F487484
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 984 | 372 | 1968 | 382 |
Family's Representative Sequence
| Representative Sequence | 3300047470|Ga0495681_0002728|Ga0495681_0002728_8290_9528 |
| Length | 412 |
| Sequence | MAPTTVELQASSLPAIFHQASFPSEKESCMLRKNLLATLCAGVLISATVPVLAAPAQTMKSEDGTLEVTSIVTGLEHPWALAFLPDSKNMLVTERPGNLRLVTADGKLSAPLNGVPTVWAKGQGGLLDVALSPDFKQDRMVYLSYAEGGGKGDKAGTAVGRGRLSDDMTALKDFQVILRQEPKLSVGNHFGSRLVFDRDGYLFVTLGENNDRPTAQDLDKLQGKVVRIYPDGTVPKDNPFVGQANVRPEIWSYGQRNPQGAALNPWNGTLWENEHGPLGGDEINIIERGKNYGWPLATHGINYSGQPIPEAKGETIEGAVAPNHVWEKSPGLSGMAFYDADRFKVWQRNVFIGALVSQELIRLEFDGDKVVHEERMLGELKKRIRDVRQGPDGYLYVLTDEENGGLYKVGLK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 6 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 7 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 17 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 23 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 24 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 25 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 26 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 27 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 28 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 36 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 43 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 44 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 45 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 46 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 48 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 49 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 55 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 57 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 73 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 74 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 75 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 76 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 77 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 78 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 79 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 80 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 81 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 82 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 83 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 84 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 85 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 86 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 87 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 88 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 89 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 90 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 91 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 92 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 93 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 94 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 95 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 96 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 97 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 98 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 99 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 100 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 101 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 102 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 103 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 104 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 105 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 106 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 107 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 108 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 109 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 110 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 111 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 112 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 191 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 192 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 193 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 194 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 195 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 196 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 197 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 198 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 199 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 200 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 201 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 202 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 203 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 204 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 205 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 206 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 207 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 212 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 213 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 214 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 215 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 216 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 217 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 218 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 219 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 220 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 221 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 222 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 223 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 224 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 225 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 226 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 227 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 228 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 229 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 230 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 231 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 232 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 233 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 234 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 235 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 236 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 237 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 238 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 239 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 240 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 241 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 242 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 243 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 244 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 245 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 246 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 247 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 248 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 249 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 250 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 251 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 252 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 253 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 254 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 255 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 256 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 257 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 258 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 259 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 260 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 261 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 262 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 263 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 264 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 265 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 266 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 267 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 268 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 269 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 270 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 271 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 272 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 273 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 274 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 275 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 276 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 277 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 278 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 279 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 280 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 281 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 282 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 283 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 284 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 285 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 286 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 287 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 288 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 289 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 290 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 291 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 292 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 293 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 294 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 295 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 296 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 297 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 298 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 299 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 300 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 301 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 302 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 303 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 304 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 305 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 306 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 307 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 308 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 309 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 310 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 311 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 312 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 313 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 314 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 315 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 316 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 317 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 318 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 319 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 320 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 321 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 322 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 323 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 324 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 325 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 326 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 327 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 328 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 329 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 330 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 331 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 332 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 333 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 334 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 335 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 336 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 337 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 338 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 339 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 340 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 341 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 342 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 343 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 344 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 345 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 346 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 347 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 348 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 349 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 350 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 351 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 352 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 353 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 354 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 355 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 356 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 357 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 358 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 359 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 360 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 361 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 362 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 363 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 364 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 365 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 366 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 367 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 368 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 369 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 370 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 371 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 372 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.84 |
