F487515

General Info

Members Datasets Scaffolds Average Seq Length
986 330 1972 244

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100296039|Ga0068855_1002960392
Length 277
Sequence MRRTSGEGPPRAASSAPLGGSEGAKPRAWGGHIPTARSLAFALFQMVVTPPYALMVLALFWLPSVPRYRFITGWCALNLWAARVFCGIRHRVVGLENVGGTPLIVACKHSSTWETLFLSRLLPPLAYVAKKELLSLPFFGWGFRLASPITIDRKAGQDAMSQIATQGRERFAQGFWIILYPEGTRIAPGRRVRYKTGTARLAIEMRTPILPIAHNAGWLWPKGVLGKQPGTITLSIGAPISPDGKDAGALMQAVESWIENEVARIGDPRTAAAAKPR

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
196 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
197 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
198 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
199 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
200 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
201 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
202 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
203 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
204 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
205 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
206 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
207 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
208 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
209 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
210 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
211 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
212 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
213 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
214 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
215 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
216 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
217 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
218 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
219 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
220 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
221 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
222 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
223 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
224 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
225 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
226 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
227 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
228 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
229 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
230 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
231 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
232 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
234 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
235 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
236 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
237 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
238 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
239 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
240 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
241 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
242 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
243 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
244 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
245 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
246 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
247 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
248 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
249 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
250 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
251 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
252 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
253 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
254 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
255 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
256 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
257 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
258 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
259 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
260 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
261 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
262 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
263 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
264 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
265 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
266 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
267 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
268 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
269 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
270 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
271 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
272 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
273 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
274 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
275 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
276 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
277 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
278 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
279 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
280 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
283 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
284 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
285 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
286 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
287 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
291 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
292 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
293 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
294 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
295 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
309 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
310 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
311 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
312 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
313 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
314 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
315 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
316 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
317 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
318 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
320 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
321 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
322 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
323 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
324 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
325 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
326 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
327 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
328 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
329 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
330 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.9
Metatranscriptomes 0.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.94
Rhizosphere 96.65
Stem 0
Stem Tuber 0
Unclassified 6.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100296039 3300005563 Bacteria 1793
2 JGI24752J21851_1006033 3300001976 Bacteria 1582
3 JGI24743J22301_10001883 3300001991 Bacteria 3037
4 JGI24749J21850_1001852 3300002076 Bacteria 2992
5 JGI24751J29686_10022522 3300002459 Bacteria 1307
6 Ga0065712_10092240 3300005290 Bacteria 2317
7 Ga0065715_10237003 3300005293 Bacteria 1213
8 Ga0070658_10004452 3300005327 Bacteria 11411
9 Ga0070658_10006154 3300005327 Bacteria 9730
10 Ga0070676_10001197 3300005328 Bacteria 13004
11 Ga0070676_10033042 3300005328 Bacteria 2967
12 Ga0070676_10047970 3300005328 Bacteria 2496
13 Ga0070676_10064021 3300005328 Bacteria 2191
14 Ga0070676_10223984 3300005328 Unclassified 1243
15 Ga0070676_10285233 3300005328 Unclassified 1114
16 Ga0070676_10332026 3300005328 Bacteria 1040
17 Ga0070683_100002408 3300005329 Bacteria 14856
18 Ga0070683_100020433 3300005329 Bacteria 5894
19 Ga0070683_100024406 3300005329 Bacteria 5416
20 Ga0070683_100024882 3300005329 Bacteria 5368
21 Ga0070690_100058565 3300005330 Bacteria 2474
22 Ga0070690_100288987 3300005330 Unclassified 1172
23 Ga0070670_100020034 3300005331 Bacteria 5745
24 Ga0070670_100032907 3300005331 Bacteria 4467
25 Ga0070670_100053699 3300005331 Bacteria 3460
26 Ga0070670_100132811 3300005331 Bacteria 2150
27 Ga0070670_100177497 3300005331 Bacteria 1849
28 Ga0070670_100182946 3300005331 Bacteria 1820
29 Ga0070670_100310215 3300005331 Bacteria 1381
30 Ga0070670_100566236 3300005331 Bacteria 1015
31 Ga0070677_10057732 3300005333 Unclassified 1591
32 Ga0070677_10262860 3300005333 Unclassified 862
33 Ga0070677_10346177 3300005333 Bacteria 769
34 Ga0068869_100000199 3300005334 Bacteria 31215
35 Ga0068869_100000776 3300005334 Bacteria 18193
36 Ga0068869_100264647 3300005334 Bacteria 1377
37 Ga0068869_100281331 3300005334 Bacteria 1338
38 Ga0070666_10003158 3300005335 Bacteria 10010
39 Ga0070666_10032813 3300005335 Bacteria 3432
40 Ga0070666_10139574 3300005335 Bacteria 1688
41 Ga0070666_10168433 3300005335 Bacteria 1533
42 Ga0070666_10492773 3300005335 Bacteria 888
43 Ga0070666_10556463 3300005335 Bacteria 834
44 Ga0070680_100012090 3300005336 Bacteria 6703
45 Ga0070680_100050473 3300005336 Bacteria 3393
46 Ga0070680_100189996 3300005336 Bacteria 1730
47 Ga0070682_100043255 3300005337 Bacteria 2785
48 Ga0070682_100122983 3300005337 Bacteria 1745
49 Ga0070682_100175056 3300005337 Bacteria 1494
50 Ga0068868_100002649 3300005338 Bacteria 12425
51 Ga0068868_100076836 3300005338 Bacteria 2670
52 Ga0068868_100110283 3300005338 Bacteria 2235
53 Ga0068868_100139218 3300005338 Bacteria 1991
54 Ga0068868_100218418 3300005338 Bacteria 1595
55 Ga0068868_100836361 3300005338 Unclassified 833
56 Ga0070660_100001621 3300005339 Bacteria 15476
