F487484

General Info

Members Datasets Scaffolds Average Seq Length
984 372 1968 382

Family's Representative Sequence

Representative Sequence 3300047470|Ga0495681_0002728|Ga0495681_0002728_8290_9528
Length 412
Sequence MAPTTVELQASSLPAIFHQASFPSEKESCMLRKNLLATLCAGVLISATVPVLAAPAQTMKSEDGTLEVTSIVTGLEHPWALAFLPDSKNMLVTERPGNLRLVTADGKLSAPLNGVPTVWAKGQGGLLDVALSPDFKQDRMVYLSYAEGGGKGDKAGTAVGRGRLSDDMTALKDFQVILRQEPKLSVGNHFGSRLVFDRDGYLFVTLGENNDRPTAQDLDKLQGKVVRIYPDGTVPKDNPFVGQANVRPEIWSYGQRNPQGAALNPWNGTLWENEHGPLGGDEINIIERGKNYGWPLATHGINYSGQPIPEAKGETIEGAVAPNHVWEKSPGLSGMAFYDADRFKVWQRNVFIGALVSQELIRLEFDGDKVVHEERMLGELKKRIRDVRQGPDGYLYVLTDEENGGLYKVGLK

Samples

Sample ID Description Type Environment
1 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
6 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
7 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
23 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
24 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
25 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
26 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
27 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
28 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
29 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
30 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
44 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
45 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
48 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
55 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
73 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
74 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
77 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
78 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
79 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
80 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
84 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
85 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
86 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
87 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
88 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
89 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
90 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
91 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
92 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
93 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
94 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
95 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
96 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
97 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
98 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
99 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
100 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
101 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
102 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
103 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
104 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
105 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
106 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
107 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
108 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
109 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
110 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
111 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
112 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
113 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
114 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
115 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
116 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
117 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
118 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
123 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
124 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
125 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
126 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
127 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
128 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
129 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
130 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
131 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
132 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
133 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
136 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
137 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
138 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
139 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
140 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
141 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
142 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
143 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
144 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
147 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
148 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
149 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
150 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
151 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
154 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
158 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
159 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
160 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
161 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
165 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
166 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
167 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
168 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
169 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
170 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
171 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
172 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
173 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
179 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
180 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
181 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
182 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
183 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
184 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
187 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
197 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
198 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
199 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
200 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
203 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
204 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
205 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
208 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
212 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
213 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
214 2511231007 Pseudomonas sp. GM18 Isolate Nodule
215 2511231008 Pseudomonas sp. GM21 Isolate Nodule
216 2511231010 Pseudomonas sp. GM25 Isolate Nodule
217 2511231011 Pseudomonas sp. GM30 Isolate Nodule
218 2511231012 Pseudomonas sp. GM33 Isolate Nodule
219 2511231014 Pseudomonas sp. GM48 Isolate Nodule
220 2511231017 Pseudomonas sp. GM55 Isolate Nodule
221 2511231018 Pseudomonas sp. GM60 Isolate Nodule
222 2511231019 Pseudomonas sp. GM67 Isolate Nodule
223 2511231020 Pseudomonas sp. GM74 Isolate Nodule
224 2511231021 Pseudomonas sp. GM78 Isolate Nodule
225 2511231023 Pseudomonas sp. GM80 Isolate Nodule
226 2511231031 Pseudomonas sp. GM16 Isolate Nodule
227 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
228 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
229 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
230 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
231 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
232 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
233 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
234 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
235 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
236 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
237 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
238 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
239 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
240 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
241 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
242 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
243 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
244 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
245 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
246 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
247 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
248 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
249 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
250 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
251 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
252 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
253 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
254 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
255 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
256 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
257 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
258 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
259 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
260 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
261 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
262 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
263 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
264 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
265 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
266 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
267 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
268 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
269 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
270 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
271 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
272 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
273 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
274 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
275 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