| Metatranscriptomes | 0 |
| Isolates | 16.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.46 |
| Nodule | 2.03 |
| Rhizoplane | 5.28 |
| Rhizosphere | 79.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495681_0002728 | 3300047470 | Bacteria | 12495 |
| 2 | MRS2a_Contig_6993 | 2124908027 | Bacteria | 5600 |
| 3 | MRS2a_Contig_731 | 2124908027 | Bacteria | 6715 |
| 4 | SwRhRL2b_contig_1875304 | 2162886007 | Bacteria | 8741 |
| 5 | MRS1b_contig_5847325 | 2162886011 | Bacteria | 6155 |
| 6 | Ga0055539_1000011 | 3300003752 | Bacteria | 399747 |
| 7 | Ga0055533_1000014 | 3300003756 | Bacteria | 399747 |
| 8 | Ga0055532_1000009 | 3300003758 | Bacteria | 399537 |
| 9 | Ga0055525_1000016 | 3300003759 | Bacteria | 399724 |
| 10 | Ga0055536_1000352 | 3300003781 | Bacteria | 34235 |
| 11 | Ga0055530_10000019 | 3300003791 | Bacteria | 140299 |
| 12 | Ga0055530_10002917 | 3300003791 | Bacteria | 10359 |
| 13 | Ga0055540_1000006 | 3300003792 | Bacteria | 372018 |
| 14 | Ga0055540_1000055 | 3300003792 | Bacteria | 140299 |
| 15 | Ga0055531_10000126 | 3300003794 | Bacteria | 85918 |
| 16 | Ga0055541_1000008 | 3300003841 | Bacteria | 399724 |
| 17 | Ga0065714_10000255 | 3300005288 | Bacteria | 6634 |
| 18 | Ga0065714_10002219 | 3300005288 | Bacteria | 48487 |
| 19 | Ga0065714_10003565 | 3300005288 | Bacteria | 9246 |
| 20 | Ga0065714_10009982 | 3300005288 | Bacteria | 2919 |
| 21 | Ga0065714_10012859 | 3300005288 | Bacteria | 2408 |
| 22 | Ga0065714_10023451 | 3300005288 | Bacteria | 1325 |
| 23 | Ga0065714_10068323 | 3300005288 | Bacteria | 4813 |
| 24 | Ga0065714_10075816 | 3300005288 | Bacteria | 2853 |
| 25 | Ga0065714_10082916 | 3300005288 | Bacteria | 2280 |
| 26 | Ga0065704_10070628 | 3300005289 | Bacteria | 18936 |
| 27 | Ga0065704_10099151 | 3300005289 | Bacteria | 2323 |
| 28 | Ga0065704_10136757 | 3300005289 | Bacteria | 1562 |
| 29 | Ga0065712_10069901 | 3300005290 | Bacteria | 6539 |
| 30 | Ga0065715_10013805 | 3300005293 | Bacteria | 2439 |
| 31 | Ga0070670_100000495 | 3300005331 | Bacteria | 31488 |
| 32 | Ga0070670_100002291 | 3300005331 | Bacteria | 15770 |
| 33 | Ga0070669_100010476 | 3300005353 | Bacteria | 6585 |
| 34 | Ga0070662_100003888 | 3300005457 | Bacteria | 9362 |
| 35 | Ga0070662_100037132 | 3300005457 | Bacteria | 3452 |
| 36 | Ga0070664_100000064 | 3300005564 | Bacteria | 65571 |
| 37 | Ga0068851_10000165 | 3300005834 | Bacteria | 34440 |
| 38 | Ga0075432_10000990 | 3300006058 | Bacteria | 8989 |
| 39 | Ga0075432_10003031 | 3300006058 | Bacteria | 5668 |
| 40 | Ga0075362_10118062 | 3300006177 | Bacteria | 1254 |
| 41 | Ga0075436_100015966 | 3300006914 | Bacteria | 5140 |
| 42 | Ga0075436_100022524 | 3300006914 | Bacteria | 4326 |
| 43 | Ga0079104_1000235 | 3300006946 | Bacteria | 74576 |
| 44 | Ga0079104_1000873 | 3300006946 | Bacteria | 24899 |
| 45 | Ga0099826_10010909 | 3300006948 | Bacteria | 6824 |
| 46 | Ga0105251_10000456 | 3300009011 | Bacteria | 39260 |
| 47 | Ga0105251_10001310 | 3300009011 | Bacteria | 21494 |
| 48 | Ga0105251_10014230 | 3300009011 | Bacteria | 4412 |
| 49 | Ga0105251_10019713 | 3300009011 | Bacteria | 3555 |
| 50 | Ga0105251_10025751 | 3300009011 | Bacteria | 3004 |
| 51 | Ga0105251_10029890 | 3300009011 | Bacteria | 2741 |
| 52 | Ga0105251_10034266 | 3300009011 | Bacteria | 2514 |
| 53 | Ga0105251_10100078 | 3300009011 | Bacteria | 1325 |
| 54 | Ga0105244_10002575 | 3300009036 | Bacteria | 13612 |
| 55 | Ga0105244_10003967 | 3300009036 | Bacteria | 10376 |
| 56 | Ga0105244_10004549 | 3300009036 | Bacteria | 9500 |
| 57 | Ga0105244_10006056 | 3300009036 | Bacteria | 7920 |
| 58 | Ga0105244_10009002 | 3300009036 | Bacteria | 6178 |
| 59 | Ga0105244_10015172 | 3300009036 | Bacteria | 4425 |
| 60 | Ga0105244_10027913 | 3300009036 | Bacteria | 3035 |
| 61 | Ga0105250_10000145 | 3300009092 | Bacteria | 62334 |
| 62 | Ga0105250_10000256 | 3300009092 | Bacteria | 44131 |
| 63 | Ga0105250_10000757 | 3300009092 | Bacteria | 19646 |
| 64 | Ga0105250_10011541 | 3300009092 | Bacteria | 3663 |
| 65 | Ga0105250_10015734 | 3300009092 | Bacteria | 3095 |
| 66 | Ga0105243_10013488 | 3300009148 | Bacteria | 6180 |
| 67 | Ga0105243_10022501 | 3300009148 | Bacteria | 4792 |
| 68 | Ga0105242_10004868 | 3300009176 | Bacteria | 10395 |
| 69 | Ga0105237_10000426 | 3300009545 | Bacteria | 59965 |
| 70 | Ga0105246_10000009 | 3300011119 | Bacteria | 79055 |
| 71 | Ga0105246_10011996 | 3300011119 | Bacteria | 5396 |
| 72 | Ga0105246_10086860 | 3300011119 | Bacteria | 2243 |
| 73 | Ga0157345_1000181 | 3300012498 | Bacteria | 9989 |
| 74 | Ga0157373_10002099 | 3300013100 | Bacteria | 15088 |
| 75 | Ga0157373_10002260 | 3300013100 | Bacteria | 14599 |
| 76 | Ga0157373_10002438 | 3300013100 | Bacteria | 14153 |
| 77 | Ga0157373_10004688 | 3300013100 | Bacteria | 10279 |
| 78 | Ga0157373_10016012 | 3300013100 | Bacteria | 5473 |
| 79 | Ga0157373_10025264 | 3300013100 | Bacteria | 4298 |
| 80 | Ga0157373_10134310 | 3300013100 | Bacteria | 1740 |
| 81 | Ga0157373_10164962 | 3300013100 | Bacteria | 1559 |
| 82 | Ga0157371_10000189 | 3300013102 | Bacteria | 91155 |
| 83 | Ga0157371_10017892 | 3300013102 | Bacteria | 5255 |
| 84 | Ga0157370_10066712 | 3300013104 | Bacteria | 3402 |
| 85 | Ga0157370_10086648 | 3300013104 | Bacteria | 2942 |
| 86 | Ga0157370_10103178 | 3300013104 | Bacteria | 2670 |
| 87 | Ga0157370_10191776 | 3300013104 | Bacteria | 1897 |
| 88 | Ga0157369_10005447 | 3300013105 | Bacteria | 14804 |
| 89 | Ga0157369_10007726 | 3300013105 | Bacteria | 12369 |
| 90 | Ga0157369_10012736 | 3300013105 | Bacteria | 9536 |
| 91 | Ga0157369_10036133 | 3300013105 | Bacteria | 5414 |
| 92 | Ga0157369_10045733 | 3300013105 | Bacteria | 4759 |
| 93 | Ga0157369_10100516 | 3300013105 | Bacteria | 3083 |
| 94 | Ga0163162_10000169 | 3300013306 | Bacteria | 60285 |
| 95 | Ga0157375_10003950 | 3300013308 | Bacteria | 12858 |
| 96 | Ga0157375_10215829 | 3300013308 | Bacteria | 2076 |
| 97 | Ga0182008_10000404 | 3300014497 | Bacteria | 33433 |
| 98 | Ga0182008_10000942 | 3300014497 | Bacteria | 20251 |
| 99 | Ga0182008_10007227 | 3300014497 | Bacteria | 6143 |
| 100 | Ga0182008_10044238 | 3300014497 | Bacteria | 2214 |
| 101 | Ga0182008_10055744 | 3300014497 | Bacteria | 1954 |
| 102 | Ga0182008_10085377 | 3300014497 | Bacteria | 1555 |
| 103 | Ga0182006_1000452 | 3300015261 | Bacteria | 32460 |
| 104 | Ga0182006_1000704 | 3300015261 | Bacteria | 23177 |
| 105 | Ga0182006_1004026 | 3300015261 | Bacteria | 7334 |
| 106 | Ga0182006_1011474 | 3300015261 | Bacteria | 3895 |
| 107 | Ga0182006_1016570 | 3300015261 | Bacteria | 3142 |
| 108 | Ga0182006_1030283 | 3300015261 | Bacteria | 2187 |
| 109 | Ga0182007_10000083 | 3300015262 | Bacteria | 71163 |
| 110 | Ga0182007_10001288 | 3300015262 | Bacteria | 13564 |
| 111 | Ga0182007_10004715 | 3300015262 | Bacteria | 6134 |
| 112 | Ga0182005_1001844 | 3300015265 | Bacteria | 8061 |
| 113 | Ga0182005_1008383 | 3300015265 | Bacteria | 3050 |
| 114 | Ga0182005_1008813 | 3300015265 | Bacteria | 2961 |
| 115 | Ga0182005_1009216 | 3300015265 | Bacteria | 2881 |
| 116 | Ga0182005_1040602 | 3300015265 | Bacteria | 1265 |
| 117 | Ga0163161_10000440 | 3300017792 | Bacteria | 34643 |
| 118 | Ga0163161_10001602 | 3300017792 | Bacteria | 16690 |
| 119 | Ga0163161_10004328 | 3300017792 | Bacteria | 9895 |
| 120 | Ga0163161_10009073 | 3300017792 | Bacteria | 6878 |
| 121 | Ga0163161_10048643 | 3300017792 | Bacteria | 3063 |
| 122 | Ga0163161_10097373 | 3300017792 | Bacteria | 2185 |
| 123 | Ga0163161_10161309 | 3300017792 | Bacteria | 1710 |
| 124 | Ga0209435_101164 | 3300025206 | Bacteria | 3595 |
| 125 | Ga0209784_100023 | 3300025224 | Bacteria | 399841 |
| 126 | Ga0209566_100019 | 3300025225 | Bacteria | 414836 |
| 127 | Ga0209674_100034 | 3300025226 | Bacteria | 414903 |
| 128 | Ga0209147_100027 | 3300025229 | Bacteria | 414610 |
| 129 | Ga0209563_100037 | 3300025230 | Bacteria | 414903 |
| 130 | Ga0209563_100908 | 3300025230 | Bacteria | 8742 |
| 131 | Ga0209258_100268 | 3300025242 | Bacteria | 89701 |
| 132 | Ga0209646_1000323 | 3300025246 | Bacteria | 36796 |
| 133 | Ga0209677_100021 | 3300025253 | Bacteria | 414954 |
| 134 | Ga0209675_1004176 | 3300025291 | Bacteria | 6539 |
| 135 | Ga0209676_1000002 | 3300025292 | Bacteria | 1732948 |
| 136 | Ga0209676_1000158 | 3300025292 | Bacteria | 162469 |
| 137 | Ga0209676_1002612 | 3300025292 | Bacteria | 12321 |
| 138 | Ga0209676_1004504 | 3300025292 | Bacteria | 7733 |
| 139 | Ga0209050_1000006 | 3300025298 | Bacteria | 1359702 |
| 140 | Ga0209050_1000013 | 3300025298 | Bacteria | 811408 |
| 141 | Ga0209050_1000321 | 3300025298 | Bacteria | 96465 |
| 142 | Ga0209051_1000001 | 3300025303 | Bacteria | 1732974 |
| 143 | Ga0209051_1000007 | 3300025303 | Bacteria | 811408 |
| 144 | Ga0209051_1017169 | 3300025303 | Bacteria | 3243 |
| 145 | Ga0209257_1000029 | 3300025304 | Bacteria | 695617 |
| 146 | Ga0207656_10002984 | 3300025321 | Bacteria | 5782 |
| 147 | Ga0207696_1000002 | 3300025711 | Bacteria | 1098043 |
| 148 | Ga0207696_1000011 | 3300025711 | Bacteria | 530614 |
| 149 | Ga0207696_1000186 | 3300025711 | Bacteria | 96544 |
| 150 | Ga0207696_1002373 | 3300025711 | Bacteria | 9305 |
| 151 | Ga0207696_1004244 | 3300025711 | Bacteria | 6221 |
| 152 | Ga0207696_1039914 | 3300025711 | Bacteria | 1377 |
| 153 | Ga0207655_1000022 | 3300025728 | Bacteria | 483933 |
| 154 | Ga0207655_1000207 | 3300025728 | Bacteria | 102951 |
| 155 | Ga0207655_1000379 | 3300025728 | Bacteria | 62077 |
| 156 | Ga0207655_1001659 | 3300025728 | Bacteria | 19713 |
| 157 | Ga0207655_1004289 | 3300025728 | Bacteria | 10202 |
| 158 | Ga0207655_1005715 | 3300025728 | Bacteria | 8399 |
| 159 | Ga0207655_1008836 | 3300025728 | Bacteria | 6334 |
| 160 | Ga0207655_1015187 | 3300025728 | Bacteria | 4298 |
| 161 | Ga0207655_1018714 | 3300025728 | Bacteria | 3658 |
| 162 | Ga0207655_1027367 | 3300025728 | Bacteria | 2717 |
| 163 | Ga0207655_1028945 | 3300025728 | Bacteria | 2603 |
| 164 | Ga0207655_1047020 | 3300025728 | Bacteria | 1785 |
| 165 | Ga0207713_1000162 | 3300025735 | Bacteria | 98630 |
| 166 | Ga0207713_1000326 | 3300025735 | Bacteria | 53850 |
| 167 | Ga0207713_1000447 | 3300025735 | Bacteria | 43462 |
| 168 | Ga0207713_1000552 | 3300025735 | Bacteria | 37422 |
| 169 | Ga0207713_1006733 | 3300025735 | Bacteria | 6943 |
| 170 | Ga0207713_1008776 | 3300025735 | Bacteria | 5762 |
| 171 | Ga0207713_1011581 | 3300025735 | Bacteria | 4780 |
| 172 | Ga0207713_1029694 | 3300025735 | Bacteria | 2444 |
| 173 | Ga0207713_1029696 | 3300025735 | Bacteria | 2444 |
| 174 | Ga0207713_1056082 | 3300025735 | Bacteria | 1533 |
| 175 | Ga0207671_10000743 | 3300025914 | Bacteria | 41315 |
| 176 | Ga0207649_10000116 | 3300025920 | Bacteria | 67931 |
| 177 | Ga0207650_10000750 | 3300025925 | Bacteria | 24996 |
| 178 | Ga0207686_10002731 | 3300025934 | Bacteria | 9567 |
| 179 | Ga0207709_10000004 | 3300025935 | Bacteria | 825156 |
| 180 | Ga0207679_10000054 | 3300025945 | Bacteria | 108733 |
| 181 | Ga0207639_10118851 | 3300026041 | Bacteria | 2168 |
| 182 | Ga0209281_1000009 | 3300027111 | Bacteria | 771717 |
| 183 | Ga0209281_1000046 | 3300027111 | Bacteria | 327042 |
| 184 | Ga0209281_1013568 | 3300027111 | Bacteria | 1754 |
| 185 | Ga0207428_10007691 | 3300027907 | Bacteria | 9809 |
| 186 | Ga0207428_10022356 | 3300027907 | Bacteria | 5338 |
| 187 | Ga0307511_10144701 | 3300030521 | Bacteria | 1384 |
| 188 | Ga0307408_100007588 | 3300031548 | Bacteria | 7171 |
| 189 | Ga0307405_10000328 | 3300031731 | Bacteria | 17621 |
| 190 | Ga0307405_10050641 | 3300031731 | Bacteria | 2572 |
| 191 | Ga0307413_10044281 | 3300031824 | Bacteria | 2629 |
| 192 | Ga0307413_10072835 | 3300031824 | Bacteria | 2170 |
| 193 | Ga0307406_10016525 | 3300031901 | Bacteria | 4290 |
| 194 | Ga0307407_10058849 | 3300031903 | Bacteria | 2235 |
| 195 | Ga0307412_10001489 | 3300031911 | Bacteria | 13016 |
| 196 | Ga0307412_10004125 | 3300031911 | Bacteria | 8096 |
