F487517
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 986 | 458 | 1972 | 318 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10134664|Ga0081455_101346642 |
| Length | 319 |
| Sequence | MSLDSDVIVDRRRIRRKLTFWRVFAALVAILAVVTIGVIATPGGRGSLATTGSIARVKIDGLIRSDSDRVEALERLEKSQTAAVIVHINSPGGTTAGSEQLYDSLMRLKTKKPLVVVVEGLAASGGYITAIAADHIVAQQSSLIGSIGVLFQYPNFAELLKTVGVKVEEIKSNGYEPTSPEARAAIDALVKDSYAWFRSLVKERRGMDDAQIEKVADGRVFTGRQAVELKLIDALGDEKAAVAWLEANKNVKKGLPVRDYKLTPRFGDLTFLRTATSITLDAIGLSGIARRIEQSGVTQAVDRLSMDGMLALWQPGASN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 9 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 70 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 76 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 84 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 112 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 113 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 114 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 115 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 116 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 181 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 182 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 187 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 188 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 189 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 190 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 191 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 192 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 194 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 195 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 196 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 197 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 198 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 199 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 200 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 201 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 202 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 204 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 207 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 208 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 209 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 210 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 211 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 212 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 213 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 218 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 219 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 221 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 222 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 225 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 228 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 229 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 230 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 233 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 234 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 235 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 236 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 237 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 238 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 239 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 240 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 241 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 242 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 243 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 244 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 245 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 246 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 247 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 248 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 249 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 328 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 329 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 330 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 331 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 332 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 333 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 336 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 337 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 338 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 339 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 340 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 341 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 342 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 343 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 344 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 345 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 346 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 347 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 348 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 349 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 350 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 351 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 352 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 379 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 380 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 381 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 382 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 383 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 384 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 385 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 391 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 394 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 395 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 396 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 397 