57 Ga0070660_100009419 3300005339 Bacteria 6868
58 Ga0070660_100016519 3300005339 Bacteria 5358
59 Ga0070660_100018731 3300005339 Bacteria 5064
60 Ga0070660_100026042 3300005339 Bacteria 4353
61 Ga0070660_100050014 3300005339 Bacteria 3215
62 Ga0070689_100000623 3300005340 Bacteria 21418
63 Ga0070691_10071614 3300005341 Bacteria 1683
64 Ga0070687_100012546 3300005343 Bacteria 3745
65 Ga0070687_100063777 3300005343 Bacteria 1955
66 Ga0070661_100007665 3300005344 Bacteria 7452
67 Ga0070661_100010082 3300005344 Bacteria 6561
68 Ga0070661_100011350 3300005344 Bacteria 6207
69 Ga0070661_100012934 3300005344 Bacteria 5847
70 Ga0070661_100077891 3300005344 Bacteria 2445
71 Ga0070661_100275213 3300005344 Bacteria 1305
72 Ga0070661_100299209 3300005344 Bacteria 1252
73 Ga0070661_100316732 3300005344 Bacteria 1217
74 Ga0070661_100393516 3300005344 Bacteria 1094
75 Ga0070692_10061027 3300005345 Bacteria 1986
76 Ga0070692_10090607 3300005345 Bacteria 1662
77 Ga0070668_100002104 3300005347 Bacteria 14563
78 Ga0070668_100005829 3300005347 Bacteria 9137
79 Ga0070668_100010371 3300005347 Bacteria 6920
80 Ga0070668_100023287 3300005347 Bacteria 4683
81 Ga0070668_100061111 3300005347 Bacteria 2919
82 Ga0070668_100100500 3300005347 Bacteria 2291
83 Ga0070668_100296651 3300005347 Bacteria 1354
84 Ga0070668_100765642 3300005347 Bacteria 855
85 Ga0070669_100002169 3300005353 Bacteria 14191
86 Ga0070669_100002258 3300005353 Bacteria 13981
87 Ga0070669_100064722 3300005353 Bacteria 2693
88 Ga0070669_100075441 3300005353 Bacteria 2501
89 Ga0070669_100089295 3300005353 Bacteria 2308
90 Ga0070669_100101684 3300005353 Bacteria 2169
91 Ga0070669_100515970 3300005353 Bacteria 993
92 Ga0070675_100003509 3300005354 Bacteria 11892
93 Ga0070675_100011661 3300005354 Bacteria 6887
94 Ga0070675_100060194 3300005354 Bacteria 3135
95 Ga0070675_100089804 3300005354 Bacteria 2573
96 Ga0070675_100126616 3300005354 Bacteria 2174
97 Ga0070671_100001072 3300005355 Bacteria 20211
98 Ga0070671_100006008 3300005355 Bacteria 9676
99 Ga0070671_100037330 3300005355 Bacteria 4028
100 Ga0070671_100100137 3300005355 Bacteria 2431
101 Ga0070671_100101763 3300005355 Bacteria 2411
102 Ga0070674_100110323 3300005356 Bacteria 2019
103 Ga0070674_100255380 3300005356 Bacteria 1378
104 Ga0070674_100615347 3300005356 Unclassified 919
105 Ga0070673_100019641 3300005364 Bacteria 4854
106 Ga0070673_100022157 3300005364 Bacteria 4619
107 Ga0070673_100049037 3300005364 Bacteria 3295
108 Ga0070673_100240636 3300005364 Bacteria 1573
109 Ga0070688_100001240 3300005365 Bacteria 12734
110 Ga0070688_100036154 3300005365 Bacteria 3003
111 Ga0070688_100078314 3300005365 Bacteria 2132
112 Ga0070659_100001948 3300005366 Bacteria 14740
113 Ga0070659_100007538 3300005366 Bacteria 7909
114 Ga0070659_100008028 3300005366 Bacteria 7695
115 Ga0070659_100008879 3300005366 Bacteria 7365
116 Ga0070659_100196217 3300005366 Bacteria 1660
117 Ga0070659_100503161 3300005366 Bacteria 1033
118 Ga0070667_100005673 3300005367 Bacteria 10427
119 Ga0070667_100059071 3300005367 Bacteria 3243
120 Ga0070667_100059399 3300005367 Bacteria 3235
121 Ga0070667_100083166 3300005367 Bacteria 2742
122 Ga0070667_100154007 3300005367 Bacteria 2021
123 Ga0070667_100532705 3300005367 Bacteria 1078
124 Ga0070703_10008093 3300005406 Bacteria 2955
125 Ga0070709_10261415 3300005434 Bacteria 1250
126 Ga0070709_10311641 3300005434 Bacteria 1152
127 Ga0070714_100006871 3300005435 Bacteria 8821
128 Ga0070714_100009695 3300005435 Bacteria 7583
129 Ga0070714_100027289 3300005435 Bacteria 4728
130 Ga0070714_100174009 3300005435 Bacteria 1955
131 Ga0070714_100343906 3300005435 Bacteria 1400
132 Ga0070713_100000120 3300005436 Bacteria 50691
133 Ga0070713_100009471 3300005436 Bacteria 6977
134 Ga0070713_100323888 3300005436 Bacteria 1424
135 Ga0070713_100440056 3300005436 Bacteria 1223
136 Ga0070710_10001425 3300005437 Bacteria 11281
137 Ga0070710_10023698 3300005437 Bacteria 3229
138 Ga0070701_10008499 3300005438 Bacteria 4444
139 Ga0070701_10026865 3300005438 Bacteria 2813
140 Ga0070711_100017274 3300005439 Bacteria 4592
141 Ga0070705_100035543 3300005440 Bacteria 2794
142 Ga0070700_100337772 3300005441 Bacteria 1112
143 Ga0070694_100040265 3300005444 Bacteria 3114
144 Ga0070694_100048399 3300005444 Bacteria 2860
145 Ga0070694_100131133 3300005444 Bacteria 1811
146 Ga0070708_100005348 3300005445 Bacteria 10185
147 Ga0070708_100026316 3300005445 Bacteria 4978
148 Ga0070708_100175979 3300005445 Bacteria 1999
149 Ga0070708_100211934 3300005445 Bacteria 1815
150 Ga0070708_100431046 3300005445 Bacteria 1243
151 Ga0070663_100004086 3300005455 Bacteria 8531
152 Ga0070663_100093735 3300005455 Bacteria 2228
153 Ga0070663_100157225 3300005455 Bacteria 1747
154 Ga0070663_100346465 3300005455 Bacteria 1202
155 Ga0070678_100001644 3300005456 Bacteria 11975
156 Ga0070678_100037134 3300005456 Bacteria 3417
157 Ga0070678_100145262 3300005456 Unclassified 1903
158 Ga0070678_100214312 3300005456 Bacteria 1597
159 Ga0070678_100216028 3300005456 Unclassified 1591
160 Ga0070662_100036215 3300005457 Bacteria 3489
161 Ga0070662_100171676 3300005457 Bacteria 1703
162 Ga0070662_100362494 3300005457 Bacteria 1190
163 Ga0070681_10004785 3300005458 Bacteria 12971
164 Ga0070681_10006592 3300005458 Bacteria 11309
165 Ga0070681_10026874 3300005458 Bacteria 5787
166 Ga0070681_10062539 3300005458 Bacteria 3696
167 Ga0070681_10230927 3300005458 Bacteria 1765
168 Ga0070681_10482901 3300005458 Bacteria 1152
169 Ga0068867_100000670 3300005459 Bacteria 22720
170 Ga0068867_100022459 3300005459 Bacteria 4512
171 Ga0068867_100171325 3300005459 Bacteria 1719
172 Ga0070685_10007999 3300005466 Bacteria 5420
173 Ga0070685_10065521 3300005466 Bacteria 2138
174 Ga0070706_100008057 3300005467 Bacteria 9828
175 Ga0070706_100294635 3300005467 Bacteria 1514
176 Ga0070706_100496701 3300005467 Unclassified 1135
177 Ga0070707_100259393 3300005468 Bacteria 1691
178 Ga0070707_100390003 3300005468 Bacteria 1352
179 Ga0070698_100012043 3300005471 Bacteria 9170
180 Ga0070698_100374987 3300005471 Bacteria 1355
181 Ga0070699_100003014 3300005518 Bacteria 14959
182 Ga0070699_100008370 3300005518 Bacteria 8962
183 Ga0070679_100009886 3300005530 Bacteria 9024
184 Ga0070679_100015755 3300005530 Bacteria 7272
185 Ga0070679_100020738 3300005530 Bacteria 6411
186 Ga0070679_100024507 3300005530 Bacteria 5912
187 Ga0070679_100350106 3300005530 Bacteria 1425
188 Ga0070684_100006799 3300005535 Bacteria 8869
189 Ga0070684_100035708 3300005535 Bacteria 4256
190 Ga0070684_100408464 3300005535 Unclassified 1252
191 Ga0070697_100015946 3300005536 Bacteria 5906
192 Ga0070697_100101712 3300005536 Bacteria 2388
193 Ga0070697_100546526 3300005536 Bacteria 1015
194 Ga0068853_100003272 3300005539 Bacteria 12389
195 Ga0068853_100010787 3300005539 Bacteria 7402
196 Ga0068853_100121300 3300005539 Bacteria 2332
197 Ga0068853_100134778 3300005539 Bacteria 2213
198 Ga0068853_100156993 3300005539 Bacteria 2050
199 Ga0068853_100226005 3300005539 Unclassified 1711
200 Ga0068853_100524160 3300005539 Bacteria 1120
201 Ga0070672_100000985 3300005543 Bacteria 17215
202 Ga0070672_100010190 3300005543 Bacteria 6510
203 Ga0070672_100019193 3300005543 Bacteria 4959
204 Ga0070672_100072442 3300005543 Bacteria 2743
205 Ga0070672_100102206 3300005543 Bacteria 2326
206 Ga0070672_100159552 3300005543 Bacteria 1870
207 Ga0070672_100298979 3300005543 Bacteria 1364
208 Ga0070672_100334813 3300005543 Unclassified 1288
209 Ga0070672_100697405 3300005543 Bacteria 889
210 Ga0070686_100021648 3300005544 Bacteria 3827
211 Ga0070686_100031524 3300005544 Bacteria 3242
212 Ga0070686_100111539 3300005544 Archaea 1864
213 Ga0070695_100015066 3300005545 Bacteria 4666
214 Ga0070696_100004421 3300005546 Bacteria 9381
215 Ga0070696_100017297 3300005546 Bacteria 4867
216 Ga0070693_100033342 3300005547 Bacteria 2842
217 Ga0070693_100107366 3300005547 Bacteria 1711
218 Ga0070693_100112194 3300005547 Bacteria 1679
219 Ga0070693_100181524 3300005547 Bacteria 1355
220 Ga0070665_100002349 3300005548 Bacteria 20939
221 Ga0070665_100006316 3300005548 Bacteria 12094
222 Ga0070665_100014604 3300005548 Bacteria 7881
223 Ga0070665_100015984 3300005548 Bacteria 7532
224 Ga0070665_100046509 3300005548 Bacteria 4359
225 Ga0070665_100332066 3300005548 Bacteria 1525
226 Ga0070665_100697983 3300005548 Unclassified 1028
227 Ga0070704_100008769 3300005549 Bacteria 6083
228 Ga0070704_100022812 3300005549 Bacteria 4077
229 Ga0070704_100152558 3300005549 Bacteria 1818
230 Ga0068855_100002371 3300005563 Bacteria 23222
231 Ga0068855_100064469 3300005563 Bacteria 4273
232 Ga0068855_100100539 3300005563 Bacteria 3329
233 Ga0068855_100182495 3300005563 Bacteria 2372
234 Ga0068855_100206390 3300005563 Bacteria 2210
235 Ga0068855_100335359 3300005563 Bacteria 1669
236 Ga0068855_100392361 3300005563 Bacteria 1522
237 Ga0070664_100001040 3300005564 Bacteria 21786
238 Ga0070664_100009004 3300005564 Bacteria 8097
239 Ga0070664_100053672 3300005564 Bacteria 3417
240 Ga0070664_100086200 3300005564 Bacteria 2713
241 Ga0070664_100089165 3300005564 Bacteria 2668
242 Ga0070664_100114495 3300005564 Bacteria 2356
243 Ga0070664_100173863 3300005564 Bacteria 1911
244 Ga0070664_100387582 3300005564 Bacteria 1276
245 Ga0070664_100402097 3300005564 Unclassified 1252
246 Ga0068857_100001304 3300005577 Bacteria 19593
247 Ga0068857_100018749 3300005577 Bacteria 6073
248 Ga0068857_100066783 3300005577 Bacteria 3201
249 Ga0068857_100081365 3300005577 Bacteria 2892
250 Ga0068854_100017927 3300005578 Bacteria 4745
251 Ga0068854_100030809 3300005578 Bacteria 3723
252 Ga0068854_100033701 3300005578 Bacteria 3571
253 Ga0068854_100066219 3300005578 Bacteria 2629
254 Ga0068854_100068983 3300005578 Bacteria 2580
255 Ga0068854_100131191 3300005578 Bacteria 1914
256 Ga0068856_100003525 3300005614 Bacteria 15776
257 Ga0068856_100012958 3300005614 Bacteria 8073
258 Ga0068856_100013681 3300005614 Bacteria 7845
259 Ga0068856_100019692 3300005614 Bacteria 6548
260 Ga0068856_100020036 3300005614 Bacteria 6493
261 Ga0068856_100069501 3300005614 Bacteria 3482
262 Ga0068856_100098881 3300005614 Bacteria 2908