276 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
277 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
278 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
279 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
280 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
281 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
282 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
283 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
284 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
285 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
286 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
287 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
288 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
289 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
290 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
291 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
292 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
293 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
294 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
295 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
296 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
297 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
298 2773857673 Pseudomonas sp. 443 Isolate Unclassified
299 2784132063 Pseudomonas sp. 424 Isolate Unclassified
300 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
301 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
302 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
303 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
304 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
305 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
306 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
307 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
308 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
309 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
310 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
311 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
312 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
313 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
314 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
315 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
316 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
317 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
318 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
319 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
320 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
321 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
322 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
323 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
324 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
325 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
326 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
327 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
328 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
329 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
330 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
331 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
332 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
333 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
334 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
335 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
336 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
337 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
338 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
339 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
340 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
341 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
342 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
343 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
344 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
345 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
346 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
347 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
348 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
349 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
350 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
351 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
352 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
353 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
354 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
355 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
356 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
357 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
358 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
359 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
360 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
361 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
362 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
363 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
364 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
365 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
366 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
367 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
368 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
369 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
370 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
371 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
372 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.84
Metatranscriptomes 0
Isolates 16.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.46
Nodule 2.03
Rhizoplane 5.28
Rhizosphere 79.07
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495681_0002728 3300047470 Bacteria 12495
2 MRS2a_Contig_6993 2124908027 Bacteria 5600
3 MRS2a_Contig_731 2124908027 Bacteria 6715
4 SwRhRL2b_contig_1875304 2162886007 Bacteria 8741
5 MRS1b_contig_5847325 2162886011 Bacteria 6155
6 Ga0055539_1000011 3300003752 Bacteria 399747
7 Ga0055533_1000014 3300003756 Bacteria 399747
8 Ga0055532_1000009 3300003758 Bacteria 399537
9 Ga0055525_1000016 3300003759 Bacteria 399724
10 Ga0055536_1000352 3300003781 Bacteria 34235
11 Ga0055530_10000019 3300003791 Bacteria 140299
12 Ga0055530_10002917 3300003791 Bacteria 10359
13 Ga0055540_1000006 3300003792 Bacteria 372018
14 Ga0055540_1000055 3300003792 Bacteria 140299
15 Ga0055531_10000126 3300003794 Bacteria 85918
16 Ga0055541_1000008 3300003841 Bacteria 399724
17 Ga0065714_10000255 3300005288 Bacteria 6634
18 Ga0065714_10002219 3300005288 Bacteria 48487
19 Ga0065714_10003565 3300005288 Bacteria 9246
20 Ga0065714_10009982 3300005288 Bacteria 2919
21 Ga0065714_10012859 3300005288 Bacteria 2408
22 Ga0065714_10023451 3300005288 Bacteria 1325
23 Ga0065714_10068323 3300005288 Bacteria 4813
24 Ga0065714_10075816 3300005288 Bacteria 2853
25 Ga0065714_10082916 3300005288 Bacteria 2280
26 Ga0065704_10070628 3300005289 Bacteria 18936
27 Ga0065704_10099151 3300005289 Bacteria 2323
28 Ga0065704_10136757 3300005289 Bacteria 1562
29 Ga0065712_10069901 3300005290 Bacteria 6539
30 Ga0065715_10013805 3300005293 Bacteria 2439
31 Ga0070670_100000495 3300005331 Bacteria 31488
32 Ga0070670_100002291 3300005331 Bacteria 15770
33 Ga0070669_100010476 3300005353 Bacteria 6585
34 Ga0070662_100003888 3300005457 Bacteria 9362
35 Ga0070662_100037132 3300005457 Bacteria 3452
36 Ga0070664_100000064 3300005564 Bacteria 65571
37 Ga0068851_10000165 3300005834 Bacteria 34440
38 Ga0075432_10000990 3300006058 Bacteria 8989
39 Ga0075432_10003031 3300006058 Bacteria 5668
40 Ga0075362_10118062 3300006177 Bacteria 1254
41 Ga0075436_100015966 3300006914 Bacteria 5140
42 Ga0075436_100022524 3300006914 Bacteria 4326
43 Ga0079104_1000235 3300006946 Bacteria 74576
44 Ga0079104_1000873 3300006946 Bacteria 24899
45 Ga0099826_10010909 3300006948 Bacteria 6824
46 Ga0105251_10000456 3300009011 Bacteria 39260
47 Ga0105251_10001310 3300009011 Bacteria 21494
48 Ga0105251_10014230 3300009011 Bacteria 4412
49 Ga0105251_10019713 3300009011 Bacteria 3555
50 Ga0105251_10025751 3300009011 Bacteria 3004
51 Ga0105251_10029890 3300009011 Bacteria 2741
52 Ga0105251_10034266 3300009011 Bacteria 2514
53 Ga0105251_10100078 3300009011 Bacteria 1325
54 Ga0105244_10002575 3300009036 Bacteria 13612
55 Ga0105244_10003967 3300009036 Bacteria 10376
56 Ga0105244_10004549 3300009036 Bacteria 9500
57 Ga0105244_10006056 3300009036 Bacteria 7920
58 Ga0105244_10009002 3300009036 Bacteria 6178
59 Ga0105244_10015172 3300009036 Bacteria 4425
60 Ga0105244_10027913 3300009036 Bacteria 3035
61 Ga0105250_10000145 3300009092 Bacteria 62334
62 Ga0105250_10000256 3300009092 Bacteria 44131
63 Ga0105250_10000757 3300009092 Bacteria 19646
64 Ga0105250_10011541 3300009092 Bacteria 3663
65 Ga0105250_10015734 3300009092 Bacteria 3095
66 Ga0105243_10013488 3300009148 Bacteria 6180
67 Ga0105243_10022501 3300009148 Bacteria 4792
68 Ga0105242_10004868 3300009176 Bacteria 10395
69 Ga0105237_10000426 3300009545 Bacteria 59965
70 Ga0105246_10000009 3300011119 Bacteria 79055
71 Ga0105246_10011996 3300011119 Bacteria 5396
72 Ga0105246_10086860 3300011119 Bacteria 2243
73 Ga0157345_1000181 3300012498 Bacteria 9989
74 Ga0157373_10002099 3300013100 Bacteria 15088
75 Ga0157373_10002260 3300013100 Bacteria 14599
76 Ga0157373_10002438 3300013100 Bacteria 14153
77 Ga0157373_10004688 3300013100 Bacteria 10279
78 Ga0157373_10016012 3300013100 Bacteria 5473
79 Ga0157373_10025264 3300013100 Bacteria 4298
80 Ga0157373_10134310 3300013100 Bacteria 1740
81 Ga0157373_10164962 3300013100 Bacteria 1559
82 Ga0157371_10000189 3300013102 Bacteria 91155
83 Ga0157371_10017892 3300013102 Bacteria 5255
84 Ga0157370_10066712 3300013104 Bacteria 3402
85 Ga0157370_10086648 3300013104 Bacteria 2942
86 Ga0157370_10103178 3300013104 Bacteria 2670
87 Ga0157370_10191776 3300013104 Bacteria 1897
88 Ga0157369_10005447 3300013105 Bacteria 14804
89 Ga0157369_10007726 3300013105 Bacteria 12369
90 Ga0157369_10012736 3300013105 Bacteria 9536
91 Ga0157369_10036133 3300013105 Bacteria 5414
92 Ga0157369_10045733 3300013105 Bacteria 4759
93 Ga0157369_10100516 3300013105 Bacteria 3083
94 Ga0163162_10000169 3300013306 Bacteria 60285
95 Ga0157375_10003950 3300013308 Bacteria 12858
96 Ga0157375_10215829 3300013308 Bacteria 2076
97 Ga0182008_10000404 3300014497 Bacteria 33433
98 Ga0182008_10000942 3300014497 Bacteria 20251
99 Ga0182008_10007227 3300014497 Bacteria 6143
100 Ga0182008_10044238 3300014497 Bacteria 2214
101 Ga0182008_10055744 3300014497 Bacteria 1954
102 Ga0182008_10085377 3300014497 Bacteria 1555
103 Ga0182006_1000452 3300015261 Bacteria 32460