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 398 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 399 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 400 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 401 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 402 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 403 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 404 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 405 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 406 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 407 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 408 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 409 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 410 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 411 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 412 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 413 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 414 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 415 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 416 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 417 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 418 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 419 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 420 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 421 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 422 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 423 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 424 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 425 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 426 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 427 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 428 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 429 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 431 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 433 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 434 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 435 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 436 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 437 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 438 | 2791355199 | |||
| 439 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 440 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 441 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 442 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 443 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 444 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 445 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 446 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 447 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 448 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 449 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 450 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 451 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 452 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 453 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 454 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 455 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 456 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 457 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 458 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.46 |
| Metatranscriptomes | 0 |
| Isolates | 2.54 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.89 |
| Nodule | 2.03 |
| Rhizoplane | 7.2 |
| Rhizosphere | 68.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0081455_10134664 | 3300005937 | Bacteria | 1927 |
| 2 | JGI24740J21852_10005816 | 3300001979 | Bacteria | 5177 |
| 3 | JGI24737J22298_10003455 | 3300001990 | Bacteria | 5582 |
| 4 | JGI25406J46586_10001269 | 3300003203 | Bacteria | 11845 |
| 5 | JGI25406J46586_10001837 | 3300003203 | Bacteria | 9963 |
| 6 | JGI25406J46586_10005215 | 3300003203 | Bacteria | 6025 |
| 7 | JGI25153J46596_10009381 | 3300003215 | Bacteria | 4558 |
| 8 | JGI25153J46596_10031830 | 3300003215 | Bacteria | 1768 |
| 9 | JGI25153J46596_10032438 | 3300003215 | Bacteria | 1742 |
| 10 | JGI25153J46596_10034898 | 3300003215 | Bacteria | 1637 |
| 11 | rootH2_10095142 | 3300003320 | Bacteria | 2257 |
| 12 | JGI25160J50197_1020957 | 3300003354 | Bacteria | 1956 |
| 13 | JGI25160J50197_1031796 | 3300003354 | Bacteria | 1352 |
| 14 | JGI25404J52841_10010710 | 3300003659 | Bacteria | 1972 |
| 15 | Ga0055531_10007516 | 3300003794 | Bacteria | 5927 |
| 16 | Ga0065165_1027884 | 3300005262 | Bacteria | 1832 |
| 17 | Ga0065165_1030603 | 3300005262 | Bacteria | 1710 |
| 18 | Ga0065165_1032286 | 3300005262 | Bacteria | 1643 |
| 19 | Ga0070658_10023727 | 3300005327 | Bacteria | 4919 |
| 20 | Ga0070683_100030491 | 3300005329 | Bacteria | 4897 |
| 21 | Ga0070683_100044264 | 3300005329 | Bacteria | 4104 |
| 22 | Ga0070690_100372690 | 3300005330 | Bacteria | 1042 |
| 23 | Ga0070670_100136854 | 3300005331 | Bacteria | 2117 |
| 24 | Ga0070670_100200985 | 3300005331 | Bacteria | 1731 |
| 25 | Ga0068869_100179485 | 3300005334 | Bacteria | 1659 |
| 26 | Ga0070680_100018066 | 3300005336 | Bacteria | 5570 |
| 27 | Ga0070680_100081192 | 3300005336 | Bacteria | 2675 |
| 28 | Ga0070682_100202985 | 3300005337 | Bacteria | 1400 |
| 29 | Ga0068868_100017439 | 3300005338 | Bacteria | 5351 |
| 30 | Ga0068868_100123391 | 3300005338 | Bacteria | 2114 |
| 31 | Ga0070660_100118721 | 3300005339 | Bacteria | 2109 |
| 32 | Ga0070660_100403070 | 3300005339 | Bacteria | 1131 |
| 33 | Ga0070689_100271375 | 3300005340 | Bacteria | 1404 |
| 34 | Ga0070661_100146714 | 3300005344 | Bacteria | 1781 |
| 35 | Ga0070668_100088248 | 3300005347 | Bacteria | 2441 |
| 36 | Ga0070668_100129749 | 3300005347 | Bacteria | 2022 |
| 37 | Ga0070668_100154825 | 3300005347 | Bacteria | 1856 |
| 38 | Ga0070668_100194289 | 3300005347 | Bacteria | 1663 |
