ga0207700_101518982 263
477 3300025928 Ga0207700_10290386 Ga0207700_102903862 263
478 3300025929 Ga0207664_10000017 Ga0207664_10000017206 263
479 3300025929 Ga0207664_10079865 Ga0207664_100798652 263
480 3300025929 Ga0207664_10183739 Ga0207664_101837391 263
481 3300025929 Ga0207664_10244383 Ga0207664_102443832 263
482 3300025931 Ga0207644_10050621 Ga0207644_100506212 263
483 3300025933 Ga0207706_10000165 Ga0207706_1000016545 263
484 3300025933 Ga0207706_10000697 Ga0207706_1000069712 263
485 3300025934 Ga0207686_10075110 Ga0207686_100751102 263
486 3300025936 Ga0207670_10017570 Ga0207670_100175703 263
487 3300025938 Ga0207704_10320897 Ga0207704_103208972 263
488 3300025939 Ga0207665_10000574 Ga0207665_100005743 263
489 3300025939 Ga0207665_10006271 Ga0207665_100062713 263
490 3300025939 Ga0207665_10024235 Ga0207665_100242352 263
491 3300025939 Ga0207665_10069262 Ga0207665_100692623 263
492 3300025939 Ga0207665_10123730 Ga0207665_101237303 263
493 3300025940 Ga0207691_10012852 Ga0207691_100128525 263
494 3300025941 Ga0207711_10056108 Ga0207711_100561083 263
495 3300025941 Ga0207711_10063010 Ga0207711_100630102 263
496 3300025942 Ga0207689_10011276 Ga0207689_100112762 263
497 3300025942 Ga0207689_10038232 Ga0207689_100382324 263
498 3300025942 Ga0207689_10058924 Ga0207689_100589243 263
499 3300025944 Ga0207661_10000527 Ga0207661_100005273 263
500 3300025944 Ga0207661_10084577 Ga0207661_100845771 263
501 3300025944 Ga0207661_10136623 Ga0207661_101366231 263
502 3300025944 Ga0207661_10255053 Ga0207661_102550532 263
503 3300025945 Ga0207679_10000234 Ga0207679_1000023437 263
504 3300025949 Ga0207667_10000996 Ga0207667_1000099613 263
505 3300025949 Ga0207667_10009402 Ga0207667_100094022 263
506 3300025949 Ga0207667_10042095 Ga0207667_100420954 263
507 3300025949 Ga0207667_10046556 Ga0207667_100465562 263
508 3300025949 Ga0207667_10175955 Ga0207667_101759551 263
509 3300025960 Ga0207651_10104937 Ga0207651_101049372 263
510 3300025961 Ga0207712_10166043 Ga0207712_101660432 263
511 3300025972 Ga0207668_10041204 Ga0207668_100412042 263
512 3300025981 Ga0207640_10002918 Ga0207640_100029184 263
513 3300025981 Ga0207640_10043256 Ga0207640_100432561 263
514 3300025981 Ga0207640_10146219 Ga0207640_101462192 263
515 3300025981 Ga0207640_10389088 Ga0207640_103890881 263
516 3300025986 Ga0207658_10101197 Ga0207658_101011972 263
517 3300026023 Ga0207677_10004359 Ga0207677_100043592 263
518 3300026023 Ga0207677_10007078 Ga0207677_100070785 263
519 3300026023 Ga0207677_10047949 Ga0207677_100479492 263
520 3300026023 Ga0207677_10048703 Ga0207677_100487032 263
521 3300026035 Ga0207703_10011133 Ga0207703_100111333 263
522 3300026035 Ga0207703_10027168 Ga0207703_100271682 263
523 3300026041 Ga0207639_10004383 Ga0207639_100043832 263
524 3300026041 Ga0207639_10018888 Ga0207639_100188883 263
525 3300026041 Ga0207639_10136695 Ga0207639_101366952 263
526 3300026067 Ga0207678_10000543 Ga0207678_100005439 263
527 3300026067 Ga0207678_10002291 Ga0207678_100022912 263
528 3300026078 Ga0207702_10000917 Ga0207702_1000091714 263
529 3300026078 Ga0207702_10001294 Ga0207702_1000129416 263
530 3300026078 Ga0207702_10001832 Ga0207702_1000183211 263
531 3300026078 Ga0207702_10030455 Ga0207702_100304552 263
532 3300026078 Ga0207702_10036473 Ga0207702_100364733 263
533 3300026078 Ga0207702_10510745 Ga0207702_105107452 263
534 3300026088 Ga0207641_10000009 Ga0207641_1000000946 263
535 3300026088 Ga0207641_10007711 Ga0207641_100077112 263
536 3300026088 Ga0207641_10433896 Ga0207641_104338962 263
537 3300026089 Ga0207648_10001467 Ga0207648_100014674 263
538 3300026089 Ga0207648_10078452 Ga0207648_100784523 263
539 3300026095 Ga0207676_10000092 Ga0207676_1000009222 263
540 3300026095 Ga0207676_10151563 Ga0207676_101515633 263
541 3300026116 Ga0207674_10000016 Ga0207674_10000016112 263
542 3300026116 Ga0207674_10001595 Ga0207674_1000159511 263
543 3300026118 Ga0207675_100510758 Ga0207675_1005107582 263
544 3300026121 Ga0207683_10000359 Ga0207683_1000035919 263
545 3300026142 Ga0207698_10011854 Ga0207698_100118543 263
546 3300026142 Ga0207698_10155380 Ga0207698_101553802 263