104 Ga0182006_1000704 3300015261 Bacteria 23177
105 Ga0182006_1004026 3300015261 Bacteria 7334
106 Ga0182006_1011474 3300015261 Bacteria 3895
107 Ga0182006_1016570 3300015261 Bacteria 3142
108 Ga0182006_1030283 3300015261 Bacteria 2187
109 Ga0182007_10000083 3300015262 Bacteria 71163
110 Ga0182007_10001288 3300015262 Bacteria 13564
111 Ga0182007_10004715 3300015262 Bacteria 6134
112 Ga0182005_1001844 3300015265 Bacteria 8061
113 Ga0182005_1008383 3300015265 Bacteria 3050
114 Ga0182005_1008813 3300015265 Bacteria 2961
115 Ga0182005_1009216 3300015265 Bacteria 2881
116 Ga0182005_1040602 3300015265 Bacteria 1265
117 Ga0163161_10000440 3300017792 Bacteria 34643
118 Ga0163161_10001602 3300017792 Bacteria 16690
119 Ga0163161_10004328 3300017792 Bacteria 9895
120 Ga0163161_10009073 3300017792 Bacteria 6878
121 Ga0163161_10048643 3300017792 Bacteria 3063
122 Ga0163161_10097373 3300017792 Bacteria 2185
123 Ga0163161_10161309 3300017792 Bacteria 1710
124 Ga0209435_101164 3300025206 Bacteria 3595
125 Ga0209784_100023 3300025224 Bacteria 399841
126 Ga0209566_100019 3300025225 Bacteria 414836
127 Ga0209674_100034 3300025226 Bacteria 414903
128 Ga0209147_100027 3300025229 Bacteria 414610
129 Ga0209563_100037 3300025230 Bacteria 414903
130 Ga0209563_100908 3300025230 Bacteria 8742
131 Ga0209258_100268 3300025242 Bacteria 89701
132 Ga0209646_1000323 3300025246 Bacteria 36796
133 Ga0209677_100021 3300025253 Bacteria 414954
134 Ga0209675_1004176 3300025291 Bacteria 6539
135 Ga0209676_1000002 3300025292 Bacteria 1732948
136 Ga0209676_1000158 3300025292 Bacteria 162469
137 Ga0209676_1002612 3300025292 Bacteria 12321
138 Ga0209676_1004504 3300025292 Bacteria 7733
139 Ga0209050_1000006 3300025298 Bacteria 1359702
140 Ga0209050_1000013 3300025298 Bacteria 811408
141 Ga0209050_1000321 3300025298 Bacteria 96465
142 Ga0209051_1000001 3300025303 Bacteria 1732974
143 Ga0209051_1000007 3300025303 Bacteria 811408
144 Ga0209051_1017169 3300025303 Bacteria 3243
145 Ga0209257_1000029 3300025304 Bacteria 695617
146 Ga0207656_10002984 3300025321 Bacteria 5782
147 Ga0207696_1000002 3300025711 Bacteria 1098043
148 Ga0207696_1000011 3300025711 Bacteria 530614
149 Ga0207696_1000186 3300025711 Bacteria 96544
150 Ga0207696_1002373 3300025711 Bacteria 9305
151 Ga0207696_1004244 3300025711 Bacteria 6221
152 Ga0207696_1039914 3300025711 Bacteria 1377
153 Ga0207655_1000022 3300025728 Bacteria 483933
154 Ga0207655_1000207 3300025728 Bacteria 102951
155 Ga0207655_1000379 3300025728 Bacteria 62077
156 Ga0207655_1001659 3300025728 Bacteria 19713
157 Ga0207655_1004289 3300025728 Bacteria 10202
158 Ga0207655_1005715 3300025728 Bacteria 8399
159 Ga0207655_1008836 3300025728 Bacteria 6334
160 Ga0207655_1015187 3300025728 Bacteria 4298
161 Ga0207655_1018714 3300025728 Bacteria 3658
162 Ga0207655_1027367 3300025728 Bacteria 2717
163 Ga0207655_1028945 3300025728 Bacteria 2603
164 Ga0207655_1047020 3300025728 Bacteria 1785
165 Ga0207713_1000162 3300025735 Bacteria 98630
166 Ga0207713_1000326 3300025735 Bacteria 53850
167 Ga0207713_1000447 3300025735 Bacteria 43462
168 Ga0207713_1000552 3300025735 Bacteria 37422
169 Ga0207713_1006733 3300025735 Bacteria 6943
170 Ga0207713_1008776 3300025735 Bacteria 5762
171 Ga0207713_1011581 3300025735 Bacteria 4780
172 Ga0207713_1029694 3300025735 Bacteria 2444
173 Ga0207713_1029696 3300025735 Bacteria 2444
174 Ga0207713_1056082 3300025735 Bacteria 1533
175 Ga0207671_10000743 3300025914 Bacteria 41315
176 Ga0207649_10000116 3300025920 Bacteria 67931
177 Ga0207650_10000750 3300025925 Bacteria 24996
178 Ga0207686_10002731 3300025934 Bacteria 9567
179 Ga0207709_10000004 3300025935 Bacteria 825156
180 Ga0207679_10000054 3300025945 Bacteria 108733
181 Ga0207639_10118851 3300026041 Bacteria 2168
182 Ga0209281_1000009 3300027111 Bacteria 771717
183 Ga0209281_1000046 3300027111 Bacteria 327042
184 Ga0209281_1013568 3300027111 Bacteria 1754
185 Ga0207428_10007691 3300027907 Bacteria 9809
186 Ga0207428_10022356 3300027907 Bacteria 5338
187 Ga0307511_10144701 3300030521 Bacteria 1384
188 Ga0307408_100007588 3300031548 Bacteria 7171
189 Ga0307405_10000328 3300031731 Bacteria 17621
190 Ga0307405_10050641 3300031731 Bacteria 2572
191 Ga0307413_10044281 3300031824 Bacteria 2629
192 Ga0307413_10072835 3300031824 Bacteria 2170
193 Ga0307406_10016525 3300031901 Bacteria 4290
194 Ga0307407_10058849 3300031903 Bacteria 2235
195 Ga0307412_10001489 3300031911 Bacteria 13016
196 Ga0307412_10004125 3300031911 Bacteria 8096
197 Ga0307412_10005227 3300031911 Bacteria 7278
198 Ga0307412_10014820 3300031911 Bacteria 4607
199 Ga0307412_10193721 3300031911 Bacteria 1538
200 Ga0307409_100211491 3300031995 Bacteria 1743
201 Ga0307409_100271065 3300031995 Bacteria 1563
202 Ga0307416_100012044 3300032002 Bacteria 5805
203 Ga0307414_10265513 3300032004 Bacteria 1434
204 Ga0307414_10296114 3300032004 Bacteria 1366
205 Ga0307411_10012125 3300032005 Bacteria 4685
206 Ga0307411_10065922 3300032005 Bacteria 2430
207 Ga0307510_10014347 3300033180 Bacteria 9379
208 Ga0439438_000875 3300041405 Bacteria 13434
209 Ga0439438_000998 3300041405 Bacteria 12668
210 Ga0439438_001021 3300041405 Bacteria 12472
211 Ga0439438_001408 3300041405 Bacteria 10611
212 Ga0439438_001812 3300041405 Bacteria 9372
213 Ga0439438_003024 3300041405 Bacteria 6932
214 Ga0439438_003764 3300041405 Bacteria 5993
215 Ga0439438_004188 3300041405 Bacteria 5608
216 Ga0439438_005138 3300041405 Bacteria 4871
217 Ga0439447_001833 3300041407 Bacteria 7785
218 Ga0439447_002314 3300041407 Bacteria 6974
219 Ga0439447_003667 3300041407 Bacteria 5414
220 Ga0439447_003840 3300041407 Bacteria 5271
221 Ga0439447_005155 3300041407 Bacteria 4378
222 Ga0439447_014969 3300041407 Bacteria 2162
223 Ga0439466_0001055 3300041411 Bacteria 10631
224 Ga0439466_0001400 3300041411 Bacteria 9407
225 Ga0439466_0003160 3300041411 Bacteria 6409
226 Ga0439466_0010386 3300041411 Bacteria 3460
227 Ga0439466_0018033 3300041411 Bacteria 2536
228 Ga0451793_1073897 3300041452 Bacteria 2307
229 Ga0451807_1051409 3300041486 Bacteria 1826
230 Ga0439431_0006087 3300041997 Bacteria 2664
231 Ga0439445_0002580 3300042004 Bacteria 4031
232 Ga0439432_000031 3300042006 Bacteria 45793
233 Ga0439432_001202 3300042006 Bacteria 9801
234 Ga0439432_001230 3300042006 Bacteria 9678
235 Ga0439432_001672 3300042006 Bacteria 8305
236 Ga0439432_003431 3300042006 Bacteria 5883
237 Ga0439451_000310 3300042009 Bacteria 9433
238 Ga0439451_001779 3300042009 Bacteria 4303
239 Ga0439451_009077 3300042009 Bacteria 2014
240 Ga0439452_000317 3300042010 Bacteria 30475
241 Ga0439452_001132 3300042010 Bacteria 11656
242 Ga0439452_001430 3300042010 Bacteria 9795
243 Ga0439452_017043 3300042010 Bacteria 1962
244 Ga0439456_004229 3300042013 Bacteria 2911
245 Ga0439463_018138 3300042016 Bacteria 1750
246 Ga0450911_000076 3300042115 Bacteria 40401
247 Ga0450911_001437 3300042115 Bacteria 5488
248 Ga0450920_001078 3300042122 Bacteria 4467
249 Ga0450902_001808 3300042137 Bacteria 2963
250 Ga0450903_001550 3300042138 Bacteria 4281
251 Ga0450903_007363 3300042138 Bacteria 1812
252 Ga0450903_009157 3300042138 Bacteria 1616
253 Ga0450904_001002 3300042139 Bacteria 4387
254 Ga0450906_004556 3300042145 Bacteria 2892
255 Ga0450907_000269 3300042146 Bacteria 17496
256 Ga0450907_002262 3300042146 Bacteria 3742
257 Ga0439446_0005630 3300042156 Bacteria 3227
258 Ga0450908_001729 3300042184 Bacteria 4256
259 Ga0450909_001472 3300042185 Bacteria 3287
260 Ga0439434_0001842 3300042435 Bacteria 6160
261 Ga0439460_0003382 3300042461 Bacteria 3859
262 Ga0439460_0003508 3300042461 Bacteria 3794
263 Ga0450901_001417 3300042533 Bacteria 2739
264 Ga0439440_0000822 3300042993 Bacteria 5388
265 Ga0495617_000097 3300046452 Bacteria 62559
266 Ga0495617_001247 3300046452 Bacteria 11427
267 Ga0495617_001668 3300046452 Bacteria 9541
268 Ga0495617_005076 3300046452 Bacteria 4712
269 Ga0495617_005125 3300046452 Bacteria 4681
270 Ga0495617_005357 3300046452 Bacteria 4556
271 Ga0495617_017035 3300046452 Bacteria 2455
272 Ga0495617_026955 3300046452 Bacteria 1934
273 Ga0495617_034199 3300046452 Bacteria 1706
274 Ga0495627_000517 3300046453 Bacteria 31910
275 Ga0495627_000526 3300046453 Bacteria 31735
276 Ga0495627_001863 3300046453 Bacteria 11138
277 Ga0495627_004951 3300046453 Bacteria 5474
278 Ga0495627_015889 3300046453 Bacteria 2590
279 Ga0495592_0017072 3300046454 Bacteria 5510
280 Ga0495603_0011368 3300046455 Bacteria 5390
281 Ga0495603_0027710 3300046455 Bacteria 3418
282 Ga0495603_0037608 3300046455 Bacteria 2904
283 Ga0495590_0000708 3300046457 Bacteria 15249
284 Ga0495590_0008745 3300046457 Bacteria 3852
285 Ga0495590_0019869 3300046457 Bacteria 2389
286 Ga0495590_0021644 3300046457 Bacteria 2277
287 Ga0495591_000060 3300046458 Bacteria 129321
288 Ga0495591_000221 3300046458 Bacteria 56635
289 Ga0495591_000354 3300046458 Bacteria 40651
290 Ga0495591_002731 3300046458 Bacteria 9556
291 Ga0495591_002853 3300046458 Bacteria 9286
292 Ga0495591_006357 3300046458 Bacteria 5241
293 Ga0495591_006811 3300046458 Bacteria 4973
294 Ga0495591_007623 3300046458 Bacteria 4569
295 Ga0495591_007952 3300046458 Bacteria 4415
296 Ga0495591_008212 3300046458 Bacteria 4302
297 Ga0495591_015788 3300046458 Bacteria 2655
298 Ga0495638_0000298 3300046460 Bacteria 64005
299 Ga0495638_0001565 3300046460 Bacteria 20511
300 Ga0495638_0002480 3300046460 Bacteria 15021
301 Ga0495638_0002560 3300046460 Bacteria 14734
302 Ga0495638_0003323 3300046460 Bacteria 12686
303 Ga0495638_0012218 3300046460 Bacteria 5895
304 Ga0495638_0013298 3300046460 Bacteria 5611
305 Ga0495638_0015951 3300046460 Bacteria 5035
306 Ga0495638_0022972 3300046460 Bacteria 4086
307 Ga0495638_0030695 3300046460 Bacteria 3457
308 Ga0495638_0035221 3300046460 Bacteria 3192
309 Ga0495638_0035682 3300046460 Bacteria 3169
310 Ga0495638_0043170 3300046460 Bacteria 2846
311 Ga0495638_0066691 3300046460 Bacteria 2211
312 Ga0495638_0095059 3300046460 Bacteria 1790
313 Ga0495638_0147148 3300046460 Bacteria 1369
314 Ga0495653_0000844 3300046463 Bacteria 23601
315 Ga0495653_0002370 3300046463 Bacteria 14975
316 Ga0495653_0006664 3300046463 Bacteria 9478
317 Ga0495653_0045650 3300046463 Bacteria 3396
318 Ga0495650_0001297 3300046471 Bacteria 25392
319 Ga0495650_0002090 3300046471 Bacteria 17198
320 Ga0495650_0015181 3300046471 Bacteria 3963
321 Ga0495650_0022221 3300046471 Bacteria 3046
322 Ga0495650_0026452 3300046471 Bacteria 2698
323 Ga0495650_0046317 3300046471 Bacteria 1825
324 Ga0495650_0071139 3300046471 Bacteria 1364
325 Ga0495580_0144905 3300046472 Bacteria 1646
326 Ga0495605_0000197 3300046474 Bacteria 75351
327 Ga0495605_0000789 3300046474 Bacteria 22739
328 Ga0495605_0002861 3300046474 Bacteria 10491