| 197 | Ga0307412_10005227 | 3300031911 | Bacteria | 7278 |
| 198 | Ga0307412_10014820 | 3300031911 | Bacteria | 4607 |
| 199 | Ga0307412_10193721 | 3300031911 | Bacteria | 1538 |
| 200 | Ga0307409_100211491 | 3300031995 | Bacteria | 1743 |
| 201 | Ga0307409_100271065 | 3300031995 | Bacteria | 1563 |
| 202 | Ga0307416_100012044 | 3300032002 | Bacteria | 5805 |
| 203 | Ga0307414_10265513 | 3300032004 | Bacteria | 1434 |
| 204 | Ga0307414_10296114 | 3300032004 | Bacteria | 1366 |
| 205 | Ga0307411_10012125 | 3300032005 | Bacteria | 4685 |
| 206 | Ga0307411_10065922 | 3300032005 | Bacteria | 2430 |
| 207 | Ga0307510_10014347 | 3300033180 | Bacteria | 9379 |
| 208 | Ga0439438_000875 | 3300041405 | Bacteria | 13434 |
| 209 | Ga0439438_000998 | 3300041405 | Bacteria | 12668 |
| 210 | Ga0439438_001021 | 3300041405 | Bacteria | 12472 |
| 211 | Ga0439438_001408 | 3300041405 | Bacteria | 10611 |
| 212 | Ga0439438_001812 | 3300041405 | Bacteria | 9372 |
| 213 | Ga0439438_003024 | 3300041405 | Bacteria | 6932 |
| 214 | Ga0439438_003764 | 3300041405 | Bacteria | 5993 |
| 215 | Ga0439438_004188 | 3300041405 | Bacteria | 5608 |
| 216 | Ga0439438_005138 | 3300041405 | Bacteria | 4871 |
| 217 | Ga0439447_001833 | 3300041407 | Bacteria | 7785 |
| 218 | Ga0439447_002314 | 3300041407 | Bacteria | 6974 |
| 219 | Ga0439447_003667 | 3300041407 | Bacteria | 5414 |
| 220 | Ga0439447_003840 | 3300041407 | Bacteria | 5271 |
| 221 | Ga0439447_005155 | 3300041407 | Bacteria | 4378 |
| 222 | Ga0439447_014969 | 3300041407 | Bacteria | 2162 |
| 223 | Ga0439466_0001055 | 3300041411 | Bacteria | 10631 |
| 224 | Ga0439466_0001400 | 3300041411 | Bacteria | 9407 |
| 225 | Ga0439466_0003160 | 3300041411 | Bacteria | 6409 |
| 226 | Ga0439466_0010386 | 3300041411 | Bacteria | 3460 |
| 227 | Ga0439466_0018033 | 3300041411 | Bacteria | 2536 |
| 228 | Ga0451793_1073897 | 3300041452 | Bacteria | 2307 |
| 229 | Ga0451807_1051409 | 3300041486 | Bacteria | 1826 |
| 230 | Ga0439431_0006087 | 3300041997 | Bacteria | 2664 |
| 231 | Ga0439445_0002580 | 3300042004 | Bacteria | 4031 |
| 232 | Ga0439432_000031 | 3300042006 | Bacteria | 45793 |
| 233 | Ga0439432_001202 | 3300042006 | Bacteria | 9801 |
| 234 | Ga0439432_001230 | 3300042006 | Bacteria | 9678 |
| 235 | Ga0439432_001672 | 3300042006 | Bacteria | 8305 |
| 236 | Ga0439432_003431 | 3300042006 | Bacteria | 5883 |
| 237 | Ga0439451_000310 | 3300042009 | Bacteria | 9433 |
| 238 | Ga0439451_001779 | 3300042009 | Bacteria | 4303 |
| 239 | Ga0439451_009077 | 3300042009 | Bacteria | 2014 |
| 240 | Ga0439452_000317 | 3300042010 | Bacteria | 30475 |
| 241 | Ga0439452_001132 | 3300042010 | Bacteria | 11656 |
| 242 | Ga0439452_001430 | 3300042010 | Bacteria | 9795 |
| 243 | Ga0439452_017043 | 3300042010 | Bacteria | 1962 |
| 244 | Ga0439456_004229 | 3300042013 | Bacteria | 2911 |
| 245 | Ga0439463_018138 | 3300042016 | Bacteria | 1750 |
| 246 | Ga0450911_000076 | 3300042115 | Bacteria | 40401 |
| 247 | Ga0450911_001437 | 3300042115 | Bacteria | 5488 |
| 248 | Ga0450920_001078 | 3300042122 | Bacteria | 4467 |
| 249 | Ga0450902_001808 | 3300042137 | Bacteria | 2963 |
| 250 | Ga0450903_001550 | 3300042138 | Bacteria | 4281 |
| 251 | Ga0450903_007363 | 3300042138 | Bacteria | 1812 |
| 252 | Ga0450903_009157 | 3300042138 | Bacteria | 1616 |
| 253 | Ga0450904_001002 | 3300042139 | Bacteria | 4387 |
| 254 | Ga0450906_004556 | 3300042145 | Bacteria | 2892 |
| 255 | Ga0450907_000269 | 3300042146 | Bacteria | 17496 |
| 256 | Ga0450907_002262 | 3300042146 | Bacteria | 3742 |
| 257 | Ga0439446_0005630 | 3300042156 | Bacteria | 3227 |
| 258 | Ga0450908_001729 | 3300042184 | Bacteria | 4256 |
| 259 | Ga0450909_001472 | 3300042185 | Bacteria | 3287 |
| 260 | Ga0439434_0001842 | 3300042435 | Bacteria | 6160 |
| 261 | Ga0439460_0003382 | 3300042461 | Bacteria | 3859 |
| 262 | Ga0439460_0003508 | 3300042461 | Bacteria | 3794 |
| 263 | Ga0450901_001417 | 3300042533 | Bacteria | 2739 |
| 264 | Ga0439440_0000822 | 3300042993 | Bacteria | 5388 |
| 265 | Ga0495617_000097 | 3300046452 | Bacteria | 62559 |
| 266 | Ga0495617_001247 | 3300046452 | Bacteria | 11427 |
| 267 | Ga0495617_001668 | 3300046452 | Bacteria | 9541 |
| 268 | Ga0495617_005076 | 3300046452 | Bacteria | 4712 |
| 269 | Ga0495617_005125 | 3300046452 | Bacteria | 4681 |
| 270 | Ga0495617_005357 | 3300046452 | Bacteria | 4556 |
| 271 | Ga0495617_017035 | 3300046452 | Bacteria | 2455 |
| 272 | Ga0495617_026955 | 3300046452 | Bacteria | 1934 |
| 273 | Ga0495617_034199 | 3300046452 | Bacteria | 1706 |
| 274 | Ga0495627_000517 | 3300046453 | Bacteria | 31910 |
| 275 | Ga0495627_000526 | 3300046453 | Bacteria | 31735 |
| 276 | Ga0495627_001863 | 3300046453 | Bacteria | 11138 |
| 277 | Ga0495627_004951 | 3300046453 | Bacteria | 5474 |
| 278 | Ga0495627_015889 | 3300046453 | Bacteria | 2590 |
| 279 | Ga0495592_0017072 | 3300046454 | Bacteria | 5510 |
| 280 | Ga0495603_0011368 | 3300046455 | Bacteria | 5390 |
| 281 | Ga0495603_0027710 | 3300046455 | Bacteria | 3418 |
| 282 | Ga0495603_0037608 | 3300046455 | Bacteria | 2904 |
| 283 | Ga0495590_0000708 | 3300046457 | Bacteria | 15249 |
| 284 | Ga0495590_0008745 | 3300046457 | Bacteria | 3852 |
| 285 | Ga0495590_0019869 | 3300046457 | Bacteria | 2389 |
| 286 | Ga0495590_0021644 | 3300046457 | Bacteria | 2277 |
| 287 | Ga0495591_000060 | 3300046458 | Bacteria | 129321 |
| 288 | Ga0495591_000221 | 3300046458 | Bacteria | 56635 |
| 289 | Ga0495591_000354 | 3300046458 | Bacteria | 40651 |
| 290 | Ga0495591_002731 | 3300046458 | Bacteria | 9556 |
| 291 | Ga0495591_002853 | 3300046458 | Bacteria | 9286 |
| 292 | Ga0495591_006357 | 3300046458 | Bacteria | 5241 |
| 293 | Ga0495591_006811 | 3300046458 | Bacteria | 4973 |
| 294 | Ga0495591_007623 | 3300046458 | Bacteria | 4569 |
| 295 | Ga0495591_007952 | 3300046458 | Bacteria | 4415 |
| 296 | Ga0495591_008212 | 3300046458 | Bacteria | 4302 |
| 297 | Ga0495591_015788 | 3300046458 | Bacteria | 2655 |
| 298 | Ga0495638_0000298 | 3300046460 | Bacteria | 64005 |
| 299 | Ga0495638_0001565 | 3300046460 | Bacteria | 20511 |
| 300 | Ga0495638_0002480 | 3300046460 | Bacteria | 15021 |
| 301 | Ga0495638_0002560 | 3300046460 | Bacteria | 14734 |
| 302 | Ga0495638_0003323 | 3300046460 | Bacteria | 12686 |
| 303 | Ga0495638_0012218 | 3300046460 | Bacteria | 5895 |
| 304 | Ga0495638_0013298 | 3300046460 | Bacteria | 5611 |
| 305 | Ga0495638_0015951 | 3300046460 | Bacteria | 5035 |
| 306 | Ga0495638_0022972 | 3300046460 | Bacteria | 4086 |
| 307 | Ga0495638_0030695 | 3300046460 | Bacteria | 3457 |
| 308 | Ga0495638_0035221 | 3300046460 | Bacteria | 3192 |
| 309 | Ga0495638_0035682 | 3300046460 | Bacteria | 3169 |
| 310 | Ga0495638_0043170 | 3300046460 | Bacteria | 2846 |
| 311 | Ga0495638_0066691 | 3300046460 | Bacteria | 2211 |
| 312 | Ga0495638_0095059 | 3300046460 | Bacteria | 1790 |
| 313 | Ga0495638_0147148 | 3300046460 | Bacteria | 1369 |
| 314 | Ga0495653_0000844 | 3300046463 | Bacteria | 23601 |
| 315 | Ga0495653_0002370 | 3300046463 | Bacteria | 14975 |
| 316 | Ga0495653_0006664 | 3300046463 | Bacteria | 9478 |
| 317 | Ga0495653_0045650 | 3300046463 | Bacteria | 3396 |
| 318 | Ga0495650_0001297 | 3300046471 | Bacteria | 25392 |
| 319 | Ga0495650_0002090 | 3300046471 | Bacteria | 17198 |
| 320 | Ga0495650_0015181 | 3300046471 | Bacteria | 3963 |
| 321 | Ga0495650_0022221 | 3300046471 | Bacteria | 3046 |
| 322 | Ga0495650_0026452 | 3300046471 | Bacteria | 2698 |
| 323 | Ga0495650_0046317 | 3300046471 | Bacteria | 1825 |
| 324 | Ga0495650_0071139 | 3300046471 | Bacteria | 1364 |
| 325 | Ga0495580_0144905 | 3300046472 | Bacteria | 1646 |
| 326 | Ga0495605_0000197 | 3300046474 | Bacteria | 75351 |
| 327 | Ga0495605_0000789 | 3300046474 | Bacteria | 22739 |
| 328 | Ga0495605_0002861 | 3300046474 | Bacteria | 10491 |
| 329 | Ga0495605_0007042 | 3300046474 | Bacteria | 6411 |
| 330 | Ga0495605_0008045 | 3300046474 | Bacteria | 5969 |
| 331 | Ga0495605_0011728 | 3300046474 | Bacteria | 4878 |
| 332 | Ga0495605_0015578 | 3300046474 | Bacteria | 4130 |
| 333 | Ga0495605_0024112 | 3300046474 | Bacteria | 3188 |
| 334 | Ga0495605_0030899 | 3300046474 | Bacteria | 2740 |
| 335 | Ga0495605_0041097 | 3300046474 | Bacteria | 2304 |
| 336 | Ga0495605_0057215 | 3300046474 | Bacteria | 1877 |
| 337 | Ga0495639_0000038 | 3300046475 | Bacteria | 57641 |
| 338 | Ga0495639_0016334 | 3300046475 | Bacteria | 3222 |
| 339 | Ga0495639_0034347 | 3300046475 | Bacteria | 2268 |
| 340 | Ga0495584_0001813 | 3300046491 | Bacteria | 12395 |
| 341 | Ga0495584_0002046 | 3300046491 | Bacteria | 11595 |
| 342 | Ga0495584_0003710 | 3300046491 | Bacteria | 8327 |
| 343 | Ga0495584_0004982 | 3300046491 | Bacteria | 7073 |
| 344 | Ga0495584_0005128 | 3300046491 | Bacteria | 6953 |
| 345 | Ga0495584_0005630 | 3300046491 | Bacteria | 6621 |
| 346 | Ga0495584_0005823 | 3300046491 | Bacteria | 6494 |
| 347 | Ga0495584_0007364 | 3300046491 | Bacteria | 5740 |
| 348 | Ga0495584_0012567 | 3300046491 | Bacteria | 4322 |
| 349 | Ga0495584_0033562 | 3300046491 | Bacteria | 2596 |
| 350 | Ga0495584_0052008 | 3300046491 | Bacteria | 2061 |
| 351 | Ga0495585_0000124 | 3300046492 | Bacteria | 83121 |
| 352 | Ga0495585_0000581 | 3300046492 | Bacteria | 34377 |
| 353 | Ga0495585_0001763 | 3300046492 | Bacteria | 16437 |
| 354 | Ga0495585_0002723 | 3300046492 | Bacteria | 12354 |
| 355 | Ga0495585_0005945 | 3300046492 | Bacteria | 7636 |
| 356 | Ga0495585_0011083 | 3300046492 | Bacteria | 5350 |
| 357 | Ga0495585_0012080 | 3300046492 | Bacteria | 5095 |
| 358 | Ga0495585_0019325 | 3300046492 | Bacteria | 3928 |
| 359 | Ga0495585_0019756 | 3300046492 | Bacteria | 3881 |
| 360 | Ga0495585_0061378 | 3300046492 | Bacteria | 2067 |
| 361 | Ga0495594_0002774 | 3300046499 | Bacteria | 9088 |
| 362 | Ga0495594_0005166 | 3300046499 | Bacteria | 6713 |
| 363 | Ga0495594_0013928 | 3300046499 | Bacteria | 4208 |
| 364 | Ga0495594_0065612 | 3300046499 | Bacteria | 2013 |
| 365 | Ga0495596_0000014 | 3300046500 | Bacteria | 121944 |
| 366 | Ga0495596_0017459 | 3300046500 | Bacteria | 2969 |
| 367 | Ga0495607_0000014 | 3300046501 | Bacteria | 186627 |
| 368 | Ga0495607_0000575 | 3300046501 | Bacteria | 35761 |
| 369 | Ga0495607_0002301 | 3300046501 | Bacteria | 15698 |
| 370 | Ga0495607_0002457 | 3300046501 | Bacteria | 15062 |
| 371 | Ga0495607_0003228 | 3300046501 | Bacteria | 12569 |
| 372 | Ga0495607_0004200 | 3300046501 | Bacteria | 10691 |
| 373 | Ga0495607_0004809 | 3300046501 | Bacteria | 9851 |
| 374 | Ga0495607_0005102 | 3300046501 | Bacteria | 9502 |
| 375 | Ga0495607_0007112 | 3300046501 | Bacteria | 7778 |
| 376 | Ga0495607_0007458 | 3300046501 | Bacteria | 7568 |
| 377 | Ga0495607_0013226 | 3300046501 | Bacteria | 5418 |
| 378 | Ga0495607_0015525 | 3300046501 | Bacteria | 4934 |
| 379 | Ga0495607_0022955 | 3300046501 | Bacteria | 3910 |
| 380 | Ga0495607_0035320 | 3300046501 | Bacteria | 3025 |
| 381 | Ga0495607_0057886 | 3300046501 | Bacteria | 2219 |
| 382 | Ga0495607_0061043 | 3300046501 | Bacteria | 2143 |
| 383 | Ga0495583_0000283 | 3300046506 | Bacteria | 81166 |
| 384 | Ga0495583_0001409 | 3300046506 | Bacteria | 24503 |
| 385 | Ga0495583_0002906 | 3300046506 | Bacteria | 13850 |
| 386 | Ga0495583_0003128 | 3300046506 | Bacteria | 13068 |
| 387 | Ga0495583_0011563 | 3300046506 | Bacteria | 5060 |
| 388 | Ga0495583_0014447 | 3300046506 | Bacteria | 4356 |
| 389 | Ga0495583_0015939 | 3300046506 | Bacteria | 4063 |
| 390 | Ga0495606_0000508 | 3300046507 | Bacteria | 63146 |
| 391 | Ga0495606_0001003 | 3300046507 | Bacteria | 41160 |
| 392 | Ga0495606_0003198 | 3300046507 | Bacteria | 17665 |
| 393 | Ga0495606_0003510 | 3300046507 | Bacteria | 16582 |
| 394 | Ga0495606_0007251 | 3300046507 | Bacteria | 9991 |
| 395 | Ga0495606_0009606 | 3300046507 | Bacteria | 8150 |
| 396 | Ga0495606_0023792 | 3300046507 | Bacteria | 4429 |
| 397 | Ga0495606_0028570 | 3300046507 | Bacteria | 3931 |
| 398 | Ga0495606_0031522 | 3300046507 | Bacteria | 3684 |
| 399 | Ga0495606_0033671 | 3300046507 | Bacteria | 3531 |
| 400 | Ga0495606_0047199 | 3300046507 | Bacteria | 2840 |
| 401 | Ga0495606_0084789 | 3300046507 | Bacteria | 1961 |
| 402 | Ga0495610_0000143 | 3300046512 | Bacteria | 78495 |
| 403 | Ga0495610_0001762 | 3300046512 | Bacteria | 18950 |
| 404 | Ga0495610_0002906 | 3300046512 | Bacteria | 13866 |
| 405 | Ga0495610_0006950 | 3300046512 | Bacteria | 7657 |
| 406 | Ga0495610_0011661 | 3300046512 | Bacteria | 5351 |
| 407 | Ga0495610_0013584 | 3300046512 | Bacteria | 4832 |
| 408 | Ga0495610_0015991 | 3300046512 | Bacteria | 4339 |
| 409 | Ga0495610_0017194 | 3300046512 | Bacteria | 4129 |
| 410 | Ga0495610_0034611 | 3300046512 | Bacteria | 2600 |
| 411 | Ga0495610_0038006 | 3300046512 | Bacteria | 2445 |
| 412 | Ga0495610_0058676 | 3300046512 | Bacteria | 1840 |
| 413 | Ga0495610_0071069 | 3300046512 | Bacteria | 1623 |
| 414 | Ga0495610_0097298 | 3300046512 | Bacteria | 1324 |
| 415 | Ga0495616_0001207 | 3300046513 | Bacteria | 18220 |
| 416 | Ga0495616_0002614 | 3300046513 | Bacteria | 11862 |
| 417 | Ga0495616_0003642 | 3300046513 | Bacteria | 9840 |
| 418 | Ga0495616_0003841 | 3300046513 | Bacteria | 9575 |
| 419 | Ga0495616_0006614 | 3300046513 | Bacteria | 7001 |