547 3300026142 Ga0207698_10296572 Ga0207698_102965721 263
548 3300028017 Ga0265356_1000162 Ga0265356_10001625 263
549 3300028036 Ga0265355_1004774 Ga0265355_10047741 263
550 3300028379 Ga0268266_10018145 Ga0268266_100181452 263
551 3300028380 Ga0268265_10032921 Ga0268265_100329213 263
552 3300028381 Ga0268264_10055629 Ga0268264_100556292 263
553 3300028381 Ga0268264_10284363 Ga0268264_102843632 263
554 3300028381 Ga0268264_10327992 Ga0268264_103279921 263
555 3300028381 Ga0268264_10749307 Ga0268264_107493071 263
556 3300028800 Ga0265338_10028115 Ga0265338_100281154 263
557 3300028800 Ga0265338_10034925 Ga0265338_100349252 263
558 3300028800 Ga0265338_10041360 Ga0265338_100413603 263
559 3300028800 Ga0265338_10174800 Ga0265338_101748002 263
560 3300030760 Ga0265762_1001567 Ga0265762_10015672 263
561 3300030760 Ga0265762_1002908 Ga0265762_10029082 263
562 3300030760 Ga0265762_1005112 Ga0265762_10051122 263
563 3300031090 Ga0265760_10002726 Ga0265760_100027263 263
564 3300031090 Ga0265760_10003481 Ga0265760_100034812 263
565 3300031090 Ga0265760_10004804 Ga0265760_100048042 263
566 3300031090 Ga0265760_10010933 Ga0265760_100109332 263
567 3300031090 Ga0265760_10030200 Ga0265760_100302001 263
568 3300031241 Ga0265325_10032379 Ga0265325_100323792 263
569 3300031247 Ga0265340_10067538 Ga0265340_100675382 263
570 3300031249 Ga0265339_10033204 Ga0265339_100332042 263
571 3300031249 Ga0265339_10091731 Ga0265339_100917311 263
572 3300031249 Ga0265339_10110786 Ga0265339_101107862 263
573 3300031344 Ga0265316_10022666 Ga0265316_100226662 263
574 3300031711 Ga0265314_10195327 Ga0265314_101953272 263
575 3300033545 Ga0316214_1003861 Ga0316214_10038612 263
576 3300035083 Ga0373926_0021249 Ga0373926_0021249_617_1408 263
577 3300035086 Ga0373934_0009342 Ga0373934_0009342_2780_3571 263
578 3300035089 Ga0373944_0012417 Ga0373944_0012417_1236_2027 263
579 3300035111 Ga0373923_0084605 Ga0373923_0084605_224_1015 263
580 3300035113 Ga0373936_0007163 Ga0373936_0007163_1048_1839 263
581 3300035113 Ga0373936_0024521 Ga0373936_0024521_1048_1839 263
582 3300035113 Ga0373936_0104169 Ga0373936_0104169_360_1151 263
583 3300035114 Ga0373939_0132934 Ga0373939_0132934_48_839 263
584 3300035116 Ga0373945_0010902 Ga0373945_0010902_160_951 263
585 3300035116 Ga0373945_0016207 Ga0373945_0016207_1437_2228 263
586 3300035116 Ga0373945_0147216 Ga0373945_0147216_15_806 263
587 3300035170 Ga0373943_0000062 Ga0373943_0000062_8552_9343 263
588 3300035170 Ga0373943_0005454 Ga0373943_0005454_518_1309 263
589 3300035170 Ga0373943_0017035 Ga0373943_0017035_2503_3294 263
590 3300035171 Ga0373946_0030210 Ga0373946_0030210_177_968 263
591 3300035172 Ga0373955_0111267 Ga0373955_0111267_253_1044 263
592 3300035207 Ga0373942_0027177 Ga0373942_0027177_628_1419 263
593 3300035241 Ga0373961_0085071 Ga0373961_0085071_196_987 263
594 3300035691 Ga0373931_0042741 Ga0373931_0042741_517_1308 263
595 3300035691 Ga0373931_0093921 Ga0373931_0093921_798_1589 263
596 3300035691 Ga0373931_0123830 Ga0373931_0123830_254_1045 263
597 3300035691 Ga0373931_0261774 Ga0373931_0261774_57_848 263
598 3300035692 Ga0373935_0007678 Ga0373935_0007678_210_1001 263
599 3300035692 Ga0373935_0380071 Ga0373935_0380071_69_860 263
600 3300035695 Ga0373927_0000697 Ga0373927_0000697_23470_24261 263
601 3300035695 Ga0373927_0022735 Ga0373927_0022735_488_1279 263
602 3300035695 Ga0373927_0040029 Ga0373927_0040029_956_1747 263
603 3300035695 Ga0373927_0044797 Ga0373927_0044797_298_1089 263
604 3300035724 Ga0373933_0025322 Ga0373933_0025322_2486_3277 263
605 3300035724 Ga0373933_0140287 Ga0373933_0140287_662_1453 263
606 3300035725 Ga0373947_0001762 Ga0373947_0001762_11227_12018 263
607 3300035725 Ga0373947_0007266 Ga0373947_0007266_4380_5171 263
608 3300035725 Ga0373947_0174587 Ga0373947_0174587_453_1244 263
609 3300035725 Ga0373947_0276709 Ga0373947_0276709_115_906 263
610 3300036401 Ga0373937_0031985 Ga0373937_0031985_1889_2680 263
611 3300036401 Ga0373937_0247429 Ga0373937_0247429_764_1555 263
612 3300037068 Ga0373925_0001775 Ga0373925_0001775_3286_4077 263
613 3300037068 Ga0373925_0002053 Ga0373925_0002053_9463_10254 263