263 Ga0068856_100650114 3300005614 Bacteria 1075
264 Ga0068852_100000687 3300005616 Bacteria 22156
265 Ga0068852_100004752 3300005616 Bacteria 9644
266 Ga0068852_100007723 3300005616 Bacteria 7866
267 Ga0068852_100029203 3300005616 Bacteria 4526
268 Ga0068852_100073424 3300005616 Bacteria 3009
269 Ga0068852_100087042 3300005616 Bacteria 2786
270 Ga0068852_100090567 3300005616 Bacteria 2735
271 Ga0068852_100143012 3300005616 Bacteria 2216
272 Ga0068852_100227222 3300005616 Bacteria 1778
273 Ga0068852_100486615 3300005616 Bacteria 1227
274 Ga0068859_100044791 3300005617 Bacteria 4446
275 Ga0068859_100082349 3300005617 Bacteria 3261
276 Ga0068859_100127347 3300005617 Bacteria 2616
277 Ga0068859_100604339 3300005617 Bacteria 1190
278 Ga0068864_100001373 3300005618 Bacteria 20167
279 Ga0068864_100004332 3300005618 Bacteria 11654
280 Ga0068864_100014871 3300005618 Bacteria 6466
281 Ga0068864_100020339 3300005618 Bacteria 5553
282 Ga0068864_100085595 3300005618 Bacteria 2772
283 Ga0068864_100138210 3300005618 Bacteria 2195
284 Ga0068864_100539152 3300005618 Bacteria 1127
285 Ga0068866_10043391 3300005718 Bacteria 2244
286 Ga0068861_100052359 3300005719 Bacteria 3102
287 Ga0068861_100078865 3300005719 Bacteria 2573
288 Ga0068861_100326598 3300005719 Bacteria 1338
289 Ga0068861_100414380 3300005719 Bacteria 1199
290 Ga0068861_100635656 3300005719 Unclassified 984
291 Ga0068851_10000904 3300005834 Bacteria 12785
292 Ga0068851_10011639 3300005834 Bacteria 4129
293 Ga0068851_10018593 3300005834 Bacteria 3349
294 Ga0068851_10103539 3300005834 Bacteria 1512
295 Ga0068851_10154102 3300005834 Bacteria 1258
296 Ga0068851_10319521 3300005834 Unclassified 897
297 Ga0068870_10034193 3300005840 Bacteria 2600
298 Ga0068870_10209939 3300005840 Bacteria 1185
299 Ga0068863_100008119 3300005841 Bacteria 10247
300 Ga0068863_100009830 3300005841 Bacteria 9320
301 Ga0068863_100017008 3300005841 Bacteria 6974
302 Ga0068863_100257670 3300005841 Bacteria 1686
303 Ga0068863_100269900 3300005841 Bacteria 1647
304 Ga0068863_100439159 3300005841 Bacteria 1280
305 Ga0068863_100689356 3300005841 Unclassified 1015
306 Ga0068858_100009529 3300005842 Bacteria 9263
307 Ga0068858_100029457 3300005842 Bacteria 5098
308 Ga0068858_100038576 3300005842 Bacteria 4431
309 Ga0068858_100068830 3300005842 Bacteria 3281
310 Ga0068858_100076253 3300005842 Bacteria 3114
311 Ga0068858_100080382 3300005842 Bacteria 3029
312 Ga0068860_100002515 3300005843 Bacteria 19231
313 Ga0068860_100002776 3300005843 Bacteria 18207
314 Ga0068860_100124048 3300005843 Bacteria 2475
315 Ga0068862_100011879 3300005844 Bacteria 7190
316 Ga0068862_100026536 3300005844 Bacteria 4869
317 Ga0068862_100026621 3300005844 Bacteria 4861
318 Ga0068862_100079711 3300005844 Bacteria 2839
319 Ga0068862_100086735 3300005844 Bacteria 2722
320 Ga0068862_100138338 3300005844 Bacteria 2160
321 Ga0068862_100533750 3300005844 Bacteria 1118
322 Ga0081539_10014444 3300005985 Bacteria 5840
323 Ga0070715_10008280 3300006163 Bacteria 3619
324 Ga0070716_100011496 3300006173 Bacteria 4458
325 Ga0070716_100023993 3300006173 Bacteria 3242
326 Ga0070712_100051501 3300006175 Bacteria 2868
327 Ga0097621_100001201 3300006237 Bacteria 17936
328 Ga0097621_100013378 3300006237 Bacteria 6116
329 Ga0097621_100093595 3300006237 Bacteria 2519
330 Ga0097621_100143553 3300006237 Bacteria 2042
331 Ga0068871_100001648 3300006358 Bacteria 15030
332 Ga0068871_100037828 3300006358 Bacteria 3851
333 Ga0068871_100080676 3300006358 Bacteria 2694
334 Ga0068871_100396058 3300006358 Bacteria 1229
335 Ga0068871_100399020 3300006358 Bacteria 1224
336 Ga0075428_100340044 3300006844 Bacteria 1612
337 Ga0075433_10023958 3300006852 Bacteria 5146
338 Ga0075434_100018896 3300006871 Bacteria 6662
339 Ga0075434_100039689 3300006871 Bacteria 4664
340 Ga0075434_100091390 3300006871 Bacteria 3046
341 Ga0075434_100776536 3300006871 Bacteria 975
342 Ga0068865_100003744 3300006881 Bacteria 9123
343 Ga0068865_100089689 3300006881 Bacteria 2227
344 Ga0068865_100107176 3300006881 Bacteria 2055
345 Ga0068865_100473601 3300006881 Bacteria 1039
346 Ga0075436_100121712 3300006914 Bacteria 1826
347 Ga0075436_100153719 3300006914 Unclassified 1620
348 Ga0097620_100044791 3300006931 Bacteria 4446
349 Ga0097620_100082350 3300006931 Bacteria 3261
350 Ga0097620_100127347 3300006931 Bacteria 2616
351 Ga0097620_100604317 3300006931 Bacteria 1190
352 Ga0075435_100099281 3300007076 Bacteria 2411
353 Ga0075435_100135458 3300007076 Bacteria 2063
354 Ga0075435_100218510 3300007076 Bacteria 1618
355 Ga0105240_10006424 3300009093 Bacteria 17278
356 Ga0105240_10036712 3300009093 Bacteria 6301
357 Ga0105240_10057669 3300009093 Bacteria 4850
358 Ga0105240_10159747 3300009093 Bacteria 2678
359 Ga0111539_10070880 3300009094 Bacteria 4114
360 Ga0111539_10474712 3300009094 Bacteria 1456
361 Ga0105245_10721266 3300009098 Unclassified 1031
362 Ga0114129_10445152 3300009147 Bacteria 1700
363 Ga0105243_10167984 3300009148 Bacteria 1898
364 Ga0105243_10299759 3300009148 Archaea 1456
365 Ga0105243_11010529 3300009148 Unclassified 835
366 Ga0105241_10001181 3300009174 Bacteria 19921
367 Ga0105241_10126243 3300009174 Bacteria 2066
368 Ga0105242_10026683 3300009176 Bacteria 4579
369 Ga0105242_10233037 3300009176 Bacteria 1651
370 Ga0105242_10571499 3300009176 Bacteria 1087
371 Ga0105242_10864703 3300009176 Bacteria 901
372 Ga0105248_10015845 3300009177 Bacteria 8308
373 Ga0105248_10023975 3300009177 Bacteria 6783
374 Ga0105248_10032084 3300009177 Bacteria 5870
375 Ga0105248_10107425 3300009177 Bacteria 3147
376 Ga0105248_10107486 3300009177 Bacteria 3146
377 Ga0105248_10245089 3300009177 Bacteria 2017
378 Ga0105248_10284841 3300009177 Bacteria 1860
379 Ga0105237_10043252 3300009545 Bacteria 4539
380 Ga0105237_10154452 3300009545 Bacteria 2292
381 Ga0105238_10007799 3300009551 Bacteria 10708
382 Ga0105238_10019814 3300009551 Bacteria 6847
383 Ga0105249_10076951 3300009553 Bacteria 3093
384 Ga0105249_10083816 3300009553 Bacteria 2968
385 Ga0105249_10239507 3300009553 Bacteria 1793
386 Ga0105239_10137616 3300010375 Bacteria 2719
387 Ga0105239_10417374 3300010375 Bacteria 1520
388 Ga0105239_10738467 3300010375 Bacteria 1126
389 Ga0105246_10322582 3300011119 Unclassified 1256
390 Ga0105246_10549214 3300011119 Unclassified 990
391 Ga0157373_10001581 3300013100 Bacteria 17385
392 Ga0157373_10009248 3300013100 Bacteria 7285
393 Ga0157373_10022994 3300013100 Bacteria 4520
394 Ga0157371_10003402 3300013102 Bacteria 14456
395 Ga0157371_10307534 3300013102 Bacteria 1148
396 Ga0157370_10004672 3300013104 Bacteria 15630
397 Ga0157370_10027164 3300013104 Bacteria 5644
398 Ga0157370_10054181 3300013104 Bacteria 3823
399 Ga0157370_10080342 3300013104 Bacteria 3070
400 Ga0157370_10097551 3300013104 Bacteria 2757
401 Ga0157370_10116948 3300013104 Bacteria 2491
402 Ga0157370_10331319 3300013104 Bacteria 1403
403 Ga0157369_10008340 3300013105 Bacteria 11880
404 Ga0157369_10023293 3300013105 Bacteria 6897
405 Ga0157369_10046744 3300013105 Bacteria 4704
406 Ga0157369_10202999 3300013105 Bacteria 2080
407 Ga0157369_10595204 3300013105 Unclassified 1142
408 Ga0157374_10003178 3300013296 Bacteria 13799
409 Ga0157374_10116541 3300013296 Bacteria 2574
410 Ga0157374_10452197 3300013296 Bacteria 1286
411 Ga0157374_10511328 3300013296 Bacteria 1206
412 Ga0157378_10023016 3300013297 Bacteria 5485
413 Ga0157378_10025852 3300013297 Bacteria 5172
414 Ga0157378_10144851 3300013297 Bacteria 2209
415 Ga0157378_10224977 3300013297 Bacteria 1785
416 Ga0157378_10374278 3300013297 Bacteria 1397
417 Ga0163162_10022029 3300013306 Bacteria 6278
418 Ga0163162_10089920 3300013306 Bacteria 3152
419 Ga0163162_10146575 3300013306 Bacteria 2477
420 Ga0163162_10149142 3300013306 Bacteria 2455
421 Ga0163162_10196571 3300013306 Bacteria 2146
422 Ga0163162_10763278 3300013306 Bacteria 1086
423 Ga0163162_10983699 3300013306 Unclassified 953
424 Ga0163162_11332764 3300013306 Bacteria 816
425 Ga0157372_10015616 3300013307 Bacteria 8142
426 Ga0157372_10020677 3300013307 Bacteria 7103
427 Ga0157372_10026105 3300013307 Bacteria 6356
428 Ga0157372_10026362 3300013307 Bacteria 6324
429 Ga0157372_10036039 3300013307 Bacteria 5450
430 Ga0157372_10064887 3300013307 Bacteria 4098
431 Ga0157372_10070621 3300013307 Bacteria 3930
432 Ga0157372_10071612 3300013307 Bacteria 3904
433 Ga0157372_10297896 3300013307 Bacteria 1876
434 Ga0157372_10372324 3300013307 Bacteria 1664
435 Ga0157372_10709423 3300013307 Bacteria 1170
436 Ga0157372_10782746 3300013307 Bacteria 1109
437 Ga0157372_11242145 3300013307 Bacteria 860
438 Ga0157375_10090520 3300013308 Bacteria 3118
439 Ga0157375_10143448 3300013308 Bacteria 2517
440 Ga0157375_10185380 3300013308 Bacteria 2234
441 Ga0157375_10216955 3300013308 Bacteria 2071
442 Ga0157375_10296040 3300013308 Bacteria 1781
443 Ga0157375_10381793 3300013308 Bacteria 1575
444 Ga0157375_10405890 3300013308 Bacteria 1529
445 Ga0157375_11000352 3300013308 Unclassified 976
446 Ga0157375_11318795 3300013308 Bacteria 849
447 Ga0163163_10001515 3300014325 Bacteria 19620
448 Ga0163163_10011621 3300014325 Bacteria 7998
449 Ga0163163_10037573 3300014325 Bacteria 4712
450 Ga0163163_10061218 3300014325 Bacteria 3729
451 Ga0163163_10243136 3300014325 Bacteria 1850
452 Ga0163163_10642525 3300014325 Unclassified 1124
453 Ga0157380_10027280 3300014326 Bacteria 4343
454 Ga0157380_10029785 3300014326 Bacteria 4175
455 Ga0157380_10321537 3300014326 Bacteria 1435
456 Ga0157380_10403647 3300014326 Bacteria 1297
457 Ga0182008_10041277 3300014497 Bacteria 2301
458 Ga0182008_10215062 3300014497 Bacteria 982
459 Ga0157377_10000355 3300014745 Bacteria 20417
460 Ga0157377_10118285 3300014745 Bacteria 1602
461 Ga0157379_10006002 3300014968 Bacteria 10471
462 Ga0157379_10013157 3300014968 Bacteria 7244
463 Ga0157379_10023517 3300014968 Bacteria 5470
464 Ga0157379_10045178 3300014968 Bacteria 3932
465 Ga0157379_10070794 3300014968 Bacteria 3121
466 Ga0157379_10181279 3300014968 Bacteria 1903
467 Ga0157379_10227926 3300014968 Bacteria 1689
468 Ga0157376_10020569 3300014969 Bacteria 5108
469 Ga0157376_10061046 3300014969 Bacteria 3168