| 39 | Ga0070669_100141779 | 3300005353 | Bacteria | 1853 |
| 40 | Ga0070669_100207161 | 3300005353 | Bacteria | 1545 |
| 41 | Ga0070669_100405920 | 3300005353 | Bacteria | 1116 |
| 42 | Ga0070671_100172339 | 3300005355 | Bacteria | 1830 |
| 43 | Ga0070671_100182917 | 3300005355 | Bacteria | 1775 |
| 44 | Ga0070674_100156801 | 3300005356 | Bacteria | 1723 |
| 45 | Ga0070673_100279431 | 3300005364 | Bacteria | 1464 |
| 46 | Ga0070659_100187887 | 3300005366 | Bacteria | 1697 |
| 47 | Ga0070659_100444061 | 3300005366 | Bacteria | 1099 |
| 48 | Ga0070667_100085231 | 3300005367 | Bacteria | 2709 |
| 49 | Ga0070667_100249256 | 3300005367 | Bacteria | 1587 |
| 50 | Ga0070667_100305633 | 3300005367 | Bacteria | 1433 |
| 51 | Ga0070709_10008846 | 3300005434 | Bacteria | 5543 |
| 52 | Ga0070714_100006113 | 3300005435 | Bacteria | 9251 |
| 53 | Ga0070714_100013348 | 3300005435 | Bacteria | 6584 |
| 54 | Ga0070714_100089955 | 3300005435 | Bacteria | 2688 |
| 55 | Ga0070713_100033309 | 3300005436 | Bacteria | 4125 |
| 56 | Ga0070713_100035723 | 3300005436 | Bacteria | 4004 |
| 57 | Ga0070713_100046936 | 3300005436 | Bacteria | 3547 |
| 58 | Ga0070713_100091253 | 3300005436 | Bacteria | 2620 |
| 59 | Ga0070713_100245358 | 3300005436 | Bacteria | 1632 |
| 60 | Ga0070710_10000629 | 3300005437 | Bacteria | 16796 |
| 61 | Ga0070710_10002613 | 3300005437 | Bacteria | 8561 |
| 62 | Ga0070711_100007337 | 3300005439 | Bacteria | 6709 |
| 63 | Ga0070711_100007770 | 3300005439 | Bacteria | 6531 |
| 64 | Ga0070711_100091165 | 3300005439 | Bacteria | 2196 |
| 65 | Ga0070700_100101950 | 3300005441 | Bacteria | 1892 |
| 66 | Ga0070694_100109692 | 3300005444 | Bacteria | 1964 |
| 67 | Ga0070663_100005737 | 3300005455 | Bacteria | 7404 |
| 68 | Ga0070663_100030169 | 3300005455 | Bacteria | 3713 |
| 69 | Ga0070663_100082650 | 3300005455 | Bacteria | 2363 |
| 70 | Ga0070663_100105313 | 3300005455 | Bacteria | 2111 |
| 71 | Ga0070663_100121391 | 3300005455 | Bacteria | 1974 |
| 72 | Ga0070663_100176525 | 3300005455 | Bacteria | 1654 |
| 73 | Ga0070663_100223453 | 3300005455 | Bacteria | 1479 |
| 74 | Ga0070678_100179341 | 3300005456 | Bacteria | 1732 |
| 75 | Ga0070678_100270236 | 3300005456 | Bacteria | 1433 |
| 76 | Ga0070662_100152209 | 3300005457 | Bacteria | 1802 |
| 77 | Ga0070662_100349043 | 3300005457 | Bacteria | 1212 |
| 78 | Ga0070681_10065324 | 3300005458 | Bacteria | 3607 |
| 79 | Ga0070681_10138275 | 3300005458 | Bacteria | 2365 |
| 80 | Ga0070681_10140700 | 3300005458 | Bacteria | 2343 |
| 81 | Ga0070681_10286788 | 3300005458 | Bacteria | 1557 |
| 82 | Ga0070685_10140521 | 3300005466 | Bacteria | 1520 |
| 83 | Ga0070707_100074049 | 3300005468 | Bacteria | 3283 |
| 84 | Ga0070707_100117076 | 3300005468 | Bacteria | 2586 |
| 85 | Ga0070698_100270947 | 3300005471 | Bacteria | 1629 |
| 86 | Ga0070698_100338567 | 3300005471 | Bacteria | 1436 |
| 87 | Ga0070679_100111200 | 3300005530 | Bacteria | 2726 |
| 88 | Ga0070679_100243743 | 3300005530 | Bacteria | 1754 |
| 89 | Ga0070679_100334017 | 3300005530 | Bacteria | 1464 |
| 90 | Ga0070684_100003879 | 3300005535 | Bacteria | 11314 |
| 91 | Ga0070684_100052912 | 3300005535 | Bacteria | 3532 |
| 92 | Ga0070684_100335350 | 3300005535 | Bacteria | 1390 |
| 93 | Ga0068853_100001617 | 3300005539 | Bacteria | 16448 |
| 94 | Ga0068853_100012905 | 3300005539 | Bacteria | 6808 |
| 95 | Ga0068853_100029373 | 3300005539 | Bacteria | 4634 |
| 96 | Ga0068853_100126841 | 3300005539 | Bacteria | 2280 |
| 97 | Ga0068853_100180047 | 3300005539 | Bacteria | 1916 |
| 98 | Ga0070686_100088905 | 3300005544 | Bacteria | 2062 |
| 99 | Ga0070665_100019142 | 3300005548 | Bacteria | 6869 |
| 100 | Ga0070665_100128458 | 3300005548 | Bacteria | 2537 |
| 101 | Ga0070665_100277819 | 3300005548 | Bacteria | 1677 |
| 102 | Ga0070665_100442234 | 3300005548 | Bacteria | 1309 |
| 103 | Ga0068855_100057419 | 3300005563 | Bacteria | 4562 |
| 104 | Ga0068855_100090885 | 3300005563 | Bacteria | 3522 |
| 105 | Ga0068855_100188548 | 3300005563 | Bacteria | 2327 |
| 106 | Ga0070664_100138901 | 3300005564 | Bacteria | 2138 |
| 107 | Ga0068857_100040874 | 3300005577 | Bacteria | 4111 |
| 108 | Ga0068857_100088196 | 3300005577 | Bacteria | 2775 |
| 109 | Ga0068854_100026066 | 3300005578 | Bacteria | 4014 |
| 110 | Ga0068854_100096044 | 3300005578 | Bacteria | 2213 |
| 111 | Ga0068856_100074933 | 3300005614 | Bacteria | 3351 |
| 112 | Ga0068856_100197610 | 3300005614 | Bacteria | 2025 |
| 113 | Ga0068856_100231152 | 3300005614 | Bacteria | 1865 |
| 114 | Ga0068856_100247067 | 3300005614 | Bacteria | 1800 |
| 115 | Ga0070702_100042184 | 3300005615 | Bacteria | 2564 |
| 116 | Ga0068852_100020357 | 3300005616 | Bacteria | 5275 |
| 117 | Ga0068859_100177940 | 3300005617 | Bacteria | 2209 |
| 118 | Ga0068859_100378331 | 3300005617 | Bacteria | 1511 |
| 119 | Ga0068864_100055720 | 3300005618 | Bacteria | 3414 |
| 120 | Ga0068864_100094342 | 3300005618 | Bacteria | 2645 |
| 121 | Ga0068864_100325057 | 3300005618 | Bacteria | 1445 |
| 122 | Ga0068864_100347988 | 3300005618 | Bacteria | 1398 |
| 123 | Ga0068866_10062985 | 3300005718 | Bacteria | 1931 |
| 124 | Ga0068866_10166041 | 3300005718 | Bacteria | 1292 |
| 125 | Ga0068866_10269179 | 3300005718 | Bacteria | 1051 |
| 126 | Ga0068861_100169819 | 3300005719 | Bacteria | 1807 |
| 127 | Ga0068861_100185350 | 3300005719 | Bacteria | 1735 |
| 128 | Ga0068861_100352524 | 3300005719 | Bacteria | 1291 |
| 129 | Ga0068851_10004728 | 3300005834 | Bacteria | 6164 |
| 130 | Ga0068863_100415836 | 3300005841 | Bacteria | 1317 |
| 131 | Ga0068863_100609846 | 3300005841 | Bacteria | 1081 |
| 132 | Ga0068858_100195042 | 3300005842 | Bacteria | 1914 |
| 133 | Ga0068860_100001803 | 3300005843 | Bacteria | 22784 |
| 134 | Ga0068860_100112266 | 3300005843 | Bacteria | 2606 |
| 135 | Ga0068862_100273969 | 3300005844 | Bacteria | 1544 |
| 136 | Ga0081455_10049478 | 3300005937 | Bacteria | 3623 |
| 137 | Ga0081455_10050463 | 3300005937 | Bacteria | 3578 |