614 3300037068 Ga0373925_0013350 Ga0373925_0013350_4364_5155 263
615 3300037068 Ga0373925_0163702 Ga0373925_0163702_751_1542 263
616 3300037068 Ga0373925_0243473 Ga0373925_0243473_447_1238 263
617 3300037068 Ga0373925_0579914 Ga0373925_0579914_17_808 263
618 3300037853 Ga0436364_0461878 Ga0436364_0461878_70_861 263
619 3300039450 Ga0436363_0584167 Ga0436363_0584167_1018_1809 263
620 3300039450 Ga0436363_0673976 Ga0436363_0673976_440_1231 263
621 3300039450 Ga0436363_1024259 Ga0436363_1024259_86_877 263
622 3300039453 Ga0436362_0434675 Ga0436362_0434675_151_942 263
623 3300045051 Ga0451576_0819938 Ga0451576_0819938_142_933 263
624 3300045976 Ga0466967_0265648 Ga0466967_0265648_585_1376 263
625 3300046462 Ga0495651_0140485 Ga0495651_0140485_106_897 263
626 3300046472 Ga0495580_0000204 Ga0495580_0000204_39184_39975 263
627 3300046472 Ga0495580_0000349 Ga0495580_0000349_7089_7880 263
628 3300046472 Ga0495580_0001787 Ga0495580_0001787_7844_8635 263
629 3300046472 Ga0495580_0008710 Ga0495580_0008710_1095_1886 263
630 3300046472 Ga0495580_0010802 Ga0495580_0010802_5701_6492 263
631 3300046472 Ga0495580_0014895 Ga0495580_0014895_3945_4736 263
632 3300046472 Ga0495580_0032412 Ga0495580_0032412_1128_1919 263
633 3300046472 Ga0495580_0044577 Ga0495580_0044577_780_1571 263
634 3300046472 Ga0495580_0047967 Ga0495580_0047967_1356_2147 263
635 3300046472 Ga0495580_0056017 Ga0495580_0056017_1296_2087 263
636 3300046472 Ga0495580_0143534 Ga0495580_0143534_62_853 263
637 3300046472 Ga0495580_0241953 Ga0495580_0241953_413_1204 263
638 3300046473 Ga0495582_0008953 Ga0495582_0008953_1625_2416 263
639 3300046475 Ga0495639_0038918 Ga0495639_0038918_1031_1822 263
640 3300046477 Ga0495664_0010671 Ga0495664_0010671_1606_2397 263
641 3300046516 Ga0495628_0078360 Ga0495628_0078360_736_1527 263
642 3300046517 Ga0495630_0080010 Ga0495630_0080010_1305_2096 263
643 3300046517 Ga0495630_0616610 Ga0495630_0616610_30_821 263
644 3300046531 Ga0495665_0053485 Ga0495665_0053485_1113_1904 263
645 3300046531 Ga0495665_0057929 Ga0495665_0057929_683_1474 263
646 3300046536 Ga0495587_0113660 Ga0495587_0113660_228_1019 263
647 3300046543 Ga0495645_0096399 Ga0495645_0096399_177_968 263
648 3300046678 Ga0495599_0100695 Ga0495599_0100695_360_1151 263
649 3300046683 Ga0495658_0353374 Ga0495658_0353374_117_908 263
650 3300046690 Ga0495624_0069750 Ga0495624_0069750_1246_2037 263
651 3300046690 Ga0495624_0236825 Ga0495624_0236825_113_904 263
652 3300047317 Ga0495604_0094719 Ga0495604_0094719_137_928 263
653 3300047319 Ga0495674_0019591 Ga0495674_0019591_492_1283 263
654 3300047319 Ga0495674_0045930 Ga0495674_0045930_1437_2228 263
655 3300047319 Ga0495674_0154358 Ga0495674_0154358_67_858 263
656 3300047319 Ga0495674_0270575 Ga0495674_0270575_58_849 263
657 3300047321 Ga0495676_0164089 Ga0495676_0164089_585_1376 263
658 3300047471 Ga0495684_0112258 Ga0495684_0112258_556_1347 263
659 3300048088 Ga0495602_0025434 Ga0495602_0025434_1213_2004 263
660 3300048088 Ga0495602_0049501 Ga0495602_0049501_827_1618 263
661 3300048089 Ga0495614_0133357 Ga0495614_0133357_177_968 263
662 3300048905 Ga0496102_0005655 Ga0496102_0005655_8013_8804 263
663 3300048906 Ga0496103_0000974 Ga0496103_0000974_18712_19503 263
664 3300048907 Ga0496104_0116658 Ga0496104_0116658_783_1574 263
665 3300048907 Ga0496104_0152054 Ga0496104_0152054_1047_1838 263
666 3300048910 Ga0496107_0033203 Ga0496107_0033203_855_1646 263
667 3300048911 Ga0496108_0000477 Ga0496108_0000477_18327_19118 263
668 3300048911 Ga0496108_0382796 Ga0496108_0382796_377_1168 263
669 3300048912 Ga0496109_0000020 Ga0496109_0000020_179589_180380 263
670 3300048912 Ga0496109_0729969 Ga0496109_0729969_44_835 263
671 3300048913 Ga0496110_0004805 Ga0496110_0004805_5047_5838 263
672 3300048914 Ga0496111_0444141 Ga0496111_0444141_56_847 263
673 3300048915 Ga0496112_0000402 Ga0496112_0000402_24020_24811 263
674 3300048915 Ga0496112_0002357 Ga0496112_0002357_5145_5936 263
675 3300048915 Ga0496112_0195828 Ga0496112_0195828_1105_1896 263
676 3300048915 Ga0496112_0295265 Ga0496112_0295265_25_816 263