329 Ga0495605_0007042 3300046474 Bacteria 6411
330 Ga0495605_0008045 3300046474 Bacteria 5969
331 Ga0495605_0011728 3300046474 Bacteria 4878
332 Ga0495605_0015578 3300046474 Bacteria 4130
333 Ga0495605_0024112 3300046474 Bacteria 3188
334 Ga0495605_0030899 3300046474 Bacteria 2740
335 Ga0495605_0041097 3300046474 Bacteria 2304
336 Ga0495605_0057215 3300046474 Bacteria 1877
337 Ga0495639_0000038 3300046475 Bacteria 57641
338 Ga0495639_0016334 3300046475 Bacteria 3222
339 Ga0495639_0034347 3300046475 Bacteria 2268
340 Ga0495584_0001813 3300046491 Bacteria 12395
341 Ga0495584_0002046 3300046491 Bacteria 11595
342 Ga0495584_0003710 3300046491 Bacteria 8327
343 Ga0495584_0004982 3300046491 Bacteria 7073
344 Ga0495584_0005128 3300046491 Bacteria 6953
345 Ga0495584_0005630 3300046491 Bacteria 6621
346 Ga0495584_0005823 3300046491 Bacteria 6494
347 Ga0495584_0007364 3300046491 Bacteria 5740
348 Ga0495584_0012567 3300046491 Bacteria 4322
349 Ga0495584_0033562 3300046491 Bacteria 2596
350 Ga0495584_0052008 3300046491 Bacteria 2061
351 Ga0495585_0000124 3300046492 Bacteria 83121
352 Ga0495585_0000581 3300046492 Bacteria 34377
353 Ga0495585_0001763 3300046492 Bacteria 16437
354 Ga0495585_0002723 3300046492 Bacteria 12354
355 Ga0495585_0005945 3300046492 Bacteria 7636
356 Ga0495585_0011083 3300046492 Bacteria 5350
357 Ga0495585_0012080 3300046492 Bacteria 5095
358 Ga0495585_0019325 3300046492 Bacteria 3928
359 Ga0495585_0019756 3300046492 Bacteria 3881
360 Ga0495585_0061378 3300046492 Bacteria 2067
361 Ga0495594_0002774 3300046499 Bacteria 9088
362 Ga0495594_0005166 3300046499 Bacteria 6713
363 Ga0495594_0013928 3300046499 Bacteria 4208
364 Ga0495594_0065612 3300046499 Bacteria 2013
365 Ga0495596_0000014 3300046500 Bacteria 121944
366 Ga0495596_0017459 3300046500 Bacteria 2969
367 Ga0495607_0000014 3300046501 Bacteria 186627
368 Ga0495607_0000575 3300046501 Bacteria 35761
369 Ga0495607_0002301 3300046501 Bacteria 15698
370 Ga0495607_0002457 3300046501 Bacteria 15062
371 Ga0495607_0003228 3300046501 Bacteria 12569
372 Ga0495607_0004200 3300046501 Bacteria 10691
373 Ga0495607_0004809 3300046501 Bacteria 9851
374 Ga0495607_0005102 3300046501 Bacteria 9502
375 Ga0495607_0007112 3300046501 Bacteria 7778
376 Ga0495607_0007458 3300046501 Bacteria 7568
377 Ga0495607_0013226 3300046501 Bacteria 5418
378 Ga0495607_0015525 3300046501 Bacteria 4934
379 Ga0495607_0022955 3300046501 Bacteria 3910
380 Ga0495607_0035320 3300046501 Bacteria 3025
381 Ga0495607_0057886 3300046501 Bacteria 2219
382 Ga0495607_0061043 3300046501 Bacteria 2143
383 Ga0495583_0000283 3300046506 Bacteria 81166
384 Ga0495583_0001409 3300046506 Bacteria 24503
385 Ga0495583_0002906 3300046506 Bacteria 13850
386 Ga0495583_0003128 3300046506 Bacteria 13068
387 Ga0495583_0011563 3300046506 Bacteria 5060
388 Ga0495583_0014447 3300046506 Bacteria 4356
389 Ga0495583_0015939 3300046506 Bacteria 4063
390 Ga0495606_0000508 3300046507 Bacteria 63146
391 Ga0495606_0001003 3300046507 Bacteria 41160
392 Ga0495606_0003198 3300046507 Bacteria 17665
393 Ga0495606_0003510 3300046507 Bacteria 16582
394 Ga0495606_0007251 3300046507 Bacteria 9991
395 Ga0495606_0009606 3300046507 Bacteria 8150
396 Ga0495606_0023792 3300046507 Bacteria 4429
397 Ga0495606_0028570 3300046507 Bacteria 3931
398 Ga0495606_0031522 3300046507 Bacteria 3684
399 Ga0495606_0033671 3300046507 Bacteria 3531
400 Ga0495606_0047199 3300046507 Bacteria 2840
401 Ga0495606_0084789 3300046507 Bacteria 1961
402 Ga0495610_0000143 3300046512 Bacteria 78495
403 Ga0495610_0001762 3300046512 Bacteria 18950
404 Ga0495610_0002906 3300046512 Bacteria 13866
405 Ga0495610_0006950 3300046512 Bacteria 7657
406 Ga0495610_0011661 3300046512 Bacteria 5351
407 Ga0495610_0013584 3300046512 Bacteria 4832
408 Ga0495610_0015991 3300046512 Bacteria 4339
409 Ga0495610_0017194 3300046512 Bacteria 4129
410 Ga0495610_0034611 3300046512 Bacteria 2600
411 Ga0495610_0038006 3300046512 Bacteria 2445
412 Ga0495610_0058676 3300046512 Bacteria 1840
413 Ga0495610_0071069 3300046512 Bacteria 1623
414 Ga0495610_0097298 3300046512 Bacteria 1324
415 Ga0495616_0001207 3300046513 Bacteria 18220
416 Ga0495616_0002614 3300046513 Bacteria 11862
417 Ga0495616_0003642 3300046513 Bacteria 9840
418 Ga0495616_0003841 3300046513 Bacteria 9575
419 Ga0495616_0006614 3300046513 Bacteria 7001
420 Ga0495616_0007845 3300046513 Bacteria 6366
421 Ga0495616_0009899 3300046513 Bacteria 5543
422 Ga0495616_0023433 3300046513 Bacteria 3320
423 Ga0495616_0026244 3300046513 Bacteria 3103
424 Ga0495616_0047436 3300046513 Bacteria 2163
425 Ga0495620_0000137 3300046515 Bacteria 59671
426 Ga0495620_0000821 3300046515 Bacteria 19140
427 Ga0495620_0002752 3300046515 Bacteria 10121
428 Ga0495620_0003278 3300046515 Bacteria 9278
429 Ga0495620_0004732 3300046515 Bacteria 7651
430 Ga0495620_0007616 3300046515 Bacteria 5865
431 Ga0495620_0012237 3300046515 Bacteria 4443
432 Ga0495620_0017251 3300046515 Bacteria 3605
433 Ga0495620_0055877 3300046515 Bacteria 1662
434 Ga0495628_0069275 3300046516 Bacteria 2751
435 Ga0495630_0011572 3300046517 Bacteria 6389
436 Ga0495631_0000549 3300046518 Bacteria 25271
437 Ga0495631_0005780 3300046518 Bacteria 6452
438 Ga0495631_0009697 3300046518 Bacteria 4800
439 Ga0495631_0013894 3300046518 Bacteria 3896
440 Ga0495631_0027458 3300046518 Bacteria 2604
441 Ga0495631_0036244 3300046518 Bacteria 2203
442 Ga0495631_0053730 3300046518 Bacteria 1758
443 Ga0495632_0000343 3300046519 Bacteria 44184
444 Ga0495632_0000424 3300046519 Bacteria 40109
445 Ga0495632_0001203 3300046519 Bacteria 21962
446 Ga0495632_0001891 3300046519 Bacteria 16786
447 Ga0495632_0004152 3300046519 Bacteria 9938
448 Ga0495632_0004771 3300046519 Bacteria 9131
449 Ga0495632_0011200 3300046519 Bacteria 5250
450 Ga0495632_0012377 3300046519 Bacteria 4924
451 Ga0495632_0013467 3300046519 Bacteria 4667
452 Ga0495632_0016829 3300046519 Bacteria 4054
453 Ga0495632_0057298 3300046519 Bacteria 1902
454 Ga0495637_0001107 3300046520 Bacteria 16544
455 Ga0495637_0001358 3300046520 Bacteria 14693
456 Ga0495637_0001433 3300046520 Bacteria 14062
457 Ga0495637_0002336 3300046520 Bacteria 10503
458 Ga0495637_0002746 3300046520 Bacteria 9577
459 Ga0495637_0003626 3300046520 Bacteria 8179
460 Ga0495637_0007030 3300046520 Bacteria 5604
461 Ga0495637_0008349 3300046520 Bacteria 5091
462 Ga0495637_0012988 3300046520 Bacteria 3967
463 Ga0495637_0015660 3300046520 Bacteria 3556
464 Ga0495637_0017417 3300046520 Bacteria 3348
465 Ga0495637_0018945 3300046520 Bacteria 3188
466 Ga0495637_0025447 3300046520 Bacteria 2666
467 Ga0495637_0028380 3300046520 Bacteria 2500
468 Ga0495637_0032251 3300046520 Bacteria 2309
469 Ga0495637_0035951 3300046520 Bacteria 2161
470 Ga0495643_0005784 3300046522 Bacteria 8275
471 Ga0495643_0010944 3300046522 Bacteria 5553
472 Ga0495643_0012619 3300046522 Bacteria 5089
473 Ga0495643_0028326 3300046522 Bacteria 3141
474 Ga0495643_0030954 3300046522 Bacteria 2983
475 Ga0495643_0083795 3300046522 Bacteria 1655
476 Ga0495644_0000462 3300046523 Bacteria 17616
477 Ga0495644_0000922 3300046523 Bacteria 12223
478 Ga0495644_0004200 3300046523 Bacteria 5660
479 Ga0495644_0006368 3300046523 Bacteria 4579
480 Ga0495644_0019354 3300046523 Bacteria 2600
481 Ga0495644_0060544 3300046523 Bacteria 1423
482 Ga0495648_0003483 3300046524 Bacteria 13806
483 Ga0495648_0003589 3300046524 Bacteria 13570
484 Ga0495648_0006435 3300046524 Bacteria 9589
485 Ga0495648_0010044 3300046524 Bacteria 7254
486 Ga0495648_0011482 3300046524 Bacteria 6665
487 Ga0495648_0012334 3300046524 Bacteria 6383
488 Ga0495648_0012644 3300046524 Bacteria 6277
489 Ga0495648_0031337 3300046524 Bacteria 3502
490 Ga0495648_0043924 3300046524 Bacteria 2794
491 Ga0495648_0046995 3300046524 Bacteria 2671
492 Ga0495666_0000655 3300046526 Bacteria 15584
493 Ga0495666_0020763 3300046526 Bacteria 3252
494 Ga0495642_0000479 3300046528 Bacteria 20493
495 Ga0495642_0000918 3300046528 Bacteria 13832
496 Ga0495642_0001912 3300046528 Bacteria 8853
497 Ga0495654_0000461 3300046530 Bacteria 33935
498 Ga0495654_0000968 3300046530 Bacteria 21179
499 Ga0495654_0000998 3300046530 Bacteria 20842
500 Ga0495654_0001138 3300046530 Bacteria 19070
501 Ga0495654_0002727 3300046530 Bacteria 11146
502 Ga0495654_0002967 3300046530 Bacteria 10616
503 Ga0495654_0005013 3300046530 Bacteria 7772
504 Ga0495654_0010285 3300046530 Bacteria 5093
505 Ga0495654_0014876 3300046530 Bacteria 4135
506 Ga0495654_0020910 3300046530 Bacteria 3408
507 Ga0495654_0023729 3300046530 Bacteria 3175
508 Ga0495654_0028323 3300046530 Bacteria 2865
509 Ga0495654_0032437 3300046530 Bacteria 2648
510 Ga0495654_0037453 3300046530 Bacteria 2431
511 Ga0495654_0054186 3300046530 Bacteria 1946
512 Ga0495654_0069695 3300046530 Bacteria 1669
513 Ga0495654_0070423 3300046530 Bacteria 1658
514 Ga0495587_0113083 3300046536 Bacteria 1558
515 Ga0495609_0000222 3300046538 Bacteria 55849
516 Ga0495609_0000534 3300046538 Bacteria 30280
517 Ga0495609_0002790 3300046538 Bacteria 10505
518 Ga0495609_0012717 3300046538 Bacteria 3989
519 Ga0495609_0017034 3300046538 Bacteria 3380
520 Ga0495609_0063214 3300046538 Bacteria 1633
521 Ga0495609_0071714 3300046538 Bacteria 1521
522 Ga0495609_0076608 3300046538 Bacteria 1465
523 Ga0495597_0003745 3300046542 Bacteria 8672
524 Ga0495597_0004251 3300046542 Bacteria 7921
525 Ga0495597_0008255 3300046542 Bacteria 5226
526 Ga0495597_0012456 3300046542 Bacteria 4104
527 Ga0495597_0014295 3300046542 Bacteria 3781
528 Ga0495597_0024067 3300046542 Bacteria 2812
529 Ga0495597_0025445 3300046542 Bacteria 2724
530 Ga0495597_0051033 3300046542 Bacteria 1824
531 Ga0495597_0059360 3300046542 Bacteria 1670
532 Ga0495597_0061770 3300046542 Bacteria 1631
533 Ga0495645_0036187 3300046543 Bacteria 3599
534 Ga0495622_0000070 3300046557 Bacteria 89579
535 Ga0495622_0003221 3300046557 Bacteria 7734
536 Ga0495622_0005941 3300046557 Bacteria 5672
537 Ga0495622_0019825 3300046557 Bacteria 3130
538 Ga0495622_0047678 3300046557 Bacteria 1990
539 Ga0495622_0050602 3300046557 Bacteria 1927
540 Ga0495633_0005332 3300046558 Bacteria 7885
541 Ga0495633_0010062 3300046558 Bacteria 5184
542 Ga0495656_0082405 3300046615 Bacteria 1454
543 Ga0495668_0002243 3300046616 Bacteria 16320
544 Ga0495668_0002296 3300046616 Bacteria 16057
545 Ga0495668_0008915 3300046616 Bacteria 6204
546 Ga0495634_0002704 3300046642 Bacteria 14590
547 Ga0495611_0000279 3300046648 Bacteria 34844
548 Ga0495611_0003070 3300046648 Bacteria 7419
549 Ga0495611_0004084 3300046648 Bacteria 6355
550 Ga0495611_0030037 3300046648 Bacteria 2387
551 Ga0495625_0003800 3300046660 Bacteria 14617
552 Ga0495625_0006173 3300046660 Bacteria 10732
553 Ga0495625_0015419 3300046660 Bacteria 6053