470 Ga0163161_10066889 3300017792 Bacteria 2624
471 Ga0163161_10162254 3300017792 Bacteria 1704
472 Ga0163161_10336920 3300017792 Bacteria 1196
473 Ga0206353_11782120 3300020082 Bacteria 1828
474 Ga0207697_10000908 3300025315 Bacteria 16758
475 Ga0207697_10029436 3300025315 Bacteria 2247
476 Ga0207656_10003989 3300025321 Bacteria 5116
477 Ga0207656_10017292 3300025321 Bacteria 2822
478 Ga0207656_10045922 3300025321 Bacteria 1871
479 Ga0207682_10002549 3300025893 Bacteria 8131
480 Ga0207682_10004630 3300025893 Bacteria 5715
481 Ga0207682_10111096 3300025893 Unclassified 1207
482 Ga0207682_10133191 3300025893 Unclassified 1111
483 Ga0207692_10004781 3300025898 Bacteria 5383
484 Ga0207642_10023666 3300025899 Bacteria 2457
485 Ga0207642_10085814 3300025899 Bacteria 1541
486 Ga0207688_10003725 3300025901 Bacteria 8317
487 Ga0207688_10079373 3300025901 Bacteria 1872
488 Ga0207680_10100081 3300025903 Bacteria 1861
489 Ga0207680_10138904 3300025903 Bacteria 1609
490 Ga0207680_10414564 3300025903 Bacteria 953
491 Ga0207647_10047248 3300025904 Bacteria 2678
492 Ga0207699_10049743 3300025906 Bacteria 2468
493 Ga0207699_10082838 3300025906 Bacteria 1994
494 Ga0207699_10091217 3300025906 Bacteria 1913
495 Ga0207699_10457310 3300025906 Bacteria 917
496 Ga0207645_10000773 3300025907 Bacteria 26695
497 Ga0207645_10041830 3300025907 Bacteria 2932
498 Ga0207645_10060729 3300025907 Bacteria 2414
499 Ga0207645_10061574 3300025907 Bacteria 2397
500 Ga0207645_10137119 3300025907 Bacteria 1593
501 Ga0207645_10239647 3300025907 Bacteria 1198
502 Ga0207645_10310807 3300025907 Bacteria 1050
503 Ga0207643_10000257 3300025908 Bacteria 36775
504 Ga0207643_10009067 3300025908 Bacteria 5344
505 Ga0207684_10032486 3300025910 Bacteria 4438
506 Ga0207684_10037325 3300025910 Bacteria 4123
507 Ga0207684_10247884 3300025910 Bacteria 1537
508 Ga0207654_10041748 3300025911 Bacteria 2593
509 Ga0207654_10176320 3300025911 Bacteria 1392
510 Ga0207654_10447063 3300025911 Bacteria 906
511 Ga0207654_10477314 3300025911 Bacteria 878
512 Ga0207707_10006055 3300025912 Bacteria 10581
513 Ga0207707_10007043 3300025912 Bacteria 9803
514 Ga0207707_10028114 3300025912 Bacteria 4916
515 Ga0207707_10032528 3300025912 Bacteria 4565
516 Ga0207707_10079520 3300025912 Bacteria 2862
517 Ga0207707_10159730 3300025912 Bacteria 1971
518 Ga0207695_10009625 3300025913 Bacteria 11925
519 Ga0207695_10032886 3300025913 Bacteria 5670
520 Ga0207695_10063993 3300025913 Bacteria 3789
521 Ga0207671_10040511 3300025914 Bacteria 3449
522 Ga0207671_10118655 3300025914 Bacteria 2020
523 Ga0207693_10005151 3300025915 Bacteria 10946
524 Ga0207693_10035293 3300025915 Bacteria 3942
525 Ga0207693_10143909 3300025915 Bacteria 1875
526 Ga0207663_10064905 3300025916 Bacteria 2331
527 Ga0207663_10099105 3300025916 Bacteria 1953
528 Ga0207663_10375212 3300025916 Bacteria 1082
529 Ga0207660_10004060 3300025917 Bacteria 9552
530 Ga0207660_10123587 3300025917 Bacteria 1963
531 Ga0207660_10283989 3300025917 Bacteria 1314
532 Ga0207662_10010202 3300025918 Bacteria 5180
533 Ga0207662_10117666 3300025918 Bacteria 1663
534 Ga0207657_10001483 3300025919 Bacteria 25107
535 Ga0207657_10003925 3300025919 Bacteria 15787
536 Ga0207657_10005869 3300025919 Bacteria 12791
537 Ga0207657_10017917 3300025919 Bacteria 6776
538 Ga0207657_10025502 3300025919 Bacteria 5450
539 Ga0207657_10060304 3300025919 Bacteria 3256
540 Ga0207657_10212863 3300025919 Bacteria 1550
541 Ga0207657_10470372 3300025919 Bacteria 986
542 Ga0207649_10004328 3300025920 Bacteria 7714
543 Ga0207649_10007982 3300025920 Bacteria 5758
544 Ga0207649_10025382 3300025920 Bacteria 3454
545 Ga0207649_10025873 3300025920 Bacteria 3427
546 Ga0207649_10026992 3300025920 Bacteria 3365
547 Ga0207649_10072023 3300025920 Bacteria 2210
548 Ga0207652_10003655 3300025921 Bacteria 12659
549 Ga0207652_10011745 3300025921 Bacteria 7069
550 Ga0207652_10014269 3300025921 Bacteria 6434
551 Ga0207652_10024111 3300025921 Bacteria 5045
552 Ga0207652_10047312 3300025921 Bacteria 3674
553 Ga0207652_10051509 3300025921 Bacteria 3530
554 Ga0207652_10181620 3300025921 Bacteria 1891
555 Ga0207646_10218048 3300025922 Unclassified 1724
556 Ga0207646_10312377 3300025922 Bacteria 1420
557 Ga0207681_10014107 3300025923 Bacteria 4955
558 Ga0207681_10016908 3300025923 Bacteria 4574
559 Ga0207681_10058628 3300025923 Unclassified 2637
560 Ga0207681_10089693 3300025923 Bacteria 2192
561 Ga0207681_10119820 3300025923 Bacteria 1928
562 Ga0207681_10162871 3300025923 Unclassified 1683
563 Ga0207694_10002927 3300025924 Bacteria 13713
564 Ga0207694_10004091 3300025924 Bacteria 11466
565 Ga0207694_10350168 3300025924 Bacteria 1222
566 Ga0207650_10001671 3300025925 Bacteria 15758
567 Ga0207650_10005022 3300025925 Bacteria 9038
568 Ga0207650_10027863 3300025925 Bacteria 4046
569 Ga0207650_10034237 3300025925 Bacteria 3683
570 Ga0207650_10041524 3300025925 Bacteria 3371
571 Ga0207650_10096712 3300025925 Bacteria 2265
572 Ga0207650_10139740 3300025925 Bacteria 1903
573 Ga0207650_10198802 3300025925 Unclassified 1605
574 Ga0207659_10007146 3300025926 Bacteria 6853
575 Ga0207659_10007803 3300025926 Bacteria 6611
576 Ga0207659_10247843 3300025926 Bacteria 1444
577 Ga0207659_10338513 3300025926 Bacteria 1245
578 Ga0207659_10454530 3300025926 Bacteria 1079
579 Ga0207687_10091727 3300025927 Bacteria 2217
580 Ga0207700_10000110 3300025928 Bacteria 48839
581 Ga0207700_10005337 3300025928 Bacteria 7667
582 Ga0207700_10019463 3300025928 Bacteria 4586
583 Ga0207700_10293385 3300025928 Bacteria 1402
584 Ga0207664_10000325 3300025929 Bacteria 35400
585 Ga0207664_10003216 3300025929 Bacteria 10856
586 Ga0207664_10007382 3300025929 Bacteria 7620
587 Ga0207664_10014720 3300025929 Bacteria 5659
588 Ga0207644_10004560 3300025931 Bacteria 9005
589 Ga0207644_10004889 3300025931 Bacteria 8731
590 Ga0207644_10026800 3300025931 Bacteria 3976
591 Ga0207690_10010605 3300025932 Bacteria 5485
592 Ga0207690_10026620 3300025932 Bacteria 3643
593 Ga0207690_10042763 3300025932 Bacteria 2978
594 Ga0207706_10000775 3300025933 Bacteria 33144
595 Ga0207706_10011882 3300025933 Bacteria 7926
596 Ga0207706_10038551 3300025933 Bacteria 4239
597 Ga0207706_10050091 3300025933 Bacteria 3691
598 Ga0207706_10164154 3300025933 Bacteria 1952
599 Ga0207706_10267325 3300025933 Bacteria 1493
600 Ga0207686_10004238 3300025934 Bacteria 7684
601 Ga0207686_10110099 3300025934 Bacteria 1856
602 Ga0207709_10259268 3300025935 Bacteria 1274
603 Ga0207669_10095845 3300025937 Bacteria 1946
604 Ga0207669_10244883 3300025937 Bacteria 1331
605 Ga0207669_10263315 3300025937 Bacteria 1291
606 Ga0207704_10054998 3300025938 Unclassified 2430
607 Ga0207704_10055713 3300025938 Bacteria 2418
608 Ga0207704_10308378 3300025938 Bacteria 1216
609 Ga0207704_10339073 3300025938 Bacteria 1166
610 Ga0207665_10009663 3300025939 Bacteria 6337
611 Ga0207665_10739232 3300025939 Bacteria 775
612 Ga0207691_10001118 3300025940 Bacteria 26702
613 Ga0207691_10004281 3300025940 Bacteria 13864
614 Ga0207691_10017446 3300025940 Bacteria 6808
615 Ga0207691_10023823 3300025940 Bacteria 5762
616 Ga0207691_10031234 3300025940 Bacteria 4973
617 Ga0207691_10067528 3300025940 Bacteria 3233
618 Ga0207691_10074294 3300025940 Bacteria 3066
619 Ga0207691_10088432 3300025940 Bacteria 2778
620 Ga0207691_10133183 3300025940 Bacteria 2194
621 Ga0207691_10133358 3300025940 Bacteria 2192
622 Ga0207691_10449734 3300025940 Unclassified 1096
623 Ga0207711_10003922 3300025941 Bacteria 12803
624 Ga0207711_10017838 3300025941 Bacteria 5897
625 Ga0207711_10029128 3300025941 Bacteria 4654
626 Ga0207711_10040057 3300025941 Bacteria 3985
627 Ga0207711_10045930 3300025941 Bacteria 3732
628 Ga0207711_10101928 3300025941 Bacteria 2540
629 Ga0207689_10001324 3300025942 Bacteria 23874
630 Ga0207689_10001910 3300025942 Bacteria 19696
631 Ga0207689_10004207 3300025942 Bacteria 13087
632 Ga0207689_10005247 3300025942 Bacteria 11625
633 Ga0207689_10105632 3300025942 Bacteria 2314
634 Ga0207689_10187420 3300025942 Bacteria 1706
635 Ga0207661_10059588 3300025944 Bacteria 3077
636 Ga0207661_10356777 3300025944 Bacteria 1320
637 Ga0207679_10012789 3300025945 Bacteria 5484
638 Ga0207679_10025062 3300025945 Bacteria 4097
639 Ga0207679_10044433 3300025945 Bacteria 3205
640 Ga0207679_10050872 3300025945 Bacteria 3030
641 Ga0207679_10051898 3300025945 Bacteria 3005
642 Ga0207679_10065197 3300025945 Bacteria 2725
643 Ga0207679_10087371 3300025945 Bacteria 2400
644 Ga0207679_10176208 3300025945 Bacteria 1765
645 Ga0207667_10007285 3300025949 Bacteria 13332
646 Ga0207667_10013540 3300025949 Bacteria 9326
647 Ga0207667_10030164 3300025949 Bacteria 5868
648 Ga0207667_10047859 3300025949 Bacteria 4523
649 Ga0207667_10096187 3300025949 Bacteria 3056
650 Ga0207667_10193039 3300025949 Bacteria 2089
651 Ga0207667_10280104 3300025949 Bacteria 1704
652 Ga0207667_10454393 3300025949 Bacteria 1301
653 Ga0207651_10002029 3300025960 Bacteria 9518
654 Ga0207651_10004255 3300025960 Bacteria 7182
655 Ga0207651_10028834 3300025960 Bacteria 3508
656 Ga0207651_10332116 3300025960 Bacteria 1274
657 Ga0207651_10379807 3300025960 Unclassified 1197
658 Ga0207651_10739504 3300025960 Bacteria 869
659 Ga0207651_10806664 3300025960 Unclassified 832
660 Ga0207712_10060042 3300025961 Bacteria 2694
661 Ga0207668_10001734 3300025972 Bacteria 12777
662 Ga0207668_10003042 3300025972 Bacteria 9831
663 Ga0207668_10028954 3300025972 Bacteria 3627
664 Ga0207668_10044712 3300025972 Bacteria 3015
665 Ga0207668_10046033 3300025972 Bacteria 2978
666 Ga0207668_10047383 3300025972 Bacteria 2942
667 Ga0207668_10254081 3300025972 Bacteria 1429
668 Ga0207668_10390732 3300025972 Bacteria 1173
669 Ga0207640_10011401 3300025981 Bacteria 5033
670 Ga0207640_10022408 3300025981 Bacteria 3780
671 Ga0207640_10023534 3300025981 Bacteria 3702
672 Ga0207640_10108953 3300025981 Bacteria 1959
673 Ga0207640_10119211 3300025981 Bacteria 1887
674 Ga0207640_10440173 3300025981 Bacteria 1071
675 Ga0207640_10582877 3300025981 Unclassified 944
676 Ga0207658_10010655 3300025986 Bacteria 6249
677 Ga0207658_10032970 3300025986 Bacteria 3691
678 Ga0207658_10059386 3300025986 Bacteria 2849