| 420 | Ga0495616_0007845 | 3300046513 | Bacteria | 6366 |
| 421 | Ga0495616_0009899 | 3300046513 | Bacteria | 5543 |
| 422 | Ga0495616_0023433 | 3300046513 | Bacteria | 3320 |
| 423 | Ga0495616_0026244 | 3300046513 | Bacteria | 3103 |
| 424 | Ga0495616_0047436 | 3300046513 | Bacteria | 2163 |
| 425 | Ga0495620_0000137 | 3300046515 | Bacteria | 59671 |
| 426 | Ga0495620_0000821 | 3300046515 | Bacteria | 19140 |
| 427 | Ga0495620_0002752 | 3300046515 | Bacteria | 10121 |
| 428 | Ga0495620_0003278 | 3300046515 | Bacteria | 9278 |
| 429 | Ga0495620_0004732 | 3300046515 | Bacteria | 7651 |
| 430 | Ga0495620_0007616 | 3300046515 | Bacteria | 5865 |
| 431 | Ga0495620_0012237 | 3300046515 | Bacteria | 4443 |
| 432 | Ga0495620_0017251 | 3300046515 | Bacteria | 3605 |
| 433 | Ga0495620_0055877 | 3300046515 | Bacteria | 1662 |
| 434 | Ga0495628_0069275 | 3300046516 | Bacteria | 2751 |
| 435 | Ga0495630_0011572 | 3300046517 | Bacteria | 6389 |
| 436 | Ga0495631_0000549 | 3300046518 | Bacteria | 25271 |
| 437 | Ga0495631_0005780 | 3300046518 | Bacteria | 6452 |
| 438 | Ga0495631_0009697 | 3300046518 | Bacteria | 4800 |
| 439 | Ga0495631_0013894 | 3300046518 | Bacteria | 3896 |
| 440 | Ga0495631_0027458 | 3300046518 | Bacteria | 2604 |
| 441 | Ga0495631_0036244 | 3300046518 | Bacteria | 2203 |
| 442 | Ga0495631_0053730 | 3300046518 | Bacteria | 1758 |
| 443 | Ga0495632_0000343 | 3300046519 | Bacteria | 44184 |
| 444 | Ga0495632_0000424 | 3300046519 | Bacteria | 40109 |
| 445 | Ga0495632_0001203 | 3300046519 | Bacteria | 21962 |
| 446 | Ga0495632_0001891 | 3300046519 | Bacteria | 16786 |
| 447 | Ga0495632_0004152 | 3300046519 | Bacteria | 9938 |
| 448 | Ga0495632_0004771 | 3300046519 | Bacteria | 9131 |
| 449 | Ga0495632_0011200 | 3300046519 | Bacteria | 5250 |
| 450 | Ga0495632_0012377 | 3300046519 | Bacteria | 4924 |
| 451 | Ga0495632_0013467 | 3300046519 | Bacteria | 4667 |
| 452 | Ga0495632_0016829 | 3300046519 | Bacteria | 4054 |
| 453 | Ga0495632_0057298 | 3300046519 | Bacteria | 1902 |
| 454 | Ga0495637_0001107 | 3300046520 | Bacteria | 16544 |
| 455 | Ga0495637_0001358 | 3300046520 | Bacteria | 14693 |
| 456 | Ga0495637_0001433 | 3300046520 | Bacteria | 14062 |
| 457 | Ga0495637_0002336 | 3300046520 | Bacteria | 10503 |
| 458 | Ga0495637_0002746 | 3300046520 | Bacteria | 9577 |
| 459 | Ga0495637_0003626 | 3300046520 | Bacteria | 8179 |
| 460 | Ga0495637_0007030 | 3300046520 | Bacteria | 5604 |
| 461 | Ga0495637_0008349 | 3300046520 | Bacteria | 5091 |
| 462 | Ga0495637_0012988 | 3300046520 | Bacteria | 3967 |
| 463 | Ga0495637_0015660 | 3300046520 | Bacteria | 3556 |
| 464 | Ga0495637_0017417 | 3300046520 | Bacteria | 3348 |
| 465 | Ga0495637_0018945 | 3300046520 | Bacteria | 3188 |
| 466 | Ga0495637_0025447 | 3300046520 | Bacteria | 2666 |
| 467 | Ga0495637_0028380 | 3300046520 | Bacteria | 2500 |
| 468 | Ga0495637_0032251 | 3300046520 | Bacteria | 2309 |
| 469 | Ga0495637_0035951 | 3300046520 | Bacteria | 2161 |
| 470 | Ga0495643_0005784 | 3300046522 | Bacteria | 8275 |
| 471 | Ga0495643_0010944 | 3300046522 | Bacteria | 5553 |
| 472 | Ga0495643_0012619 | 3300046522 | Bacteria | 5089 |
| 473 | Ga0495643_0028326 | 3300046522 | Bacteria | 3141 |
| 474 | Ga0495643_0030954 | 3300046522 | Bacteria | 2983 |
| 475 | Ga0495643_0083795 | 3300046522 | Bacteria | 1655 |
| 476 | Ga0495644_0000462 | 3300046523 | Bacteria | 17616 |
| 477 | Ga0495644_0000922 | 3300046523 | Bacteria | 12223 |
| 478 | Ga0495644_0004200 | 3300046523 | Bacteria | 5660 |
| 479 | Ga0495644_0006368 | 3300046523 | Bacteria | 4579 |
| 480 | Ga0495644_0019354 | 3300046523 | Bacteria | 2600 |
| 481 | Ga0495644_0060544 | 3300046523 | Bacteria | 1423 |
| 482 | Ga0495648_0003483 | 3300046524 | Bacteria | 13806 |
| 483 | Ga0495648_0003589 | 3300046524 | Bacteria | 13570 |
| 484 | Ga0495648_0006435 | 3300046524 | Bacteria | 9589 |
| 485 | Ga0495648_0010044 | 3300046524 | Bacteria | 7254 |
| 486 | Ga0495648_0011482 | 3300046524 | Bacteria | 6665 |
| 487 | Ga0495648_0012334 | 3300046524 | Bacteria | 6383 |
| 488 | Ga0495648_0012644 | 3300046524 | Bacteria | 6277 |
| 489 | Ga0495648_0031337 | 3300046524 | Bacteria | 3502 |
| 490 | Ga0495648_0043924 | 3300046524 | Bacteria | 2794 |
| 491 | Ga0495648_0046995 | 3300046524 | Bacteria | 2671 |
| 492 | Ga0495666_0000655 | 3300046526 | Bacteria | 15584 |
| 493 | Ga0495666_0020763 | 3300046526 | Bacteria | 3252 |
| 494 | Ga0495642_0000479 | 3300046528 | Bacteria | 20493 |
| 495 | Ga0495642_0000918 | 3300046528 | Bacteria | 13832 |
| 496 | Ga0495642_0001912 | 3300046528 | Bacteria | 8853 |
| 497 | Ga0495654_0000461 | 3300046530 | Bacteria | 33935 |
| 498 | Ga0495654_0000968 | 3300046530 | Bacteria | 21179 |
| 499 | Ga0495654_0000998 | 3300046530 | Bacteria | 20842 |
| 500 | Ga0495654_0001138 | 3300046530 | Bacteria | 19070 |
| 501 | Ga0495654_0002727 | 3300046530 | Bacteria | 11146 |
| 502 | Ga0495654_0002967 | 3300046530 | Bacteria | 10616 |
| 503 | Ga0495654_0005013 | 3300046530 | Bacteria | 7772 |
| 504 | Ga0495654_0010285 | 3300046530 | Bacteria | 5093 |
| 505 | Ga0495654_0014876 | 3300046530 | Bacteria | 4135 |
| 506 | Ga0495654_0020910 | 3300046530 | Bacteria | 3408 |
| 507 | Ga0495654_0023729 | 3300046530 | Bacteria | 3175 |
| 508 | Ga0495654_0028323 | 3300046530 | Bacteria | 2865 |
| 509 | Ga0495654_0032437 | 3300046530 | Bacteria | 2648 |
| 510 | Ga0495654_0037453 | 3300046530 | Bacteria | 2431 |
| 511 | Ga0495654_0054186 | 3300046530 | Bacteria | 1946 |
| 512 | Ga0495654_0069695 | 3300046530 | Bacteria | 1669 |
| 513 | Ga0495654_0070423 | 3300046530 | Bacteria | 1658 |
| 514 | Ga0495587_0113083 | 3300046536 | Bacteria | 1558 |
| 515 | Ga0495609_0000222 | 3300046538 | Bacteria | 55849 |
| 516 | Ga0495609_0000534 | 3300046538 | Bacteria | 30280 |
| 517 | Ga0495609_0002790 | 3300046538 | Bacteria | 10505 |
| 518 | Ga0495609_0012717 | 3300046538 | Bacteria | 3989 |
| 519 | Ga0495609_0017034 | 3300046538 | Bacteria | 3380 |
| 520 | Ga0495609_0063214 | 3300046538 | Bacteria | 1633 |
| 521 | Ga0495609_0071714 | 3300046538 | Bacteria | 1521 |
| 522 | Ga0495609_0076608 | 3300046538 | Bacteria | 1465 |
| 523 | Ga0495597_0003745 | 3300046542 | Bacteria | 8672 |
| 524 | Ga0495597_0004251 | 3300046542 | Bacteria | 7921 |
| 525 | Ga0495597_0008255 | 3300046542 | Bacteria | 5226 |
| 526 | Ga0495597_0012456 | 3300046542 | Bacteria | 4104 |
| 527 | Ga0495597_0014295 | 3300046542 | Bacteria | 3781 |
| 528 | Ga0495597_0024067 | 3300046542 | Bacteria | 2812 |
| 529 | Ga0495597_0025445 | 3300046542 | Bacteria | 2724 |
| 530 | Ga0495597_0051033 | 3300046542 | Bacteria | 1824 |
| 531 | Ga0495597_0059360 | 3300046542 | Bacteria | 1670 |
| 532 | Ga0495597_0061770 | 3300046542 | Bacteria | 1631 |
| 533 | Ga0495645_0036187 | 3300046543 | Bacteria | 3599 |
| 534 | Ga0495622_0000070 | 3300046557 | Bacteria | 89579 |
| 535 | Ga0495622_0003221 | 3300046557 | Bacteria | 7734 |
| 536 | Ga0495622_0005941 | 3300046557 | Bacteria | 5672 |
| 537 | Ga0495622_0019825 | 3300046557 | Bacteria | 3130 |
| 538 | Ga0495622_0047678 | 3300046557 | Bacteria | 1990 |
| 539 | Ga0495622_0050602 | 3300046557 | Bacteria | 1927 |
| 540 | Ga0495633_0005332 | 3300046558 | Bacteria | 7885 |
| 541 | Ga0495633_0010062 | 3300046558 | Bacteria | 5184 |
| 542 | Ga0495656_0082405 | 3300046615 | Bacteria | 1454 |
| 543 | Ga0495668_0002243 | 3300046616 | Bacteria | 16320 |
| 544 | Ga0495668_0002296 | 3300046616 | Bacteria | 16057 |
| 545 | Ga0495668_0008915 | 3300046616 | Bacteria | 6204 |
| 546 | Ga0495634_0002704 | 3300046642 | Bacteria | 14590 |
| 547 | Ga0495611_0000279 | 3300046648 | Bacteria | 34844 |
| 548 | Ga0495611_0003070 | 3300046648 | Bacteria | 7419 |
| 549 | Ga0495611_0004084 | 3300046648 | Bacteria | 6355 |
| 550 | Ga0495611_0030037 | 3300046648 | Bacteria | 2387 |
| 551 | Ga0495625_0003800 | 3300046660 | Bacteria | 14617 |
| 552 | Ga0495625_0006173 | 3300046660 | Bacteria | 10732 |
| 553 | Ga0495625_0015419 | 3300046660 | Bacteria | 6053 |
| 554 | Ga0495625_0025708 | 3300046660 | Bacteria | 4461 |
| 555 | Ga0495625_0027633 | 3300046660 | Bacteria | 4266 |
| 556 | Ga0495625_0051136 | 3300046660 | Bacteria | 2963 |
| 557 | Ga0495625_0055990 | 3300046660 | Bacteria | 2809 |
| 558 | Ga0495625_0067149 | 3300046660 | Bacteria | 2524 |
| 559 | Ga0495625_0119647 | 3300046660 | Bacteria | 1793 |
| 560 | Ga0495625_0150703 | 3300046660 | Bacteria | 1563 |
| 561 | Ga0495635_0001198 | 3300046663 | Bacteria | 17284 |
| 562 | Ga0495659_0000305 | 3300046664 | Bacteria | 19486 |
| 563 | Ga0495659_0003767 | 3300046664 | Bacteria | 4818 |
| 564 | Ga0495659_0008860 | 3300046664 | Bacteria | 3204 |
| 565 | Ga0495661_0000116 | 3300046665 | Bacteria | 95285 |
| 566 | Ga0495661_0000501 | 3300046665 | Bacteria | 40800 |
| 567 | Ga0495661_0002639 | 3300046665 | Bacteria | 13720 |
| 568 | Ga0495661_0006788 | 3300046665 | Bacteria | 8025 |
| 569 | Ga0495661_0018225 | 3300046665 | Bacteria | 4621 |
| 570 | Ga0495661_0018542 | 3300046665 | Bacteria | 4574 |
| 571 | Ga0495661_0020589 | 3300046665 | Bacteria | 4304 |
| 572 | Ga0495661_0021497 | 3300046665 | Bacteria | 4206 |
| 573 | Ga0495661_0036388 | 3300046665 | Bacteria | 3083 |
| 574 | Ga0495661_0081584 | 3300046665 | Bacteria | 1863 |
| 575 | Ga0495661_0084568 | 3300046665 | Bacteria | 1820 |
| 576 | Ga0495661_0116845 | 3300046665 | Bacteria | 1479 |
| 577 | Ga0495661_0122528 | 3300046665 | Bacteria | 1434 |
| 578 | Ga0495661_0124791 | 3300046665 | Bacteria | 1418 |
| 579 | Ga0495588_0007522 | 3300046674 | Bacteria | 4961 |
| 580 | Ga0495588_0030856 | 3300046674 | Bacteria | 2695 |
| 581 | Ga0495623_0003673 | 3300046679 | Bacteria | 10133 |
| 582 | Ga0495623_0005137 | 3300046679 | Bacteria | 8591 |
| 583 | Ga0495646_0058620 | 3300046680 | Bacteria | 2301 |
| 584 | Ga0495669_0023467 | 3300046684 | Bacteria | 2685 |
| 585 | Ga0495613_0021198 | 3300046689 | Bacteria | 4846 |
| 586 | Ga0495613_0059247 | 3300046689 | Bacteria | 2807 |
| 587 | Ga0495613_0088248 | 3300046689 | Bacteria | 2247 |
| 588 | Ga0495624_0001306 | 3300046690 | Bacteria | 19565 |
| 589 | Ga0495624_0038574 | 3300046690 | Bacteria | 3069 |
| 590 | Ga0495670_0000341 | 3300046691 | Bacteria | 22294 |
| 591 | Ga0495670_0000788 | 3300046691 | Bacteria | 15221 |
| 592 | Ga0495670_0002069 | 3300046691 | Bacteria | 9893 |
| 593 | Ga0495670_0002573 | 3300046691 | Bacteria | 8962 |
| 594 | Ga0495670_0010332 | 3300046691 | Bacteria | 4585 |
| 595 | Ga0495670_0012726 | 3300046691 | Bacteria | 4138 |
| 596 | Ga0495670_0013384 | 3300046691 | Bacteria | 4036 |
| 597 | Ga0495670_0093923 | 3300046691 | Bacteria | 1537 |
| 598 | Ga0495670_0094839 | 3300046691 | Bacteria | 1530 |
| 599 | Ga0495671_0000397 | 3300046692 | Bacteria | 35515 |
| 600 | Ga0495671_0002310 | 3300046692 | Bacteria | 12114 |
| 601 | Ga0495671_0006217 | 3300046692 | Bacteria | 6923 |
| 602 | Ga0495671_0006266 | 3300046692 | Bacteria | 6892 |
| 603 | Ga0495671_0007157 | 3300046692 | Bacteria | 6387 |
| 604 | Ga0495671_0011310 | 3300046692 | Bacteria | 4918 |
| 605 | Ga0495671_0012858 | 3300046692 | Bacteria | 4556 |
| 606 | Ga0495671_0016732 | 3300046692 | Bacteria | 3910 |
| 607 | Ga0495671_0035923 | 3300046692 | Bacteria | 2513 |
| 608 | Ga0495671_0044049 | 3300046692 | Bacteria | 2238 |
| 609 | Ga0495649_0000104 | 3300046694 | Bacteria | 74938 |
| 610 | Ga0495649_0001289 | 3300046694 | Bacteria | 19188 |
| 611 | Ga0495649_0002799 | 3300046694 | Bacteria | 12148 |
| 612 | Ga0495649_0006751 | 3300046694 | Bacteria | 7110 |
| 613 | Ga0495649_0007473 | 3300046694 | Bacteria | 6655 |
| 614 | Ga0495649_0008877 | 3300046694 | Bacteria | 6017 |
| 615 | Ga0495649_0012100 | 3300046694 | Bacteria | 5035 |
| 616 | Ga0495649_0012430 | 3300046694 | Bacteria | 4949 |
| 617 | Ga0495649_0016024 | 3300046694 | Bacteria | 4254 |
| 618 | Ga0495649_0017986 | 3300046694 | Bacteria | 3983 |
| 619 | Ga0495649_0023960 | 3300046694 | Bacteria | 3407 |
| 620 | Ga0495649_0160156 | 3300046694 | Bacteria | 1180 |
| 621 | Ga0495589_0002546 | 3300046794 | Bacteria | 10146 |
| 622 | Ga0495589_0007918 | 3300046794 | Bacteria | 5565 |
| 623 | Ga0495589_0008025 | 3300046794 | Bacteria | 5523 |
| 624 | Ga0495589_0008427 | 3300046794 | Bacteria | 5386 |
| 625 | Ga0495589_0009776 | 3300046794 | Bacteria | 4980 |
| 626 | Ga0495589_0011638 | 3300046794 | Bacteria | 4567 |
| 627 | Ga0495589_0013865 | 3300046794 | Bacteria | 4155 |
| 628 | Ga0495589_0019208 | 3300046794 | Bacteria | 3506 |
| 629 | Ga0495589_0021297 | 3300046794 | Bacteria | 3312 |
| 630 | Ga0495600_0020119 | 3300046809 | Bacteria | 4269 |
| 631 | Ga0495660_0001225 | 3300046810 | Bacteria | 17883 |
| 632 | Ga0495660_0003166 | 3300046810 | Bacteria | 10247 |
| 633 | Ga0495660_0005235 | 3300046810 | Bacteria | 7781 |
| 634 | Ga0495660_0006799 | 3300046810 | Bacteria | 6743 |
| 635 | Ga0495660_0007040 | 3300046810 | Bacteria | 6629 |
| 636 | Ga0495660_0010097 | 3300046810 | Bacteria | 5490 |
| 637 | Ga0495660_0010374 | 3300046810 | Bacteria | 5419 |
| 638 | Ga0495660_0010525 | 3300046810 | Bacteria | 5381 |
| 639 | Ga0495660_0015419 | 3300046810 | Bacteria | 4415 |
| 640 | Ga0495660_0018142 | 3300046810 | Bacteria | 4046 |
| 641 | Ga0495660_0023450 | 3300046810 | Bacteria | 3519 |