554 Ga0495625_0025708 3300046660 Bacteria 4461
555 Ga0495625_0027633 3300046660 Bacteria 4266
556 Ga0495625_0051136 3300046660 Bacteria 2963
557 Ga0495625_0055990 3300046660 Bacteria 2809
558 Ga0495625_0067149 3300046660 Bacteria 2524
559 Ga0495625_0119647 3300046660 Bacteria 1793
560 Ga0495625_0150703 3300046660 Bacteria 1563
561 Ga0495635_0001198 3300046663 Bacteria 17284
562 Ga0495659_0000305 3300046664 Bacteria 19486
563 Ga0495659_0003767 3300046664 Bacteria 4818
564 Ga0495659_0008860 3300046664 Bacteria 3204
565 Ga0495661_0000116 3300046665 Bacteria 95285
566 Ga0495661_0000501 3300046665 Bacteria 40800
567 Ga0495661_0002639 3300046665 Bacteria 13720
568 Ga0495661_0006788 3300046665 Bacteria 8025
569 Ga0495661_0018225 3300046665 Bacteria 4621
570 Ga0495661_0018542 3300046665 Bacteria 4574
571 Ga0495661_0020589 3300046665 Bacteria 4304
572 Ga0495661_0021497 3300046665 Bacteria 4206
573 Ga0495661_0036388 3300046665 Bacteria 3083
574 Ga0495661_0081584 3300046665 Bacteria 1863
575 Ga0495661_0084568 3300046665 Bacteria 1820
576 Ga0495661_0116845 3300046665 Bacteria 1479
577 Ga0495661_0122528 3300046665 Bacteria 1434
578 Ga0495661_0124791 3300046665 Bacteria 1418
579 Ga0495588_0007522 3300046674 Bacteria 4961
580 Ga0495588_0030856 3300046674 Bacteria 2695
581 Ga0495623_0003673 3300046679 Bacteria 10133
582 Ga0495623_0005137 3300046679 Bacteria 8591
583 Ga0495646_0058620 3300046680 Bacteria 2301
584 Ga0495669_0023467 3300046684 Bacteria 2685
585 Ga0495613_0021198 3300046689 Bacteria 4846
586 Ga0495613_0059247 3300046689 Bacteria 2807
587 Ga0495613_0088248 3300046689 Bacteria 2247
588 Ga0495624_0001306 3300046690 Bacteria 19565
589 Ga0495624_0038574 3300046690 Bacteria 3069
590 Ga0495670_0000341 3300046691 Bacteria 22294
591 Ga0495670_0000788 3300046691 Bacteria 15221
592 Ga0495670_0002069 3300046691 Bacteria 9893
593 Ga0495670_0002573 3300046691 Bacteria 8962
594 Ga0495670_0010332 3300046691 Bacteria 4585
595 Ga0495670_0012726 3300046691 Bacteria 4138
596 Ga0495670_0013384 3300046691 Bacteria 4036
597 Ga0495670_0093923 3300046691 Bacteria 1537
598 Ga0495670_0094839 3300046691 Bacteria 1530
599 Ga0495671_0000397 3300046692 Bacteria 35515
600 Ga0495671_0002310 3300046692 Bacteria 12114
601 Ga0495671_0006217 3300046692 Bacteria 6923
602 Ga0495671_0006266 3300046692 Bacteria 6892
603 Ga0495671_0007157 3300046692 Bacteria 6387
604 Ga0495671_0011310 3300046692 Bacteria 4918
605 Ga0495671_0012858 3300046692 Bacteria 4556
606 Ga0495671_0016732 3300046692 Bacteria 3910
607 Ga0495671_0035923 3300046692 Bacteria 2513
608 Ga0495671_0044049 3300046692 Bacteria 2238
609 Ga0495649_0000104 3300046694 Bacteria 74938
610 Ga0495649_0001289 3300046694 Bacteria 19188
611 Ga0495649_0002799 3300046694 Bacteria 12148
612 Ga0495649_0006751 3300046694 Bacteria 7110
613 Ga0495649_0007473 3300046694 Bacteria 6655
614 Ga0495649_0008877 3300046694 Bacteria 6017
615 Ga0495649_0012100 3300046694 Bacteria 5035
616 Ga0495649_0012430 3300046694 Bacteria 4949
617 Ga0495649_0016024 3300046694 Bacteria 4254
618 Ga0495649_0017986 3300046694 Bacteria 3983
619 Ga0495649_0023960 3300046694 Bacteria 3407
620 Ga0495649_0160156 3300046694 Bacteria 1180
621 Ga0495589_0002546 3300046794 Bacteria 10146
622 Ga0495589_0007918 3300046794 Bacteria 5565
623 Ga0495589_0008025 3300046794 Bacteria 5523
624 Ga0495589_0008427 3300046794 Bacteria 5386
625 Ga0495589_0009776 3300046794 Bacteria 4980
626 Ga0495589_0011638 3300046794 Bacteria 4567
627 Ga0495589_0013865 3300046794 Bacteria 4155
628 Ga0495589_0019208 3300046794 Bacteria 3506
629 Ga0495589_0021297 3300046794 Bacteria 3312
630 Ga0495600_0020119 3300046809 Bacteria 4269
631 Ga0495660_0001225 3300046810 Bacteria 17883
632 Ga0495660_0003166 3300046810 Bacteria 10247
633 Ga0495660_0005235 3300046810 Bacteria 7781
634 Ga0495660_0006799 3300046810 Bacteria 6743
635 Ga0495660_0007040 3300046810 Bacteria 6629
636 Ga0495660_0010097 3300046810 Bacteria 5490
637 Ga0495660_0010374 3300046810 Bacteria 5419
638 Ga0495660_0010525 3300046810 Bacteria 5381
639 Ga0495660_0015419 3300046810 Bacteria 4415
640 Ga0495660_0018142 3300046810 Bacteria 4046
641 Ga0495660_0023450 3300046810 Bacteria 3519
642 Ga0495660_0041413 3300046810 Bacteria 2550
643 Ga0495660_0046397 3300046810 Bacteria 2382
644 Ga0495660_0062832 3300046810 Bacteria 1989
645 Ga0495660_0067238 3300046810 Bacteria 1909
646 Ga0495660_0070263 3300046810 Bacteria 1859
647 Ga0495581_0003578 3300047315 Bacteria 8928
648 Ga0495604_0002652 3300047317 Bacteria 14362
649 Ga0495604_0013567 3300047317 Bacteria 6499
650 Ga0495604_0076280 3300047317 Bacteria 2521
651 Ga0495636_0005637 3300047318 Bacteria 4910
652 Ga0495636_0059735 3300047318 Bacteria 1610
653 Ga0495674_0046201 3300047319 Bacteria 3865
654 Ga0495672_0000331 3300047320 Bacteria 62021
655 Ga0495672_0002113 3300047320 Bacteria 18623
656 Ga0495672_0003018 3300047320 Bacteria 14803
657 Ga0495672_0004451 3300047320 Bacteria 11472
658 Ga0495672_0007558 3300047320 Bacteria 8156
659 Ga0495672_0012721 3300047320 Bacteria 5850
660 Ga0495672_0019327 3300047320 Bacteria 4496
661 Ga0495672_0031812 3300047320 Bacteria 3290
662 Ga0495672_0048335 3300047320 Bacteria 2522
663 Ga0495672_0066852 3300047320 Bacteria 2049
664 Ga0495672_0094122 3300047320 Bacteria 1639
665 Ga0495676_0001611 3300047321 Bacteria 19632
666 Ga0495676_0012710 3300047321 Bacteria 7571
667 Ga0495676_0034799 3300047321 Bacteria 4222
668 Ga0495680_0032117 3300047322 Bacteria 4265
669 Ga0495680_0077959 3300047322 Bacteria 2508
670 Ga0495683_0000185 3300047323 Bacteria 61212
671 Ga0495683_0000920 3300047323 Bacteria 20759
672 Ga0495683_0001071 3300047323 Bacteria 18950
673 Ga0495683_0001701 3300047323 Bacteria 13985
674 Ga0495683_0002732 3300047323 Bacteria 10513
675 Ga0495683_0018033 3300047323 Bacteria 3653
676 Ga0495683_0030608 3300047323 Bacteria 2746
677 Ga0495683_0051323 3300047323 Bacteria 2062
678 Ga0495683_0064014 3300047323 Bacteria 1816
679 Ga0495683_0071177 3300047323 Bacteria 1706
680 Ga0495687_001896 3300047443 Bacteria 18021
681 Ga0495687_002012 3300047443 Bacteria 17233
682 Ga0495687_003051 3300047443 Bacteria 12564
683 Ga0495687_003319 3300047443 Bacteria 11800
684 Ga0495675_0085201 3300047444 Bacteria 1987
685 Ga0495677_0002044 3300047445 Bacteria 8049
686 Ga0495679_000727 3300047446 Bacteria 21158
687 Ga0495679_000875 3300047446 Bacteria 18952
688 Ga0495679_001754 3300047446 Bacteria 11907
689 Ga0495679_002192 3300047446 Bacteria 10213
690 Ga0495679_003911 3300047446 Bacteria 7041
691 Ga0495679_004726 3300047446 Bacteria 6184
692 Ga0495679_008670 3300047446 Bacteria 4116
693 Ga0495679_023295 3300047446 Bacteria 2102
694 Ga0495685_025982 3300047447 Bacteria 2015
695 Ga0495673_0001043 3300047469 Bacteria 24417
696 Ga0495673_0001505 3300047469 Bacteria 18401
697 Ga0495673_0002263 3300047469 Bacteria 13812
698 Ga0495673_0002289 3300047469 Bacteria 13723
699 Ga0495673_0003406 3300047469 Bacteria 10500
700 Ga0495673_0004020 3300047469 Bacteria 9382
701 Ga0495673_0004197 3300047469 Bacteria 9091
702 Ga0495673_0004554 3300047469 Bacteria 8653
703 Ga0495673_0005403 3300047469 Bacteria 7734
704 Ga0495673_0005775 3300047469 Bacteria 7414
705 Ga0495673_0009682 3300047469 Bacteria 5310
706 Ga0495673_0014932 3300047469 Bacteria 4021
707 Ga0495673_0022317 3300047469 Bacteria 3105
708 Ga0495673_0029359 3300047469 Bacteria 2595
709 Ga0495673_0035676 3300047469 Bacteria 2288
710 Ga0495673_0048213 3300047469 Bacteria 1879
711 Ga0495681_0000399 3300047470 Bacteria 33808
712 Ga0495681_0000804 3300047470 Bacteria 24176
713 Ga0495681_0001014 3300047470 Bacteria 21549
714 Ga0495681_0002079 3300047470 Bacteria 14550
715 Ga0495681_0003785 3300047470 Bacteria 10487
716 Ga0495681_0005868 3300047470 Bacteria 8151
717 Ga0495681_0007243 3300047470 Bacteria 7131
718 Ga0495681_0009471 3300047470 Bacteria 5995
719 Ga0495681_0011105 3300047470 Bacteria 5397
720 Ga0495681_0017614 3300047470 Bacteria 3959
721 Ga0495681_0019031 3300047470 Bacteria 3763
722 Ga0495681_0032446 3300047470 Bacteria 2629
723 Ga0495681_0033687 3300047470 Bacteria 2561
724 Ga0495681_0035989 3300047470 Bacteria 2453
725 Ga0495681_0069668 3300047470 Bacteria 1597
726 Ga0495684_0029668 3300047471 Bacteria 4197
727 Ga0495684_0101291 3300047471 Bacteria 2177
728 Ga0495686_0003471 3300047472 Bacteria 13634
729 Ga0495686_0008020 3300047472 Bacteria 7828
730 Ga0495686_0009315 3300047472 Bacteria 7085
731 Ga0495686_0018000 3300047472 Bacteria 4750
732 Ga0495686_0029995 3300047472 Bacteria 3534
733 Ga0495593_0007442 3300047673 Bacteria 6406
734 Ga0495593_0008928 3300047673 Bacteria 5818
735 Ga0495602_0002686 3300048088 Bacteria 18185
736 Ga0495626_0000203 3300048091 Bacteria 71731
737 Ga0495626_0000456 3300048091 Bacteria 41667
738 Ga0495626_0001599 3300048091 Bacteria 17651
739 Ga0495626_0001772 3300048091 Bacteria 16401
740 Ga0495626_0002511 3300048091 Bacteria 12651
741 Ga0495626_0003174 3300048091 Bacteria 10707
742 Ga0495626_0006388 3300048091 Bacteria 6712
743 Ga0495626_0008350 3300048091 Bacteria 5688
744 Ga0495626_0014487 3300048091 Bacteria 4064
745 Ga0495626_0027701 3300048091 Bacteria 2753
746 Ga0495626_0048175 3300048091 Bacteria 1978
747 Ga0496102_0001019 3300048905 Bacteria 26110
748 Ga0496103_0005170 3300048906 Bacteria 7853
749 Ga0496105_0078700 3300048908 Bacteria 2722
750 Ga0496106_0075915 3300048909 Bacteria 2575
751 Ga0496107_0143940 3300048910 Bacteria 1762
752 Ga0496113_0102919 3300048916 Bacteria 2215
753 Ga0496116_0001790 3300048919 Bacteria 23362
754 Ga0496116_0001797 3300048919 Bacteria 23299
755 Ga0496116_0003072 3300048919 Bacteria 16842
756 Ga0496116_0003590 3300048919 Bacteria 15259
757 Ga0496117_0000720 3300048920 Bacteria 52184
758 Ga0496117_0006016 3300048920 Bacteria 12483
759 Ga0496117_0015516 3300048920 Bacteria 6489
760 Ga0496117_0023681 3300048920 Bacteria 4882
761 Ga0496117_0070727 3300048920 Bacteria 2342
762 Ga0496118_0008420 3300048921 Bacteria 10663
763 Ga0496118_0008627 3300048921 Bacteria 10487
764 Ga0496118_0009584 3300048921 Bacteria 9748
765 Ga0496118_0016534 3300048921 Bacteria 6764
766 Ga0496118_0017192 3300048921 Bacteria 6596
767 Ga0496118_0022489 3300048921 Bacteria 5509
768 Ga0496118_0094905 3300048921 Bacteria 2038
769 Ga0496119_0016404 3300048922 Bacteria 5639
770 Ga0496120_0007042 3300048923 Bacteria 8444
771 Ga0496120_0015856 3300048923 Bacteria 4949
772 Ga0496120_0033702 3300048923 Bacteria 3075
773 Ga0496120_0050548 3300048923 Bacteria 2379
774 Ga0496121_0013896 3300048924 Bacteria 8608
775 Ga0496121_0022233 3300048924 Bacteria 6167
776 Ga0496121_0032478 3300048924 Bacteria 4743
777 Ga0496121_0071912 3300048924 Bacteria 2780
778 Ga0496122_0004285 3300048925 Bacteria 17875
779 Ga0496122_0011812 3300048925 Bacteria 8782