679 Ga0207658_10076766 3300025986 Bacteria 2546
680 Ga0207658_10097629 3300025986 Bacteria 2294
681 Ga0207677_10009134 3300026023 Bacteria 5566
682 Ga0207677_10015337 3300026023 Bacteria 4503
683 Ga0207677_10052056 3300026023 Bacteria 2780
684 Ga0207677_10053604 3300026023 Bacteria 2746
685 Ga0207677_10060493 3300026023 Bacteria 2618
686 Ga0207677_10132176 3300026023 Bacteria 1897
687 Ga0207703_10016163 3300026035 Bacteria 5817
688 Ga0207703_10021591 3300026035 Bacteria 5041
689 Ga0207703_10026427 3300026035 Bacteria 4569
690 Ga0207703_10039504 3300026035 Bacteria 3772
691 Ga0207703_10193082 3300026035 Bacteria 1805
692 Ga0207639_10005171 3300026041 Bacteria 8803
693 Ga0207639_10012036 3300026041 Bacteria 6018
694 Ga0207639_10057662 3300026041 Bacteria 2983
695 Ga0207639_10090763 3300026041 Bacteria 2444
696 Ga0207639_10107181 3300026041 Bacteria 2269
697 Ga0207639_10179937 3300026041 Bacteria 1798
698 Ga0207678_10003312 3300026067 Bacteria 14526
699 Ga0207678_10003326 3300026067 Bacteria 14498
700 Ga0207678_10058530 3300026067 Bacteria 3316
701 Ga0207678_10414823 3300026067 Bacteria 1167
702 Ga0207678_10463364 3300026067 Unclassified 1102
703 Ga0207678_10601567 3300026067 Bacteria 964
704 Ga0207708_10001956 3300026075 Bacteria 15197
705 Ga0207702_10001462 3300026078 Bacteria 23492
706 Ga0207702_10006653 3300026078 Bacteria 9938
707 Ga0207702_10008073 3300026078 Bacteria 8905
708 Ga0207702_10011050 3300026078 Bacteria 7536
709 Ga0207702_10015081 3300026078 Bacteria 6407
710 Ga0207702_10116465 3300026078 Bacteria 2384
711 Ga0207702_10341715 3300026078 Bacteria 1430
712 Ga0207641_10006138 3300026088 Bacteria 10166
713 Ga0207641_10012440 3300026088 Bacteria 6976
714 Ga0207641_10033483 3300026088 Bacteria 4268
715 Ga0207641_10054734 3300026088 Bacteria 3387
716 Ga0207641_10089869 3300026088 Bacteria 2685
717 Ga0207641_10100259 3300026088 Bacteria 2550
718 Ga0207641_10222943 3300026088 Bacteria 1749
719 Ga0207648_10001827 3300026089 Bacteria 23270
720 Ga0207648_10011910 3300026089 Bacteria 8168
721 Ga0207648_10016484 3300026089 Bacteria 6749
722 Ga0207648_10032246 3300026089 Bacteria 4627
723 Ga0207648_10061256 3300026089 Bacteria 3281
724 Ga0207676_10009892 3300026095 Bacteria 6784
725 Ga0207676_10009997 3300026095 Bacteria 6751
726 Ga0207676_10033318 3300026095 Bacteria 3891
727 Ga0207676_10036893 3300026095 Bacteria 3720
728 Ga0207676_10038295 3300026095 Bacteria 3658
729 Ga0207676_10123862 3300026095 Bacteria 2185
730 Ga0207676_10327784 3300026095 Bacteria 1408
731 Ga0207674_10000221 3300026116 Bacteria 70884
732 Ga0207674_10004336 3300026116 Bacteria 17115
733 Ga0207674_10007628 3300026116 Bacteria 12601
734 Ga0207674_10011597 3300026116 Bacteria 9900
735 Ga0207674_10023879 3300026116 Bacteria 6540
736 Ga0207674_10106772 3300026116 Bacteria 2777
737 Ga0207675_100000448 3300026118 Bacteria 40003
738 Ga0207675_100019868 3300026118 Bacteria 6269
739 Ga0207675_100161035 3300026118 Bacteria 2140
740 Ga0207675_100185348 3300026118 Bacteria 1994
741 Ga0207675_100246894 3300026118 Bacteria 1726
742 Ga0207675_100330461 3300026118 Bacteria 1490
743 Ga0207683_10000377 3300026121 Bacteria 41081
744 Ga0207683_10001065 3300026121 Bacteria 25020
745 Ga0207683_10031304 3300026121 Bacteria 4617
746 Ga0207683_10032552 3300026121 Bacteria 4529
747 Ga0207683_10185991 3300026121 Bacteria 1885
748 Ga0207683_10361319 3300026121 Bacteria 1333
749 Ga0207683_10778440 3300026121 Bacteria 888
750 Ga0207698_10003448 3300026142 Bacteria 9523
751 Ga0207698_10004094 3300026142 Bacteria 8852
752 Ga0207698_10012858 3300026142 Bacteria 5498
753 Ga0207698_10024401 3300026142 Bacteria 4244
754 Ga0207698_10050752 3300026142 Bacteria 3167
755 Ga0207698_10132509 3300026142 Bacteria 2132
756 Ga0207698_10132927 3300026142 Bacteria 2130
757 Ga0207698_10249953 3300026142 Bacteria 1622
758 Ga0207698_10297813 3300026142 Bacteria 1500
759 Ga0207698_10410085 3300026142 Bacteria 1297
760 Ga0207698_10767153 3300026142 Bacteria 964
761 Ga0207698_10934648 3300026142 Bacteria 876
762 Ga0209984_1011085 3300027424 Bacteria 1164
763 Ga0209982_1011889 3300027552 Bacteria 1303
764 Ga0209983_1003003 3300027665 Bacteria 3637
765 Ga0209971_1004647 3300027682 Bacteria 3258
766 Ga0209974_10007359 3300027876 Bacteria 3792
767 Ga0268266_10013956 3300028379 Bacteria 6917
768 Ga0268266_10014925 3300028379 Bacteria 6669
769 Ga0268266_10050679 3300028379 Bacteria 3562
770 Ga0268266_10145809 3300028379 Bacteria 2128
771 Ga0268265_10022007 3300028380 Bacteria 4475
772 Ga0268265_10032004 3300028380 Bacteria 3804
773 Ga0268265_10252332 3300028380 Unclassified 1563
774 Ga0268265_10397894 3300028380 Bacteria 1272
775 Ga0268264_10001625 3300028381 Bacteria 20773
776 Ga0268264_10021480 3300028381 Bacteria 5271
777 Ga0268264_10044006 3300028381 Bacteria 3702
778 Ga0268264_10079498 3300028381 Bacteria 2797
779 Ga0268264_10128099 3300028381 Bacteria 2246
780 Ga0268264_10621980 3300028381 Bacteria 1066
781 Ga0268264_10784426 3300028381 Bacteria 951
782 Ga0265330_10000192 3300031235 Bacteria 47459
783 Ga0265332_10000149 3300031238 Bacteria 56225
784 Ga0265328_10014434 3300031239 Bacteria 3112
785 Ga0265325_10010556 3300031241 Bacteria 5343
786 Ga0265329_10001838 3300031242 Bacteria 10080
787 Ga0265340_10047176 3300031247 Bacteria 2099
788 Ga0265339_10166176 3300031249 Bacteria 1107
789 Ga0265331_10000228 3300031250 Bacteria 67497
790 Ga0265327_10003481 3300031251 Bacteria 14976
791 Ga0265316_10010082 3300031344 Bacteria 8633
792 Ga0265342_10213126 3300031712 Bacteria 1043
793 Ga0307405_10021014 3300031731 Bacteria 3661
794 Ga0307413_10001357 3300031824 Bacteria 9171
795 Ga0307413_10020198 3300031824 Bacteria 3537
796 Ga0307413_10225425 3300031824 Bacteria 1372
797 Ga0307410_10000559 3300031852 Bacteria 15264
798 Ga0307410_10011773 3300031852 Bacteria 5022
799 Ga0307410_10019464 3300031852 Bacteria 4130
800 Ga0307410_10021282 3300031852 Bacteria 3985
801 Ga0307406_10001937 3300031901 Bacteria 11293
802 Ga0307406_10011837 3300031901 Bacteria 4957
803 Ga0307406_10018944 3300031901 Bacteria 4032
804 Ga0307407_10004795 3300031903 Bacteria 5791
805 Ga0307407_10028720 3300031903 Bacteria 2977
806 Ga0307412_10005858 3300031911 Bacteria 6918
807 Ga0307412_10006089 3300031911 Bacteria 6793
808 Ga0307412_10082208 3300031911 Bacteria 2230
809 Ga0307412_10112001 3300031911 Bacteria 1950
810 Ga0307409_100001453 3300031995 Bacteria 11642
811 Ga0307409_100023649 3300031995 Bacteria 4264
812 Ga0307409_100048185 3300031995 Bacteria 3240
813 Ga0307409_100694985 3300031995 Bacteria 1016
814 Ga0307416_100000562 3300032002 Bacteria 18936
815 Ga0307416_100021231 3300032002 Bacteria 4656
816 Ga0307416_100618151 3300032002 Unclassified 1165
817 Ga0307416_100888317 3300032002 Bacteria 991
818 Ga0307414_10008973 3300032004 Bacteria 5716
819 Ga0307414_10018541 3300032004 Bacteria 4289
820 Ga0307414_10043985 3300032004 Bacteria 3046
821 Ga0307411_10011851 3300032005 Bacteria 4728
822 Ga0307411_10015067 3300032005 Bacteria 4327
823 Ga0307411_10189750 3300032005 Bacteria 1568
824 Ga0307415_100027608 3300032126 Bacteria 3599
825 Ga0307415_100252613 3300032126 Bacteria 1433
826 Ga0373958_0036612 3300034819 Bacteria 987
827 Ga0373934_0034644 3300035086 Bacteria 1984
828 Ga0373951_0021821 3300035091 Bacteria 1472
829 Ga0373945_0036637 3300035116 Bacteria 1758
830 Ga0373945_0046033 3300035116 Unclassified 1590
831 Ga0373953_0205946 3300035117 Bacteria 851
832 Ga0373954_0054490 3300035118 Bacteria 1881
833 Ga0373954_0104473 3300035118 Bacteria 1367
834 Ga0373957_0012248 3300035120 Bacteria 2883
835 Ga0373943_0021028 3300035170 Bacteria 3013
836 Ga0373943_0069531 3300035170 Unclassified 1779
837 Ga0373943_0147567 3300035170 Bacteria 1272
838 Ga0373946_0223183 3300035171 Bacteria 910
839 Ga0373961_0120832 3300035241 Bacteria 868
840 Ga0373935_0176787 3300035692 Bacteria 1463
841 Ga0373927_0009052 3300035695 Bacteria 6685
842 Ga0373927_0021167 3300035695 Bacteria 4261
843 Ga0373927_0036795 3300035695 Bacteria 3182
844 Ga0373927_0202733 3300035695 Unclassified 1302
845 Ga0373933_0082649 3300035724 Bacteria 1971
846 Ga0373947_0013951 3300035725 Bacteria 4605
847 Ga0373947_0065850 3300035725 Unclassified 2210
848 Ga0373947_0192222 3300035725 Unclassified 1332
849 Ga0373937_0033799 3300036401 Bacteria 4648
850 Ga0373937_0065651 3300036401 Bacteria 3341
851 Ga0373937_0177526 3300036401 Bacteria 1999
852 Ga0373937_0580808 3300036401 Bacteria 1064
853 Ga0373925_0014406 3300037068 Bacteria 5716
854 Ga0373925_0166308 3300037068 Bacteria 1739
855 Ga0373925_0359679 3300037068 Bacteria 1183
856 Ga0395900_0015798 3300037418 Bacteria 7697
857 Ga0395900_0422379 3300037418 Bacteria 1294
858 Ga0395898_0010188 3300037466 Bacteria 9840
859 Ga0395901_0281408 3300038443 Bacteria 1728
860 Ga0395901_0546426 3300038443 Bacteria 1174
861 Ga0400483_017926 3300039062 Bacteria 2359
862 Ga0436365_0276243 3300039437 Bacteria 4590
863 Ga0451839_0423031 3300041496 Unclassified 1682
864 Ga0451853_3998981 3300041512 Bacteria 1184
865 Ga0439448_0008057 3300042005 Bacteria 3075
866 Ga0451577_0435054 3300042876 Bacteria 1191
867 Ga0451577_0445517 3300042876 Bacteria 1176
868 Ga0466957_0199173 3300044842 Unclassified 1315
869 Ga0451576_0096516 3300045051 Bacteria 3075
870 Ga0495592_0100940 3300046454 Bacteria 2057
871 Ga0495603_0136883 3300046455 Bacteria 1425
872 Ga0495651_0083061 3300046462 Bacteria 2416
873 Ga0495653_0268634 3300046463 Bacteria 1124
874 Ga0495580_0112008 3300046472 Bacteria 1895
875 Ga0495582_0244918 3300046473 Unclassified 1027
876 Ga0495639_0003235 3300046475 Bacteria 7076
877 Ga0495664_0017413 3300046477 Bacteria 4107
878 Ga0495608_0343336 3300046511 Unclassified 920
879 Ga0495666_0151192 3300046526 Unclassified 1079
880 Ga0495665_0091240 3300046531 Unclassified 1601
881 Ga0495640_0170254 3300046533 Bacteria 1392
882 Ga0495586_0064475 3300046535 Bacteria 1996
883 Ga0495621_0002493 3300046539 Bacteria 4967
884 Ga0495667_0033233 3300046559 Bacteria 3453
885 Ga0495635_0164545 3300046663 Unclassified 1509
886 Ga0495588_0075947 3300046674 Unclassified 1751
887 Ga0495657_0119884 3300046675 Bacteria 1658