677 3300048915 Ga0496112_0444787 Ga0496112_0444787_316_1107 263
678 3300048915 Ga0496112_0504415 Ga0496112_0504415_328_1119 263
679 3300048916 Ga0496113_0031949 Ga0496113_0031949_2973_3764 263
680 3300048916 Ga0496113_0471256 Ga0496113_0471256_173_964 263
681 3300048918 Ga0496115_0461849 Ga0496115_0461849_108_899 263
682 3300050514 nmdc:mga08x19_2121_c1 nmdc:mga08x19_2121_c1_5940_6746 263
683 3300050514 nmdc:mga08x19_2456_c1 nmdc:mga08x19_2456_c1_8317_9108 263
684 3300050514 nmdc:mga08x19_66516_c1 nmdc:mga08x19_66516_c1_577_1368 263
685 3300053078 Ga0495612_0193600 Ga0495612_0193600_84_875 263
686 3300005435 Ga0070714_100074082 Ga0070714_1000740822 264
687 3300005436 Ga0070713_100271111 Ga0070713_1002711112 264
688 3300005439 Ga0070711_100210306 Ga0070711_1002103062 264
689 3300005445 Ga0070708_100001252 Ga0070708_10000125212 264
690 3300005445 Ga0070708_100009817 Ga0070708_1000098173 264
691 3300005467 Ga0070706_100004861 Ga0070706_1000048614 264
692 3300005467 Ga0070706_100009047 Ga0070706_1000090474 264
693 3300005468 Ga0070707_100004944 Ga0070707_1000049448 264
694 3300005468 Ga0070707_100005109 Ga0070707_1000051095 264
695 3300005471 Ga0070698_100003126 Ga0070698_1000031268 264
696 3300005518 Ga0070699_100001451 Ga0070699_1000014516 264
697 3300005536 Ga0070697_100000656 Ga0070697_10000065617 264
698 3300005536 Ga0070697_100243012 Ga0070697_1002430122 264
699 3300006914 Ga0075436_100005023 Ga0075436_1000050235 264
700 3300013306 Ga0163162_10512783 Ga0163162_105127832 264
701 3300013307 Ga0157372_10262633 Ga0157372_102626332 264
702 3300013307 Ga0157372_10961393 Ga0157372_109613931 264
703 3300014968 Ga0157379_10184343 Ga0157379_101843432 264
704 3300021377 Ga0213874_10001758 Ga0213874_100017582 264
705 3300021384 Ga0213876_10153075 Ga0213876_101530752 264
706 3300025910 Ga0207684_10000677 Ga0207684_100006778 264
707 3300025910 Ga0207684_10098685 Ga0207684_100986853 264
708 3300025916 Ga0207663_10380112 Ga0207663_103801121 264
709 3300025922 Ga0207646_10003352 Ga0207646_100033528 264
710 3300025922 Ga0207646_10008896 Ga0207646_100088965 264
711 3300025928 Ga0207700_10253931 Ga0207700_102539312 264
712 3300025929 Ga0207664_10033597 Ga0207664_100335973 264
713 3300026088 Ga0207641_10028376 Ga0207641_100283762 264
714 3300031090 Ga0265760_10009647 Ga0265760_100096473 264
715 3300039437 Ga0436365_0674223 Ga0436365_0674223_332_1126 264
716 3300039450 Ga0436363_0575896 Ga0436363_0575896_5620_6414 264
717 3300039453 Ga0436362_0069449 Ga0436362_0069449_402_1196 264
718 3300044684 Ga0466966_0280084 Ga0466966_0280084_194_988 264
719 3300045051 Ga0451576_0081559 Ga0451576_0081559_893_1687 264
720 3300047472 Ga0495686_0002162 Ga0495686_0002162_9760_10554 264
721 3300050512 nmdc:mga0n895_233_c1 nmdc:mga0n895_233_c1_34320_35114 264
722 3300050513 nmdc:mga0rr50_133795_c1 nmdc:mga0rr50_133795_c1_31_825 264
723 3300050514 nmdc:mga08x19_5912_c1 nmdc:mga08x19_5912_c1_1674_2468 264
724 3300004799 Ga0058863_11948358 Ga0058863_119483582 265
725 3300004800 Ga0058861_12038421 Ga0058861_120384211 265
726 3300005290 Ga0065712_10168060 Ga0065712_101680602 265
727 3300005336 Ga0070680_100007843 Ga0070680_1000078433 265
728 3300005338 Ga0068868_100054428 Ga0068868_1000544282 265
729 3300005339 Ga0070660_100105033 Ga0070660_1001050332 265
730 3300005345 Ga0070692_10134893 Ga0070692_101348931 265
731 3300005366 Ga0070659_100365931 Ga0070659_1003659312 265
732 3300005434 Ga0070709_10121001 Ga0070709_101210012 265
733 3300005435 Ga0070714_100009371 Ga0070714_1000093712 265
734 3300005435 Ga0070714_100045952 Ga0070714_1000459522 265
735 3300005435 Ga0070714_100910826 Ga0070714_1009108261 265
736 3300005436 Ga0070713_100112837 Ga0070713_1001128372 265
737 3300005436 Ga0070713_100353140 Ga0070713_1003531402 265
738 3300005436 Ga0070713_100565869 Ga0070713_1005658691 265
739 3300005439 Ga0070711_100003458 Ga0070711_1000034586 265
740 3300005439 Ga0070711_100229975 Ga0070711_1002299752 265
741 3300005439 Ga0070711_100309430 Ga0070711_1003094301 265
742 3300005458 Ga0070681_10002085 Ga0070681_1000208516 265
743 3300005458 Ga0070681_10045960 Ga0070681_100459602 265