| 642 | Ga0495660_0041413 | 3300046810 | Bacteria | 2550 |
| 643 | Ga0495660_0046397 | 3300046810 | Bacteria | 2382 |
| 644 | Ga0495660_0062832 | 3300046810 | Bacteria | 1989 |
| 645 | Ga0495660_0067238 | 3300046810 | Bacteria | 1909 |
| 646 | Ga0495660_0070263 | 3300046810 | Bacteria | 1859 |
| 647 | Ga0495581_0003578 | 3300047315 | Bacteria | 8928 |
| 648 | Ga0495604_0002652 | 3300047317 | Bacteria | 14362 |
| 649 | Ga0495604_0013567 | 3300047317 | Bacteria | 6499 |
| 650 | Ga0495604_0076280 | 3300047317 | Bacteria | 2521 |
| 651 | Ga0495636_0005637 | 3300047318 | Bacteria | 4910 |
| 652 | Ga0495636_0059735 | 3300047318 | Bacteria | 1610 |
| 653 | Ga0495674_0046201 | 3300047319 | Bacteria | 3865 |
| 654 | Ga0495672_0000331 | 3300047320 | Bacteria | 62021 |
| 655 | Ga0495672_0002113 | 3300047320 | Bacteria | 18623 |
| 656 | Ga0495672_0003018 | 3300047320 | Bacteria | 14803 |
| 657 | Ga0495672_0004451 | 3300047320 | Bacteria | 11472 |
| 658 | Ga0495672_0007558 | 3300047320 | Bacteria | 8156 |
| 659 | Ga0495672_0012721 | 3300047320 | Bacteria | 5850 |
| 660 | Ga0495672_0019327 | 3300047320 | Bacteria | 4496 |
| 661 | Ga0495672_0031812 | 3300047320 | Bacteria | 3290 |
| 662 | Ga0495672_0048335 | 3300047320 | Bacteria | 2522 |
| 663 | Ga0495672_0066852 | 3300047320 | Bacteria | 2049 |
| 664 | Ga0495672_0094122 | 3300047320 | Bacteria | 1639 |
| 665 | Ga0495676_0001611 | 3300047321 | Bacteria | 19632 |
| 666 | Ga0495676_0012710 | 3300047321 | Bacteria | 7571 |
| 667 | Ga0495676_0034799 | 3300047321 | Bacteria | 4222 |
| 668 | Ga0495680_0032117 | 3300047322 | Bacteria | 4265 |
| 669 | Ga0495680_0077959 | 3300047322 | Bacteria | 2508 |
| 670 | Ga0495683_0000185 | 3300047323 | Bacteria | 61212 |
| 671 | Ga0495683_0000920 | 3300047323 | Bacteria | 20759 |
| 672 | Ga0495683_0001071 | 3300047323 | Bacteria | 18950 |
| 673 | Ga0495683_0001701 | 3300047323 | Bacteria | 13985 |
| 674 | Ga0495683_0002732 | 3300047323 | Bacteria | 10513 |
| 675 | Ga0495683_0018033 | 3300047323 | Bacteria | 3653 |
| 676 | Ga0495683_0030608 | 3300047323 | Bacteria | 2746 |
| 677 | Ga0495683_0051323 | 3300047323 | Bacteria | 2062 |
| 678 | Ga0495683_0064014 | 3300047323 | Bacteria | 1816 |
| 679 | Ga0495683_0071177 | 3300047323 | Bacteria | 1706 |
| 680 | Ga0495687_001896 | 3300047443 | Bacteria | 18021 |
| 681 | Ga0495687_002012 | 3300047443 | Bacteria | 17233 |
| 682 | Ga0495687_003051 | 3300047443 | Bacteria | 12564 |
| 683 | Ga0495687_003319 | 3300047443 | Bacteria | 11800 |
| 684 | Ga0495675_0085201 | 3300047444 | Bacteria | 1987 |
| 685 | Ga0495677_0002044 | 3300047445 | Bacteria | 8049 |
| 686 | Ga0495679_000727 | 3300047446 | Bacteria | 21158 |
| 687 | Ga0495679_000875 | 3300047446 | Bacteria | 18952 |
| 688 | Ga0495679_001754 | 3300047446 | Bacteria | 11907 |
| 689 | Ga0495679_002192 | 3300047446 | Bacteria | 10213 |
| 690 | Ga0495679_003911 | 3300047446 | Bacteria | 7041 |
| 691 | Ga0495679_004726 | 3300047446 | Bacteria | 6184 |
| 692 | Ga0495679_008670 | 3300047446 | Bacteria | 4116 |
| 693 | Ga0495679_023295 | 3300047446 | Bacteria | 2102 |
| 694 | Ga0495685_025982 | 3300047447 | Bacteria | 2015 |
| 695 | Ga0495673_0001043 | 3300047469 | Bacteria | 24417 |
| 696 | Ga0495673_0001505 | 3300047469 | Bacteria | 18401 |
| 697 | Ga0495673_0002263 | 3300047469 | Bacteria | 13812 |
| 698 | Ga0495673_0002289 | 3300047469 | Bacteria | 13723 |
| 699 | Ga0495673_0003406 | 3300047469 | Bacteria | 10500 |
| 700 | Ga0495673_0004020 | 3300047469 | Bacteria | 9382 |
| 701 | Ga0495673_0004197 | 3300047469 | Bacteria | 9091 |
| 702 | Ga0495673_0004554 | 3300047469 | Bacteria | 8653 |
| 703 | Ga0495673_0005403 | 3300047469 | Bacteria | 7734 |
| 704 | Ga0495673_0005775 | 3300047469 | Bacteria | 7414 |
| 705 | Ga0495673_0009682 | 3300047469 | Bacteria | 5310 |
| 706 | Ga0495673_0014932 | 3300047469 | Bacteria | 4021 |
| 707 | Ga0495673_0022317 | 3300047469 | Bacteria | 3105 |
| 708 | Ga0495673_0029359 | 3300047469 | Bacteria | 2595 |
| 709 | Ga0495673_0035676 | 3300047469 | Bacteria | 2288 |
| 710 | Ga0495673_0048213 | 3300047469 | Bacteria | 1879 |
| 711 | Ga0495681_0000399 | 3300047470 | Bacteria | 33808 |
| 712 | Ga0495681_0000804 | 3300047470 | Bacteria | 24176 |
| 713 | Ga0495681_0001014 | 3300047470 | Bacteria | 21549 |
| 714 | Ga0495681_0002079 | 3300047470 | Bacteria | 14550 |
| 715 | Ga0495681_0003785 | 3300047470 | Bacteria | 10487 |
| 716 | Ga0495681_0005868 | 3300047470 | Bacteria | 8151 |
| 717 | Ga0495681_0007243 | 3300047470 | Bacteria | 7131 |
| 718 | Ga0495681_0009471 | 3300047470 | Bacteria | 5995 |
| 719 | Ga0495681_0011105 | 3300047470 | Bacteria | 5397 |
| 720 | Ga0495681_0017614 | 3300047470 | Bacteria | 3959 |
| 721 | Ga0495681_0019031 | 3300047470 | Bacteria | 3763 |
| 722 | Ga0495681_0032446 | 3300047470 | Bacteria | 2629 |
| 723 | Ga0495681_0033687 | 3300047470 | Bacteria | 2561 |
| 724 | Ga0495681_0035989 | 3300047470 | Bacteria | 2453 |
| 725 | Ga0495681_0069668 | 3300047470 | Bacteria | 1597 |
| 726 | Ga0495684_0029668 | 3300047471 | Bacteria | 4197 |
| 727 | Ga0495684_0101291 | 3300047471 | Bacteria | 2177 |
| 728 | Ga0495686_0003471 | 3300047472 | Bacteria | 13634 |
| 729 | Ga0495686_0008020 | 3300047472 | Bacteria | 7828 |
| 730 | Ga0495686_0009315 | 3300047472 | Bacteria | 7085 |
| 731 | Ga0495686_0018000 | 3300047472 | Bacteria | 4750 |
| 732 | Ga0495686_0029995 | 3300047472 | Bacteria | 3534 |
| 733 | Ga0495593_0007442 | 3300047673 | Bacteria | 6406 |
| 734 | Ga0495593_0008928 | 3300047673 | Bacteria | 5818 |
| 735 | Ga0495602_0002686 | 3300048088 | Bacteria | 18185 |
| 736 | Ga0495626_0000203 | 3300048091 | Bacteria | 71731 |
| 737 | Ga0495626_0000456 | 3300048091 | Bacteria | 41667 |
| 738 | Ga0495626_0001599 | 3300048091 | Bacteria | 17651 |
| 739 | Ga0495626_0001772 | 3300048091 | Bacteria | 16401 |
| 740 | Ga0495626_0002511 | 3300048091 | Bacteria | 12651 |
| 741 | Ga0495626_0003174 | 3300048091 | Bacteria | 10707 |
| 742 | Ga0495626_0006388 | 3300048091 | Bacteria | 6712 |
| 743 | Ga0495626_0008350 | 3300048091 | Bacteria | 5688 |
| 744 | Ga0495626_0014487 | 3300048091 | Bacteria | 4064 |
| 745 | Ga0495626_0027701 | 3300048091 | Bacteria | 2753 |
| 746 | Ga0495626_0048175 | 3300048091 | Bacteria | 1978 |
| 747 | Ga0496102_0001019 | 3300048905 | Bacteria | 26110 |
| 748 | Ga0496103_0005170 | 3300048906 | Bacteria | 7853 |
| 749 | Ga0496105_0078700 | 3300048908 | Bacteria | 2722 |
| 750 | Ga0496106_0075915 | 3300048909 | Bacteria | 2575 |
| 751 | Ga0496107_0143940 | 3300048910 | Bacteria | 1762 |
| 752 | Ga0496113_0102919 | 3300048916 | Bacteria | 2215 |
| 753 | Ga0496116_0001790 | 3300048919 | Bacteria | 23362 |
| 754 | Ga0496116_0001797 | 3300048919 | Bacteria | 23299 |
| 755 | Ga0496116_0003072 | 3300048919 | Bacteria | 16842 |
| 756 | Ga0496116_0003590 | 3300048919 | Bacteria | 15259 |
| 757 | Ga0496117_0000720 | 3300048920 | Bacteria | 52184 |
| 758 | Ga0496117_0006016 | 3300048920 | Bacteria | 12483 |
| 759 | Ga0496117_0015516 | 3300048920 | Bacteria | 6489 |
| 760 | Ga0496117_0023681 | 3300048920 | Bacteria | 4882 |
| 761 | Ga0496117_0070727 | 3300048920 | Bacteria | 2342 |
| 762 | Ga0496118_0008420 | 3300048921 | Bacteria | 10663 |
| 763 | Ga0496118_0008627 | 3300048921 | Bacteria | 10487 |
| 764 | Ga0496118_0009584 | 3300048921 | Bacteria | 9748 |
| 765 | Ga0496118_0016534 | 3300048921 | Bacteria | 6764 |
| 766 | Ga0496118_0017192 | 3300048921 | Bacteria | 6596 |
| 767 | Ga0496118_0022489 | 3300048921 | Bacteria | 5509 |
| 768 | Ga0496118_0094905 | 3300048921 | Bacteria | 2038 |
| 769 | Ga0496119_0016404 | 3300048922 | Bacteria | 5639 |
| 770 | Ga0496120_0007042 | 3300048923 | Bacteria | 8444 |
| 771 | Ga0496120_0015856 | 3300048923 | Bacteria | 4949 |
| 772 | Ga0496120_0033702 | 3300048923 | Bacteria | 3075 |
| 773 | Ga0496120_0050548 | 3300048923 | Bacteria | 2379 |
| 774 | Ga0496121_0013896 | 3300048924 | Bacteria | 8608 |
| 775 | Ga0496121_0022233 | 3300048924 | Bacteria | 6167 |
| 776 | Ga0496121_0032478 | 3300048924 | Bacteria | 4743 |
| 777 | Ga0496121_0071912 | 3300048924 | Bacteria | 2780 |
| 778 | Ga0496122_0004285 | 3300048925 | Bacteria | 17875 |
| 779 | Ga0496122_0011812 | 3300048925 | Bacteria | 8782 |
| 780 | Ga0496122_0018619 | 3300048925 | Bacteria | 6399 |
| 781 | Ga0496122_0052361 | 3300048925 | Bacteria | 3090 |
| 782 | Ga0496122_0062736 | 3300048925 | Bacteria | 2718 |
| 783 | Ga0496123_0003416 | 3300048926 | Bacteria | 17871 |
| 784 | Ga0496123_0011560 | 3300048926 | Bacteria | 7637 |
| 785 | Ga0496123_0014910 | 3300048926 | Bacteria | 6407 |
| 786 | Ga0496124_0000816 | 3300048927 | Bacteria | 50663 |
| 787 | Ga0496124_0006096 | 3300048927 | Bacteria | 13264 |
| 788 | Ga0496124_0010907 | 3300048927 | Bacteria | 9142 |
| 789 | Ga0496124_0027067 | 3300048927 | Bacteria | 5157 |
| 790 | Ga0496124_0052203 | 3300048927 | Bacteria | 3474 |
| 791 | Ga0496124_0167582 | 3300048927 | Bacteria | 1705 |
| 792 | Ga0496125_0000822 | 3300048928 | Bacteria | 50288 |
| 793 | Ga0496125_0003780 | 3300048928 | Bacteria | 17999 |
| 794 | Ga0496125_0004344 | 3300048928 | Bacteria | 16443 |
| 795 | Ga0496125_0008974 | 3300048928 | Bacteria | 10365 |
| 796 | Ga0496125_0033195 | 3300048928 | Bacteria | 4572 |
| 797 | Ga0496125_0036046 | 3300048928 | Bacteria | 4326 |
| 798 | Ga0496125_0038878 | 3300048928 | Bacteria | 4108 |
| 799 | Ga0496125_0050653 | 3300048928 | Bacteria | 3435 |
| 800 | Ga0496125_0057874 | 3300048928 | Bacteria | 3135 |
| 801 | Ga0496125_0058225 | 3300048928 | Bacteria | 3122 |
| 802 | Ga0496126_0005995 | 3300048929 | Bacteria | 13652 |
| 803 | Ga0496126_0007640 | 3300048929 | Bacteria | 11801 |
| 804 | Ga0495678_002361 | 3300049459 | Bacteria | 12956 |
| 805 | Ga0495678_003607 | 3300049459 | Bacteria | 9440 |
| 806 | Ga0495678_004892 | 3300049459 | Bacteria | 7571 |
| 807 | Ga0495678_005865 | 3300049459 | Bacteria | 6649 |
| 808 | Ga0495678_008259 | 3300049459 | Bacteria | 5276 |
| 809 | Ga0495678_008485 | 3300049459 | Bacteria | 5177 |
| 810 | Ga0495678_010183 | 3300049459 | Bacteria | 4583 |
| 811 | Ga0495678_013970 | 3300049459 | Bacteria | 3749 |
| 812 | Ga0495678_022851 | 3300049459 | Bacteria | 2728 |
| 813 | Ga0495678_025920 | 3300049459 | Bacteria | 2510 |
| 814 | Ga0495678_026257 | 3300049459 | Bacteria | 2489 |
| 815 | Ga0495678_035309 | 3300049459 | Bacteria | 2050 |
| 816 | Ga0495682_0000905 | 3300049460 | Bacteria | 18206 |
| 817 | Ga0495682_0002057 | 3300049460 | Bacteria | 9853 |
| 818 | Ga0495682_0005159 | 3300049460 | Bacteria | 5463 |
| 819 | Ga0495682_0020833 | 3300049460 | Bacteria | 2459 |
| 820 | Ga0495682_0025014 | 3300049460 | Bacteria | 2223 |
| 821 | Ga0501042_0174739 | 3300049578 | Bacteria | 1550 |
| 822 | Ga0501073_0019911 | 3300049589 | Bacteria | 4840 |
| 823 | Ga0501222_000598 | 3300049662 | Bacteria | 5291 |
| 824 | Ga0500572_001735 | 3300053111 | Bacteria | 5658 |
| 825 | Ga0500618_002697 | 3300053125 | Bacteria | 6485 |
| 826 | 2511272345 | 2511231007 | Bacteria | 6306603 |
| 827 | 2511280800 | 2511231008 | Bacteria | 6624100 |
| 828 | 2511291575 | 2511231010 | Bacteria | 6373152 |
| 829 | 2511295820 | 2511231011 | Bacteria | 6149768 |
| 830 | 2511299046 | 2511231012 | Bacteria | 6738011 |
| 831 | 2511312357 | 2511231014 | Bacteria | 6462302 |
| 832 | 2511335087 | 2511231017 | Bacteria | 6503007 |
| 833 | 2511337137 | 2511231018 | Bacteria | 6436256 |
| 834 | 2511344711 | 2511231019 | Bacteria | 6520662 |
| 835 | 2511352917 | 2511231020 | Bacteria | 6115223 |
| 836 | 2511357550 | 2511231021 | Bacteria | 7302637 |
| 837 | 2511367663 | 2511231023 | Bacteria | 6808468 |
| 838 | 2511413878 | 2511231031 | Bacteria | 6558529 |
| 839 | 2511824688 | 2511231156 | Bacteria | 6845832 |
| 840 | 2597863815 | 2597489888 | Bacteria | 6179543 |
| 841 | 2597869964 | 2597489889 | Bacteria | 6297495 |
| 842 | 2599330281 | 2599185155 | Bacteria | 5827168 |
| 843 | 2599398228 | 2599185167 | Bacteria | 6353609 |
| 844 | 2599450238 | 2599185179 | Bacteria | 6611171 |
| 845 | 2599500668 | 2599185188 | Bacteria | 6164180 |
| 846 | 2599510411 | 2599185189 | Bacteria | 5862825 |
| 847 | 2599516085 | 2599185190 | Bacteria | 6285678 |
| 848 | 2599521186 | 2599185191 | Bacteria | 6297582 |
| 849 | 2599612906 | 2599185212 | Bacteria | 6765997 |
| 850 | 2599771778 | 2599185248 | Bacteria | 6696816 |
| 851 | 2599883605 | 2599185288 | Bacteria | 6666191 |
| 852 | 2599889144 | 2599185289 | Bacteria | 6778765 |
| 853 | 2599895616 | 2599185290 | Bacteria | 6289611 |
| 854 | 2599901198 | 2599185291 | Bacteria | 6775623 |
| 855 | 2599932331 | 2599185300 | Bacteria | 6062622 |
| 856 | 2599943502 | 2599185302 | Bacteria | 5954930 |
| 857 | 2599950367 | 2599185303 | Bacteria | 6512725 |
| 858 | 2599954613 | 2599185304 | Bacteria | 5951361 |
| 859 | 2599962302 | 2599185305 | Bacteria | 6748700 |
| 860 | 2599968092 | 2599185306 | Bacteria | 6637356 |
| 861 | 2599977117 | 2599185308 | Bacteria | 6621546 |
| 862 | 2599985168 | 2599185309 | Bacteria | 5969593 |
| 863 | 2599988582 | 2599185310 | Bacteria | 6014457 |
| 864 | 2599993417 | 2599185311 | Bacteria | 6354990 |
| 865 | 2600002893 | 2599185312 | Bacteria | 5912071 |
| 866 | 2600008203 | 2599185313 | Bacteria | 6658188 |