780 Ga0496122_0018619 3300048925 Bacteria 6399
781 Ga0496122_0052361 3300048925 Bacteria 3090
782 Ga0496122_0062736 3300048925 Bacteria 2718
783 Ga0496123_0003416 3300048926 Bacteria 17871
784 Ga0496123_0011560 3300048926 Bacteria 7637
785 Ga0496123_0014910 3300048926 Bacteria 6407
786 Ga0496124_0000816 3300048927 Bacteria 50663
787 Ga0496124_0006096 3300048927 Bacteria 13264
788 Ga0496124_0010907 3300048927 Bacteria 9142
789 Ga0496124_0027067 3300048927 Bacteria 5157
790 Ga0496124_0052203 3300048927 Bacteria 3474
791 Ga0496124_0167582 3300048927 Bacteria 1705
792 Ga0496125_0000822 3300048928 Bacteria 50288
793 Ga0496125_0003780 3300048928 Bacteria 17999
794 Ga0496125_0004344 3300048928 Bacteria 16443
795 Ga0496125_0008974 3300048928 Bacteria 10365
796 Ga0496125_0033195 3300048928 Bacteria 4572
797 Ga0496125_0036046 3300048928 Bacteria 4326
798 Ga0496125_0038878 3300048928 Bacteria 4108
799 Ga0496125_0050653 3300048928 Bacteria 3435
800 Ga0496125_0057874 3300048928 Bacteria 3135
801 Ga0496125_0058225 3300048928 Bacteria 3122
802 Ga0496126_0005995 3300048929 Bacteria 13652
803 Ga0496126_0007640 3300048929 Bacteria 11801
804 Ga0495678_002361 3300049459 Bacteria 12956
805 Ga0495678_003607 3300049459 Bacteria 9440
806 Ga0495678_004892 3300049459 Bacteria 7571
807 Ga0495678_005865 3300049459 Bacteria 6649
808 Ga0495678_008259 3300049459 Bacteria 5276
809 Ga0495678_008485 3300049459 Bacteria 5177
810 Ga0495678_010183 3300049459 Bacteria 4583
811 Ga0495678_013970 3300049459 Bacteria 3749
812 Ga0495678_022851 3300049459 Bacteria 2728
813 Ga0495678_025920 3300049459 Bacteria 2510
814 Ga0495678_026257 3300049459 Bacteria 2489
815 Ga0495678_035309 3300049459 Bacteria 2050
816 Ga0495682_0000905 3300049460 Bacteria 18206
817 Ga0495682_0002057 3300049460 Bacteria 9853
818 Ga0495682_0005159 3300049460 Bacteria 5463
819 Ga0495682_0020833 3300049460 Bacteria 2459
820 Ga0495682_0025014 3300049460 Bacteria 2223
821 Ga0501042_0174739 3300049578 Bacteria 1550
822 Ga0501073_0019911 3300049589 Bacteria 4840
823 Ga0501222_000598 3300049662 Bacteria 5291
824 Ga0500572_001735 3300053111 Bacteria 5658
825 Ga0500618_002697 3300053125 Bacteria 6485
826 2511272345 2511231007 Bacteria 6306603
827 2511280800 2511231008 Bacteria 6624100
828 2511291575 2511231010 Bacteria 6373152
829 2511295820 2511231011 Bacteria 6149768
830 2511299046 2511231012 Bacteria 6738011
831 2511312357 2511231014 Bacteria 6462302
832 2511335087 2511231017 Bacteria 6503007
833 2511337137 2511231018 Bacteria 6436256
834 2511344711 2511231019 Bacteria 6520662
835 2511352917 2511231020 Bacteria 6115223
836 2511357550 2511231021 Bacteria 7302637
837 2511367663 2511231023 Bacteria 6808468
838 2511413878 2511231031 Bacteria 6558529
839 2511824688 2511231156 Bacteria 6845832
840 2597863815 2597489888 Bacteria 6179543
841 2597869964 2597489889 Bacteria 6297495
842 2599330281 2599185155 Bacteria 5827168
843 2599398228 2599185167 Bacteria 6353609
844 2599450238 2599185179 Bacteria 6611171
845 2599500668 2599185188 Bacteria 6164180
846 2599510411 2599185189 Bacteria 5862825
847 2599516085 2599185190 Bacteria 6285678
848 2599521186 2599185191 Bacteria 6297582
849 2599612906 2599185212 Bacteria 6765997
850 2599771778 2599185248 Bacteria 6696816
851 2599883605 2599185288 Bacteria 6666191
852 2599889144 2599185289 Bacteria 6778765
853 2599895616 2599185290 Bacteria 6289611
854 2599901198 2599185291 Bacteria 6775623
855 2599932331 2599185300 Bacteria 6062622
856 2599943502 2599185302 Bacteria 5954930
857 2599950367 2599185303 Bacteria 6512725
858 2599954613 2599185304 Bacteria 5951361
859 2599962302 2599185305 Bacteria 6748700
860 2599968092 2599185306 Bacteria 6637356
861 2599977117 2599185308 Bacteria 6621546
862 2599985168 2599185309 Bacteria 5969593
863 2599988582 2599185310 Bacteria 6014457
864 2599993417 2599185311 Bacteria 6354990
865 2600002893 2599185312 Bacteria 5912071
866 2600008203 2599185313 Bacteria 6658188
867 2600011155 2599185314 Bacteria 6621749
868 2600016190 2599185315 Bacteria 6771107
869 2600022000 2599185316 Bacteria 6320029
870 2600028486 2599185317 Bacteria 6435722
871 2600038027 2599185318 Bacteria 6961590
872 2600044368 2599185319 Bacteria 6637840
873 2600049841 2599185320 Bacteria 5963263
874 2600051396 2599185321 Bacteria 6764560
875 2600060013 2599185322 Bacteria 6763055
876 2600063235 2599185323 Bacteria 6688755
877 2600070538 2599185324 Bacteria 6590677
878 2600075274 2599185325 Bacteria 6324919
879 2600357653 2600254930 Bacteria 6431253
880 2601691771 2600255296 Bacteria 5784754
881 2601799226 2600255318 Bacteria 6383414
882 2606078126 2603880185 Bacteria 6379190
883 2606125997 2603880199 Bacteria 6377649
884 2621299460 2619619299 Bacteria 6649820
885 2624480664 2623620443 Bacteria 6427864
886 2624492435 2623620446 Bacteria 6500345
887 2643844507 2643221565 Bacteria 6216018
888 2643869899 2643221571 Bacteria 6228673
889 2643954365 2643221589 Bacteria 6250934
890 2644023174 2643221602 Bacteria 6249926
891 2644185302 2643221633 Bacteria 6733554
892 2644283683 2643221650 Bacteria 7029547
893 2644621131 2643221713 Bacteria 6554480
894 2652546928 2651869719 Bacteria 6047974
895 2671094278 2667528170 Bacteria 6786960
896 2671126347 2667528176 Bacteria 6724917
897 2677896325 2675903420 Bacteria 6247433
898 2678262050 2675903515 Bacteria 6580491
899 2715753236 2713897148 Bacteria 5883533
900 2715756624 2713897149 Bacteria 6506249
901 2723248601 2721755607 Bacteria 5841722
902 2738747868 2738541282 Bacteria 6593925
903 2738810741 2738541294 Bacteria 6925949
904 2738856911 2738541303 Bacteria 6591772
905 2738898101 2738541309 Bacteria 6926455
906 2739199494 2738543004 Bacteria 6381073
907 2739257239 2738543015 Bacteria 6750701
908 2739311859 2738543025 Bacteria 6600348
909 2745008398 2744054620 Bacteria 6551379
910 2774133919 2773857673 Bacteria 6513460
911 2784264313 2784132063 Bacteria 6262788
912 2794597200 2791355520 Bacteria 5948615
913 2808922190 2808606376 Bacteria 6248667
914 2808929608 2808606377 Bacteria 6646337
915 2808933641 2808606378 Bacteria 6177535
916 2808944827 2808606380 Bacteria 6248705
917 2808951813 2808606381 Bacteria 6646461
918 2808959486 2808606382 Bacteria 6841132
919 2808962115 2808606383 Bacteria 6138645
920 2808980624 2808606385 Bacteria 6711065
921 2808996345 2808606388 Bacteria 6706662
922 2808997128 2808606389 Bacteria 6138126
923 2809214907 2808606445 Bacteria 6057339
924 2817490822 2816332298 Bacteria 6852809
925 2819659014 2818991456 Bacteria 6123676
926 2825651477 2825651385 Bacteria 6715909
927 2826586032 2826581358 Bacteria 5963467
928 2834029982 2834028612 Bacteria 6354979
929 2842819069 2842815866 Bacteria 5947510
930 2842826849 2842826826 Bacteria 5974129
931 2842834633 2842832357 Bacteria 5959113
932 2842839416 2842837860 Bacteria 6066181
933 2842843720 2842843487 Bacteria 6004777
934 2842853395 2842849001 Bacteria 5924277
935 2842859100 2842854478 Bacteria 6143501
936 2852614714 2852612431 Bacteria 6885235
937 2852657606 2852657418 Bacteria 6472974
938 2852667548 2852667396 Bacteria 6885555
939 2860344712 2860339153 Bacteria 6846989
940 2878032540 2878029506 Bacteria 6418441
941 2880233605 2880230671 Bacteria 6140320
942 2904520015 2904518522 Bacteria 6068986
943 2904550279 2904550169 Bacteria 6221258
944 2908449885 2908446538 Bacteria 6829095
945 2919065083 2919063839 Bacteria 6302690
946 2919387006 2919385768 Bacteria 5897293
947 2919458767 2919456309 Bacteria 6586567
948 2919487381 2919481497 Bacteria 6907839
949 2919492304 2919487758 Bacteria 5929766
950 2919698602 2919697872 Bacteria 6553725
951 2923588803 2923586266 Bacteria 6565975
952 2929147509 2929144301 Bacteria 6622272
953 2929192396 2929189879 Bacteria 5930554
954 2931394107 2931390751 Bacteria 6273349
955 2931402231 2931396565 Bacteria 7251677
956 2939638890 2939636861 Bacteria 6297853
957 2945933672 2945928738 Bacteria 6053221
958 2945963886 2945961074 Bacteria 7342064
959 2946010063 2946006987 Bacteria 6705746
960 2946031076 2946027586 Bacteria 6049274
961 2947237659 2947233263 Bacteria 6439278
962 2974290933 2974289157 Bacteria 6080362
963 2998142887 2998139840 Bacteria 6073514
964 3007422941 3007419365 Bacteria 7026924
965 3007514184 3007511990 Bacteria 6481491
966 3007614239 3007614139 Bacteria 6053559
967 3007621616 3007619802 Bacteria 6411688
968 3007719159 3007718800 Bacteria 5971527
969 3007856906 3007855910 Bacteria 5637581
970 3007869352 3007866637 Bacteria 5899198
971 8019778930 8019775933 Bacteria 6858656
972 8029997907 8029995093 Bacteria 5990776
973 8054288496 8054285046 Bacteria 6919322
974 8054348089 8054347763 Bacteria 5901107
975 8054506147 8054503363 Bacteria 6101651
976 8055820748 8055817908 Bacteria 6609162
977 8056128748 8056125926 Bacteria 6228218
978 8056134596 8056131705 Bacteria 6107031
979 8056145845 8056143049 Bacteria 6307666
980 8056154648 8056148874 Bacteria 6479865
981 8056165874 8056161164 Bacteria 6106669
982 8056168311 8056166840 Bacteria 5820959
983 8056178327 8056177738 Bacteria 6748268
984 8056574390 8056569372 Bacteria 5997322
985 Ga0495681_0002728
986 MRS2a_Contig_6993
987 MRS2a_Contig_731
988 SwRhRL2b_contig_1875304
989 MRS1b_contig_5847325
990 Ga0055539_1000011
991 Ga0055533_1000014
992 Ga0055532_1000009
993 Ga0055525_1000016
994 Ga0055536_1000352
995 Ga0055530_10000019
996 Ga0055530_10002917
997 Ga0055540_1000006
998 Ga0055540_1000055
999 Ga0055531_10000126
1000 Ga0055541_1000008
1001 Ga0065714_10000255
1002 Ga0065714_10002219
1003 Ga0065714_10003565
1004 Ga0065714_10009982
1005 Ga0065714_10012859
1006 Ga0065714_10023451
1007 Ga0065714_10068323
1008 Ga0065714_10075816
1009 Ga0065714_10082916
1010 Ga0065704_10070628
1011 Ga0065704_10099151
1012 Ga0065704_10136757
1013 Ga0065712_10069901
1014 Ga0065715_10013805
1015 Ga0070670_100000495
1016 Ga0070670_100002291
1017 Ga0070669_100010476
1018 Ga0070662_100003888
1019 Ga0070662_100037132
1020 Ga0070664_100000064
1021 Ga0068851_10000165
1022 Ga0075432_10000990
1023 Ga0075432_10003031
1024 Ga0075362_10118062
1025 Ga0075436_100015966
1026 Ga0075436_100022524
1027 Ga0079104_1000235
1028 Ga0079104_1000873
1029 Ga0099826_10010909
1030 Ga0105251_10000456
1031 Ga0105251_10001310
1032 Ga0105251_10014230
1033 Ga0105251_10019713
1034 Ga0105251_10025751
1035 Ga0105251_10029890
1036 Ga0105251_10034266
1037 Ga0105251_10100078
1038 Ga0105244_10002575
1039 Ga0105244_10003967
1040 Ga0105244_10004549
1041 Ga0105244_10006056
1042 Ga0105244_10009002
1043 Ga0105244_10015172
1044 Ga0105244_10027913
1045 Ga0105250_10000145
1046 Ga0105250_10000256
1047 Ga0105250_10000757
1048 Ga0105250_10011541
1049 Ga0105250_10015734
1050 Ga0105243_10013488
1051 Ga0105243_10022501
1052 Ga0105242_10004868
1053 Ga0105237_10000426
1054 Ga0105246_10000009