888 Ga0495599_0061956 3300046678 Bacteria 2337
889 Ga0495623_0108791 3300046679 Bacteria 1682
890 Ga0495647_0029039 3300046681 Bacteria 2042
891 Ga0495658_0202848 3300046683 Unclassified 1236
892 Ga0495613_0003941 3300046689 Bacteria 11117
893 Ga0495624_0202943 3300046690 Unclassified 1204
894 Ga0495600_0021025 3300046809 Bacteria 4176
895 Ga0495581_0005776 3300047315 Bacteria 7174
896 Ga0495604_0112552 3300047317 Bacteria 1982
897 Ga0495636_0041567 3300047318 Bacteria 1909
898 Ga0495674_0430238 3300047319 Unclassified 1062
899 Ga0495680_0107023 3300047322 Bacteria 2077
900 Ga0495675_0134109 3300047444 Bacteria 1538
901 Ga0495684_0118457 3300047471 Bacteria 1995
902 Ga0495593_0021125 3300047673 Bacteria 3639
903 Ga0495602_0126935 3300048088 Bacteria 2042
904 Ga0495602_0247623 3300048088 Bacteria 1330
905 Ga0495614_0029963 3300048089 Bacteria 2341
906 Ga0496100_0006492 3300048903 Bacteria 6379
907 Ga0496101_0006574 3300048904 Bacteria 7490
908 Ga0496101_0125797 3300048904 Bacteria 1942
909 Ga0496102_0003413 3300048905 Bacteria 13474
910 Ga0496102_0639605 3300048905 Bacteria 987
911 Ga0496103_0017533 3300048906 Bacteria 4287
912 Ga0496103_0109377 3300048906 Unclassified 1755
913 Ga0496104_0370727 3300048907 Bacteria 1344
914 Ga0496105_0002972 3300048908 Bacteria 12451
915 Ga0496105_0008700 3300048908 Bacteria 7899
916 Ga0496106_0006570 3300048909 Bacteria 8609
917 Ga0496106_0012708 3300048909 Bacteria 6219
918 Ga0496106_0046416 3300048909 Bacteria 3266
919 Ga0496106_0154863 3300048909 Bacteria 1809
920 Ga0496107_0002506 3300048910 Bacteria 11941
921 Ga0496107_0153960 3300048910 Bacteria 1701
922 Ga0496108_0000825 3300048911 Bacteria 24093
923 Ga0496109_0003498 3300048912 Bacteria 13119
924 Ga0496110_0003050 3300048913 Bacteria 12698
925 Ga0496110_0082758 3300048913 Bacteria 2863
926 Ga0496110_0214890 3300048913 Bacteria 1748
927 Ga0496111_0269174 3300048914 Bacteria 1264
928 Ga0496112_0061278 3300048915 Bacteria 3708
929 Ga0496112_0063505 3300048915 Bacteria 3643
930 Ga0496112_0381885 3300048915 Bacteria 1350
931 Ga0496113_0312883 3300048916 Bacteria 1258
932 Ga0496114_0007396 3300048917 Bacteria 8678
933 Ga0496115_0039396 3300048918 Bacteria 3753
934 Ga0496115_0225313 3300048918 Bacteria 1546
935 Ga0501031_0000764 3300049568 Bacteria 19335
936 Ga0501031_0087684 3300049568 Bacteria 2029
937 Ga0501031_0154604 3300049568 Bacteria 1499
938 Ga0501032_0001947 3300049569 Bacteria 16245
939 Ga0501033_0001731 3300049570 Bacteria 19081
940 Ga0501033_0084749 3300049570 Bacteria 2322
941 Ga0501034_0022333 3300049571 Bacteria 6448
942 Ga0501036_0000142 3300049572 Bacteria 46404
943 Ga0501037_0000670 3300049573 Bacteria 26232
944 Ga0501037_0071264 3300049573 Bacteria 2528
945 Ga0501037_0255060 3300049573 Unclassified 1227
946 Ga0501037_0473349 3300049573 Bacteria 852
947 Ga0501038_0001606 3300049574 Bacteria 20982
948 Ga0501039_0099177 3300049575 Bacteria 2273
949 Ga0501040_0304101 3300049576 Bacteria 1140
950 Ga0501042_0327572 3300049578 Bacteria 1107
951 Ga0501043_0001095 3300049579 Bacteria 23800
952 Ga0501046_0003542 3300049580 Bacteria 14302
953 Ga0501047_0002544 3300049581 Bacteria 17375
954 Ga0501047_0584367 3300049581 Unclassified 939
955 Ga0501069_0067132 3300049585 Bacteria 2006
956 Ga0501070_0015401 3300049586 Bacteria 6432
957 Ga0501071_0173665 3300049587 Bacteria 1614
958 Ga0501072_0006062 3300049588 Bacteria 9228
959 Ga0501073_0004305 3300049589 Bacteria 10678
960 Ga0501074_0031656 3300049590 Bacteria 3832
961 Ga0501076_0233306 3300049592 Bacteria 1504
962 Ga0501080_0018321 3300049742 Bacteria 6480
963 Ga0501080_0159730 3300049742 Bacteria 2082
964 Ga0501081_0160518 3300049743 Bacteria 1620
965 Ga0501083_0037655 3300049744 Bacteria 3293
966 Ga0501035_0004300 3300049822 Bacteria 13526
967 Ga0501044_0000825 3300049823 Bacteria 37302
968 Ga0501044_0359628 3300049823 Bacteria 1374
969 nmdc:mga05p37_234713_c1 3300050507 Bacteria 2208
970 nmdc:mga08y16_149680_c1 3300050511 Bacteria 2426
971 nmdc:mga08y16_86080_c1 3300050511 Bacteria 3275
972 nmdc:mga08y16_93701_c1 3300050511 Bacteria 3129
973 nmdc:mga0n895_158524_c1 3300050512 Bacteria 2294
974 nmdc:mga0n895_31554_c1 3300050512 Bacteria 5074
975 nmdc:mga0n895_967500_c1 3300050512 Unclassified 834
976 nmdc:mga0rr50_105619_c1 3300050513 Bacteria 2221
977 nmdc:mga0rr50_478534_c1 3300050513 Bacteria 1057
978 nmdc:mga08x19_181274_c1 3300050514 Unclassified 1438
979 nmdc:mga08x19_354927_c1 3300050514 Unclassified 1024
980 nmdc:mga0a205_2394_c1 3300050515 Bacteria 16542
981 Ga0495601_0057860 3300053077 Bacteria 2456
982 Ga0495595_0048565 3300053084 Bacteria 1960
983 Ga0495619_0066205 3300053085 Bacteria 2411
984 Ga0495619_0114078 3300053085 Bacteria 1848
985 Ga0501084_0887515 3300054114 Unclassified 750
986 Ga0501082_0038004 3300060353 Bacteria 4152
987 Ga0068855_100296039
988 JGI24752J21851_1006033
989 JGI24743J22301_10001883
990 JGI24749J21850_1001852
991 JGI24751J29686_10022522
992 Ga0065712_10092240
993 Ga0065715_10237003
994 Ga0070658_10004452
995 Ga0070658_10006154
996 Ga0070676_10001197
997 Ga0070676_10033042
998 Ga0070676_10047970
999 Ga0070676_10064021
1000 Ga0070676_10223984
1001 Ga0070676_10285233
1002 Ga0070676_10332026
1003 Ga0070683_100002408
1004 Ga0070683_100020433
1005 Ga0070683_100024406
1006 Ga0070683_100024882
1007 Ga0070690_100058565
1008 Ga0070690_100288987
1009 Ga0070670_100020034
1010 Ga0070670_100032907
1011 Ga0070670_100053699
1012 Ga0070670_100132811
1013 Ga0070670_100177497
1014 Ga0070670_100182946
1015 Ga0070670_100310215
1016 Ga0070670_100566236
1017 Ga0070677_10057732
1018 Ga0070677_10262860
1019 Ga0070677_10346177
1020 Ga0068869_100000199
1021 Ga0068869_100000776
1022 Ga0068869_100264647
1023 Ga0068869_100281331
1024 Ga0070666_10003158
1025 Ga0070666_10032813
1026 Ga0070666_10139574
1027 Ga0070666_10168433
1028 Ga0070666_10492773
1029 Ga0070666_10556463
1030 Ga0070680_100012090
1031 Ga0070680_100050473
1032 Ga0070680_100189996
1033 Ga0070682_100043255
1034 Ga0070682_100122983
1035 Ga0070682_100175056
1036 Ga0068868_100002649
1037 Ga0068868_100076836
1038 Ga0068868_100110283
1039 Ga0068868_100139218
1040 Ga0068868_100218418
1041 Ga0068868_100836361
1042 Ga0070660_100001621
1043 Ga0070660_100009419
1044 Ga0070660_100016519
1045 Ga0070660_100018731
1046 Ga0070660_100026042
1047 Ga0070660_100050014
1048 Ga0070689_100000623
1049 Ga0070691_10071614
1050 Ga0070687_100012546
1051 Ga0070687_100063777
1052 Ga0070661_100007665
1053 Ga0070661_100010082
1054 Ga0070661_100011350
1055 Ga0070661_100012934
1056 Ga0070661_100077891
1057 Ga0070661_100275213
1058 Ga0070661_100299209
1059 Ga0070661_100316732
1060 Ga0070661_100393516
1061 Ga0070692_10061027
1062 Ga0070692_10090607
1063 Ga0070668_100002104
1064 Ga0070668_100005829
1065 Ga0070668_100010371
1066 Ga0070668_100023287
1067 Ga0070668_100061111
1068 Ga0070668_100100500
1069 Ga0070668_100296651
1070 Ga0070668_100765642
1071 Ga0070669_100002169
1072 Ga0070669_100002258
1073 Ga0070669_100064722
1074 Ga0070669_100075441
1075 Ga0070669_100089295
1076 Ga0070669_100101684
1077 Ga0070669_100515970
1078 Ga0070675_100003509
1079 Ga0070675_100011661
1080 Ga0070675_100060194
1081 Ga0070675_100089804
1082 Ga0070675_100126616
1083 Ga0070671_100001072
1084 Ga0070671_100006008
1085 Ga0070671_100037330
1086 Ga0070671_100100137
1087 Ga0070671_100101763
1088 Ga0070674_100110323
1089 Ga0070674_100255380
1090 Ga0070674_100615347
1091 Ga0070673_100019641
1092 Ga0070673_100022157
1093 Ga0070673_100049037
1094 Ga0070673_100240636
1095 Ga0070688_100001240
1096 Ga0070688_100036154
1097 Ga0070688_100078314
1098 Ga0070659_100001948
1099 Ga0070659_100007538
1100 Ga0070659_100008028
1101 Ga0070659_100008879
1102 Ga0070659_100196217
1103 Ga0070659_100503161
1104 Ga0070667_100005673
1105 Ga0070667_100059071
1106 Ga0070667_100059399
1107 Ga0070667_100083166
1108 Ga0070667_100154007
1109 Ga0070667_100532705
1110 Ga0070703_10008093
1111 Ga0070709_10261415
1112 Ga0070709_10311641
1113 Ga0070714_100006871
1114 Ga0070714_100009695
1115 Ga0070714_100027289
1116 Ga0070714_100174009
1117 Ga0070714_100343906
1118 Ga0070713_100000120
1119 Ga0070713_100009471
1120 Ga0070713_100323888
1121 Ga0070713_100440056
1122 Ga0070710_10001425
1123 Ga0070710_10023698
1124 Ga0070701_10008499
1125 Ga0070701_10026865
1126 Ga0070711_100017274
1127 Ga0070705_100035543
1128 Ga0070700_100337772
1129 Ga0070694_100040265
1130 Ga0070694_100048399
1131 Ga0070694_100131133
1132 Ga0070708_100005348
1133 Ga0070708_100026316
1134 Ga0070708_100175979
1135 Ga0070708_100211934
1136 Ga0070708_100431046
1137 Ga0070663_100004086
1138 Ga0070663_100093735
1139 Ga0070663_100157225
1140 Ga0070663_100346465
1141 Ga0070678_100001644
1142 Ga0070678_100037134
1143 Ga0070678_100145262
1144 Ga0070678_100214312
1145 Ga0070678_100216028
1146 Ga0070662_100036215
1147 Ga0070662_100171676
1148 Ga0070662_100362494
1149 Ga0070681_10004785
1150 Ga0070681_10006592
1151 Ga0070681_10026874
1152 Ga0070681_10062539
1153 Ga0070681_10230927
1154 Ga0070681_10482901
1155 Ga0068867_100000670
1156 Ga0068867_100022459
1157 Ga0068867_100171325
1158 Ga0070685_10007999
1159 Ga0070685_10065521
1160 Ga0070706_100008057
1161 Ga0070706_100294635
1162 Ga0070706_100496701
1163 Ga0070707_100259393
1164 Ga0070707_100390003
1165 Ga0070698_100012043
1166 Ga0070698_100374987
1167 Ga0070699_100003014
1168 Ga0070699_100008370
1169 Ga0070679_100009886
1170 Ga0070679_100015755
1171 Ga0070679_100020738
1172 Ga0070679_100024507
1173 Ga0070679_100350106
1174 Ga0070684_100006799
1175 Ga0070684_100035708
1176 Ga0070684_100408464
1177 Ga0070697_100015946
1178 Ga0070697_100101712
1179 Ga0070697_100546526
1180 Ga0068853_100003272
1181 Ga0068853_100010787
1182 Ga0068853_100121300
1183 Ga0068853_100134778
1184 Ga0068853_100156993
1185 Ga0068853_100226005
1186 Ga0068853_100524160
1187 Ga0070672_100000985
1188 Ga0070672_100010190
1189 Ga0070672_100019193
1190 Ga0070672_100072442
1191 Ga0070672_100102206
1192 Ga0070672_100159552
1193 Ga0070672_100298979
1194 Ga0070672_100334813
1195 Ga0070672_100697405
1196 Ga0070686_100021648
1197 Ga0070686_100031524
1198 Ga0070686_100111539
1199 Ga0070695_100015066
1200 Ga0070696_100004421