| 867 | 2600011155 | 2599185314 | Bacteria | 6621749 |
| 868 | 2600016190 | 2599185315 | Bacteria | 6771107 |
| 869 | 2600022000 | 2599185316 | Bacteria | 6320029 |
| 870 | 2600028486 | 2599185317 | Bacteria | 6435722 |
| 871 | 2600038027 | 2599185318 | Bacteria | 6961590 |
| 872 | 2600044368 | 2599185319 | Bacteria | 6637840 |
| 873 | 2600049841 | 2599185320 | Bacteria | 5963263 |
| 874 | 2600051396 | 2599185321 | Bacteria | 6764560 |
| 875 | 2600060013 | 2599185322 | Bacteria | 6763055 |
| 876 | 2600063235 | 2599185323 | Bacteria | 6688755 |
| 877 | 2600070538 | 2599185324 | Bacteria | 6590677 |
| 878 | 2600075274 | 2599185325 | Bacteria | 6324919 |
| 879 | 2600357653 | 2600254930 | Bacteria | 6431253 |
| 880 | 2601691771 | 2600255296 | Bacteria | 5784754 |
| 881 | 2601799226 | 2600255318 | Bacteria | 6383414 |
| 882 | 2606078126 | 2603880185 | Bacteria | 6379190 |
| 883 | 2606125997 | 2603880199 | Bacteria | 6377649 |
| 884 | 2621299460 | 2619619299 | Bacteria | 6649820 |
| 885 | 2624480664 | 2623620443 | Bacteria | 6427864 |
| 886 | 2624492435 | 2623620446 | Bacteria | 6500345 |
| 887 | 2643844507 | 2643221565 | Bacteria | 6216018 |
| 888 | 2643869899 | 2643221571 | Bacteria | 6228673 |
| 889 | 2643954365 | 2643221589 | Bacteria | 6250934 |
| 890 | 2644023174 | 2643221602 | Bacteria | 6249926 |
| 891 | 2644185302 | 2643221633 | Bacteria | 6733554 |
| 892 | 2644283683 | 2643221650 | Bacteria | 7029547 |
| 893 | 2644621131 | 2643221713 | Bacteria | 6554480 |
| 894 | 2652546928 | 2651869719 | Bacteria | 6047974 |
| 895 | 2671094278 | 2667528170 | Bacteria | 6786960 |
| 896 | 2671126347 | 2667528176 | Bacteria | 6724917 |
| 897 | 2677896325 | 2675903420 | Bacteria | 6247433 |
| 898 | 2678262050 | 2675903515 | Bacteria | 6580491 |
| 899 | 2715753236 | 2713897148 | Bacteria | 5883533 |
| 900 | 2715756624 | 2713897149 | Bacteria | 6506249 |
| 901 | 2723248601 | 2721755607 | Bacteria | 5841722 |
| 902 | 2738747868 | 2738541282 | Bacteria | 6593925 |
| 903 | 2738810741 | 2738541294 | Bacteria | 6925949 |
| 904 | 2738856911 | 2738541303 | Bacteria | 6591772 |
| 905 | 2738898101 | 2738541309 | Bacteria | 6926455 |
| 906 | 2739199494 | 2738543004 | Bacteria | 6381073 |
| 907 | 2739257239 | 2738543015 | Bacteria | 6750701 |
| 908 | 2739311859 | 2738543025 | Bacteria | 6600348 |
| 909 | 2745008398 | 2744054620 | Bacteria | 6551379 |
| 910 | 2774133919 | 2773857673 | Bacteria | 6513460 |
| 911 | 2784264313 | 2784132063 | Bacteria | 6262788 |
| 912 | 2794597200 | 2791355520 | Bacteria | 5948615 |
| 913 | 2808922190 | 2808606376 | Bacteria | 6248667 |
| 914 | 2808929608 | 2808606377 | Bacteria | 6646337 |
| 915 | 2808933641 | 2808606378 | Bacteria | 6177535 |
| 916 | 2808944827 | 2808606380 | Bacteria | 6248705 |
| 917 | 2808951813 | 2808606381 | Bacteria | 6646461 |
| 918 | 2808959486 | 2808606382 | Bacteria | 6841132 |
| 919 | 2808962115 | 2808606383 | Bacteria | 6138645 |
| 920 | 2808980624 | 2808606385 | Bacteria | 6711065 |
| 921 | 2808996345 | 2808606388 | Bacteria | 6706662 |
| 922 | 2808997128 | 2808606389 | Bacteria | 6138126 |
| 923 | 2809214907 | 2808606445 | Bacteria | 6057339 |
| 924 | 2817490822 | 2816332298 | Bacteria | 6852809 |
| 925 | 2819659014 | 2818991456 | Bacteria | 6123676 |
| 926 | 2825651477 | 2825651385 | Bacteria | 6715909 |
| 927 | 2826586032 | 2826581358 | Bacteria | 5963467 |
| 928 | 2834029982 | 2834028612 | Bacteria | 6354979 |
| 929 | 2842819069 | 2842815866 | Bacteria | 5947510 |
| 930 | 2842826849 | 2842826826 | Bacteria | 5974129 |
| 931 | 2842834633 | 2842832357 | Bacteria | 5959113 |
| 932 | 2842839416 | 2842837860 | Bacteria | 6066181 |
| 933 | 2842843720 | 2842843487 | Bacteria | 6004777 |
| 934 | 2842853395 | 2842849001 | Bacteria | 5924277 |
| 935 | 2842859100 | 2842854478 | Bacteria | 6143501 |
| 936 | 2852614714 | 2852612431 | Bacteria | 6885235 |
| 937 | 2852657606 | 2852657418 | Bacteria | 6472974 |
| 938 | 2852667548 | 2852667396 | Bacteria | 6885555 |
| 939 | 2860344712 | 2860339153 | Bacteria | 6846989 |
| 940 | 2878032540 | 2878029506 | Bacteria | 6418441 |
| 941 | 2880233605 | 2880230671 | Bacteria | 6140320 |
| 942 | 2904520015 | 2904518522 | Bacteria | 6068986 |
| 943 | 2904550279 | 2904550169 | Bacteria | 6221258 |
| 944 | 2908449885 | 2908446538 | Bacteria | 6829095 |
| 945 | 2919065083 | 2919063839 | Bacteria | 6302690 |
| 946 | 2919387006 | 2919385768 | Bacteria | 5897293 |
| 947 | 2919458767 | 2919456309 | Bacteria | 6586567 |
| 948 | 2919487381 | 2919481497 | Bacteria | 6907839 |
| 949 | 2919492304 | 2919487758 | Bacteria | 5929766 |
| 950 | 2919698602 | 2919697872 | Bacteria | 6553725 |
| 951 | 2923588803 | 2923586266 | Bacteria | 6565975 |
| 952 | 2929147509 | 2929144301 | Bacteria | 6622272 |
| 953 | 2929192396 | 2929189879 | Bacteria | 5930554 |
| 954 | 2931394107 | 2931390751 | Bacteria | 6273349 |
| 955 | 2931402231 | 2931396565 | Bacteria | 7251677 |
| 956 | 2939638890 | 2939636861 | Bacteria | 6297853 |
| 957 | 2945933672 | 2945928738 | Bacteria | 6053221 |
| 958 | 2945963886 | 2945961074 | Bacteria | 7342064 |
| 959 | 2946010063 | 2946006987 | Bacteria | 6705746 |
| 960 | 2946031076 | 2946027586 | Bacteria | 6049274 |
| 961 | 2947237659 | 2947233263 | Bacteria | 6439278 |
| 962 | 2974290933 | 2974289157 | Bacteria | 6080362 |
| 963 | 2998142887 | 2998139840 | Bacteria | 6073514 |
| 964 | 3007422941 | 3007419365 | Bacteria | 7026924 |
| 965 | 3007514184 | 3007511990 | Bacteria | 6481491 |
| 966 | 3007614239 | 3007614139 | Bacteria | 6053559 |
| 967 | 3007621616 | 3007619802 | Bacteria | 6411688 |
| 968 | 3007719159 | 3007718800 | Bacteria | 5971527 |
| 969 | 3007856906 | 3007855910 | Bacteria | 5637581 |
| 970 | 3007869352 | 3007866637 | Bacteria | 5899198 |
| 971 | 8019778930 | 8019775933 | Bacteria | 6858656 |
| 972 | 8029997907 | 8029995093 | Bacteria | 5990776 |
| 973 | 8054288496 | 8054285046 | Bacteria | 6919322 |
| 974 | 8054348089 | 8054347763 | Bacteria | 5901107 |
| 975 | 8054506147 | 8054503363 | Bacteria | 6101651 |
| 976 | 8055820748 | 8055817908 | Bacteria | 6609162 |
| 977 | 8056128748 | 8056125926 | Bacteria | 6228218 |
| 978 | 8056134596 | 8056131705 | Bacteria | 6107031 |
| 979 | 8056145845 | 8056143049 | Bacteria | 6307666 |
| 980 | 8056154648 | 8056148874 | Bacteria | 6479865 |
| 981 | 8056165874 | 8056161164 | Bacteria | 6106669 |
| 982 | 8056168311 | 8056166840 | Bacteria | 5820959 |
| 983 | 8056178327 | 8056177738 | Bacteria | 6748268 |
| 984 | 8056574390 | 8056569372 | Bacteria | 5997322 |
| 985 | Ga0495681_0002728 | |||
| 986 | MRS2a_Contig_6993 | |||
| 987 | MRS2a_Contig_731 | |||
| 988 | SwRhRL2b_contig_1875304 | |||
| 989 | MRS1b_contig_5847325 | |||
| 990 | Ga0055539_1000011 | |||
| 991 | Ga0055533_1000014 | |||
| 992 | Ga0055532_1000009 | |||
| 993 | Ga0055525_1000016 | |||
| 994 | Ga0055536_1000352 | |||
| 995 | Ga0055530_10000019 | |||
| 996 | Ga0055530_10002917 | |||
| 997 | Ga0055540_1000006 | |||
| 998 | Ga0055540_1000055 | |||
| 999 | Ga0055531_10000126 | |||
| 1000 | Ga0055541_1000008 | |||
| 1001 | Ga0065714_10000255 | |||
| 1002 | Ga0065714_10002219 | |||
| 1003 | Ga0065714_10003565 | |||
| 1004 | Ga0065714_10009982 | |||
| 1005 | Ga0065714_10012859 | |||
| 1006 | Ga0065714_10023451 | |||
| 1007 | Ga0065714_10068323 | |||
| 1008 | Ga0065714_10075816 | |||
| 1009 | Ga0065714_10082916 | |||
| 1010 | Ga0065704_10070628 | |||
| 1011 | Ga0065704_10099151 | |||
| 1012 | Ga0065704_10136757 | |||
| 1013 | Ga0065712_10069901 | |||
| 1014 | Ga0065715_10013805 | |||
| 1015 | Ga0070670_100000495 | |||
| 1016 | Ga0070670_100002291 | |||
| 1017 | Ga0070669_100010476 | |||
| 1018 | Ga0070662_100003888 | |||
| 1019 | Ga0070662_100037132 | |||
| 1020 | Ga0070664_100000064 | |||
| 1021 | Ga0068851_10000165 | |||
| 1022 | Ga0075432_10000990 | |||
| 1023 | Ga0075432_10003031 | |||
| 1024 | Ga0075362_10118062 | |||
| 1025 | Ga0075436_100015966 | |||
| 1026 | Ga0075436_100022524 | |||
| 1027 | Ga0079104_1000235 | |||
| 1028 | Ga0079104_1000873 | |||
| 1029 | Ga0099826_10010909 | |||
| 1030 | Ga0105251_10000456 | |||
| 1031 | Ga0105251_10001310 | |||
| 1032 | Ga0105251_10014230 | |||
| 1033 | Ga0105251_10019713 | |||
| 1034 | Ga0105251_10025751 | |||
| 1035 | Ga0105251_10029890 | |||
| 1036 | Ga0105251_10034266 | |||
| 1037 | Ga0105251_10100078 | |||
| 1038 | Ga0105244_10002575 | |||
| 1039 | Ga0105244_10003967 | |||
| 1040 | Ga0105244_10004549 | |||
| 1041 | Ga0105244_10006056 | |||
| 1042 | Ga0105244_10009002 | |||
| 1043 | Ga0105244_10015172 | |||
| 1044 | Ga0105244_10027913 | |||
| 1045 | Ga0105250_10000145 | |||
| 1046 | Ga0105250_10000256 | |||
| 1047 | Ga0105250_10000757 | |||
| 1048 | Ga0105250_10011541 | |||
| 1049 | Ga0105250_10015734 | |||
| 1050 | Ga0105243_10013488 | |||
| 1051 | Ga0105243_10022501 | |||
| 1052 | Ga0105242_10004868 | |||
| 1053 | Ga0105237_10000426 | |||
| 1054 | Ga0105246_10000009 | |||
| 1055 | Ga0105246_10011996 | |||
| 1056 | Ga0105246_10086860 | |||
| 1057 | Ga0157345_1000181 | |||
| 1058 | Ga0157373_10002099 | |||
| 1059 | Ga0157373_10002260 | |||
| 1060 | Ga0157373_10002438 | |||
| 1061 | Ga0157373_10004688 | |||
| 1062 | Ga0157373_10016012 | |||
| 1063 | Ga0157373_10025264 | |||
| 1064 | Ga0157373_10134310 | |||
| 1065 | Ga0157373_10164962 | |||
| 1066 | Ga0157371_10000189 | |||
| 1067 | Ga0157371_10017892 | |||
| 1068 | Ga0157370_10066712 | |||
| 1069 | Ga0157370_10086648 | |||
| 1070 | Ga0157370_10103178 | |||
| 1071 | Ga0157370_10191776 | |||
| 1072 | Ga0157369_10005447 | |||
| 1073 | Ga0157369_10007726 | |||
| 1074 | Ga0157369_10012736 | |||
| 1075 | Ga0157369_10036133 | |||
| 1076 | Ga0157369_10045733 | |||
| 1077 | Ga0157369_10100516 | |||
| 1078 | Ga0163162_10000169 | |||
| 1079 | Ga0157375_10003950 | |||
| 1080 | Ga0157375_10215829 | |||
| 1081 | Ga0182008_10000404 | |||
| 1082 | Ga0182008_10000942 | |||
| 1083 | Ga0182008_10007227 | |||
| 1084 | Ga0182008_10044238 | |||
| 1085 | Ga0182008_10055744 | |||
| 1086 | Ga0182008_10085377 | |||
| 1087 | Ga0182006_1000452 | |||
| 1088 | Ga0182006_1000704 | |||
| 1089 | Ga0182006_1004026 | |||
| 1090 | Ga0182006_1011474 | |||
| 1091 | Ga0182006_1016570 | |||
| 1092 | Ga0182006_1030283 | |||
| 1093 | Ga0182007_10000083 | |||
| 1094 | Ga0182007_10001288 | |||
| 1095 | Ga0182007_10004715 | |||
| 1096 | Ga0182005_1001844 | |||
| 1097 | Ga0182005_1008383 | |||
| 1098 | Ga0182005_1008813 | |||
| 1099 | Ga0182005_1009216 | |||
| 1100 | Ga0182005_1040602 | |||
| 1101 | Ga0163161_10000440 | |||
| 1102 | Ga0163161_10001602 | |||
| 1103 | Ga0163161_10004328 | |||
| 1104 | Ga0163161_10009073 | |||
| 1105 | Ga0163161_10048643 | |||
| 1106 | Ga0163161_10097373 | |||
| 1107 | Ga0163161_10161309 | |||
| 1108 | Ga0209435_101164 | |||
| 1109 | Ga0209784_100023 | |||
| 1110 | Ga0209566_100019 | |||
| 1111 | Ga0209674_100034 | |||
| 1112 | Ga0209147_100027 | |||
| 1113 | Ga0209563_100037 | |||
| 1114 | Ga0209563_100908 | |||
| 1115 | Ga0209258_100268 | |||
| 1116 | Ga0209646_1000323 | |||
| 1117 | Ga0209677_100021 | |||
| 1118 | Ga0209675_1004176 | |||
| 1119 | Ga0209676_1000002 | |||
| 1120 | Ga0209676_1000158 | |||
| 1121 | Ga0209676_1002612 | |||
| 1122 | Ga0209676_1004504 | |||
| 1123 | Ga0209050_1000006 | |||
| 1124 | Ga0209050_1000013 | |||
| 1125 | Ga0209050_1000321 | |||
| 1126 | Ga0209051_1000001 | |||
| 1127 | Ga0209051_1000007 | |||
| 1128 | Ga0209051_1017169 | |||
| 1129 | Ga0209257_1000029 | |||
| 1130 | Ga0207656_10002984 | |||
| 1131 | Ga0207696_1000002 | |||
| 1132 | Ga0207696_1000011 | |||
| 1133 | Ga0207696_1000186 | |||
| 1134 | Ga0207696_1002373 | |||
| 1135 | Ga0207696_1004244 | |||
| 1136 | Ga0207696_1039914 | |||
| 1137 | Ga0207655_1000022 | |||
| 1138 | Ga0207655_1000207 | |||
| 1139 | Ga0207655_1000379 | |||
| 1140 | Ga0207655_1001659 | |||
| 1141 | Ga0207655_1004289 | |||
| 1142 | Ga0207655_1005715 | |||
| 1143 | Ga0207655_1008836 | |||
| 1144 | Ga0207655_1015187 | |||
| 1145 | Ga0207655_1018714 | |||
| 1146 | Ga0207655_1027367 | |||
| 1147 | Ga0207655_1028945 | |||
| 1148 | Ga0207655_1047020 | |||
| 1149 | Ga0207713_1000162 | |||
| 1150 | Ga0207713_1000326 | |||
| 1151 | Ga0207713_1000447 | |||
| 1152 | Ga0207713_1000552 | |||
| 1153 | Ga0207713_1006733 | |||
| 1154 | Ga0207713_1008776 | |||
| 1155 | Ga0207713_1011581 | |||
| 1156 | Ga0207713_1029694 | |||
| 1157 | Ga0207713_1029696 | |||
| 1158 | Ga0207713_1056082 | |||
| 1159 | Ga0207671_10000743 | |||
| 1160 | Ga0207649_10000116 | |||
| 1161 | Ga0207650_10000750 | |||
| 1162 | Ga0207686_10002731 | |||
| 1163 | Ga0207709_10000004 | |||
| 1164 | Ga0207679_10000054 | |||
| 1165 | Ga0207639_10118851 | |||
| 1166 | Ga0209281_1000009 | |||
| 1167 | Ga0209281_1000046 | |||
| 1168 | Ga0209281_1013568 | |||
| 1169 | Ga0207428_10007691 | |||
| 1170 | Ga0207428_10022356 | |||
| 1171 | Ga0307511_10144701 | |||
| 1172 | Ga0307408_100007588 | |||
| 1173 | Ga0307405_10000328 | |||
| 1174 | Ga0307405_10050641 | |||
| 1175 | Ga0307413_10044281 | |||
| 1176 | Ga0307413_10072835 | |||
| 1177 | Ga0307406_10016525 | |||
| 1178 | Ga0307407_10058849 | |||
| 1179 | Ga0307412_10001489 | |||
| 1180 | Ga0307412_10004125 | |||
| 1181 | Ga0307412_10005227 | |||
| 1182 | Ga0307412_10014820 | |||