| 138 | Ga0081455_10061926 | 3300005937 | Bacteria | 3147 |
| 139 | Ga0081538_10042376 | 3300005981 | Bacteria | 2874 |
| 140 | Ga0081540_1011691 | 3300005983 | Bacteria | 5845 |
| 141 | Ga0081540_1014715 | 3300005983 | Bacteria | 4995 |
| 142 | Ga0081540_1021762 | 3300005983 | Bacteria | 3807 |
| 143 | Ga0081540_1024510 | 3300005983 | Bacteria | 3500 |
| 144 | Ga0081540_1033318 | 3300005983 | Bacteria | 2800 |
| 145 | Ga0081540_1035887 | 3300005983 | Bacteria | 2652 |
| 146 | Ga0081540_1060263 | 3300005983 | Bacteria | 1817 |
| 147 | Ga0081540_1065822 | 3300005983 | Bacteria | 1702 |
| 148 | Ga0081539_10000064 | 3300005985 | Bacteria | 247020 |
| 149 | Ga0081539_10002206 | 3300005985 | Bacteria | 28466 |
| 150 | Ga0081539_10079352 | 3300005985 | Bacteria | 1730 |
| 151 | Ga0081539_10114377 | 3300005985 | Bacteria | 1352 |
| 152 | Ga0070717_10001080 | 3300006028 | Bacteria | 18339 |
| 153 | Ga0075365_10066556 | 3300006038 | Bacteria | 2417 |
| 154 | Ga0075365_10126224 | 3300006038 | Bacteria | 1768 |
| 155 | Ga0075365_10171066 | 3300006038 | Bacteria | 1516 |
| 156 | Ga0075365_10176074 | 3300006038 | Bacteria | 1494 |
| 157 | Ga0075365_10221546 | 3300006038 | Bacteria | 1327 |
| 158 | Ga0075365_10284016 | 3300006038 | Bacteria | 1165 |
| 159 | Ga0075368_10021396 | 3300006042 | Bacteria | 2456 |
| 160 | Ga0075363_100005325 | 3300006048 | Bacteria | 5711 |
| 161 | Ga0075363_100030237 | 3300006048 | Bacteria | 2802 |
| 162 | Ga0075364_10005413 | 3300006051 | Bacteria | 7413 |
| 163 | Ga0075364_10022995 | 3300006051 | Bacteria | 3943 |
| 164 | Ga0075364_10098288 | 3300006051 | Bacteria | 1947 |
| 165 | Ga0075364_10139088 | 3300006051 | Bacteria | 1632 |
| 166 | Ga0070715_10088356 | 3300006163 | Bacteria | 1421 |
| 167 | Ga0070716_100000664 | 3300006173 | Bacteria | 14620 |
| 168 | Ga0070716_100000748 | 3300006173 | Bacteria | 13913 |
| 169 | Ga0070716_100068077 | 3300006173 | Bacteria | 2082 |
| 170 | Ga0070716_100145980 | 3300006173 | Bacteria | 1515 |
| 171 | Ga0070712_100006771 | 3300006175 | Bacteria | 7128 |
| 172 | Ga0070712_100022828 | 3300006175 | Bacteria | 4125 |
| 173 | Ga0070712_100061362 | 3300006175 | Bacteria | 2656 |
| 174 | Ga0070712_100161689 | 3300006175 | Bacteria | 1730 |
| 175 | Ga0075367_10015170 | 3300006178 | Bacteria | 4182 |
| 176 | Ga0075367_10041093 | 3300006178 | Bacteria | 2702 |
| 177 | Ga0075367_10114965 | 3300006178 | Bacteria | 1654 |
| 178 | Ga0075369_10056747 | 3300006186 | Bacteria | 1702 |
| 179 | Ga0075369_10057758 | 3300006186 | Bacteria | 1688 |
| 180 | Ga0075369_10066856 | 3300006186 | Bacteria | 1577 |
| 181 | Ga0075366_10085515 | 3300006195 | Bacteria | 1886 |
| 182 | Ga0075366_10110989 | 3300006195 | Bacteria | 1649 |
| 183 | Ga0075366_10115633 | 3300006195 | Bacteria | 1615 |
| 184 | Ga0075370_10136286 | 3300006353 | Bacteria | 1434 |
| 185 | Ga0075370_10163340 | 3300006353 | Bacteria | 1307 |
| 186 | Ga0068871_100226482 | 3300006358 | Bacteria | 1621 |
| 187 | Ga0068871_100237795 | 3300006358 | Bacteria | 1582 |
| 188 | Ga0075434_100028847 | 3300006871 | Bacteria | 5458 |
| 189 | Ga0075434_100502283 | 3300006871 | Bacteria | 1234 |
| 190 | Ga0068865_100076637 | 3300006881 | Bacteria | 2387 |
| 191 | Ga0097620_100177946 | 3300006931 | Bacteria | 2209 |
| 192 | Ga0097620_100378367 | 3300006931 | Bacteria | 1511 |
| 193 | Ga0099824_1035261 | 3300006942 | Bacteria | 1538 |
| 194 | Ga0099822_1048339 | 3300006943 | Bacteria | 1888 |
| 195 | Ga0075435_100130333 | 3300007076 | Bacteria | 2104 |
| 196 | Ga0099795_10018310 | 3300007788 | Bacteria | 2249 |
| 197 | Ga0099795_10022791 | 3300007788 | Bacteria | 2071 |
| 198 | Ga0105240_10001754 | 3300009093 | Bacteria | 36622 |
| 199 | Ga0105240_10096404 | 3300009093 | Bacteria | 3604 |
| 200 | Ga0111539_10170198 | 3300009094 | Bacteria | 2545 |
| 201 | Ga0105245_10047428 | 3300009098 | Bacteria | 3841 |
| 202 | Ga0105245_10476191 | 3300009098 | Bacteria | 1261 |
| 203 | Ga0105247_10110443 | 3300009101 | Bacteria | 1769 |
| 204 | Ga0105243_10088250 | 3300009148 | Bacteria | 2548 |
| 205 | Ga0105241_10002619 | 3300009174 | Bacteria | 13477 |
| 206 | Ga0105241_10149265 | 3300009174 | Bacteria | 1911 |
| 207 | Ga0105242_10216101 | 3300009176 | Bacteria | 1711 |
| 208 | Ga0105242_10223162 | 3300009176 | Bacteria | 1685 |
| 209 | Ga0105242_10306837 | 3300009176 | Bacteria | 1451 |
| 210 | Ga0105248_10169571 | 3300009177 | Bacteria | 2460 |
| 211 | Ga0105248_10269055 | 3300009177 | Bacteria | 1919 |
| 212 | Ga0105248_10305134 | 3300009177 | Bacteria | 1793 |
| 213 | Ga0105248_10385848 | 3300009177 | Bacteria | 1577 |
| 214 | Ga0105237_10005399 | 3300009545 | Bacteria | 14437 |
| 215 | Ga0105237_10056521 | 3300009545 | Bacteria | 3928 |
| 216 | Ga0105237_10155584 | 3300009545 | Bacteria | 2283 |
| 217 | Ga0105237_10427826 | 3300009545 | Bacteria | 1329 |
| 218 | Ga0105237_10436441 | 3300009545 | Bacteria | 1315 |
| 219 | Ga0105238_10001086 | 3300009551 | Bacteria | 27451 |
| 220 | Ga0105238_10012034 | 3300009551 | Bacteria | 8716 |
| 221 | Ga0105238_10041846 | 3300009551 | Bacteria | 4640 |
| 222 | Ga0105238_10046561 | 3300009551 | Bacteria | 4375 |
| 223 | Ga0105238_10090291 | 3300009551 | Bacteria | 3051 |
| 224 | Ga0105238_10259535 | 3300009551 | Bacteria | 1717 |
| 225 | Ga0105239_10087195 | 3300010375 | Bacteria | 3441 |
| 226 | Ga0105239_10089479 | 3300010375 | Bacteria | 3395 |
| 227 | Ga0105239_10095047 | 3300010375 | Bacteria | 3293 |
| 228 | Ga0105239_10118948 | 3300010375 | Bacteria | 2932 |
| 229 | Ga0105239_10123251 | 3300010375 | Bacteria | 2880 |
| 230 | Ga0105239_10201621 | 3300010375 | Bacteria | 2229 |
| 231 | Ga0105239_10582780 | 3300010375 | Bacteria | 1275 |
| 232 | Ga0105246_10055737 | 3300011119 | Bacteria | 2729 |
| 233 | Ga0105246_10094231 | 3300011119 | Bacteria | 2165 |
| 234 | Ga0105246_10156765 | 3300011119 | Bacteria | 1730 |
| 235 | Ga0157370_10148044 | 3300013104 | Bacteria | 2186 |
| 236 | Ga0157370_10179694 | 3300013104 | Bacteria | 1966 |
| 237 | Ga0157369_10010838 | 3300013105 | Bacteria | 10382 |