1055 Ga0105246_10011996
1056 Ga0105246_10086860
1057 Ga0157345_1000181
1058 Ga0157373_10002099
1059 Ga0157373_10002260
1060 Ga0157373_10002438
1061 Ga0157373_10004688
1062 Ga0157373_10016012
1063 Ga0157373_10025264
1064 Ga0157373_10134310
1065 Ga0157373_10164962
1066 Ga0157371_10000189
1067 Ga0157371_10017892
1068 Ga0157370_10066712
1069 Ga0157370_10086648
1070 Ga0157370_10103178
1071 Ga0157370_10191776
1072 Ga0157369_10005447
1073 Ga0157369_10007726
1074 Ga0157369_10012736
1075 Ga0157369_10036133
1076 Ga0157369_10045733
1077 Ga0157369_10100516
1078 Ga0163162_10000169
1079 Ga0157375_10003950
1080 Ga0157375_10215829
1081 Ga0182008_10000404
1082 Ga0182008_10000942
1083 Ga0182008_10007227
1084 Ga0182008_10044238
1085 Ga0182008_10055744
1086 Ga0182008_10085377
1087 Ga0182006_1000452
1088 Ga0182006_1000704
1089 Ga0182006_1004026
1090 Ga0182006_1011474
1091 Ga0182006_1016570
1092 Ga0182006_1030283
1093 Ga0182007_10000083
1094 Ga0182007_10001288
1095 Ga0182007_10004715
1096 Ga0182005_1001844
1097 Ga0182005_1008383
1098 Ga0182005_1008813
1099 Ga0182005_1009216
1100 Ga0182005_1040602
1101 Ga0163161_10000440
1102 Ga0163161_10001602
1103 Ga0163161_10004328
1104 Ga0163161_10009073
1105 Ga0163161_10048643
1106 Ga0163161_10097373
1107 Ga0163161_10161309
1108 Ga0209435_101164
1109 Ga0209784_100023
1110 Ga0209566_100019
1111 Ga0209674_100034
1112 Ga0209147_100027
1113 Ga0209563_100037
1114 Ga0209563_100908
1115 Ga0209258_100268
1116 Ga0209646_1000323
1117 Ga0209677_100021
1118 Ga0209675_1004176
1119 Ga0209676_1000002
1120 Ga0209676_1000158
1121 Ga0209676_1002612
1122 Ga0209676_1004504
1123 Ga0209050_1000006
1124 Ga0209050_1000013
1125 Ga0209050_1000321
1126 Ga0209051_1000001
1127 Ga0209051_1000007
1128 Ga0209051_1017169
1129 Ga0209257_1000029
1130 Ga0207656_10002984
1131 Ga0207696_1000002
1132 Ga0207696_1000011
1133 Ga0207696_1000186
1134 Ga0207696_1002373
1135 Ga0207696_1004244
1136 Ga0207696_1039914
1137 Ga0207655_1000022
1138 Ga0207655_1000207
1139 Ga0207655_1000379
1140 Ga0207655_1001659
1141 Ga0207655_1004289
1142 Ga0207655_1005715
1143 Ga0207655_1008836
1144 Ga0207655_1015187
1145 Ga0207655_1018714
1146 Ga0207655_1027367
1147 Ga0207655_1028945
1148 Ga0207655_1047020
1149 Ga0207713_1000162
1150 Ga0207713_1000326
1151 Ga0207713_1000447
1152 Ga0207713_1000552
1153 Ga0207713_1006733
1154 Ga0207713_1008776
1155 Ga0207713_1011581
1156 Ga0207713_1029694
1157 Ga0207713_1029696
1158 Ga0207713_1056082
1159 Ga0207671_10000743
1160 Ga0207649_10000116
1161 Ga0207650_10000750
1162 Ga0207686_10002731
1163 Ga0207709_10000004
1164 Ga0207679_10000054
1165 Ga0207639_10118851
1166 Ga0209281_1000009
1167 Ga0209281_1000046
1168 Ga0209281_1013568
1169 Ga0207428_10007691
1170 Ga0207428_10022356
1171 Ga0307511_10144701
1172 Ga0307408_100007588
1173 Ga0307405_10000328
1174 Ga0307405_10050641
1175 Ga0307413_10044281
1176 Ga0307413_10072835
1177 Ga0307406_10016525
1178 Ga0307407_10058849
1179 Ga0307412_10001489
1180 Ga0307412_10004125
1181 Ga0307412_10005227
1182 Ga0307412_10014820
1183 Ga0307412_10193721
1184 Ga0307409_100211491
1185 Ga0307409_100271065
1186 Ga0307416_100012044
1187 Ga0307414_10265513
1188 Ga0307414_10296114
1189 Ga0307411_10012125
1190 Ga0307411_10065922
1191 Ga0307510_10014347
1192 Ga0439438_000875
1193 Ga0439438_000998
1194 Ga0439438_001021
1195 Ga0439438_001408
1196 Ga0439438_001812
1197 Ga0439438_003024
1198 Ga0439438_003764
1199 Ga0439438_004188
1200 Ga0439438_005138
1201 Ga0439447_001833
1202 Ga0439447_002314
1203 Ga0439447_003667
1204 Ga0439447_003840
1205 Ga0439447_005155
1206 Ga0439447_014969
1207 Ga0439466_0001055
1208 Ga0439466_0001400
1209 Ga0439466_0003160
1210 Ga0439466_0010386
1211 Ga0439466_0018033
1212 Ga0451793_1073897
1213 Ga0451807_1051409
1214 Ga0439431_0006087
1215 Ga0439445_0002580
1216 Ga0439432_000031
1217 Ga0439432_001202
1218 Ga0439432_001230
1219 Ga0439432_001672
1220 Ga0439432_003431
1221 Ga0439451_000310
1222 Ga0439451_001779
1223 Ga0439451_009077
1224 Ga0439452_000317
1225 Ga0439452_001132
1226 Ga0439452_001430
1227 Ga0439452_017043
1228 Ga0439456_004229
1229 Ga0439463_018138
1230 Ga0450911_000076
1231 Ga0450911_001437
1232 Ga0450920_001078
1233 Ga0450902_001808
1234 Ga0450903_001550
1235 Ga0450903_007363
1236 Ga0450903_009157
1237 Ga0450904_001002
1238 Ga0450906_004556
1239 Ga0450907_000269
1240 Ga0450907_002262
1241 Ga0439446_0005630
1242 Ga0450908_001729
1243 Ga0450909_001472
1244 Ga0439434_0001842
1245 Ga0439460_0003382
1246 Ga0439460_0003508
1247 Ga0450901_001417
1248 Ga0439440_0000822
1249 Ga0495617_000097
1250 Ga0495617_001247
1251 Ga0495617_001668
1252 Ga0495617_005076
1253 Ga0495617_005125
1254 Ga0495617_005357
1255 Ga0495617_017035
1256 Ga0495617_026955
1257 Ga0495617_034199
1258 Ga0495627_000517
1259 Ga0495627_000526
1260 Ga0495627_001863
1261 Ga0495627_004951
1262 Ga0495627_015889
1263 Ga0495592_0017072
1264 Ga0495603_0011368
1265 Ga0495603_0027710
1266 Ga0495603_0037608
1267 Ga0495590_0000708
1268 Ga0495590_0008745
1269 Ga0495590_0019869
1270 Ga0495590_0021644
1271 Ga0495591_000060
1272 Ga0495591_000221
1273 Ga0495591_000354
1274 Ga0495591_002731
1275 Ga0495591_002853
1276 Ga0495591_006357
1277 Ga0495591_006811
1278 Ga0495591_007623
1279 Ga0495591_007952
1280 Ga0495591_008212
1281 Ga0495591_015788
1282 Ga0495638_0000298
1283 Ga0495638_0001565
1284 Ga0495638_0002480
1285 Ga0495638_0002560
1286 Ga0495638_0003323
1287 Ga0495638_0012218
1288 Ga0495638_0013298
1289 Ga0495638_0015951
1290 Ga0495638_0022972
1291 Ga0495638_0030695
1292 Ga0495638_0035221
1293 Ga0495638_0035682
1294 Ga0495638_0043170
1295 Ga0495638_0066691
1296 Ga0495638_0095059
1297 Ga0495638_0147148
1298 Ga0495653_0000844
1299 Ga0495653_0002370
1300 Ga0495653_0006664
1301 Ga0495653_0045650
1302 Ga0495650_0001297
1303 Ga0495650_0002090
1304 Ga0495650_0015181
1305 Ga0495650_0022221
1306 Ga0495650_0026452
1307 Ga0495650_0046317
1308 Ga0495650_0071139
1309 Ga0495580_0144905
1310 Ga0495605_0000197
1311 Ga0495605_0000789
1312 Ga0495605_0002861
1313 Ga0495605_0007042
1314 Ga0495605_0008045
1315 Ga0495605_0011728
1316 Ga0495605_0015578
1317 Ga0495605_0024112
1318 Ga0495605_0030899
1319 Ga0495605_0041097
1320 Ga0495605_0057215
1321 Ga0495639_0000038
1322 Ga0495639_0016334
1323 Ga0495639_0034347
1324 Ga0495584_0001813
1325 Ga0495584_0002046
1326 Ga0495584_0003710
1327 Ga0495584_0004982
1328 Ga0495584_0005128
1329 Ga0495584_0005630
1330 Ga0495584_0005823
1331 Ga0495584_0007364
1332 Ga0495584_0012567
1333 Ga0495584_0033562
1334 Ga0495584_0052008
1335 Ga0495585_0000124
1336 Ga0495585_0000581
1337 Ga0495585_0001763
1338 Ga0495585_0002723
1339 Ga0495585_0005945
1340 Ga0495585_0011083
1341 Ga0495585_0012080
1342 Ga0495585_0019325
1343 Ga0495585_0019756
1344 Ga0495585_0061378
1345 Ga0495594_0002774
1346 Ga0495594_0005166
1347 Ga0495594_0013928
1348 Ga0495594_0065612
1349 Ga0495596_0000014
1350 Ga0495596_0017459
1351 Ga0495607_0000014
1352 Ga0495607_0000575
1353 Ga0495607_0002301
1354 Ga0495607_0002457
1355 Ga0495607_0003228
1356 Ga0495607_0004200
1357 Ga0495607_0004809
1358 Ga0495607_0005102
1359 Ga0495607_0007112
1360 Ga0495607_0007458
1361 Ga0495607_0013226
1362 Ga0495607_0015525
1363 Ga0495607_0022955
1364 Ga0495607_0035320
1365 Ga0495607_0057886
1366 Ga0495607_0061043
1367 Ga0495583_0000283
1368 Ga0495583_0001409
1369 Ga0495583_0002906
1370 Ga0495583_0003128
1371 Ga0495583_0011563
1372 Ga0495583_0014447
1373 Ga0495583_0015939
1374 Ga0495606_0000508
1375 Ga0495606_0001003
1376 Ga0495606_0003198
1377 Ga0495606_0003510
1378 Ga0495606_0007251
1379 Ga0495606_0009606
1380 Ga0495606_0023792
1381 Ga0495606_0028570
1382 Ga0495606_0031522
1383 Ga0495606_0033671
1384 Ga0495606_0047199
1385 Ga0495606_0084789
1386 Ga0495610_0000143
1387 Ga0495610_0001762
1388 Ga0495610_0002906
1389 Ga0495610_0006950
1390 Ga0495610_0011661
1391 Ga0495610_0013584
1392 Ga0495610_0015991
1393 Ga0495610_0017194
1394 Ga0495610_0034611
1395 Ga0495610_0038006
1396 Ga0495610_0058676
1397 Ga0495610_0071069
1398 Ga0495610_0097298
1399 Ga0495616_0001207
1400 Ga0495616_0002614
1401 Ga0495616_0003642
1402 Ga0495616_0003841
1403 Ga0495616_0006614
1404 Ga0495616_0007845
1405 Ga0495616_0009899
1406 Ga0495616_0023433
1407 Ga0495616_0026244
1408 Ga0495616_0047436
1409 Ga0495620_0000137
1410 Ga0495620_0000821
1411 Ga0495620_0002752
1412 Ga0495620_0003278
1413 Ga0495620_0004732
1414 Ga0495620_0007616
1415 Ga0495620_0012237
1416 Ga0495620_0017251
1417 Ga0495620_0055877
1418 Ga0495628_0069275
1419 Ga0495630_0011572
1420 Ga0495631_0000549
1421 Ga0495631_0005780
1422 Ga0495631_0009697
1423 Ga0495631_0013894
1424 Ga0495631_0027458
1425 Ga0495631_0036244
1426 Ga0495631_0053730
1427 Ga0495632_0000343
1428 Ga0495632_0000424
1429 Ga0495632_0001203
1430 Ga0495632_0001891
1431 Ga0495632_0004152
1432 Ga0495632_0004771
1433 Ga0495632_0011200
1434 Ga0495632_0012377
1435 Ga0495632_0013467
1436 Ga0495632_0016829
1437 Ga0495632_0057298
1438 Ga0495637_0001107
1439 Ga0495637_0001358
1440 Ga0495637_0001433
1441 Ga0495637_0002336
1442 Ga0495637_0002746
1443 Ga0495637_0003626
1444 Ga0495637_0007030
1445 Ga0495637_0008349
1446 Ga0495637_0012988
1447 Ga0495637_0015660
1448 Ga0495637_0017417
1449 Ga0495637_0018945
1450 Ga0495637_0025447
1451 Ga0495637_0028380
1452 Ga0495637_0032251
1453 Ga0495637_0035951
1454 Ga0495643_0005784
1455 Ga0495643_0010944
1456 Ga0495643_0012619
1457 Ga0495643_0028326
1458 Ga0495643_0030954
1459 Ga0495643_0083795
1460 Ga0495644_0000462
1461 Ga0495644_0000922
1462 Ga0495644_0004200
1463 Ga0495644_0006368
1464 Ga0495644_0019354
1465 Ga0495644_0060544
1466 Ga0495648_0003483
1467 Ga0495648_0003589
1468 Ga0495648_0006435
1469 Ga0495648_0010044
1470 Ga0495648_0011482
1471 Ga0495648_0012334
1472 Ga0495648_0012644
1473 Ga0495648_0031337
1474 Ga0495648_0043924
1475 Ga0495648_0046995
1476 Ga0495666_0000655
1477 Ga0495666_0020763
1478 Ga0495642_0000479
1479 Ga0495642_0000918
1480 Ga0495642_0001912
1481 Ga0495654_0000461
1482 Ga0495654_0000968
1483 Ga0495654_0000998
1484 Ga0495654_0001138
1485 Ga0495654_0002727
1486 Ga0495654_0002967
1487 Ga0495654_0005013
1488 Ga0495654_0010285
1489 Ga0495654_0014876
1490 Ga0495654_0020910
1491 Ga0495654_0023729
1492 Ga0495654_0028323
1493 Ga0495654_0032437
1494 Ga0495654_0037453
1495 Ga0495654_0054186
1496 Ga0495654_0069695
1497 Ga0495654_0070423
1498 Ga0495587_0113083
1499 Ga0495609_0000222
1500 Ga0495609_0000534
1501 Ga0495609_0002790
1502 Ga0495609_0012717
1503 Ga0495609_0017034
1504 Ga0495609_0063214
1505 Ga0495609_0071714
1506 Ga0495609_0076608
1507 Ga0495597_0003745
1508 Ga0495597_0004251
1509 Ga0495597_0008255
1510 Ga0495597_0012456
1511 Ga0495597_0014295
1512 Ga0495597_0024067
1513 Ga0495597_0025445
1514 Ga0495597_0051033
1515 Ga0495597_0059360
1516 Ga0495597_0061770
1517 Ga0495645_0036187