744 3300005458 Ga0070681_10052615 Ga0070681_100526153 265
745 3300005458 Ga0070681_10053927 Ga0070681_100539273 265
746 3300005458 Ga0070681_10404448 Ga0070681_104044482 265
747 3300005458 Ga0070681_10423409 Ga0070681_104234091 265
748 3300005530 Ga0070679_100004624 Ga0070679_10000462410 265
749 3300005530 Ga0070679_100010477 Ga0070679_1000104772 265
750 3300005535 Ga0070684_100016314 Ga0070684_1000163144 265
751 3300005535 Ga0070684_100230180 Ga0070684_1002301801 265
752 3300005539 Ga0068853_100082946 Ga0068853_1000829463 265
753 3300005547 Ga0070693_100020544 Ga0070693_1000205442 265
754 3300005547 Ga0070693_100068857 Ga0070693_1000688572 265
755 3300005563 Ga0068855_100145735 Ga0068855_1001457352 265
756 3300005563 Ga0068855_100153502 Ga0068855_1001535022 265
757 3300005563 Ga0068855_100327964 Ga0068855_1003279642 265
758 3300005563 Ga0068855_100356410 Ga0068855_1003564102 265
759 3300005577 Ga0068857_100000432 Ga0068857_10000043214 265
760 3300005577 Ga0068857_100030346 Ga0068857_1000303463 265
761 3300005577 Ga0068857_100084219 Ga0068857_1000842193 265
762 3300005577 Ga0068857_100151267 Ga0068857_1001512672 265
763 3300005614 Ga0068856_100000243 Ga0068856_10000024337 265
764 3300005614 Ga0068856_100163222 Ga0068856_1001632222 265
765 3300005616 Ga0068852_100078088 Ga0068852_1000780882 265
766 3300005617 Ga0068859_100408396 Ga0068859_1004083962 265
767 3300005618 Ga0068864_100016673 Ga0068864_1000166733 265
768 3300005719 Ga0068861_100113945 Ga0068861_1001139452 265
769 3300005841 Ga0068863_100036962 Ga0068863_1000369623 265
770 3300006028 Ga0070717_10049675 Ga0070717_100496752 265
771 3300006028 Ga0070717_10257901 Ga0070717_102579012 265
772 3300006173 Ga0070716_100443128 Ga0070716_1004431281 265
773 3300006175 Ga0070712_100015289 Ga0070712_1000152893 265
774 3300006175 Ga0070712_100204364 Ga0070712_1002043641 265
775 3300006175 Ga0070712_100298760 Ga0070712_1002987602 265
776 3300006881 Ga0068865_100434269 Ga0068865_1004342691 265
777 3300006931 Ga0097620_100408353 Ga0097620_1004083532 265
778 3300009093 Ga0105240_10068952 Ga0105240_100689524 265
779 3300009093 Ga0105240_10081807 Ga0105240_100818072 265
780 3300009093 Ga0105240_10499335 Ga0105240_104993352 265
781 3300009098 Ga0105245_10015594 Ga0105245_100155943 265
782 3300009098 Ga0105245_10067885 Ga0105245_100678852 265
783 3300009101 Ga0105247_10090735 Ga0105247_100907351 265
784 3300009174 Ga0105241_10202572 Ga0105241_102025721 265
785 3300009177 Ga0105248_10149281 Ga0105248_101492811 265
786 3300009545 Ga0105237_10375315 Ga0105237_103753152 265
787 3300009551 Ga0105238_10087928 Ga0105238_100879283 265
788 3300009551 Ga0105238_10437052 Ga0105238_104370522 265
789 3300010375 Ga0105239_10165289 Ga0105239_101652892 265
790 3300013100 Ga0157373_10026739 Ga0157373_100267393 265
791 3300013102 Ga0157371_10082681 Ga0157371_100826812 265
792 3300013104 Ga0157370_10086651 Ga0157370_100866512 265
793 3300013105 Ga0157369_10000786 Ga0157369_1000078614 265
794 3300013105 Ga0157369_10028869 Ga0157369_100288694 265
795 3300013105 Ga0157369_10180195 Ga0157369_101801952 265
796 3300013296 Ga0157374_10037641 Ga0157374_100376412 265
797 3300013296 Ga0157374_10146951 Ga0157374_101469512 265
798 3300013297 Ga0157378_10156963 Ga0157378_101569632 265
799 3300013307 Ga0157372_10034354 Ga0157372_100343543 265
800 3300013307 Ga0157372_10088229 Ga0157372_100882292 265
801 3300014325 Ga0163163_10032223 Ga0163163_100322235 265
802 3300020080 Ga0206350_11446456 Ga0206350_114464561 265
803 3300021361 Ga0213872_10003667 Ga0213872_100036675 265
804 3300021361 Ga0213872_10010363 Ga0213872_100103635 265
805 3300025898 Ga0207692_10135553 Ga0207692_101355532 265
806 3300025898 Ga0207692_10154770 Ga0207692_101547702 265
807 3300025912 Ga0207707_10001602 Ga0207707_1000160217 265
808 3300025912 Ga0207707_10013616 Ga0207707_100136165 265
809 3300025912 Ga0207707_10064435 Ga0207707_100644352 265
810 3300025912 Ga0207707_10070875 Ga0207707_100708752 265
811 3300025912 Ga0207707_10103774 Ga0207707_101037742 265
812 3300025913 Ga0207695_10021651 Ga0207695_100216514 265
813 3300025913 Ga0207695_10125998 Ga0207695_101259982 265