| 238 | Ga0157369_10206061 | 3300013105 | Bacteria | 2063 |
| 239 | Ga0157374_10232416 | 3300013296 | Bacteria | 1811 |
| 240 | Ga0157374_10242658 | 3300013296 | Bacteria | 1772 |
| 241 | Ga0163162_10091446 | 3300013306 | Bacteria | 3126 |
| 242 | Ga0163162_10134721 | 3300013306 | Bacteria | 2581 |
| 243 | Ga0163162_10314595 | 3300013306 | Bacteria | 1698 |
| 244 | Ga0157372_10244664 | 3300013307 | Bacteria | 2081 |
| 245 | Ga0157375_10014475 | 3300013308 | Bacteria | 7038 |
| 246 | Ga0157375_10459482 | 3300013308 | Bacteria | 1439 |
| 247 | Ga0163163_10151405 | 3300014325 | Bacteria | 2363 |
| 248 | Ga0163163_10272647 | 3300014325 | Bacteria | 1743 |
| 249 | Ga0157380_10275534 | 3300014326 | Bacteria | 1536 |
| 250 | Ga0157380_10309704 | 3300014326 | Bacteria | 1459 |
| 251 | Ga0157380_10464666 | 3300014326 | Bacteria | 1219 |
| 252 | Ga0157377_10121907 | 3300014745 | Bacteria | 1581 |
| 253 | Ga0157379_10149877 | 3300014968 | Bacteria | 2104 |
| 254 | Ga0157379_10183167 | 3300014968 | Bacteria | 1892 |
| 255 | Ga0157379_10451192 | 3300014968 | Bacteria | 1187 |
| 256 | Ga0157376_10285751 | 3300014969 | Bacteria | 1555 |
| 257 | Ga0163161_10271152 | 3300017792 | Bacteria | 1328 |
| 258 | Ga0214544_1000056 | 3300021320 | Bacteria | 132760 |
| 259 | Ga0214542_1000071 | 3300021321 | Bacteria | 124568 |
| 260 | Ga0214545_1000033 | 3300021324 | Bacteria | 124568 |
| 261 | Ga0214543_1000105 | 3300021327 | Bacteria | 108404 |
| 262 | Ga0213876_10001803 | 3300021384 | Bacteria | 12975 |
| 263 | Ga0213876_10140647 | 3300021384 | Bacteria | 1284 |
| 264 | Ga0209563_103943 | 3300025230 | Bacteria | 2930 |
| 265 | Ga0209677_102065 | 3300025253 | Bacteria | 7934 |
| 266 | Ga0209677_103578 | 3300025253 | Bacteria | 4941 |
| 267 | Ga0209455_1002169 | 3300025272 | Bacteria | 7785 |
| 268 | Ga0209455_1005163 | 3300025272 | Bacteria | 4102 |
| 269 | Ga0209564_1000494 | 3300025295 | Bacteria | 65041 |
| 270 | Ga0209564_1004819 | 3300025295 | Bacteria | 8035 |
| 271 | Ga0209564_1014152 | 3300025295 | Bacteria | 3338 |
| 272 | Ga0209758_1000293 | 3300025297 | Bacteria | 98643 |
| 273 | Ga0209758_1000363 | 3300025297 | Bacteria | 80753 |
| 274 | Ga0209758_1002182 | 3300025297 | Bacteria | 20519 |
| 275 | Ga0209758_1002431 | 3300025297 | Bacteria | 19009 |
| 276 | Ga0209758_1007289 | 3300025297 | Bacteria | 7587 |
| 277 | Ga0209758_1020122 | 3300025297 | Bacteria | 3176 |
| 278 | Ga0209758_1021319 | 3300025297 | Bacteria | 3023 |
| 279 | Ga0209758_1043810 | 3300025297 | Bacteria | 1644 |
| 280 | Ga0209758_1044141 | 3300025297 | Bacteria | 1634 |
| 281 | Ga0209256_1025597 | 3300025299 | Bacteria | 1715 |
| 282 | Ga0207426_1000628 | 3300025302 | Bacteria | 44820 |
| 283 | Ga0207426_1021037 | 3300025302 | Bacteria | 2259 |
| 284 | Ga0207426_1032857 | 3300025302 | Bacteria | 1678 |
| 285 | Ga0209051_1049651 | 3300025303 | Bacteria | 1411 |
| 286 | Ga0209257_1004770 | 3300025304 | Bacteria | 10117 |
| 287 | Ga0207656_10003723 | 3300025321 | Bacteria | 5277 |
| 288 | Ga0207656_10034381 | 3300025321 | Bacteria | 2116 |
| 289 | Ga0207653_10037315 | 3300025885 | Bacteria | 1585 |
| 290 | Ga0207692_10000489 | 3300025898 | Bacteria | 13992 |
| 291 | Ga0207692_10001833 | 3300025898 | Bacteria | 8070 |
| 292 | Ga0207692_10146904 | 3300025898 | Bacteria | 1346 |
| 293 | Ga0207688_10094818 | 3300025901 | Bacteria | 1717 |
| 294 | Ga0207688_10119321 | 3300025901 | Bacteria | 1538 |
| 295 | Ga0207647_10005928 | 3300025904 | Bacteria | 8911 |
| 296 | Ga0207647_10022688 | 3300025904 | Bacteria | 4165 |
| 297 | Ga0207647_10112955 | 3300025904 | Bacteria | 1605 |
| 298 | Ga0207685_10017251 | 3300025905 | Bacteria | 2330 |
| 299 | Ga0207699_10004893 | 3300025906 | Bacteria | 6408 |
| 300 | Ga0207699_10177335 | 3300025906 | Bacteria | 1430 |
| 301 | Ga0207645_10054999 | 3300025907 | Bacteria | 2541 |
| 302 | Ga0207654_10000175 | 3300025911 | Bacteria | 39744 |
| 303 | Ga0207654_10057116 | 3300025911 | Bacteria | 2267 |
| 304 | Ga0207654_10114889 | 3300025911 | Bacteria | 1681 |
| 305 | Ga0207654_10275673 | 3300025911 | Bacteria | 1136 |
| 306 | Ga0207707_10006420 | 3300025912 | Bacteria | 10269 |
| 307 | Ga0207707_10094981 | 3300025912 | Bacteria | 2606 |
| 308 | Ga0207707_10174435 | 3300025912 | Bacteria | 1878 |
| 309 | Ga0207695_10009236 | 3300025913 | Bacteria | 12220 |
| 310 | Ga0207695_10069546 | 3300025913 | Bacteria | 3602 |
| 311 | Ga0207695_10182037 | 3300025913 | Bacteria | 2022 |
| 312 | Ga0207695_10349839 | 3300025913 | Bacteria | 1365 |
| 313 | Ga0207671_10049421 | 3300025914 | Bacteria | 3114 |
| 314 | Ga0207671_10066601 | 3300025914 | Bacteria | 2681 |
| 315 | Ga0207671_10068734 | 3300025914 | Bacteria | 2640 |
| 316 | Ga0207671_10072485 | 3300025914 | Bacteria | 2571 |
| 317 | Ga0207671_10117218 | 3300025914 | Bacteria | 2032 |
| 318 | Ga0207671_10187877 | 3300025914 | Bacteria | 1610 |
| 319 | Ga0207693_10011033 | 3300025915 | Bacteria | 7323 |
| 320 | Ga0207693_10011474 | 3300025915 | Bacteria | 7168 |
| 321 | Ga0207693_10015141 | 3300025915 | Bacteria | 6190 |
| 322 | Ga0207693_10022773 | 3300025915 | Bacteria | 4974 |
| 323 | Ga0207663_10058429 | 3300025916 | Bacteria | 2434 |
| 324 | Ga0207663_10062979 | 3300025916 | Bacteria | 2360 |
| 325 | Ga0207663_10116758 | 3300025916 | Bacteria | 1820 |
| 326 | Ga0207663_10396334 | 3300025916 | Bacteria | 1055 |
| 327 | Ga0207660_10006956 | 3300025917 | Bacteria | 7325 |
| 328 | Ga0207660_10107988 | 3300025917 | Bacteria | 2089 |
| 329 | Ga0207660_10180179 | 3300025917 | Bacteria | 1641 |
| 330 | Ga0207660_10208081 | 3300025917 | Bacteria | 1531 |
| 331 | Ga0207662_10162946 | 3300025918 | Bacteria | 1426 |
| 332 | Ga0207657_10004312 | 3300025919 | Bacteria | 15074 |
| 333 | Ga0207657_10030642 | 3300025919 | Bacteria | 4881 |
| 334 | Ga0207657_10181769 | 3300025919 | Bacteria | 1700 |
| 335 | Ga0207657_10189204 | 3300025919 | Bacteria | 1661 |
| 336 | Ga0207652_10010962 | 3300025921 | Bacteria | 7308 |