1201 Ga0070696_100017297
1202 Ga0070693_100033342
1203 Ga0070693_100107366
1204 Ga0070693_100112194
1205 Ga0070693_100181524
1206 Ga0070665_100002349
1207 Ga0070665_100006316
1208 Ga0070665_100014604
1209 Ga0070665_100015984
1210 Ga0070665_100046509
1211 Ga0070665_100332066
1212 Ga0070665_100697983
1213 Ga0070704_100008769
1214 Ga0070704_100022812
1215 Ga0070704_100152558
1216 Ga0068855_100002371
1217 Ga0068855_100064469
1218 Ga0068855_100100539
1219 Ga0068855_100182495
1220 Ga0068855_100206390
1221 Ga0068855_100335359
1222 Ga0068855_100392361
1223 Ga0070664_100001040
1224 Ga0070664_100009004
1225 Ga0070664_100053672
1226 Ga0070664_100086200
1227 Ga0070664_100089165
1228 Ga0070664_100114495
1229 Ga0070664_100173863
1230 Ga0070664_100387582
1231 Ga0070664_100402097
1232 Ga0068857_100001304
1233 Ga0068857_100018749
1234 Ga0068857_100066783
1235 Ga0068857_100081365
1236 Ga0068854_100017927
1237 Ga0068854_100030809
1238 Ga0068854_100033701
1239 Ga0068854_100066219
1240 Ga0068854_100068983
1241 Ga0068854_100131191
1242 Ga0068856_100003525
1243 Ga0068856_100012958
1244 Ga0068856_100013681
1245 Ga0068856_100019692
1246 Ga0068856_100020036
1247 Ga0068856_100069501
1248 Ga0068856_100098881
1249 Ga0068856_100650114
1250 Ga0068852_100000687
1251 Ga0068852_100004752
1252 Ga0068852_100007723
1253 Ga0068852_100029203
1254 Ga0068852_100073424
1255 Ga0068852_100087042
1256 Ga0068852_100090567
1257 Ga0068852_100143012
1258 Ga0068852_100227222
1259 Ga0068852_100486615
1260 Ga0068859_100044791
1261 Ga0068859_100082349
1262 Ga0068859_100127347
1263 Ga0068859_100604339
1264 Ga0068864_100001373
1265 Ga0068864_100004332
1266 Ga0068864_100014871
1267 Ga0068864_100020339
1268 Ga0068864_100085595
1269 Ga0068864_100138210
1270 Ga0068864_100539152
1271 Ga0068866_10043391
1272 Ga0068861_100052359
1273 Ga0068861_100078865
1274 Ga0068861_100326598
1275 Ga0068861_100414380
1276 Ga0068861_100635656
1277 Ga0068851_10000904
1278 Ga0068851_10011639
1279 Ga0068851_10018593
1280 Ga0068851_10103539
1281 Ga0068851_10154102
1282 Ga0068851_10319521
1283 Ga0068870_10034193
1284 Ga0068870_10209939
1285 Ga0068863_100008119
1286 Ga0068863_100009830
1287 Ga0068863_100017008
1288 Ga0068863_100257670
1289 Ga0068863_100269900
1290 Ga0068863_100439159
1291 Ga0068863_100689356
1292 Ga0068858_100009529
1293 Ga0068858_100029457
1294 Ga0068858_100038576
1295 Ga0068858_100068830
1296 Ga0068858_100076253
1297 Ga0068858_100080382
1298 Ga0068860_100002515
1299 Ga0068860_100002776
1300 Ga0068860_100124048
1301 Ga0068862_100011879
1302 Ga0068862_100026536
1303 Ga0068862_100026621
1304 Ga0068862_100079711
1305 Ga0068862_100086735
1306 Ga0068862_100138338
1307 Ga0068862_100533750
1308 Ga0081539_10014444
1309 Ga0070715_10008280
1310 Ga0070716_100011496
1311 Ga0070716_100023993
1312 Ga0070712_100051501
1313 Ga0097621_100001201
1314 Ga0097621_100013378
1315 Ga0097621_100093595
1316 Ga0097621_100143553
1317 Ga0068871_100001648
1318 Ga0068871_100037828
1319 Ga0068871_100080676
1320 Ga0068871_100396058
1321 Ga0068871_100399020
1322 Ga0075428_100340044
1323 Ga0075433_10023958
1324 Ga0075434_100018896
1325 Ga0075434_100039689
1326 Ga0075434_100091390
1327 Ga0075434_100776536
1328 Ga0068865_100003744
1329 Ga0068865_100089689
1330 Ga0068865_100107176
1331 Ga0068865_100473601
1332 Ga0075436_100121712
1333 Ga0075436_100153719
1334 Ga0097620_100044791
1335 Ga0097620_100082350
1336 Ga0097620_100127347
1337 Ga0097620_100604317
1338 Ga0075435_100099281
1339 Ga0075435_100135458
1340 Ga0075435_100218510
1341 Ga0105240_10006424
1342 Ga0105240_10036712
1343 Ga0105240_10057669
1344 Ga0105240_10159747
1345 Ga0111539_10070880
1346 Ga0111539_10474712
1347 Ga0105245_10721266
1348 Ga0114129_10445152
1349 Ga0105243_10167984
1350 Ga0105243_10299759
1351 Ga0105243_11010529
1352 Ga0105241_10001181
1353 Ga0105241_10126243
1354 Ga0105242_10026683
1355 Ga0105242_10233037
1356 Ga0105242_10571499
1357 Ga0105242_10864703
1358 Ga0105248_10015845
1359 Ga0105248_10023975
1360 Ga0105248_10032084
1361 Ga0105248_10107425
1362 Ga0105248_10107486
1363 Ga0105248_10245089
1364 Ga0105248_10284841
1365 Ga0105237_10043252
1366 Ga0105237_10154452
1367 Ga0105238_10007799
1368 Ga0105238_10019814
1369 Ga0105249_10076951
1370 Ga0105249_10083816
1371 Ga0105249_10239507
1372 Ga0105239_10137616
1373 Ga0105239_10417374
1374 Ga0105239_10738467
1375 Ga0105246_10322582
1376 Ga0105246_10549214
1377 Ga0157373_10001581
1378 Ga0157373_10009248
1379 Ga0157373_10022994
1380 Ga0157371_10003402
1381 Ga0157371_10307534
1382 Ga0157370_10004672
1383 Ga0157370_10027164
1384 Ga0157370_10054181
1385 Ga0157370_10080342
1386 Ga0157370_10097551
1387 Ga0157370_10116948
1388 Ga0157370_10331319
1389 Ga0157369_10008340
1390 Ga0157369_10023293
1391 Ga0157369_10046744
1392 Ga0157369_10202999
1393 Ga0157369_10595204
1394 Ga0157374_10003178
1395 Ga0157374_10116541
1396 Ga0157374_10452197
1397 Ga0157374_10511328
1398 Ga0157378_10023016
1399 Ga0157378_10025852
1400 Ga0157378_10144851
1401 Ga0157378_10224977
1402 Ga0157378_10374278
1403 Ga0163162_10022029
1404 Ga0163162_10089920
1405 Ga0163162_10146575
1406 Ga0163162_10149142
1407 Ga0163162_10196571
1408 Ga0163162_10763278
1409 Ga0163162_10983699
1410 Ga0163162_11332764
1411 Ga0157372_10015616
1412 Ga0157372_10020677
1413 Ga0157372_10026105
1414 Ga0157372_10026362
1415 Ga0157372_10036039
1416 Ga0157372_10064887
1417 Ga0157372_10070621
1418 Ga0157372_10071612
1419 Ga0157372_10297896
1420 Ga0157372_10372324
1421 Ga0157372_10709423
1422 Ga0157372_10782746
1423 Ga0157372_11242145
1424 Ga0157375_10090520
1425 Ga0157375_10143448
1426 Ga0157375_10185380
1427 Ga0157375_10216955
1428 Ga0157375_10296040
1429 Ga0157375_10381793
1430 Ga0157375_10405890
1431 Ga0157375_11000352
1432 Ga0157375_11318795
1433 Ga0163163_10001515
1434 Ga0163163_10011621
1435 Ga0163163_10037573
1436 Ga0163163_10061218
1437 Ga0163163_10243136
1438 Ga0163163_10642525
1439 Ga0157380_10027280
1440 Ga0157380_10029785
1441 Ga0157380_10321537
1442 Ga0157380_10403647
1443 Ga0182008_10041277
1444 Ga0182008_10215062
1445 Ga0157377_10000355
1446 Ga0157377_10118285
1447 Ga0157379_10006002
1448 Ga0157379_10013157
1449 Ga0157379_10023517
1450 Ga0157379_10045178
1451 Ga0157379_10070794
1452 Ga0157379_10181279
1453 Ga0157379_10227926
1454 Ga0157376_10020569
1455 Ga0157376_10061046
1456 Ga0163161_10066889
1457 Ga0163161_10162254
1458 Ga0163161_10336920
1459 Ga0206353_11782120
1460 Ga0207697_10000908
1461 Ga0207697_10029436
1462 Ga0207656_10003989
1463 Ga0207656_10017292
1464 Ga0207656_10045922
1465 Ga0207682_10002549
1466 Ga0207682_10004630
1467 Ga0207682_10111096
1468 Ga0207682_10133191
1469 Ga0207692_10004781
1470 Ga0207642_10023666
1471 Ga0207642_10085814
1472 Ga0207688_10003725
1473 Ga0207688_10079373
1474 Ga0207680_10100081
1475 Ga0207680_10138904
1476 Ga0207680_10414564
1477 Ga0207647_10047248
1478 Ga0207699_10049743
1479 Ga0207699_10082838
1480 Ga0207699_10091217
1481 Ga0207699_10457310
1482 Ga0207645_10000773
1483 Ga0207645_10041830
1484 Ga0207645_10060729
1485 Ga0207645_10061574
1486 Ga0207645_10137119
1487 Ga0207645_10239647
1488 Ga0207645_10310807
1489 Ga0207643_10000257
1490 Ga0207643_10009067
1491 Ga0207684_10032486
1492 Ga0207684_10037325
1493 Ga0207684_10247884
1494 Ga0207654_10041748
1495 Ga0207654_10176320
1496 Ga0207654_10447063
1497 Ga0207654_10477314
1498 Ga0207707_10006055
1499 Ga0207707_10007043
1500 Ga0207707_10028114
1501 Ga0207707_10032528
1502 Ga0207707_10079520
1503 Ga0207707_10159730
1504 Ga0207695_10009625
1505 Ga0207695_10032886
1506 Ga0207695_10063993
1507 Ga0207671_10040511
1508 Ga0207671_10118655
1509 Ga0207693_10005151
1510 Ga0207693_10035293
1511 Ga0207693_10143909
1512 Ga0207663_10064905
1513 Ga0207663_10099105
1514 Ga0207663_10375212
1515 Ga0207660_10004060
1516 Ga0207660_10123587
1517 Ga0207660_10283989
1518 Ga0207662_10010202
1519 Ga0207662_10117666
1520 Ga0207657_10001483
1521 Ga0207657_10003925
1522 Ga0207657_10005869
1523 Ga0207657_10017917
1524 Ga0207657_10025502
1525 Ga0207657_10060304
1526 Ga0207657_10212863
1527 Ga0207657_10470372
1528 Ga0207649_10004328
1529 Ga0207649_10007982
1530 Ga0207649_10025382
1531 Ga0207649_10025873
1532 Ga0207649_10026992
1533 Ga0207649_10072023
1534 Ga0207652_10003655
1535 Ga0207652_10011745
1536 Ga0207652_10014269
1537 Ga0207652_10024111
1538 Ga0207652_10047312
1539 Ga0207652_10051509
1540 Ga0207652_10181620
1541 Ga0207646_10218048
1542 Ga0207646_10312377
1543 Ga0207681_10014107
1544 Ga0207681_10016908
1545 Ga0207681_10058628
1546 Ga0207681_10089693
1547 Ga0207681_10119820
1548 Ga0207681_10162871
1549 Ga0207694_10002927
1550 Ga0207694_10004091
1551 Ga0207694_10350168
1552 Ga0207650_10001671
1553 Ga0207650_10005022
1554 Ga0207650_10027863
1555 Ga0207650_10034237
1556 Ga0207650_10041524
1557 Ga0207650_10096712
1558 Ga0207650_10139740
1559 Ga0207650_10198802
1560 Ga0207659_10007146
1561 Ga0207659_10007803
1562 Ga0207659_10247843
1563 Ga0207659_10338513
1564 Ga0207659_10454530
1565 Ga0207687_10091727
1566 Ga0207700_10000110
1567 Ga0207700_10005337
1568 Ga0207700_10019463
1569 Ga0207700_10293385
1570 Ga0207664_10000325
1571 Ga0207664_10003216
1572 Ga0207664_10007382
1573 Ga0207664_10014720
1574 Ga0207644_10004560
1575 Ga0207644_10004889
1576 Ga0207644_10026800
1577 Ga0207690_10010605
1578 Ga0207690_10026620
1579 Ga0207690_10042763
1580 Ga0207706_10000775
1581 Ga0207706_10011882
1582 Ga0207706_10038551
1583 Ga0207706_10050091
1584 Ga0207706_10164154
1585 Ga0207706_10267325
1586 Ga0207686_10004238
1587 Ga0207686_10110099
1588 Ga0207709_10259268
1589 Ga0207669_10095845
1590 Ga0207669_10244883
1591 Ga0207669_10263315
1592 Ga0207704_10054998
1593 Ga0207704_10055713
1594 Ga0207704_10308378
1595 Ga0207704_10339073
1596 Ga0207665_10009663
1597 Ga0207665_10739232
1598 Ga0207691_10001118
1599 Ga0207691_10004281
1600 Ga0207691_10017446
1601 Ga0207691_10023823
1602 Ga0207691_10031234
1603 Ga0207691_10067528
1604 Ga0207691_10074294
1605 Ga0207691_10088432
1606 Ga0207691_10133183
1607 Ga0207691_10133358
1608 Ga0207691_10449734
1609 Ga0207711_10003922
1610 Ga0207711_10017838
1611 Ga0207711_10029128
1612 Ga0207711_10040057
1613 Ga0207711_10045930
1614 Ga0207711_10101928