814 3300025913 Ga0207695_10190748 Ga0207695_101907482 265
815 3300025915 Ga0207693_10023355 Ga0207693_100233553 265
816 3300025915 Ga0207693_10028716 Ga0207693_100287163 265
817 3300025915 Ga0207693_10109362 Ga0207693_101093622 265
818 3300025915 Ga0207693_10228336 Ga0207693_102283361 265
819 3300025916 Ga0207663_10023177 Ga0207663_100231773 265
820 3300025917 Ga0207660_10001588 Ga0207660_100015883 265
821 3300025917 Ga0207660_10161004 Ga0207660_101610042 265
822 3300025917 Ga0207660_10204382 Ga0207660_102043822 265
823 3300025919 Ga0207657_10020387 Ga0207657_100203874 265
824 3300025921 Ga0207652_10045080 Ga0207652_100450802 265
825 3300025921 Ga0207652_10295294 Ga0207652_102952942 265
826 3300025925 Ga0207650_10003223 Ga0207650_100032239 265
827 3300025927 Ga0207687_10006171 Ga0207687_100061714 265
828 3300025927 Ga0207687_10247391 Ga0207687_102473911 265
829 3300025928 Ga0207700_10074471 Ga0207700_100744712 265
830 3300025929 Ga0207664_10003989 Ga0207664_100039894 265
831 3300025929 Ga0207664_10042383 Ga0207664_100423832 265
832 3300025933 Ga0207706_10634283 Ga0207706_106342831 265
833 3300025934 Ga0207686_10220321 Ga0207686_102203211 265
834 3300025938 Ga0207704_10023509 Ga0207704_100235093 265
835 3300025939 Ga0207665_10015745 Ga0207665_100157453 265
836 3300025944 Ga0207661_10132826 Ga0207661_101328262 265
837 3300025949 Ga0207667_10017575 Ga0207667_100175754 265
838 3300025949 Ga0207667_10052321 Ga0207667_100523214 265
839 3300025949 Ga0207667_10110734 Ga0207667_101107343 265
840 3300025981 Ga0207640_10352437 Ga0207640_103524372 265
841 3300026041 Ga0207639_10076063 Ga0207639_100760632 265
842 3300026078 Ga0207702_10055492 Ga0207702_100554922 265
843 3300026078 Ga0207702_10442719 Ga0207702_104427192 265
844 3300026088 Ga0207641_10220514 Ga0207641_102205142 265
845 3300026095 Ga0207676_10079240 Ga0207676_100792402 265
846 3300026095 Ga0207676_10146724 Ga0207676_101467242 265
847 3300026116 Ga0207674_10003232 Ga0207674_1000323216 265
848 3300026116 Ga0207674_10047700 Ga0207674_100477003 265
849 3300026116 Ga0207674_10176538 Ga0207674_101765382 265
850 3300026118 Ga0207675_100645625 Ga0207675_1006456251 265
851 3300026142 Ga0207698_10066818 Ga0207698_100668182 265
852 3300026142 Ga0207698_10392678 Ga0207698_103926782 265
853 3300028573 Ga0265334_10016857 Ga0265334_100168572 265
854 3300028577 Ga0265318_10003005 Ga0265318_100030057 265
855 3300028800 Ga0265338_10029543 Ga0265338_100295434 265
856 3300031235 Ga0265330_10000856 Ga0265330_1000085616 265
857 3300031238 Ga0265332_10047116 Ga0265332_100471162 265
858 3300031239 Ga0265328_10012831 Ga0265328_100128312 265
859 3300031241 Ga0265325_10000587 Ga0265325_100005874 265
860 3300031242 Ga0265329_10006567 Ga0265329_100065674 265
861 3300031247 Ga0265340_10010293 Ga0265340_100102936 265
862 3300031249 Ga0265339_10005863 Ga0265339_100058633 265
863 3300031249 Ga0265339_10063453 Ga0265339_100634533 265
864 3300031344 Ga0265316_10000922 Ga0265316_100009224 265
865 3300031595 Ga0265313_10014732 Ga0265313_100147325 265
866 3300031595 Ga0265313_10016258 Ga0265313_100162583 265
867 3300031712 Ga0265342_10000544 Ga0265342_1000054427 265
868 3300035089 Ga0373944_0055282 Ga0373944_0055282_48_845 265
869 3300035111 Ga0373923_0015084 Ga0373923_0015084_409_1206 265
870 3300035116 Ga0373945_0000605 Ga0373945_0000605_7362_8159 265
871 3300035170 Ga0373943_0025789 Ga0373943_0025789_1709_2506 265
872 3300035171 Ga0373946_0033005 Ga0373946_0033005_1015_1812 265
873 3300035410 Ga0373924_0000147 Ga0373924_0000147_17113_17910 265
874 3300035692 Ga0373935_0019568 Ga0373935_0019568_3038_3835 265
875 3300035725 Ga0373947_0044621 Ga0373947_0044621_343_1140 265
876 3300036401 Ga0373937_0000199 Ga0373937_0000199_51684_52481 265
877 3300036401 Ga0373937_0408538 Ga0373937_0408538_142_945 265
878 3300036401 Ga0373937_0473462 Ga0373937_0473462_260_1057 265
879 3300037466 Ga0395898_0028972 Ga0395898_0028972_3331_4128 265
880 3300039438 Ga0436360_0151269 Ga0436360_0151269_3890_4687 265
881 3300039438 Ga0436360_0232969 Ga0436360_0232969_2739_3536 265
882 3300039447 Ga0436361_0095620 Ga0436361_0095620_275_1072 265