| 337 | Ga0207652_10103551 | 3300025921 | Bacteria | 2516 |
| 338 | Ga0207652_10275043 | 3300025921 | Bacteria | 1519 |
| 339 | Ga0207652_10358357 | 3300025921 | Bacteria | 1316 |
| 340 | Ga0207646_10062005 | 3300025922 | Bacteria | 3338 |
| 341 | Ga0207681_10341544 | 3300025923 | Bacteria | 1196 |
| 342 | Ga0207694_10000226 | 3300025924 | Bacteria | 54504 |
| 343 | Ga0207694_10018472 | 3300025924 | Bacteria | 5271 |
| 344 | Ga0207694_10062964 | 3300025924 | Bacteria | 2889 |
| 345 | Ga0207694_10086361 | 3300025924 | Bacteria | 2470 |
| 346 | Ga0207650_10090200 | 3300025925 | Bacteria | 2341 |
| 347 | Ga0207659_10350710 | 3300025926 | Bacteria | 1224 |
| 348 | Ga0207687_10144393 | 3300025927 | Bacteria | 1809 |
| 349 | Ga0207687_10159431 | 3300025927 | Bacteria | 1730 |
| 350 | Ga0207700_10027465 | 3300025928 | Bacteria | 3986 |
| 351 | Ga0207700_10053782 | 3300025928 | Bacteria | 3018 |
| 352 | Ga0207700_10083890 | 3300025928 | Bacteria | 2496 |
| 353 | Ga0207700_10147668 | 3300025928 | Bacteria | 1940 |
| 354 | Ga0207700_10249354 | 3300025928 | Bacteria | 1516 |
| 355 | Ga0207700_10302826 | 3300025928 | Bacteria | 1381 |
| 356 | Ga0207664_10004352 | 3300025929 | Bacteria | 9590 |
| 357 | Ga0207664_10042658 | 3300025929 | Bacteria | 3542 |
| 358 | Ga0207664_10043916 | 3300025929 | Bacteria | 3498 |
| 359 | Ga0207664_10239471 | 3300025929 | Bacteria | 1580 |
| 360 | Ga0207644_10052228 | 3300025931 | Bacteria | 2937 |
| 361 | Ga0207644_10214732 | 3300025931 | Bacteria | 1522 |
| 362 | Ga0207644_10218990 | 3300025931 | Bacteria | 1508 |
| 363 | Ga0207690_10296022 | 3300025932 | Bacteria | 1265 |
| 364 | Ga0207706_10080388 | 3300025933 | Bacteria | 2866 |
| 365 | Ga0207706_10239310 | 3300025933 | Bacteria | 1587 |
| 366 | Ga0207686_10243828 | 3300025934 | Bacteria | 1309 |
| 367 | Ga0207709_10189716 | 3300025935 | Bacteria | 1459 |
| 368 | Ga0207670_10103182 | 3300025936 | Bacteria | 2040 |
| 369 | Ga0207665_10000235 | 3300025939 | Bacteria | 37854 |
| 370 | Ga0207665_10001984 | 3300025939 | Bacteria | 13791 |
| 371 | Ga0207665_10105429 | 3300025939 | Bacteria | 1974 |
| 372 | Ga0207665_10167723 | 3300025939 | Bacteria | 1583 |
| 373 | Ga0207691_10089157 | 3300025940 | Bacteria | 2766 |
| 374 | Ga0207711_10220555 | 3300025941 | Bacteria | 1734 |
| 375 | Ga0207711_10254365 | 3300025941 | Bacteria | 1614 |
| 376 | Ga0207689_10145962 | 3300025942 | Bacteria | 1949 |
| 377 | Ga0207689_10203379 | 3300025942 | Bacteria | 1635 |
| 378 | Ga0207689_10325570 | 3300025942 | Bacteria | 1276 |
| 379 | Ga0207661_10001179 | 3300025944 | Bacteria | 17473 |
| 380 | Ga0207661_10039390 | 3300025944 | Bacteria | 3709 |
| 381 | Ga0207679_10247549 | 3300025945 | Bacteria | 1513 |
| 382 | Ga0207679_10265154 | 3300025945 | Bacteria | 1467 |
| 383 | Ga0207667_10004170 | 3300025949 | Bacteria | 17753 |
| 384 | Ga0207667_10004673 | 3300025949 | Bacteria | 16774 |
| 385 | Ga0207667_10010892 | 3300025949 | Bacteria | 10602 |
| 386 | Ga0207667_10047542 | 3300025949 | Bacteria | 4541 |
| 387 | Ga0207667_10153908 | 3300025949 | Bacteria | 2366 |
| 388 | Ga0207667_10186840 | 3300025949 | Bacteria | 2127 |
| 389 | Ga0207667_10363491 | 3300025949 | Bacteria | 1476 |
| 390 | Ga0207668_10081435 | 3300025972 | Bacteria | 2348 |
| 391 | Ga0207668_10115575 | 3300025972 | Bacteria | 2021 |
| 392 | Ga0207640_10004452 | 3300025981 | Bacteria | 7593 |
| 393 | Ga0207640_10021376 | 3300025981 | Bacteria | 3856 |
| 394 | Ga0207658_10147266 | 3300025986 | Bacteria | 1914 |
| 395 | Ga0207677_10013346 | 3300026023 | Bacteria | 4757 |
| 396 | Ga0207703_10138291 | 3300026035 | Bacteria | 2111 |
| 397 | Ga0207639_10006164 | 3300026041 | Bacteria | 8141 |
| 398 | Ga0207639_10019626 | 3300026041 | Bacteria | 4824 |
| 399 | Ga0207639_10021327 | 3300026041 | Bacteria | 4652 |
| 400 | Ga0207639_10104816 | 3300026041 | Bacteria | 2293 |
| 401 | Ga0207639_10308097 | 3300026041 | Bacteria | 1402 |
| 402 | Ga0207678_10052756 | 3300026067 | Bacteria | 3507 |
| 403 | Ga0207678_10060689 | 3300026067 | Bacteria | 3252 |
| 404 | Ga0207678_10068056 | 3300026067 | Bacteria | 3056 |
| 405 | Ga0207678_10121258 | 3300026067 | Bacteria | 2231 |
| 406 | Ga0207678_10169969 | 3300026067 | Bacteria | 1861 |
| 407 | Ga0207678_10190307 | 3300026067 | Bacteria | 1753 |
| 408 | Ga0207678_10204927 | 3300026067 | Bacteria | 1687 |
| 409 | Ga0207678_10209987 | 3300026067 | Bacteria | 1665 |
| 410 | Ga0207678_10259286 | 3300026067 | Bacteria | 1490 |
| 411 | Ga0207708_10175218 | 3300026075 | Bacteria | 1701 |
| 412 | Ga0207708_10294888 | 3300026075 | Bacteria | 1317 |
| 413 | Ga0207702_10000004 | 3300026078 | Bacteria | 422182 |
| 414 | Ga0207702_10052064 | 3300026078 | Bacteria | 3462 |
| 415 | Ga0207702_10530611 | 3300026078 | Bacteria | 1150 |
| 416 | Ga0207641_10127533 | 3300026088 | Bacteria | 2280 |
| 417 | Ga0207641_10251432 | 3300026088 | Bacteria | 1651 |
| 418 | Ga0207641_10569331 | 3300026088 | Bacteria | 1106 |
| 419 | Ga0207648_10286296 | 3300026089 | Bacteria | 1474 |
| 420 | Ga0207648_10351005 | 3300026089 | Bacteria | 1330 |
| 421 | Ga0207676_10158453 | 3300026095 | Bacteria | 1958 |
| 422 | Ga0207676_10317651 | 3300026095 | Bacteria | 1428 |
| 423 | Ga0207674_10008354 | 3300026116 | Bacteria | 11974 |
| 424 | Ga0207674_10021710 | 3300026116 | Bacteria | 6909 |
| 425 | Ga0207674_10035034 | 3300026116 | Bacteria | 5240 |
| 426 | Ga0207674_10231467 | 3300026116 | Bacteria | 1795 |
| 427 | Ga0207674_10388239 | 3300026116 | Bacteria | 1350 |
| 428 | Ga0207675_100199827 | 3300026118 | Bacteria | 1920 |
| 429 | Ga0207683_10061295 | 3300026121 | Bacteria | 3310 |
| 430 | Ga0207683_10117340 | 3300026121 | Bacteria | 2386 |
| 431 | Ga0207683_10227305 | 3300026121 | Bacteria | 1701 |
| 432 | Ga0207683_10248661 | 3300026121 | Bacteria | 1622 |
| 433 | Ga0207698_10025144 | 3300026142 | Bacteria | 4189 |
| 434 | Ga0207698_10297811 | 3300026142 | Bacteria | 1500 |
| 435 | Ga0209389_1045303 | 3300027296 | Bacteria | 3237 |
| 436 | Ga0209589_1000032 | 3300027357 | Bacteria | 141881 |