| 1183 | Ga0307412_10193721 | |||
| 1184 | Ga0307409_100211491 | |||
| 1185 | Ga0307409_100271065 | |||
| 1186 | Ga0307416_100012044 | |||
| 1187 | Ga0307414_10265513 | |||
| 1188 | Ga0307414_10296114 | |||
| 1189 | Ga0307411_10012125 | |||
| 1190 | Ga0307411_10065922 | |||
| 1191 | Ga0307510_10014347 | |||
| 1192 | Ga0439438_000875 | |||
| 1193 | Ga0439438_000998 | |||
| 1194 | Ga0439438_001021 | |||
| 1195 | Ga0439438_001408 | |||
| 1196 | Ga0439438_001812 | |||
| 1197 | Ga0439438_003024 | |||
| 1198 | Ga0439438_003764 | |||
| 1199 | Ga0439438_004188 | |||
| 1200 | Ga0439438_005138 | |||
| 1201 | Ga0439447_001833 | |||
| 1202 | Ga0439447_002314 | |||
| 1203 | Ga0439447_003667 | |||
| 1204 | Ga0439447_003840 | |||
| 1205 | Ga0439447_005155 | |||
| 1206 | Ga0439447_014969 | |||
| 1207 | Ga0439466_0001055 | |||
| 1208 | Ga0439466_0001400 | |||
| 1209 | Ga0439466_0003160 | |||
| 1210 | Ga0439466_0010386 | |||
| 1211 | Ga0439466_0018033 | |||
| 1212 | Ga0451793_1073897 | |||
| 1213 | Ga0451807_1051409 | |||
| 1214 | Ga0439431_0006087 | |||
| 1215 | Ga0439445_0002580 | |||
| 1216 | Ga0439432_000031 | |||
| 1217 | Ga0439432_001202 | |||
| 1218 | Ga0439432_001230 | |||
| 1219 | Ga0439432_001672 | |||
| 1220 | Ga0439432_003431 | |||
| 1221 | Ga0439451_000310 | |||
| 1222 | Ga0439451_001779 | |||
| 1223 | Ga0439451_009077 | |||
| 1224 | Ga0439452_000317 | |||
| 1225 | Ga0439452_001132 | |||
| 1226 | Ga0439452_001430 | |||
| 1227 | Ga0439452_017043 | |||
| 1228 | Ga0439456_004229 | |||
| 1229 | Ga0439463_018138 | |||
| 1230 | Ga0450911_000076 | |||
| 1231 | Ga0450911_001437 | |||
| 1232 | Ga0450920_001078 | |||
| 1233 | Ga0450902_001808 | |||
| 1234 | Ga0450903_001550 | |||
| 1235 | Ga0450903_007363 | |||
| 1236 | Ga0450903_009157 | |||
| 1237 | Ga0450904_001002 | |||
| 1238 | Ga0450906_004556 | |||
| 1239 | Ga0450907_000269 | |||
| 1240 | Ga0450907_002262 | |||
| 1241 | Ga0439446_0005630 | |||
| 1242 | Ga0450908_001729 | |||
| 1243 | Ga0450909_001472 | |||
| 1244 | Ga0439434_0001842 | |||
| 1245 | Ga0439460_0003382 | |||
| 1246 | Ga0439460_0003508 | |||
| 1247 | Ga0450901_001417 | |||
| 1248 | Ga0439440_0000822 | |||
| 1249 | Ga0495617_000097 | |||
| 1250 | Ga0495617_001247 | |||
| 1251 | Ga0495617_001668 | |||
| 1252 | Ga0495617_005076 | |||
| 1253 | Ga0495617_005125 | |||
| 1254 | Ga0495617_005357 | |||
| 1255 | Ga0495617_017035 | |||
| 1256 | Ga0495617_026955 | |||
| 1257 | Ga0495617_034199 | |||
| 1258 | Ga0495627_000517 | |||
| 1259 | Ga0495627_000526 | |||
| 1260 | Ga0495627_001863 | |||
| 1261 | Ga0495627_004951 | |||
| 1262 | Ga0495627_015889 | |||
| 1263 | Ga0495592_0017072 | |||
| 1264 | Ga0495603_0011368 | |||
| 1265 | Ga0495603_0027710 | |||
| 1266 | Ga0495603_0037608 | |||
| 1267 | Ga0495590_0000708 | |||
| 1268 | Ga0495590_0008745 | |||
| 1269 | Ga0495590_0019869 | |||
| 1270 | Ga0495590_0021644 | |||
| 1271 | Ga0495591_000060 | |||
| 1272 | Ga0495591_000221 | |||
| 1273 | Ga0495591_000354 | |||
| 1274 | Ga0495591_002731 | |||
| 1275 | Ga0495591_002853 | |||
| 1276 | Ga0495591_006357 | |||
| 1277 | Ga0495591_006811 | |||
| 1278 | Ga0495591_007623 | |||
| 1279 | Ga0495591_007952 | |||
| 1280 | Ga0495591_008212 | |||
| 1281 | Ga0495591_015788 | |||
| 1282 | Ga0495638_0000298 | |||
| 1283 | Ga0495638_0001565 | |||
| 1284 | Ga0495638_0002480 | |||
| 1285 | Ga0495638_0002560 | |||
| 1286 | Ga0495638_0003323 | |||
| 1287 | Ga0495638_0012218 | |||
| 1288 | Ga0495638_0013298 | |||
| 1289 | Ga0495638_0015951 | |||
| 1290 | Ga0495638_0022972 | |||
| 1291 | Ga0495638_0030695 | |||
| 1292 | Ga0495638_0035221 | |||
| 1293 | Ga0495638_0035682 | |||
| 1294 | Ga0495638_0043170 | |||
| 1295 | Ga0495638_0066691 | |||
| 1296 | Ga0495638_0095059 | |||
| 1297 | Ga0495638_0147148 | |||
| 1298 | Ga0495653_0000844 | |||
| 1299 | Ga0495653_0002370 | |||
| 1300 | Ga0495653_0006664 | |||
| 1301 | Ga0495653_0045650 | |||
| 1302 | Ga0495650_0001297 | |||
| 1303 | Ga0495650_0002090 | |||
| 1304 | Ga0495650_0015181 | |||
| 1305 | Ga0495650_0022221 | |||
| 1306 | Ga0495650_0026452 | |||
| 1307 | Ga0495650_0046317 | |||
| 1308 | Ga0495650_0071139 | |||
| 1309 | Ga0495580_0144905 | |||
| 1310 | Ga0495605_0000197 | |||
| 1311 | Ga0495605_0000789 | |||
| 1312 | Ga0495605_0002861 | |||
| 1313 | Ga0495605_0007042 | |||
| 1314 | Ga0495605_0008045 | |||
| 1315 | Ga0495605_0011728 | |||
| 1316 | Ga0495605_0015578 | |||
| 1317 | Ga0495605_0024112 | |||
| 1318 | Ga0495605_0030899 | |||
| 1319 | Ga0495605_0041097 | |||
| 1320 | Ga0495605_0057215 | |||
| 1321 | Ga0495639_0000038 | |||
| 1322 | Ga0495639_0016334 | |||
| 1323 | Ga0495639_0034347 | |||
| 1324 | Ga0495584_0001813 | |||
| 1325 | Ga0495584_0002046 | |||
| 1326 | Ga0495584_0003710 | |||
| 1327 | Ga0495584_0004982 | |||
| 1328 | Ga0495584_0005128 | |||
| 1329 | Ga0495584_0005630 | |||
| 1330 | Ga0495584_0005823 | |||
| 1331 | Ga0495584_0007364 | |||
| 1332 | Ga0495584_0012567 | |||
| 1333 | Ga0495584_0033562 | |||
| 1334 | Ga0495584_0052008 | |||
| 1335 | Ga0495585_0000124 | |||
| 1336 | Ga0495585_0000581 | |||
| 1337 | Ga0495585_0001763 | |||
| 1338 | Ga0495585_0002723 | |||
| 1339 | Ga0495585_0005945 | |||
| 1340 | Ga0495585_0011083 | |||
| 1341 | Ga0495585_0012080 | |||
| 1342 | Ga0495585_0019325 | |||
| 1343 | Ga0495585_0019756 | |||
| 1344 | Ga0495585_0061378 | |||
| 1345 | Ga0495594_0002774 | |||
| 1346 | Ga0495594_0005166 | |||
| 1347 | Ga0495594_0013928 | |||
| 1348 | Ga0495594_0065612 | |||
| 1349 | Ga0495596_0000014 | |||
| 1350 | Ga0495596_0017459 | |||
| 1351 | Ga0495607_0000014 | |||
| 1352 | Ga0495607_0000575 | |||
| 1353 | Ga0495607_0002301 | |||
| 1354 | Ga0495607_0002457 | |||
| 1355 | Ga0495607_0003228 | |||
| 1356 | Ga0495607_0004200 | |||
| 1357 | Ga0495607_0004809 | |||
| 1358 | Ga0495607_0005102 | |||
| 1359 | Ga0495607_0007112 | |||
| 1360 | Ga0495607_0007458 | |||
| 1361 | Ga0495607_0013226 | |||
| 1362 | Ga0495607_0015525 | |||
| 1363 | Ga0495607_0022955 | |||
| 1364 | Ga0495607_0035320 | |||
| 1365 | Ga0495607_0057886 | |||
| 1366 | Ga0495607_0061043 | |||
| 1367 | Ga0495583_0000283 | |||
| 1368 | Ga0495583_0001409 | |||
| 1369 | Ga0495583_0002906 | |||
| 1370 | Ga0495583_0003128 | |||
| 1371 | Ga0495583_0011563 | |||
| 1372 | Ga0495583_0014447 | |||
| 1373 | Ga0495583_0015939 | |||
| 1374 | Ga0495606_0000508 | |||
| 1375 | Ga0495606_0001003 | |||
| 1376 | Ga0495606_0003198 | |||
| 1377 | Ga0495606_0003510 | |||
| 1378 | Ga0495606_0007251 | |||
| 1379 | Ga0495606_0009606 | |||
| 1380 | Ga0495606_0023792 | |||
| 1381 | Ga0495606_0028570 | |||
| 1382 | Ga0495606_0031522 | |||
| 1383 | Ga0495606_0033671 | |||
| 1384 | Ga0495606_0047199 | |||
| 1385 | Ga0495606_0084789 | |||
| 1386 | Ga0495610_0000143 | |||
| 1387 | Ga0495610_0001762 | |||
| 1388 | Ga0495610_0002906 | |||
| 1389 | Ga0495610_0006950 | |||
| 1390 | Ga0495610_0011661 | |||
| 1391 | Ga0495610_0013584 | |||
| 1392 | Ga0495610_0015991 | |||
| 1393 | Ga0495610_0017194 | |||
| 1394 | Ga0495610_0034611 | |||
| 1395 | Ga0495610_0038006 | |||
| 1396 | Ga0495610_0058676 | |||
| 1397 | Ga0495610_0071069 | |||
| 1398 | Ga0495610_0097298 | |||
| 1399 | Ga0495616_0001207 | |||
| 1400 | Ga0495616_0002614 | |||
| 1401 | Ga0495616_0003642 | |||
| 1402 | Ga0495616_0003841 | |||
| 1403 | Ga0495616_0006614 | |||
| 1404 | Ga0495616_0007845 | |||
| 1405 | Ga0495616_0009899 | |||
| 1406 | Ga0495616_0023433 | |||
| 1407 | Ga0495616_0026244 | |||
| 1408 | Ga0495616_0047436 | |||
| 1409 | Ga0495620_0000137 | |||
| 1410 | Ga0495620_0000821 | |||
| 1411 | Ga0495620_0002752 | |||
| 1412 | Ga0495620_0003278 | |||
| 1413 | Ga0495620_0004732 | |||
| 1414 | Ga0495620_0007616 | |||
| 1415 | Ga0495620_0012237 | |||
| 1416 | Ga0495620_0017251 | |||
| 1417 | Ga0495620_0055877 | |||
| 1418 | Ga0495628_0069275 | |||
| 1419 | Ga0495630_0011572 | |||
| 1420 | Ga0495631_0000549 | |||
| 1421 | Ga0495631_0005780 | |||
| 1422 | Ga0495631_0009697 | |||
| 1423 | Ga0495631_0013894 | |||
| 1424 | Ga0495631_0027458 | |||
| 1425 | Ga0495631_0036244 | |||
| 1426 | Ga0495631_0053730 | |||
| 1427 | Ga0495632_0000343 | |||
| 1428 | Ga0495632_0000424 | |||
| 1429 | Ga0495632_0001203 | |||
| 1430 | Ga0495632_0001891 | |||
| 1431 | Ga0495632_0004152 | |||
| 1432 | Ga0495632_0004771 | |||
| 1433 | Ga0495632_0011200 | |||
| 1434 | Ga0495632_0012377 | |||
| 1435 | Ga0495632_0013467 | |||
| 1436 | Ga0495632_0016829 | |||
| 1437 | Ga0495632_0057298 | |||
| 1438 | Ga0495637_0001107 | |||
| 1439 | Ga0495637_0001358 | |||
| 1440 | Ga0495637_0001433 | |||
| 1441 | Ga0495637_0002336 | |||
| 1442 | Ga0495637_0002746 | |||
| 1443 | Ga0495637_0003626 | |||
| 1444 | Ga0495637_0007030 | |||
| 1445 | Ga0495637_0008349 | |||
| 1446 | Ga0495637_0012988 | |||
| 1447 | Ga0495637_0015660 | |||
| 1448 | Ga0495637_0017417 | |||
| 1449 | Ga0495637_0018945 | |||
| 1450 | Ga0495637_0025447 | |||
| 1451 | Ga0495637_0028380 | |||
| 1452 | Ga0495637_0032251 | |||
| 1453 | Ga0495637_0035951 | |||
| 1454 | Ga0495643_0005784 | |||
| 1455 | Ga0495643_0010944 | |||
| 1456 | Ga0495643_0012619 | |||
| 1457 | Ga0495643_0028326 | |||
| 1458 | Ga0495643_0030954 | |||
| 1459 | Ga0495643_0083795 | |||
| 1460 | Ga0495644_0000462 | |||
| 1461 | Ga0495644_0000922 | |||
| 1462 | Ga0495644_0004200 | |||
| 1463 | Ga0495644_0006368 | |||
| 1464 | Ga0495644_0019354 | |||
| 1465 | Ga0495644_0060544 | |||
| 1466 | Ga0495648_0003483 | |||
| 1467 | Ga0495648_0003589 | |||
| 1468 | Ga0495648_0006435 | |||
| 1469 | Ga0495648_0010044 | |||
| 1470 | Ga0495648_0011482 | |||
| 1471 | Ga0495648_0012334 | |||
| 1472 | Ga0495648_0012644 | |||
| 1473 | Ga0495648_0031337 | |||
| 1474 | Ga0495648_0043924 | |||
| 1475 | Ga0495648_0046995 | |||
| 1476 | Ga0495666_0000655 | |||
| 1477 | Ga0495666_0020763 | |||
| 1478 | Ga0495642_0000479 | |||
| 1479 | Ga0495642_0000918 | |||
| 1480 | Ga0495642_0001912 | |||
| 1481 | Ga0495654_0000461 | |||
| 1482 | Ga0495654_0000968 | |||
| 1483 | Ga0495654_0000998 | |||
| 1484 | Ga0495654_0001138 | |||
| 1485 | Ga0495654_0002727 | |||
| 1486 | Ga0495654_0002967 | |||
| 1487 | Ga0495654_0005013 | |||
| 1488 | Ga0495654_0010285 | |||
| 1489 | Ga0495654_0014876 | |||
| 1490 | Ga0495654_0020910 | |||
| 1491 | Ga0495654_0023729 | |||
| 1492 | Ga0495654_0028323 | |||
| 1493 | Ga0495654_0032437 | |||
| 1494 | Ga0495654_0037453 | |||
| 1495 | Ga0495654_0054186 | |||
| 1496 | Ga0495654_0069695 | |||
| 1497 | Ga0495654_0070423 | |||
| 1498 | Ga0495587_0113083 | |||
| 1499 | Ga0495609_0000222 | |||
| 1500 | Ga0495609_0000534 | |||
| 1501 | Ga0495609_0002790 | |||
| 1502 | Ga0495609_0012717 | |||
| 1503 | Ga0495609_0017034 | |||
| 1504 | Ga0495609_0063214 | |||
| 1505 | Ga0495609_0071714 | |||
| 1506 | Ga0495609_0076608 | |||
| 1507 | Ga0495597_0003745 | |||
| 1508 | Ga0495597_0004251 | |||
| 1509 | Ga0495597_0008255 | |||
| 1510 | Ga0495597_0012456 | |||
| 1511 | Ga0495597_0014295 | |||
| 1512 | Ga0495597_0024067 | |||
| 1513 | Ga0495597_0025445 | |||
| 1514 | Ga0495597_0051033 | |||
| 1515 | Ga0495597_0059360 | |||
| 1516 | Ga0495597_0061770 | |||
| 1517 | Ga0495645_0036187 | |||
| 1518 | Ga0495622_0000070 | |||
| 1519 | Ga0495622_0003221 | |||
| 1520 | Ga0495622_0005941 | |||
| 1521 | Ga0495622_0019825 | |||
| 1522 | Ga0495622_0047678 | |||
| 1523 | Ga0495622_0050602 | |||
| 1524 | Ga0495633_0005332 | |||
| 1525 | Ga0495633_0010062 | |||
| 1526 | Ga0495656_0082405 | |||
| 1527 | Ga0495668_0002243 | |||
| 1528 | Ga0495668_0002296 | |||
| 1529 | Ga0495668_0008915 | |||
| 1530 | Ga0495634_0002704 | |||
| 1531 | Ga0495611_0000279 | |||
| 1532 | Ga0495611_0003070 | |||
| 1533 | Ga0495611_0004084 | |||
| 1534 | Ga0495611_0030037 | |||
| 1535 | Ga0495625_0003800 | |||
| 1536 | Ga0495625_0006173 | |||
| 1537 | Ga0495625_0015419 | |||
| 1538 | Ga0495625_0025708 | |||
| 1539 | Ga0495625_0027633 | |||
| 1540 | Ga0495625_0051136 | |||
| 1541 | Ga0495625_0055990 | |||
| 1542 | Ga0495625_0067149 | |||
| 1543 | Ga0495625_0119647 | |||
| 1544 | Ga0495625_0150703 | |||
| 1545 | Ga0495635_0001198 | |||
| 1546 | Ga0495659_0000305 | |||
| 1547 | Ga0495659_0003767 | |||
| 1548 | Ga0495659_0008860 | |||
| 1549 | Ga0495661_0000116 | |||
| 1550 | Ga0495661_0000501 | |||
| 1551 | Ga0495661_0002639 | |||
| 1552 | Ga0495661_0006788 | |||
| 1553 | Ga0495661_0018225 | |||
| 1554 | Ga0495661_0018542 | |||
| 1555 | Ga0495661_0020589 | |||
| 1556 | Ga0495661_0021497 | |||
| 1557 | Ga0495661_0036388 | |||
| 1558 | Ga0495661_0081584 | |||
| 1559 | Ga0495661_0084568 | |||
| 1560 | Ga0495661_0116845 | |||
| 1561 | Ga0495661_0122528 | |||
| 1562 | Ga0495661_0124791 | |||
| 1563 | Ga0495588_0007522 | |||
| 1564 | Ga0495588_0030856 | |||
| 1565 | Ga0495623_0003673 | |||
| 1566 | Ga0495623_0005137 | |||
| 1567 | Ga0495646_0058620 | |||
| 1568 | Ga0495669_0023467 | |||
| 1569 | Ga0495613_0021198 | |||
| 1570 | Ga0495613_0059247 | |||
| 1571 | Ga0495613_0088248 | |||
| 1572 | Ga0495624_0001306 | |||
| 1573 | Ga0495624_0038574 | |||
| 1574 | Ga0495670_0000341 | |||
| 1575 | Ga0495670_0000788 | |||
| 1576 | Ga0495670_0002069 | |||
| 1577 | Ga0495670_0002573 | |||
| 1578 | Ga0495670_0010332 | |||
| 1579 | Ga0495670_0012726 | |||
| 1580 | Ga0495670_0013384 | |||
| 1581 | Ga0495670_0093923 | |||
| 1582 | Ga0495670_0094839 | |||