883 3300039447 Ga0436361_0846651 Ga0436361_0846651_114_947 265
884 3300039447 Ga0436361_0962723 Ga0436361_0962723_21598_22395 265
885 3300039447 Ga0436361_1170545 Ga0436361_1170545_167_964 265
886 3300042876 Ga0451577_0000157 Ga0451577_0000157_145585_146382 265
887 3300042876 Ga0451577_0081279 Ga0451577_0081279_1442_2272 265
888 3300044673 Ga0453683_0075237 Ga0453683_0075237_1278_2075 265
889 3300044694 Ga0466963_0005107 Ga0466963_0005107_2843_3670 265
890 3300044694 Ga0466963_0123961 Ga0466963_0123961_656_1453 265
891 3300044694 Ga0466963_0301884 Ga0466963_0301884_219_1016 265
892 3300044712 Ga0453684_0000324 Ga0453684_0000324_160664_161461 265
893 3300044712 Ga0453684_1058121 Ga0453684_1058121_27_824 265
894 3300045051 Ga0451576_0041454 Ga0451576_0041454_1913_2710 265
895 3300045051 Ga0451576_0205633 Ga0451576_0205633_304_1107 265
896 3300045976 Ga0466967_0003579 Ga0466967_0003579_6651_7448 265
897 3300045976 Ga0466967_0082774 Ga0466967_0082774_314_1111 265
898 3300045976 Ga0466967_0199035 Ga0466967_0199035_752_1579 265
899 3300045976 Ga0466967_0222027 Ga0466967_0222027_629_1426 265
900 3300046462 Ga0495651_0009841 Ga0495651_0009841_4817_5614 265
901 3300046472 Ga0495580_0135683 Ga0495580_0135683_719_1522 265
902 3300046473 Ga0495582_0067127 Ga0495582_0067127_815_1618 265
903 3300046477 Ga0495664_0046400 Ga0495664_0046400_1323_2126 265
904 3300046516 Ga0495628_0082992 Ga0495628_0082992_627_1424 265
905 3300046529 Ga0495652_0335160 Ga0495652_0335160_237_1034 265
906 3300046531 Ga0495665_0011868 Ga0495665_0011868_2910_3707 265
907 3300046531 Ga0495665_0111789 Ga0495665_0111789_489_1292 265
908 3300046535 Ga0495586_0061255 Ga0495586_0061255_815_1618 265
909 3300046536 Ga0495587_0110202 Ga0495587_0110202_486_1283 265
910 3300046559 Ga0495667_0324634 Ga0495667_0324634_11_811 265
911 3300046663 Ga0495635_0204676 Ga0495635_0204676_204_1001 265
912 3300046675 Ga0495657_0307194 Ga0495657_0307194_124_927 265
913 3300046679 Ga0495623_0054381 Ga0495623_0054381_905_1702 265
914 3300046684 Ga0495669_0031535 Ga0495669_0031535_524_1321 265
915 3300046684 Ga0495669_0047925 Ga0495669_0047925_238_1041 265
916 3300046684 Ga0495669_0161947 Ga0495669_0161947_63_866 265
917 3300047315 Ga0495581_0013470 Ga0495581_0013470_3759_4562 265
918 3300047315 Ga0495581_0029574 Ga0495581_0029574_1794_2591 265
919 3300047317 Ga0495604_0036261 Ga0495604_0036261_144_941 265
920 3300047444 Ga0495675_0044359 Ga0495675_0044359_1354_2157 265
921 3300047444 Ga0495675_0119721 Ga0495675_0119721_342_1139 265
922 3300047471 Ga0495684_0114347 Ga0495684_0114347_207_1010 265
923 3300047471 Ga0495684_0215554 Ga0495684_0215554_406_1209 265
924 3300047673 Ga0495593_0096598 Ga0495593_0096598_311_1108 265
925 3300048905 Ga0496102_0357795 Ga0496102_0357795_385_1182 265
926 3300048906 Ga0496103_0009469 Ga0496103_0009469_606_1403 265
927 3300048907 Ga0496104_0013808 Ga0496104_0013808_5501_6298 265
928 3300048907 Ga0496104_0020277 Ga0496104_0020277_2791_3588 265
929 3300048907 Ga0496104_0316652 Ga0496104_0316652_45_842 265
930 3300048907 Ga0496104_0559479 Ga0496104_0559479_106_903 265
931 3300048908 Ga0496105_0103843 Ga0496105_0103843_280_1077 265
932 3300048908 Ga0496105_0359445 Ga0496105_0359445_227_1024 265
933 3300048910 Ga0496107_0275615 Ga0496107_0275615_175_978 265
934 3300048912 Ga0496109_0027873 Ga0496109_0027873_3296_4099 265
935 3300048912 Ga0496109_0498144 Ga0496109_0498144_311_1108 265
936 3300048913 Ga0496110_0031429 Ga0496110_0031429_2726_3523 265
937 3300048914 Ga0496111_0028169 Ga0496111_0028169_1810_2607 265
938 3300048915 Ga0496112_0013108 Ga0496112_0013108_4981_5778 265
939 3300048915 Ga0496112_0064959 Ga0496112_0064959_790_1587 265
940 3300048915 Ga0496112_0138641 Ga0496112_0138641_1555_2352 265
941 3300048916 Ga0496113_0000340 Ga0496113_0000340_15953_16750 265
942 3300048916 Ga0496113_0097364 Ga0496113_0097364_803_1600 265
943 3300053077 Ga0495601_0008130 Ga0495601_0008130_265_1062 265
944 3300053077 Ga0495601_0098456 Ga0495601_0098456_36_833 265
945 3300005436 Ga0070713_100001663 Ga0070713_10000166310 266
946 3300006028 Ga0070717_10006992 Ga0070717_100069924 266