| 437 | Ga0209813_10052997 | 3300027866 | Bacteria | 1274 |
| 438 | Ga0268266_10002812 | 3300028379 | Bacteria | 18151 |
| 439 | Ga0268266_10029434 | 3300028379 | Bacteria | 4668 |
| 440 | Ga0268266_10159216 | 3300028379 | Bacteria | 2041 |
| 441 | Ga0268265_10175233 | 3300028380 | Bacteria | 1837 |
| 442 | Ga0268265_10219803 | 3300028380 | Bacteria | 1661 |
| 443 | Ga0268265_10266720 | 3300028380 | Bacteria | 1525 |
| 444 | Ga0268264_10000157 | 3300028381 | Bacteria | 155163 |
| 445 | Ga0265337_1016358 | 3300028556 | Bacteria | 2399 |
| 446 | Ga0265318_10012173 | 3300028577 | Bacteria | 3671 |
| 447 | Ga0265323_10001778 | 3300028653 | Bacteria | 10233 |
| 448 | Ga0265336_10000235 | 3300028666 | Bacteria | 39578 |
| 449 | Ga0307517_10000563 | 3300028786 | Bacteria | 63467 |
| 450 | Ga0307515_10008720 | 3300028794 | Bacteria | 19712 |
| 451 | Ga0307515_10216473 | 3300028794 | Bacteria | 1745 |
| 452 | Ga0307515_10306556 | 3300028794 | Bacteria | 1267 |
| 453 | Ga0265338_10005155 | 3300028800 | Bacteria | 17189 |
| 454 | Ga0265330_10028933 | 3300031235 | Bacteria | 2494 |
| 455 | Ga0265330_10031347 | 3300031235 | Bacteria | 2383 |
| 456 | Ga0265330_10038596 | 3300031235 | Bacteria | 2123 |
| 457 | Ga0265325_10013306 | 3300031241 | Bacteria | 4686 |
| 458 | Ga0265340_10018279 | 3300031247 | Bacteria | 3616 |
| 459 | Ga0265339_10004403 | 3300031249 | Bacteria | 9609 |
| 460 | Ga0265339_10031070 | 3300031249 | Bacteria | 3020 |
| 461 | Ga0265331_10124615 | 3300031250 | Bacteria | 1177 |
| 462 | Ga0265331_10140112 | 3300031250 | Bacteria | 1100 |
| 463 | Ga0265316_10045955 | 3300031344 | Bacteria | 3463 |
| 464 | Ga0307513_10112840 | 3300031456 | Bacteria | 2707 |
| 465 | Ga0307509_10146627 | 3300031507 | Bacteria | 2284 |
| 466 | Ga0307508_10111626 | 3300031616 | Bacteria | 2334 |
| 467 | Ga0307508_10197490 | 3300031616 | Bacteria | 1613 |
| 468 | Ga0265314_10003979 | 3300031711 | Bacteria | 13976 |
| 469 | Ga0265314_10039691 | 3300031711 | Bacteria | 3387 |
| 470 | Ga0265314_10056041 | 3300031711 | Bacteria | 2716 |
| 471 | Ga0307516_10008798 | 3300031730 | Bacteria | 11346 |
| 472 | Ga0307516_10029494 | 3300031730 | Bacteria | 5547 |
| 473 | Ga0307516_10072493 | 3300031730 | Bacteria | 3303 |
| 474 | Ga0307516_10123753 | 3300031730 | Bacteria | 2373 |
| 475 | Ga0307516_10150815 | 3300031730 | Bacteria | 2085 |
| 476 | Ga0307405_10122141 | 3300031731 | Bacteria | 1784 |
| 477 | Ga0307412_10021273 | 3300031911 | Bacteria | 3960 |
| 478 | Ga0307409_100188945 | 3300031995 | Bacteria | 1831 |
| 479 | Ga0307416_100731718 | 3300032002 | Bacteria | 1081 |
| 480 | Ga0307414_10274834 | 3300032004 | Bacteria | 1413 |
| 481 | Ga0307415_100137369 | 3300032126 | Bacteria | 1861 |
| 482 | Ga0307507_10127820 | 3300033179 | Bacteria | 2002 |
| 483 | Ga0307510_10016268 | 3300033180 | Bacteria | 8782 |
| 484 | Ga0373929_0011781 | 3300035085 | Bacteria | 1653 |
| 485 | Ga0373934_0014023 | 3300035086 | Bacteria | 3034 |
| 486 | Ga0373934_0017026 | 3300035086 | Bacteria | 2770 |
| 487 | Ga0373923_0036024 | 3300035111 | Bacteria | 2017 |
| 488 | Ga0373923_0054605 | 3300035111 | Bacteria | 1682 |
| 489 | Ga0373923_0059945 | 3300035111 | Bacteria | 1614 |
| 490 | Ga0373923_0097735 | 3300035111 | Bacteria | 1291 |
| 491 | Ga0373932_0020184 | 3300035112 | Bacteria | 1745 |
| 492 | Ga0373945_0004476 | 3300035116 | Bacteria | 4442 |
| 493 | Ga0373945_0014361 | 3300035116 | Bacteria | 2652 |
| 494 | Ga0373945_0048748 | 3300035116 | Bacteria | 1553 |
| 495 | Ga0373953_0002371 | 3300035117 | Bacteria | 5685 |
| 496 | Ga0373953_0017348 | 3300035117 | Bacteria | 2645 |
| 497 | Ga0373954_0000485 | 3300035118 | Bacteria | 14918 |
| 498 | Ga0373954_0011861 | 3300035118 | Bacteria | 3870 |
| 499 | Ga0373956_0002322 | 3300035119 | Bacteria | 7818 |
| 500 | Ga0373957_0002098 | 3300035120 | Bacteria | 5594 |
| 501 | Ga0373943_0041100 | 3300035170 | Bacteria | 2235 |
| 502 | Ga0373946_0006060 | 3300035171 | Bacteria | 4383 |
| 503 | Ga0373946_0026634 | 3300035171 | Bacteria | 2282 |
| 504 | Ga0373955_0001048 | 3300035172 | Bacteria | 11759 |
| 505 | Ga0373955_0020825 | 3300035172 | Bacteria | 3301 |
| 506 | Ga0373955_0029460 | 3300035172 | Bacteria | 2855 |
| 507 | Ga0373924_0010097 | 3300035410 | Bacteria | 3476 |
| 508 | Ga0373931_0001548 | 3300035691 | Bacteria | 9916 |
| 509 | Ga0373935_0053046 | 3300035692 | Bacteria | 2579 |
| 510 | Ga0373927_0003498 | 3300035695 | Bacteria | 11247 |
| 511 | Ga0373927_0022428 | 3300035695 | Bacteria | 4136 |
| 512 | Ga0373927_0062796 | 3300035695 | Bacteria | 2402 |
| 513 | Ga0373927_0101520 | 3300035695 | Bacteria | 1871 |
| 514 | Ga0373933_0000118 | 3300035724 | Bacteria | 51316 |
| 515 | Ga0373933_0006053 | 3300035724 | Bacteria | 6581 |
| 516 | Ga0373933_0097317 | 3300035724 | Bacteria | 1822 |
| 517 | Ga0373947_0004053 | 3300035725 | Bacteria | 8620 |
| 518 | Ga0373947_0009689 | 3300035725 | Bacteria | 5527 |
| 519 | Ga0373947_0021326 | 3300035725 | Bacteria | 3749 |
| 520 | Ga0373947_0041568 | 3300035725 | Bacteria | 2741 |
| 521 | Ga0373947_0046047 | 3300035725 | Bacteria | 2611 |
| 522 | Ga0373947_0133742 | 3300035725 | Bacteria | 1585 |
| 523 | Ga0373937_0012128 | 3300036401 | Bacteria | 7565 |
| 524 | Ga0373937_0300788 | 3300036401 | Bacteria | 1516 |
| 525 | Ga0373925_0033366 | 3300037068 | Bacteria | 3793 |
| 526 | Ga0373925_0106535 | 3300037068 | Bacteria | 2161 |
| 527 | Ga0373925_0249118 | 3300037068 | Bacteria | 1424 |
| 528 | Ga0395899_0021904 | 3300037312 | Bacteria | 4847 |
| 529 | Ga0395900_0021426 | 3300037418 | Bacteria | 6608 |
| 530 | Ga0395900_0139445 | 3300037418 | Bacteria | 2484 |
| 531 | Ga0395900_0166459 | 3300037418 | Bacteria | 2246 |
| 532 | Ga0395898_0173338 | 3300037466 | Bacteria | 2062 |
| 533 | Ga0395905_0023934 | 3300037471 | Bacteria | 5766 |
| 534 | Ga0395905_0108510 | 3300037471 | Bacteria | 2606 |
| 535 | Ga0395901_0181332 | 3300038443 | Bacteria | 2209 |
| 536 | Ga0395901_0306555 | 3300038443 | Bacteria | 1645 |