1518 Ga0495622_0000070
1519 Ga0495622_0003221
1520 Ga0495622_0005941
1521 Ga0495622_0019825
1522 Ga0495622_0047678
1523 Ga0495622_0050602
1524 Ga0495633_0005332
1525 Ga0495633_0010062
1526 Ga0495656_0082405
1527 Ga0495668_0002243
1528 Ga0495668_0002296
1529 Ga0495668_0008915
1530 Ga0495634_0002704
1531 Ga0495611_0000279
1532 Ga0495611_0003070
1533 Ga0495611_0004084
1534 Ga0495611_0030037
1535 Ga0495625_0003800
1536 Ga0495625_0006173
1537 Ga0495625_0015419
1538 Ga0495625_0025708
1539 Ga0495625_0027633
1540 Ga0495625_0051136
1541 Ga0495625_0055990
1542 Ga0495625_0067149
1543 Ga0495625_0119647
1544 Ga0495625_0150703
1545 Ga0495635_0001198
1546 Ga0495659_0000305
1547 Ga0495659_0003767
1548 Ga0495659_0008860
1549 Ga0495661_0000116
1550 Ga0495661_0000501
1551 Ga0495661_0002639
1552 Ga0495661_0006788
1553 Ga0495661_0018225
1554 Ga0495661_0018542
1555 Ga0495661_0020589
1556 Ga0495661_0021497
1557 Ga0495661_0036388
1558 Ga0495661_0081584
1559 Ga0495661_0084568
1560 Ga0495661_0116845
1561 Ga0495661_0122528
1562 Ga0495661_0124791
1563 Ga0495588_0007522
1564 Ga0495588_0030856
1565 Ga0495623_0003673
1566 Ga0495623_0005137
1567 Ga0495646_0058620
1568 Ga0495669_0023467
1569 Ga0495613_0021198
1570 Ga0495613_0059247
1571 Ga0495613_0088248
1572 Ga0495624_0001306
1573 Ga0495624_0038574
1574 Ga0495670_0000341
1575 Ga0495670_0000788
1576 Ga0495670_0002069
1577 Ga0495670_0002573
1578 Ga0495670_0010332
1579 Ga0495670_0012726
1580 Ga0495670_0013384
1581 Ga0495670_0093923
1582 Ga0495670_0094839
1583 Ga0495671_0000397
1584 Ga0495671_0002310
1585 Ga0495671_0006217
1586 Ga0495671_0006266
1587 Ga0495671_0007157
1588 Ga0495671_0011310
1589 Ga0495671_0012858
1590 Ga0495671_0016732
1591 Ga0495671_0035923
1592 Ga0495671_0044049
1593 Ga0495649_0000104
1594 Ga0495649_0001289
1595 Ga0495649_0002799
1596 Ga0495649_0006751
1597 Ga0495649_0007473
1598 Ga0495649_0008877
1599 Ga0495649_0012100
1600 Ga0495649_0012430
1601 Ga0495649_0016024
1602 Ga0495649_0017986
1603 Ga0495649_0023960
1604 Ga0495649_0160156
1605 Ga0495589_0002546
1606 Ga0495589_0007918
1607 Ga0495589_0008025
1608 Ga0495589_0008427
1609 Ga0495589_0009776
1610 Ga0495589_0011638
1611 Ga0495589_0013865
1612 Ga0495589_0019208
1613 Ga0495589_0021297
1614 Ga0495600_0020119
1615 Ga0495660_0001225
1616 Ga0495660_0003166
1617 Ga0495660_0005235
1618 Ga0495660_0006799
1619 Ga0495660_0007040
1620 Ga0495660_0010097
1621 Ga0495660_0010374
1622 Ga0495660_0010525
1623 Ga0495660_0015419
1624 Ga0495660_0018142
1625 Ga0495660_0023450
1626 Ga0495660_0041413
1627 Ga0495660_0046397
1628 Ga0495660_0062832
1629 Ga0495660_0067238
1630 Ga0495660_0070263
1631 Ga0495581_0003578
1632 Ga0495604_0002652
1633 Ga0495604_0013567
1634 Ga0495604_0076280
1635 Ga0495636_0005637
1636 Ga0495636_0059735
1637 Ga0495674_0046201
1638 Ga0495672_0000331
1639 Ga0495672_0002113
1640 Ga0495672_0003018
1641 Ga0495672_0004451
1642 Ga0495672_0007558
1643 Ga0495672_0012721
1644 Ga0495672_0019327
1645 Ga0495672_0031812
1646 Ga0495672_0048335
1647 Ga0495672_0066852
1648 Ga0495672_0094122
1649 Ga0495676_0001611
1650 Ga0495676_0012710
1651 Ga0495676_0034799
1652 Ga0495680_0032117
1653 Ga0495680_0077959
1654 Ga0495683_0000185
1655 Ga0495683_0000920
1656 Ga0495683_0001071
1657 Ga0495683_0001701
1658 Ga0495683_0002732
1659 Ga0495683_0018033
1660 Ga0495683_0030608
1661 Ga0495683_0051323
1662 Ga0495683_0064014
1663 Ga0495683_0071177
1664 Ga0495687_001896
1665 Ga0495687_002012
1666 Ga0495687_003051
1667 Ga0495687_003319
1668 Ga0495675_0085201
1669 Ga0495677_0002044
1670 Ga0495679_000727
1671 Ga0495679_000875
1672 Ga0495679_001754
1673 Ga0495679_002192
1674 Ga0495679_003911
1675 Ga0495679_004726
1676 Ga0495679_008670
1677 Ga0495679_023295
1678 Ga0495685_025982
1679 Ga0495673_0001043
1680 Ga0495673_0001505
1681 Ga0495673_0002263
1682 Ga0495673_0002289
1683 Ga0495673_0003406
1684 Ga0495673_0004020
1685 Ga0495673_0004197
1686 Ga0495673_0004554
1687 Ga0495673_0005403
1688 Ga0495673_0005775
1689 Ga0495673_0009682
1690 Ga0495673_0014932
1691 Ga0495673_0022317
1692 Ga0495673_0029359
1693 Ga0495673_0035676
1694 Ga0495673_0048213
1695 Ga0495681_0000399
1696 Ga0495681_0000804
1697 Ga0495681_0001014
1698 Ga0495681_0002079
1699 Ga0495681_0003785
1700 Ga0495681_0005868
1701 Ga0495681_0007243
1702 Ga0495681_0009471
1703 Ga0495681_0011105
1704 Ga0495681_0017614
1705 Ga0495681_0019031
1706 Ga0495681_0032446
1707 Ga0495681_0033687
1708 Ga0495681_0035989
1709 Ga0495681_0069668
1710 Ga0495684_0029668
1711 Ga0495684_0101291
1712 Ga0495686_0003471
1713 Ga0495686_0008020
1714 Ga0495686_0009315
1715 Ga0495686_0018000
1716 Ga0495686_0029995
1717 Ga0495593_0007442
1718 Ga0495593_0008928
1719 Ga0495602_0002686
1720 Ga0495626_0000203
1721 Ga0495626_0000456
1722 Ga0495626_0001599
1723 Ga0495626_0001772
1724 Ga0495626_0002511
1725 Ga0495626_0003174
1726 Ga0495626_0006388
1727 Ga0495626_0008350
1728 Ga0495626_0014487
1729 Ga0495626_0027701
1730 Ga0495626_0048175
1731 Ga0496102_0001019
1732 Ga0496103_0005170
1733 Ga0496105_0078700
1734 Ga0496106_0075915
1735 Ga0496107_0143940
1736 Ga0496113_0102919
1737 Ga0496116_0001790
1738 Ga0496116_0001797
1739 Ga0496116_0003072
1740 Ga0496116_0003590
1741 Ga0496117_0000720
1742 Ga0496117_0006016
1743 Ga0496117_0015516
1744 Ga0496117_0023681
1745 Ga0496117_0070727
1746 Ga0496118_0008420
1747 Ga0496118_0008627
1748 Ga0496118_0009584
1749 Ga0496118_0016534
1750 Ga0496118_0017192
1751 Ga0496118_0022489
1752 Ga0496118_0094905
1753 Ga0496119_0016404
1754 Ga0496120_0007042
1755 Ga0496120_0015856
1756 Ga0496120_0033702
1757 Ga0496120_0050548
1758 Ga0496121_0013896
1759 Ga0496121_0022233
1760 Ga0496121_0032478
1761 Ga0496121_0071912
1762 Ga0496122_0004285
1763 Ga0496122_0011812
1764 Ga0496122_0018619
1765 Ga0496122_0052361
1766 Ga0496122_0062736
1767 Ga0496123_0003416
1768 Ga0496123_0011560
1769 Ga0496123_0014910
1770 Ga0496124_0000816
1771 Ga0496124_0006096
1772 Ga0496124_0010907
1773 Ga0496124_0027067
1774 Ga0496124_0052203
1775 Ga0496124_0167582
1776 Ga0496125_0000822
1777 Ga0496125_0003780
1778 Ga0496125_0004344
1779 Ga0496125_0008974
1780 Ga0496125_0033195
1781 Ga0496125_0036046
1782 Ga0496125_0038878
1783 Ga0496125_0050653
1784 Ga0496125_0057874
1785 Ga0496125_0058225
1786 Ga0496126_0005995
1787 Ga0496126_0007640
1788 Ga0495678_002361
1789 Ga0495678_003607
1790 Ga0495678_004892
1791 Ga0495678_005865
1792 Ga0495678_008259
1793 Ga0495678_008485
1794 Ga0495678_010183
1795 Ga0495678_013970
1796 Ga0495678_022851
1797 Ga0495678_025920
1798 Ga0495678_026257
1799 Ga0495678_035309
1800 Ga0495682_0000905
1801 Ga0495682_0002057
1802 Ga0495682_0005159
1803 Ga0495682_0020833
1804 Ga0495682_0025014
1805 Ga0501042_0174739
1806 Ga0501073_0019911
1807 Ga0501222_000598
1808 Ga0500572_001735
1809 Ga0500618_002697
1810 2511272345
1811 2511280800
1812 2511291575
1813 2511295820
1814 2511299046
1815 2511312357
1816 2511335087
1817 2511337137
1818 2511344711
1819 2511352917
1820 2511357550
1821 2511367663
1822 2511413878
1823 2511824688
1824 2597863815
1825 2597869964
1826 2599330281
1827 2599398228
1828 2599450238
1829 2599500668
1830 2599510411
1831 2599516085
1832 2599521186
1833 2599612906
1834 2599771778
1835 2599883605
1836 2599889144
1837 2599895616
1838 2599901198
1839 2599932331
1840 2599943502
1841 2599950367
1842 2599954613
1843 2599962302
1844 2599968092
1845 2599977117
1846 2599985168
1847 2599988582
1848 2599993417
1849 2600002893
1850 2600008203
1851 2600011155
1852 2600016190
1853 2600022000
1854 2600028486
1855 2600038027
1856 2600044368
1857 2600049841
1858 2600051396
1859 2600060013
1860 2600063235
1861 2600070538
1862 2600075274
1863 2600357653
1864 2601691771
1865 2601799226
1866 2606078126
1867 2606125997
1868 2621299460
1869 2624480664
1870 2624492435
1871 2643844507
1872 2643869899
1873 2643954365
1874 2644023174
1875 2644185302
1876 2644283683
1877 2644621131
1878 2652546928
1879 2671094278
1880 2671126347
1881 2677896325
1882 2678262050
1883 2715753236
1884 2715756624
1885 2723248601
1886 2738747868
1887 2738810741
1888 2738856911
1889 2738898101
1890 2739199494
1891 2739257239
1892 2739311859
1893 2745008398
1894 2774133919
1895 2784264313
1896 2794597200
1897 2808922190
1898 2808929608
1899 2808933641
1900 2808944827
1901 2808951813
1902 2808959486
1903 2808962115
1904 2808980624
1905 2808996345
1906 2808997128
1907 2809214907
1908 2817490822
1909 2819659014
1910 2825651477
1911 2826586032
1912 2834029982
1913 2842819069
1914 2842826849
1915 2842834633
1916 2842839416
1917 2842843720
1918 2842853395
1919 2842859100
1920 2852614714
1921 2852657606
1922 2852667548
1923 2860344712
1924 2878032540
1925 2880233605
1926 2904520015
1927 2904550279
1928 2908449885
1929 2919065083
1930 2919387006
1931 2919458767
1932 2919487381
1933 2919492304
1934 2919698602
1935 2923588803
1936 2929147509
1937 2929192396
1938 2931394107
1939 2931402231
1940 2939638890
1941 2945933672
1942 2945963886
1943 2946010063
1944 2946031076
1945 2947237659
1946 2974290933
1947 2998142887
1948 3007422941
1949 3007514184
1950 3007614239
1951 3007621616
1952 3007719159
1953 3007856906
1954 3007869352
1955 8019778930
1956 8029997907
1957 8054288496
1958 8054348089
1959 8054506147
1960 8055820748
1961 8056128748
1962 8056134596
1963 8056145845
1964 8056154648
1965 8056165874
1966 8056168311
1967 8056178327
1968 8056574390

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07995

GSDH

Glucose / Sorbosone dehydrogenase

75

408

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cgz-assembly1.cif.gz_A glucose dehydrogenase 0.962 38 382
7cgz-assembly1.cif.gz_A glucose dehydrogenase 0.9532 38 382
7cgz-assembly1.cif.gz_B glucose dehydrogenase 0.9302 38 382
7cdy-assembly2.cif.gz_B crystal structure of glucose dehydrogenase 0.9221 38 382
7cgz-assembly1.cif.gz_B glucose dehydrogenase 0.9196 38 382
ID Description Score Start End Superfamily
af_P75804_19_370_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9109 34 382 2.120.10.30
af_P75804_19_370_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8984 34 382 2.120.10.30
3a9gA00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8731 36 382 2.120.10.30
3a9gA00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8583 36 382 2.120.10.30
2ismB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.841 36 380 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A7X7PHR3-F1-model_v4 PQQ-dependent sugar dehydrogenase 0.9903 296 378
AF-A0A421DSI4-F1-model_v4 Glucose/Sorbosone dehydrogenase domain-containing protein 0.9888 295 382
AF-C2BE23-F1-model_v4 Glucose/Sorbosone dehydrogenase 0.9795 296 371
AF-A0A377W8K7-F1-model_v4 Soluble aldose sugar dehydrogenase, PQQ-dependent (EC 1.1.5.-) 0.9794 45 115 GO:0016491
AF-A0A4Q3TAK4-F1-model_v4 PQQ-dependent sugar dehydrogenase 0.9721 296 382

Map