947 3300006028 Ga0070717_10566614 Ga0070717_105666141 266
948 3300025906 Ga0207699_10213308 Ga0207699_102133082 266
949 3300025912 Ga0207707_10046004 Ga0207707_100460042 266
950 3300025913 Ga0207695_10057525 Ga0207695_100575251 266
951 3300025928 Ga0207700_10124197 Ga0207700_101241972 266
952 3300035116 Ga0373945_0046429 Ga0373945_0046429_174_1124 266
953 3300035171 Ga0373946_0077409 Ga0373946_0077409_126_947 266
954 3300035692 Ga0373935_0047270 Ga0373935_0047270_1517_2338 266
955 3300035692 Ga0373935_0138998 Ga0373935_0138998_252_1202 266
956 3300035725 Ga0373947_0205383 Ga0373947_0205383_312_1133 266
957 3300037068 Ga0373925_0011238 Ga0373925_0011238_3899_4720 266
958 3300037068 Ga0373925_0342746 Ga0373925_0342746_90_1040 266
959 3300046459 Ga0495629_0021734 Ga0495629_0021734_1830_2780 266
960 3300046472 Ga0495580_0000264 Ga0495580_0000264_16511_17461 266
961 3300046473 Ga0495582_0000791 Ga0495582_0000791_4942_5892 266
962 3300046535 Ga0495586_0048859 Ga0495586_0048859_1082_1903 266
963 3300046683 Ga0495658_0007432 Ga0495658_0007432_2181_3131 266
964 3300047315 Ga0495581_0244084 Ga0495581_0244084_55_1005 266
965 3300047319 Ga0495674_0020727 Ga0495674_0020727_1354_2175 266
966 3300048903 Ga0496100_0131907 Ga0496100_0131907_636_1457 266
967 3300048917 Ga0496114_0151687 Ga0496114_0151687_207_1028 266
968 3300048918 Ga0496115_0004190 Ga0496115_0004190_2529_3350 266
969 3300053077 Ga0495601_0265815 Ga0495601_0265815_73_894 266
970 3300000546 LJNas_1001133 LJNas_10011333 268
971 3300005614 Ga0068856_100033818 Ga0068856_1000338182 268
972 3300025927 Ga0207687_10150790 Ga0207687_101507901 268
973 3300025928 Ga0207700_10008211 Ga0207700_100082115 268
974 3300025928 Ga0207700_10135710 Ga0207700_101357102 268
975 3300035119 Ga0373956_0003888 Ga0373956_0003888_2891_3703 268
976 3300036401 Ga0373937_0026535 Ga0373937_0026535_513_1325 268
977 3300037068 Ga0373925_0030691 Ga0373925_0030691_1945_2757 268
978 3300039447 Ga0436361_0788453 Ga0436361_0788453_11466_12317 268
979 3300046499 Ga0495594_0027749 Ga0495594_0027749_1341_2153 268
980 3300046660 Ga0495625_0325291 Ga0495625_0325291_91_936 268
981 3300046683 Ga0495658_0029953 Ga0495658_0029953_1861_2673 268
982 3300046684 Ga0495669_0201649 Ga0495669_0201649_16_861 268
983 3300047315 Ga0495581_0123505 Ga0495581_0123505_313_1125 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13277

YmdB

YmdB-like protein

57

313

0.97

PF00149

Metallophos

Calcineurin-like phosphoesterase

54

238

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b2o-assembly1.cif.gz_D crystal structure of bacillus subtilis ymdb, a global regulator of late adaptive responses. 0.9675 4 268
1t70-assembly3.cif.gz_E crystal structure of a novel phosphatase from deinococcus radiodurans 0.9599 4 268
2cv9-assembly1.cif.gz_A crystal structure of a hypothetical protein from thermus thermophilus hb8 0.9557 4 268
1t70-assembly3.cif.gz_E crystal structure of a novel phosphatase from deinococcus radiodurans 0.9526 4 268
2cv9-assembly1.cif.gz_A crystal structure of a hypothetical protein from thermus thermophilus hb8 0.9483 4 268
ID Description Score Start End Superfamily
4b2oD00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9675 4 268 3.60.21.10
2z06B00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.963 4 268 3.60.21.10
2z06B00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9556 4 268 3.60.21.10
4b2oD00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9424 4 268 3.60.21.10
1t71A00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.905 1 268 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A661BEZ6-F1-model_v4 Metallophosphoesterase 0.9925 153 267 GO:0004113
AF-A0A3C0WKN2-F1-model_v4 Metallophosphoesterase 0.9915 169 267 GO:0004113
AF-A0A5B9ECD6-F1-model_v4 TIGR00282 family metallophosphoesterase 0.9913 4 268 GO:0004113
GO:0046872
AF-A0A7V5CTE9-F1-model_v4 Metallophosphoesterase 0.9903 4 158 GO:0004113
AF-X1P5I1-F1-model_v4 Metallophosphoesterase 0.9892 154 268 GO:0004113

Feature Viewer

pLDDT pTM Quality
95.96 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map