1615 Ga0207689_10001324
1616 Ga0207689_10001910
1617 Ga0207689_10004207
1618 Ga0207689_10005247
1619 Ga0207689_10105632
1620 Ga0207689_10187420
1621 Ga0207661_10059588
1622 Ga0207661_10356777
1623 Ga0207679_10012789
1624 Ga0207679_10025062
1625 Ga0207679_10044433
1626 Ga0207679_10050872
1627 Ga0207679_10051898
1628 Ga0207679_10065197
1629 Ga0207679_10087371
1630 Ga0207679_10176208
1631 Ga0207667_10007285
1632 Ga0207667_10013540
1633 Ga0207667_10030164
1634 Ga0207667_10047859
1635 Ga0207667_10096187
1636 Ga0207667_10193039
1637 Ga0207667_10280104
1638 Ga0207667_10454393
1639 Ga0207651_10002029
1640 Ga0207651_10004255
1641 Ga0207651_10028834
1642 Ga0207651_10332116
1643 Ga0207651_10379807
1644 Ga0207651_10739504
1645 Ga0207651_10806664
1646 Ga0207712_10060042
1647 Ga0207668_10001734
1648 Ga0207668_10003042
1649 Ga0207668_10028954
1650 Ga0207668_10044712
1651 Ga0207668_10046033
1652 Ga0207668_10047383
1653 Ga0207668_10254081
1654 Ga0207668_10390732
1655 Ga0207640_10011401
1656 Ga0207640_10022408
1657 Ga0207640_10023534
1658 Ga0207640_10108953
1659 Ga0207640_10119211
1660 Ga0207640_10440173
1661 Ga0207640_10582877
1662 Ga0207658_10010655
1663 Ga0207658_10032970
1664 Ga0207658_10059386
1665 Ga0207658_10076766
1666 Ga0207658_10097629
1667 Ga0207677_10009134
1668 Ga0207677_10015337
1669 Ga0207677_10052056
1670 Ga0207677_10053604
1671 Ga0207677_10060493
1672 Ga0207677_10132176
1673 Ga0207703_10016163
1674 Ga0207703_10021591
1675 Ga0207703_10026427
1676 Ga0207703_10039504
1677 Ga0207703_10193082
1678 Ga0207639_10005171
1679 Ga0207639_10012036
1680 Ga0207639_10057662
1681 Ga0207639_10090763
1682 Ga0207639_10107181
1683 Ga0207639_10179937
1684 Ga0207678_10003312
1685 Ga0207678_10003326
1686 Ga0207678_10058530
1687 Ga0207678_10414823
1688 Ga0207678_10463364
1689 Ga0207678_10601567
1690 Ga0207708_10001956
1691 Ga0207702_10001462
1692 Ga0207702_10006653
1693 Ga0207702_10008073
1694 Ga0207702_10011050
1695 Ga0207702_10015081
1696 Ga0207702_10116465
1697 Ga0207702_10341715
1698 Ga0207641_10006138
1699 Ga0207641_10012440
1700 Ga0207641_10033483
1701 Ga0207641_10054734
1702 Ga0207641_10089869
1703 Ga0207641_10100259
1704 Ga0207641_10222943
1705 Ga0207648_10001827
1706 Ga0207648_10011910
1707 Ga0207648_10016484
1708 Ga0207648_10032246
1709 Ga0207648_10061256
1710 Ga0207676_10009892
1711 Ga0207676_10009997
1712 Ga0207676_10033318
1713 Ga0207676_10036893
1714 Ga0207676_10038295
1715 Ga0207676_10123862
1716 Ga0207676_10327784
1717 Ga0207674_10000221
1718 Ga0207674_10004336
1719 Ga0207674_10007628
1720 Ga0207674_10011597
1721 Ga0207674_10023879
1722 Ga0207674_10106772
1723 Ga0207675_100000448
1724 Ga0207675_100019868
1725 Ga0207675_100161035
1726 Ga0207675_100185348
1727 Ga0207675_100246894
1728 Ga0207675_100330461
1729 Ga0207683_10000377
1730 Ga0207683_10001065
1731 Ga0207683_10031304
1732 Ga0207683_10032552
1733 Ga0207683_10185991
1734 Ga0207683_10361319
1735 Ga0207683_10778440
1736 Ga0207698_10003448
1737 Ga0207698_10004094
1738 Ga0207698_10012858
1739 Ga0207698_10024401
1740 Ga0207698_10050752
1741 Ga0207698_10132509
1742 Ga0207698_10132927
1743 Ga0207698_10249953
1744 Ga0207698_10297813
1745 Ga0207698_10410085
1746 Ga0207698_10767153
1747 Ga0207698_10934648
1748 Ga0209984_1011085
1749 Ga0209982_1011889
1750 Ga0209983_1003003
1751 Ga0209971_1004647
1752 Ga0209974_10007359
1753 Ga0268266_10013956
1754 Ga0268266_10014925
1755 Ga0268266_10050679
1756 Ga0268266_10145809
1757 Ga0268265_10022007
1758 Ga0268265_10032004
1759 Ga0268265_10252332
1760 Ga0268265_10397894
1761 Ga0268264_10001625
1762 Ga0268264_10021480
1763 Ga0268264_10044006
1764 Ga0268264_10079498
1765 Ga0268264_10128099
1766 Ga0268264_10621980
1767 Ga0268264_10784426
1768 Ga0265330_10000192
1769 Ga0265332_10000149
1770 Ga0265328_10014434
1771 Ga0265325_10010556
1772 Ga0265329_10001838
1773 Ga0265340_10047176
1774 Ga0265339_10166176
1775 Ga0265331_10000228
1776 Ga0265327_10003481
1777 Ga0265316_10010082
1778 Ga0265342_10213126
1779 Ga0307405_10021014
1780 Ga0307413_10001357
1781 Ga0307413_10020198
1782 Ga0307413_10225425
1783 Ga0307410_10000559
1784 Ga0307410_10011773
1785 Ga0307410_10019464
1786 Ga0307410_10021282
1787 Ga0307406_10001937
1788 Ga0307406_10011837
1789 Ga0307406_10018944
1790 Ga0307407_10004795
1791 Ga0307407_10028720
1792 Ga0307412_10005858
1793 Ga0307412_10006089
1794 Ga0307412_10082208
1795 Ga0307412_10112001
1796 Ga0307409_100001453
1797 Ga0307409_100023649
1798 Ga0307409_100048185
1799 Ga0307409_100694985
1800 Ga0307416_100000562
1801 Ga0307416_100021231
1802 Ga0307416_100618151
1803 Ga0307416_100888317
1804 Ga0307414_10008973
1805 Ga0307414_10018541
1806 Ga0307414_10043985
1807 Ga0307411_10011851
1808 Ga0307411_10015067
1809 Ga0307411_10189750
1810 Ga0307415_100027608
1811 Ga0307415_100252613
1812 Ga0373958_0036612
1813 Ga0373934_0034644
1814 Ga0373951_0021821
1815 Ga0373945_0036637
1816 Ga0373945_0046033
1817 Ga0373953_0205946
1818 Ga0373954_0054490
1819 Ga0373954_0104473
1820 Ga0373957_0012248
1821 Ga0373943_0021028
1822 Ga0373943_0069531
1823 Ga0373943_0147567
1824 Ga0373946_0223183
1825 Ga0373961_0120832
1826 Ga0373935_0176787
1827 Ga0373927_0009052
1828 Ga0373927_0021167
1829 Ga0373927_0036795
1830 Ga0373927_0202733
1831 Ga0373933_0082649
1832 Ga0373947_0013951
1833 Ga0373947_0065850
1834 Ga0373947_0192222
1835 Ga0373937_0033799
1836 Ga0373937_0065651
1837 Ga0373937_0177526
1838 Ga0373937_0580808
1839 Ga0373925_0014406
1840 Ga0373925_0166308
1841 Ga0373925_0359679
1842 Ga0395900_0015798
1843 Ga0395900_0422379
1844 Ga0395898_0010188
1845 Ga0395901_0281408
1846 Ga0395901_0546426
1847 Ga0400483_017926
1848 Ga0436365_0276243
1849 Ga0451839_0423031
1850 Ga0451853_3998981
1851 Ga0439448_0008057
1852 Ga0451577_0435054
1853 Ga0451577_0445517
1854 Ga0466957_0199173
1855 Ga0451576_0096516
1856 Ga0495592_0100940
1857 Ga0495603_0136883
1858 Ga0495651_0083061
1859 Ga0495653_0268634
1860 Ga0495580_0112008
1861 Ga0495582_0244918
1862 Ga0495639_0003235
1863 Ga0495664_0017413
1864 Ga0495608_0343336
1865 Ga0495666_0151192
1866 Ga0495665_0091240
1867 Ga0495640_0170254
1868 Ga0495586_0064475
1869 Ga0495621_0002493
1870 Ga0495667_0033233
1871 Ga0495635_0164545
1872 Ga0495588_0075947
1873 Ga0495657_0119884
1874 Ga0495599_0061956
1875 Ga0495623_0108791
1876 Ga0495647_0029039
1877 Ga0495658_0202848
1878 Ga0495613_0003941
1879 Ga0495624_0202943
1880 Ga0495600_0021025
1881 Ga0495581_0005776
1882 Ga0495604_0112552
1883 Ga0495636_0041567
1884 Ga0495674_0430238
1885 Ga0495680_0107023
1886 Ga0495675_0134109
1887 Ga0495684_0118457
1888 Ga0495593_0021125
1889 Ga0495602_0126935
1890 Ga0495602_0247623
1891 Ga0495614_0029963
1892 Ga0496100_0006492
1893 Ga0496101_0006574
1894 Ga0496101_0125797
1895 Ga0496102_0003413
1896 Ga0496102_0639605
1897 Ga0496103_0017533
1898 Ga0496103_0109377
1899 Ga0496104_0370727
1900 Ga0496105_0002972
1901 Ga0496105_0008700
1902 Ga0496106_0006570
1903 Ga0496106_0012708
1904 Ga0496106_0046416
1905 Ga0496106_0154863
1906 Ga0496107_0002506
1907 Ga0496107_0153960
1908 Ga0496108_0000825
1909 Ga0496109_0003498
1910 Ga0496110_0003050
1911 Ga0496110_0082758
1912 Ga0496110_0214890
1913 Ga0496111_0269174
1914 Ga0496112_0061278
1915 Ga0496112_0063505
1916 Ga0496112_0381885
1917 Ga0496113_0312883
1918 Ga0496114_0007396
1919 Ga0496115_0039396
1920 Ga0496115_0225313
1921 Ga0501031_0000764
1922 Ga0501031_0087684
1923 Ga0501031_0154604
1924 Ga0501032_0001947
1925 Ga0501033_0001731
1926 Ga0501033_0084749
1927 Ga0501034_0022333
1928 Ga0501036_0000142
1929 Ga0501037_0000670
1930 Ga0501037_0071264
1931 Ga0501037_0255060
1932 Ga0501037_0473349
1933 Ga0501038_0001606
1934 Ga0501039_0099177
1935 Ga0501040_0304101
1936 Ga0501042_0327572
1937 Ga0501043_0001095
1938 Ga0501046_0003542
1939 Ga0501047_0002544
1940 Ga0501047_0584367
1941 Ga0501069_0067132
1942 Ga0501070_0015401
1943 Ga0501071_0173665
1944 Ga0501072_0006062
1945 Ga0501073_0004305
1946 Ga0501074_0031656
1947 Ga0501076_0233306
1948 Ga0501080_0018321
1949 Ga0501080_0159730
1950 Ga0501081_0160518
1951 Ga0501083_0037655
1952 Ga0501035_0004300
1953 Ga0501044_0000825
1954 Ga0501044_0359628
1955 nmdc:mga05p37_234713_c1
1956 nmdc:mga08y16_149680_c1
1957 nmdc:mga08y16_86080_c1
1958 nmdc:mga08y16_93701_c1
1959 nmdc:mga0n895_158524_c1
1960 nmdc:mga0n895_31554_c1
1961 nmdc:mga0n895_967500_c1
1962 nmdc:mga0rr50_105619_c1
1963 nmdc:mga0rr50_478534_c1
1964 nmdc:mga08x19_181274_c1
1965 nmdc:mga08x19_354927_c1
1966 nmdc:mga0a205_2394_c1
1967 Ga0495601_0057860
1968 Ga0495595_0048565
1969 Ga0495619_0066205
1970 Ga0495619_0114078
1971 Ga0501084_0887515
1972 Ga0501082_0038004

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01553

Acyltransferase

Acyltransferase

89

215

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.8314 5 236
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.8259 3 234
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.8022 5 236
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7893 3 234
8e50-assembly1.cif.gz_A cryo-em structure of human glycerol-3-phosphate acyltransferase 1 (gpat1) in complex with coa and palmitoyl-lpa 0.6161 37 238
ID Description Score Start End Superfamily
af_D4AC45_64_192_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8874 60 178 3.40.50.620
af_I6YDI9_312_439_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8526 60 180 3.40.50.620
af_P33333_55_242_3.40.1130.10 Alpha Beta;3-Layer(aba) Sandwich;Glycerol-3-phosphate (1)-acyltransferase;Glycerol-3-phosphate (1)-acyltransferase 0.8523 52 233 3.40.1130.10
af_Q7XPP9_101_219_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8513 62 180 3.40.50.620
af_Q9US20_86_212_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8486 60 180 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A358JQS6-F1-model_v4 deleted 0.9758 1 147
AF-A0A1G5SEY9-F1-model_v4 Phospholipid/glycerol acyltransferase 0.9698 2 234 GO:0003841
GO:0006654
GO:0016020
AF-C3X4D5-F1-model_v4 1-acylglycerol-3-phosphate O-acyltransferase 0.9698 2 235 GO:0003841
GO:0006654
GO:0016020
AF-A0A358JQS6-F1-model_v4 deleted 0.9694 1 147
AF-A0A226WXX9-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9657 3 235 GO:0003841
GO:0006654
GO:0016020

Map