| 1583 | Ga0495671_0000397 | |||
| 1584 | Ga0495671_0002310 | |||
| 1585 | Ga0495671_0006217 | |||
| 1586 | Ga0495671_0006266 | |||
| 1587 | Ga0495671_0007157 | |||
| 1588 | Ga0495671_0011310 | |||
| 1589 | Ga0495671_0012858 | |||
| 1590 | Ga0495671_0016732 | |||
| 1591 | Ga0495671_0035923 | |||
| 1592 | Ga0495671_0044049 | |||
| 1593 | Ga0495649_0000104 | |||
| 1594 | Ga0495649_0001289 | |||
| 1595 | Ga0495649_0002799 | |||
| 1596 | Ga0495649_0006751 | |||
| 1597 | Ga0495649_0007473 | |||
| 1598 | Ga0495649_0008877 | |||
| 1599 | Ga0495649_0012100 | |||
| 1600 | Ga0495649_0012430 | |||
| 1601 | Ga0495649_0016024 | |||
| 1602 | Ga0495649_0017986 | |||
| 1603 | Ga0495649_0023960 | |||
| 1604 | Ga0495649_0160156 | |||
| 1605 | Ga0495589_0002546 | |||
| 1606 | Ga0495589_0007918 | |||
| 1607 | Ga0495589_0008025 | |||
| 1608 | Ga0495589_0008427 | |||
| 1609 | Ga0495589_0009776 | |||
| 1610 | Ga0495589_0011638 | |||
| 1611 | Ga0495589_0013865 | |||
| 1612 | Ga0495589_0019208 | |||
| 1613 | Ga0495589_0021297 | |||
| 1614 | Ga0495600_0020119 | |||
| 1615 | Ga0495660_0001225 | |||
| 1616 | Ga0495660_0003166 | |||
| 1617 | Ga0495660_0005235 | |||
| 1618 | Ga0495660_0006799 | |||
| 1619 | Ga0495660_0007040 | |||
| 1620 | Ga0495660_0010097 | |||
| 1621 | Ga0495660_0010374 | |||
| 1622 | Ga0495660_0010525 | |||
| 1623 | Ga0495660_0015419 | |||
| 1624 | Ga0495660_0018142 | |||
| 1625 | Ga0495660_0023450 | |||
| 1626 | Ga0495660_0041413 | |||
| 1627 | Ga0495660_0046397 | |||
| 1628 | Ga0495660_0062832 | |||
| 1629 | Ga0495660_0067238 | |||
| 1630 | Ga0495660_0070263 | |||
| 1631 | Ga0495581_0003578 | |||
| 1632 | Ga0495604_0002652 | |||
| 1633 | Ga0495604_0013567 | |||
| 1634 | Ga0495604_0076280 | |||
| 1635 | Ga0495636_0005637 | |||
| 1636 | Ga0495636_0059735 | |||
| 1637 | Ga0495674_0046201 | |||
| 1638 | Ga0495672_0000331 | |||
| 1639 | Ga0495672_0002113 | |||
| 1640 | Ga0495672_0003018 | |||
| 1641 | Ga0495672_0004451 | |||
| 1642 | Ga0495672_0007558 | |||
| 1643 | Ga0495672_0012721 | |||
| 1644 | Ga0495672_0019327 | |||
| 1645 | Ga0495672_0031812 | |||
| 1646 | Ga0495672_0048335 | |||
| 1647 | Ga0495672_0066852 | |||
| 1648 | Ga0495672_0094122 | |||
| 1649 | Ga0495676_0001611 | |||
| 1650 | Ga0495676_0012710 | |||
| 1651 | Ga0495676_0034799 | |||
| 1652 | Ga0495680_0032117 | |||
| 1653 | Ga0495680_0077959 | |||
| 1654 | Ga0495683_0000185 | |||
| 1655 | Ga0495683_0000920 | |||
| 1656 | Ga0495683_0001071 | |||
| 1657 | Ga0495683_0001701 | |||
| 1658 | Ga0495683_0002732 | |||
| 1659 | Ga0495683_0018033 | |||
| 1660 | Ga0495683_0030608 | |||
| 1661 | Ga0495683_0051323 | |||
| 1662 | Ga0495683_0064014 | |||
| 1663 | Ga0495683_0071177 | |||
| 1664 | Ga0495687_001896 | |||
| 1665 | Ga0495687_002012 | |||
| 1666 | Ga0495687_003051 | |||
| 1667 | Ga0495687_003319 | |||
| 1668 | Ga0495675_0085201 | |||
| 1669 | Ga0495677_0002044 | |||
| 1670 | Ga0495679_000727 | |||
| 1671 | Ga0495679_000875 | |||
| 1672 | Ga0495679_001754 | |||
| 1673 | Ga0495679_002192 | |||
| 1674 | Ga0495679_003911 | |||
| 1675 | Ga0495679_004726 | |||
| 1676 | Ga0495679_008670 | |||
| 1677 | Ga0495679_023295 | |||
| 1678 | Ga0495685_025982 | |||
| 1679 | Ga0495673_0001043 | |||
| 1680 | Ga0495673_0001505 | |||
| 1681 | Ga0495673_0002263 | |||
| 1682 | Ga0495673_0002289 | |||
| 1683 | Ga0495673_0003406 | |||
| 1684 | Ga0495673_0004020 | |||
| 1685 | Ga0495673_0004197 | |||
| 1686 | Ga0495673_0004554 | |||
| 1687 | Ga0495673_0005403 | |||
| 1688 | Ga0495673_0005775 | |||
| 1689 | Ga0495673_0009682 | |||
| 1690 | Ga0495673_0014932 | |||
| 1691 | Ga0495673_0022317 | |||
| 1692 | Ga0495673_0029359 | |||
| 1693 | Ga0495673_0035676 | |||
| 1694 | Ga0495673_0048213 | |||
| 1695 | Ga0495681_0000399 | |||
| 1696 | Ga0495681_0000804 | |||
| 1697 | Ga0495681_0001014 | |||
| 1698 | Ga0495681_0002079 | |||
| 1699 | Ga0495681_0003785 | |||
| 1700 | Ga0495681_0005868 | |||
| 1701 | Ga0495681_0007243 | |||
| 1702 | Ga0495681_0009471 | |||
| 1703 | Ga0495681_0011105 | |||
| 1704 | Ga0495681_0017614 | |||
| 1705 | Ga0495681_0019031 | |||
| 1706 | Ga0495681_0032446 | |||
| 1707 | Ga0495681_0033687 | |||
| 1708 | Ga0495681_0035989 | |||
| 1709 | Ga0495681_0069668 | |||
| 1710 | Ga0495684_0029668 | |||
| 1711 | Ga0495684_0101291 | |||
| 1712 | Ga0495686_0003471 | |||
| 1713 | Ga0495686_0008020 | |||
| 1714 | Ga0495686_0009315 | |||
| 1715 | Ga0495686_0018000 | |||
| 1716 | Ga0495686_0029995 | |||
| 1717 | Ga0495593_0007442 | |||
| 1718 | Ga0495593_0008928 | |||
| 1719 | Ga0495602_0002686 | |||
| 1720 | Ga0495626_0000203 | |||
| 1721 | Ga0495626_0000456 | |||
| 1722 | Ga0495626_0001599 | |||
| 1723 | Ga0495626_0001772 | |||
| 1724 | Ga0495626_0002511 | |||
| 1725 | Ga0495626_0003174 | |||
| 1726 | Ga0495626_0006388 | |||
| 1727 | Ga0495626_0008350 | |||
| 1728 | Ga0495626_0014487 | |||
| 1729 | Ga0495626_0027701 | |||
| 1730 | Ga0495626_0048175 | |||
| 1731 | Ga0496102_0001019 | |||
| 1732 | Ga0496103_0005170 | |||
| 1733 | Ga0496105_0078700 | |||
| 1734 | Ga0496106_0075915 | |||
| 1735 | Ga0496107_0143940 | |||
| 1736 | Ga0496113_0102919 | |||
| 1737 | Ga0496116_0001790 | |||
| 1738 | Ga0496116_0001797 | |||
| 1739 | Ga0496116_0003072 | |||
| 1740 | Ga0496116_0003590 | |||
| 1741 | Ga0496117_0000720 | |||
| 1742 | Ga0496117_0006016 | |||
| 1743 | Ga0496117_0015516 | |||
| 1744 | Ga0496117_0023681 | |||
| 1745 | Ga0496117_0070727 | |||
| 1746 | Ga0496118_0008420 | |||
| 1747 | Ga0496118_0008627 | |||
| 1748 | Ga0496118_0009584 | |||
| 1749 | Ga0496118_0016534 | |||
| 1750 | Ga0496118_0017192 | |||
| 1751 | Ga0496118_0022489 | |||
| 1752 | Ga0496118_0094905 | |||
| 1753 | Ga0496119_0016404 | |||
| 1754 | Ga0496120_0007042 | |||
| 1755 | Ga0496120_0015856 | |||
| 1756 | Ga0496120_0033702 | |||
| 1757 | Ga0496120_0050548 | |||
| 1758 | Ga0496121_0013896 | |||
| 1759 | Ga0496121_0022233 | |||
| 1760 | Ga0496121_0032478 | |||
| 1761 | Ga0496121_0071912 | |||
| 1762 | Ga0496122_0004285 | |||
| 1763 | Ga0496122_0011812 | |||
| 1764 | Ga0496122_0018619 | |||
| 1765 | Ga0496122_0052361 | |||
| 1766 | Ga0496122_0062736 | |||
| 1767 | Ga0496123_0003416 | |||
| 1768 | Ga0496123_0011560 | |||
| 1769 | Ga0496123_0014910 | |||
| 1770 | Ga0496124_0000816 | |||
| 1771 | Ga0496124_0006096 | |||
| 1772 | Ga0496124_0010907 | |||
| 1773 | Ga0496124_0027067 | |||
| 1774 | Ga0496124_0052203 | |||
| 1775 | Ga0496124_0167582 | |||
| 1776 | Ga0496125_0000822 | |||
| 1777 | Ga0496125_0003780 | |||
| 1778 | Ga0496125_0004344 | |||
| 1779 | Ga0496125_0008974 | |||
| 1780 | Ga0496125_0033195 | |||
| 1781 | Ga0496125_0036046 | |||
| 1782 | Ga0496125_0038878 | |||
| 1783 | Ga0496125_0050653 | |||
| 1784 | Ga0496125_0057874 | |||
| 1785 | Ga0496125_0058225 | |||
| 1786 | Ga0496126_0005995 | |||
| 1787 | Ga0496126_0007640 | |||
| 1788 | Ga0495678_002361 | |||
| 1789 | Ga0495678_003607 | |||
| 1790 | Ga0495678_004892 | |||
| 1791 | Ga0495678_005865 | |||
| 1792 | Ga0495678_008259 | |||
| 1793 | Ga0495678_008485 | |||
| 1794 | Ga0495678_010183 | |||
| 1795 | Ga0495678_013970 | |||
| 1796 | Ga0495678_022851 | |||
| 1797 | Ga0495678_025920 | |||
| 1798 | Ga0495678_026257 | |||
| 1799 | Ga0495678_035309 | |||
| 1800 | Ga0495682_0000905 | |||
| 1801 | Ga0495682_0002057 | |||
| 1802 | Ga0495682_0005159 | |||
| 1803 | Ga0495682_0020833 | |||
| 1804 | Ga0495682_0025014 | |||
| 1805 | Ga0501042_0174739 | |||
| 1806 | Ga0501073_0019911 | |||
| 1807 | Ga0501222_000598 | |||
| 1808 | Ga0500572_001735 | |||
| 1809 | Ga0500618_002697 | |||
| 1810 | 2511272345 | |||
| 1811 | 2511280800 | |||
| 1812 | 2511291575 | |||
| 1813 | 2511295820 | |||
| 1814 | 2511299046 | |||
| 1815 | 2511312357 | |||
| 1816 | 2511335087 | |||
| 1817 | 2511337137 | |||
| 1818 | 2511344711 | |||
| 1819 | 2511352917 | |||
| 1820 | 2511357550 | |||
| 1821 | 2511367663 | |||
| 1822 | 2511413878 | |||
| 1823 | 2511824688 | |||
| 1824 | 2597863815 | |||
| 1825 | 2597869964 | |||
| 1826 | 2599330281 | |||
| 1827 | 2599398228 | |||
| 1828 | 2599450238 | |||
| 1829 | 2599500668 | |||
| 1830 | 2599510411 | |||
| 1831 | 2599516085 | |||
| 1832 | 2599521186 | |||
| 1833 | 2599612906 | |||
| 1834 | 2599771778 | |||
| 1835 | 2599883605 | |||
| 1836 | 2599889144 | |||
| 1837 | 2599895616 | |||
| 1838 | 2599901198 | |||
| 1839 | 2599932331 | |||
| 1840 | 2599943502 | |||
| 1841 | 2599950367 | |||
| 1842 | 2599954613 | |||
| 1843 | 2599962302 | |||
| 1844 | 2599968092 | |||
| 1845 | 2599977117 | |||
| 1846 | 2599985168 | |||
| 1847 | 2599988582 | |||
| 1848 | 2599993417 | |||
| 1849 | 2600002893 | |||
| 1850 | 2600008203 | |||
| 1851 | 2600011155 | |||
| 1852 | 2600016190 | |||
| 1853 | 2600022000 | |||
| 1854 | 2600028486 | |||
| 1855 | 2600038027 | |||
| 1856 | 2600044368 | |||
| 1857 | 2600049841 | |||
| 1858 | 2600051396 | |||
| 1859 | 2600060013 | |||
| 1860 | 2600063235 | |||
| 1861 | 2600070538 | |||
| 1862 | 2600075274 | |||
| 1863 | 2600357653 | |||
| 1864 | 2601691771 | |||
| 1865 | 2601799226 | |||
| 1866 | 2606078126 | |||
| 1867 | 2606125997 | |||
| 1868 | 2621299460 | |||
| 1869 | 2624480664 | |||
| 1870 | 2624492435 | |||
| 1871 | 2643844507 | |||
| 1872 | 2643869899 | |||
| 1873 | 2643954365 | |||
| 1874 | 2644023174 | |||
| 1875 | 2644185302 | |||
| 1876 | 2644283683 | |||
| 1877 | 2644621131 | |||
| 1878 | 2652546928 | |||
| 1879 | 2671094278 | |||
| 1880 | 2671126347 | |||
| 1881 | 2677896325 | |||
| 1882 | 2678262050 | |||
| 1883 | 2715753236 | |||
| 1884 | 2715756624 | |||
| 1885 | 2723248601 | |||
| 1886 | 2738747868 | |||
| 1887 | 2738810741 | |||
| 1888 | 2738856911 | |||
| 1889 | 2738898101 | |||
| 1890 | 2739199494 | |||
| 1891 | 2739257239 | |||
| 1892 | 2739311859 | |||
| 1893 | 2745008398 | |||
| 1894 | 2774133919 | |||
| 1895 | 2784264313 | |||
| 1896 | 2794597200 | |||
| 1897 | 2808922190 | |||
| 1898 | 2808929608 | |||
| 1899 | 2808933641 | |||
| 1900 | 2808944827 | |||
| 1901 | 2808951813 | |||
| 1902 | 2808959486 | |||
| 1903 | 2808962115 | |||
| 1904 | 2808980624 | |||
| 1905 | 2808996345 | |||
| 1906 | 2808997128 | |||
| 1907 | 2809214907 | |||
| 1908 | 2817490822 | |||
| 1909 | 2819659014 | |||
| 1910 | 2825651477 | |||
| 1911 | 2826586032 | |||
| 1912 | 2834029982 | |||
| 1913 | 2842819069 | |||
| 1914 | 2842826849 | |||
| 1915 | 2842834633 | |||
| 1916 | 2842839416 | |||
| 1917 | 2842843720 | |||
| 1918 | 2842853395 | |||
| 1919 | 2842859100 | |||
| 1920 | 2852614714 | |||
| 1921 | 2852657606 | |||
| 1922 | 2852667548 | |||
| 1923 | 2860344712 | |||
| 1924 | 2878032540 | |||
| 1925 | 2880233605 | |||
| 1926 | 2904520015 | |||
| 1927 | 2904550279 | |||
| 1928 | 2908449885 | |||
| 1929 | 2919065083 | |||
| 1930 | 2919387006 | |||
| 1931 | 2919458767 | |||
| 1932 | 2919487381 | |||
| 1933 | 2919492304 | |||
| 1934 | 2919698602 | |||
| 1935 | 2923588803 | |||
| 1936 | 2929147509 | |||
| 1937 | 2929192396 | |||
| 1938 | 2931394107 | |||
| 1939 | 2931402231 | |||
| 1940 | 2939638890 | |||
| 1941 | 2945933672 | |||
| 1942 | 2945963886 | |||
| 1943 | 2946010063 | |||
| 1944 | 2946031076 | |||
| 1945 | 2947237659 | |||
| 1946 | 2974290933 | |||
| 1947 | 2998142887 | |||
| 1948 | 3007422941 | |||
| 1949 | 3007514184 | |||
| 1950 | 3007614239 | |||
| 1951 | 3007621616 | |||
| 1952 | 3007719159 | |||
| 1953 | 3007856906 | |||
| 1954 | 3007869352 | |||
| 1955 | 8019778930 | |||
| 1956 | 8029997907 | |||
| 1957 | 8054288496 | |||
| 1958 | 8054348089 | |||
| 1959 | 8054506147 | |||
| 1960 | 8055820748 | |||
| 1961 | 8056128748 | |||
| 1962 | 8056134596 | |||
| 1963 | 8056145845 | |||
| 1964 | 8056154648 | |||
| 1965 | 8056165874 | |||
| 1966 | 8056168311 | |||
| 1967 | 8056178327 | |||
| 1968 | 8056574390 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7cgz-assembly1.cif.gz_A | glucose dehydrogenase | 0.962 | 38 | 382 |
| 7cgz-assembly1.cif.gz_A | glucose dehydrogenase | 0.9532 | 38 | 382 |
| 7cgz-assembly1.cif.gz_B | glucose dehydrogenase | 0.9302 | 38 | 382 |
| 7cdy-assembly2.cif.gz_B | crystal structure of glucose dehydrogenase | 0.9221 | 38 | 382 |
| 7cgz-assembly1.cif.gz_B | glucose dehydrogenase | 0.9196 | 38 | 382 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P75804_19_370_2.120.10.30 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.9109 | 34 | 382 | 2.120.10.30 |
| af_P75804_19_370_2.120.10.30 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.8984 | 34 | 382 | 2.120.10.30 |
| 3a9gA00 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.8731 | 36 | 382 | 2.120.10.30 |
| 3a9gA00 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.8583 | 36 | 382 | 2.120.10.30 |
| 2ismB00 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.841 | 36 | 380 | 2.120.10.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X7PHR3-F1-model_v4 | PQQ-dependent sugar dehydrogenase | 0.9903 | 296 | 378 |
|
| AF-A0A421DSI4-F1-model_v4 | Glucose/Sorbosone dehydrogenase domain-containing protein | 0.9888 | 295 | 382 |
|
| AF-C2BE23-F1-model_v4 | Glucose/Sorbosone dehydrogenase | 0.9795 | 296 | 371 |
|
| AF-A0A377W8K7-F1-model_v4 | Soluble aldose sugar dehydrogenase, PQQ-dependent (EC 1.1.5.-) | 0.9794 | 45 | 115 |
GO:0016491
|
| AF-A0A4Q3TAK4-F1-model_v4 | PQQ-dependent sugar dehydrogenase | 0.9721 | 296 | 382 |
|