| 537 | Ga0395901_0431503 | 3300038443 | Bacteria | 1350 |
| 538 | Ga0436365_0361268 | 3300039437 | Bacteria | 2498 |
| 539 | Ga0436365_0517722 | 3300039437 | Bacteria | 5048 |
| 540 | Ga0436360_0293778 | 3300039438 | Bacteria | 2982 |
| 541 | Ga0436361_1023898 | 3300039447 | Bacteria | 3273 |
| 542 | Ga0436363_1514070 | 3300039450 | Bacteria | 1125 |
| 543 | Ga0436362_1162178 | 3300039453 | Bacteria | 3662 |
| 544 | Ga0439465_0068274 | 3300041413 | Bacteria | 1188 |
| 545 | Ga0451853_0973839 | 3300041512 | Bacteria | 1978 |
| 546 | Ga0466965_0017444 | 3300044683 | Bacteria | 3432 |
| 547 | Ga0466963_0044606 | 3300044694 | Bacteria | 2919 |
| 548 | Ga0466970_0065407 | 3300044765 | Bacteria | 1951 |
| 549 | Ga0466959_0195472 | 3300045049 | Bacteria | 1410 |
| 550 | Ga0466967_0044378 | 3300045976 | Bacteria | 3856 |
| 551 | Ga0466967_0131367 | 3300045976 | Bacteria | 2325 |
| 552 | Ga0495592_0000993 | 3300046454 | Bacteria | 19682 |
| 553 | Ga0495592_0024966 | 3300046454 | Bacteria | 4540 |
| 554 | Ga0495603_0000826 | 3300046455 | Bacteria | 17795 |
| 555 | Ga0495603_0003332 | 3300046455 | Bacteria | 9567 |
| 556 | Ga0495603_0011755 | 3300046455 | Bacteria | 5297 |
| 557 | Ga0495603_0038493 | 3300046455 | Bacteria | 2867 |
| 558 | Ga0495603_0041753 | 3300046455 | Bacteria | 2742 |
| 559 | Ga0495603_0189697 | 3300046455 | Bacteria | 1189 |
| 560 | Ga0495590_0033206 | 3300046457 | Bacteria | 1804 |
| 561 | Ga0495629_0000337 | 3300046459 | Bacteria | 40017 |
| 562 | Ga0495629_0000587 | 3300046459 | Bacteria | 29538 |
| 563 | Ga0495629_0046968 | 3300046459 | Bacteria | 3028 |
| 564 | Ga0495629_0098022 | 3300046459 | Bacteria | 2045 |
| 565 | Ga0495629_0230143 | 3300046459 | Bacteria | 1278 |
| 566 | Ga0495638_0009712 | 3300046460 | Bacteria | 6725 |
| 567 | Ga0495638_0051601 | 3300046460 | Bacteria | 2565 |
| 568 | Ga0495638_0166544 | 3300046460 | Bacteria | 1267 |
| 569 | Ga0495641_0003504 | 3300046461 | Bacteria | 11691 |
| 570 | Ga0495651_0003587 | 3300046462 | Bacteria | 11904 |
| 571 | Ga0495651_0039355 | 3300046462 | Bacteria | 3681 |
| 572 | Ga0495651_0044737 | 3300046462 | Bacteria | 3431 |
| 573 | Ga0495651_0088120 | 3300046462 | Bacteria | 2333 |
| 574 | Ga0495653_0010108 | 3300046463 | Bacteria | 7721 |
| 575 | Ga0495653_0030974 | 3300046463 | Bacteria | 4255 |
| 576 | Ga0495653_0081954 | 3300046463 | Bacteria | 2383 |
| 577 | Ga0495580_0025540 | 3300046472 | Bacteria | 4317 |
| 578 | Ga0495582_0000018 | 3300046473 | Bacteria | 93753 |
| 579 | Ga0495582_0057510 | 3300046473 | Bacteria | 2144 |
| 580 | Ga0495639_0000272 | 3300046475 | Bacteria | 25666 |
| 581 | Ga0495639_0041989 | 3300046475 | Bacteria | 2061 |
| 582 | Ga0495662_0002085 | 3300046476 | Bacteria | 10023 |
| 583 | Ga0495662_0013233 | 3300046476 | Bacteria | 4016 |
| 584 | Ga0495664_0006563 | 3300046477 | Bacteria | 6428 |
| 585 | Ga0495664_0020862 | 3300046477 | Bacteria | 3782 |
| 586 | Ga0495664_0071543 | 3300046477 | Bacteria | 2071 |
| 587 | Ga0495664_0238881 | 3300046477 | Bacteria | 1099 |
| 588 | Ga0495584_0091861 | 3300046491 | Bacteria | 1531 |
| 589 | Ga0495585_0035860 | 3300046492 | Bacteria | 2800 |
| 590 | Ga0495594_0000155 | 3300046499 | Bacteria | 32688 |
| 591 | Ga0495594_0075554 | 3300046499 | Bacteria | 1878 |
| 592 | Ga0495594_0109963 | 3300046499 | Bacteria | 1554 |
| 593 | Ga0495583_0042472 | 3300046506 | Bacteria | 2123 |
| 594 | Ga0495606_0000676 | 3300046507 | Bacteria | 53366 |
| 595 | Ga0495606_0117167 | 3300046507 | Bacteria | 1599 |
| 596 | Ga0495606_0153692 | 3300046507 | Bacteria | 1348 |
| 597 | Ga0495608_0001320 | 3300046511 | Bacteria | 17655 |
| 598 | Ga0495608_0051601 | 3300046511 | Bacteria | 2725 |
| 599 | Ga0495616_0016900 | 3300046513 | Bacteria | 4029 |
| 600 | Ga0495616_0025703 | 3300046513 | Bacteria | 3142 |
| 601 | Ga0495618_0004991 | 3300046514 | Bacteria | 8108 |
| 602 | Ga0495620_0040570 | 3300046515 | Bacteria | 2047 |
| 603 | Ga0495628_0010505 | 3300046516 | Bacteria | 7859 |
| 604 | Ga0495628_0016528 | 3300046516 | Bacteria | 6154 |
| 605 | Ga0495628_0064930 | 3300046516 | Bacteria | 2857 |
| 606 | Ga0495630_0018269 | 3300046517 | Bacteria | 5149 |
| 607 | Ga0495630_0079856 | 3300046517 | Bacteria | 2467 |
| 608 | Ga0495630_0119514 | 3300046517 | Bacteria | 1999 |
| 609 | Ga0495631_0055303 | 3300046518 | Bacteria | 1729 |
| 610 | Ga0495632_0061977 | 3300046519 | Bacteria | 1814 |
| 611 | Ga0495643_0014351 | 3300046522 | Bacteria | 4714 |
| 612 | Ga0495648_0001519 | 3300046524 | Bacteria | 22713 |
| 613 | Ga0495648_0189502 | 3300046524 | Bacteria | 1039 |
| 614 | Ga0495666_0151344 | 3300046526 | Bacteria | 1079 |
| 615 | Ga0495666_0162627 | 3300046526 | Bacteria | 1035 |
| 616 | Ga0495652_0001922 | 3300046529 | Bacteria | 22097 |
| 617 | Ga0495652_0025697 | 3300046529 | Bacteria | 5205 |
| 618 | Ga0495652_0047147 | 3300046529 | Bacteria | 3696 |
| 619 | Ga0495654_0032538 | 3300046530 | Bacteria | 2643 |
| 620 | Ga0495665_0009932 | 3300046531 | Bacteria | 5153 |
| 621 | Ga0495640_0020760 | 3300046533 | Bacteria | 4830 |
| 622 | Ga0495640_0038318 | 3300046533 | Bacteria | 3372 |
| 623 | Ga0495640_0122210 | 3300046533 | Bacteria | 1691 |
| 624 | Ga0495587_0003825 | 3300046536 | Bacteria | 9992 |
| 625 | Ga0495645_0121085 | 3300046543 | Bacteria | 1842 |
| 626 | Ga0495622_0006549 | 3300046557 | Bacteria | 5401 |
| 627 | Ga0495622_0010378 | 3300046557 | Bacteria | 4307 |
| 628 | Ga0495622_0090200 | 3300046557 | Bacteria | 1408 |
| 629 | Ga0495633_0098374 | 3300046558 | Bacteria | 1358 |
| 630 | Ga0495633_0137069 | 3300046558 | Bacteria | 1132 |
| 631 | Ga0495667_0000270 | 3300046559 | Bacteria | 33708 |
| 632 | Ga0495667_0083208 | 3300046559 | Bacteria | 2078 |
| 633 | Ga0495656_0003938 | 3300046615 | Bacteria | 5044 |
| 634 | Ga0495656_0023834 | 3300046615 | Bacteria | 2411 |
| 635 | Ga0495656_0139055 | 3300046615 | Bacteria | 1163 |
| 636 | Ga0495634_0005445 | 3300046642 | Bacteria | 9793 |
| 637 | Ga0495634_0006589 | 3300046642 | Bacteria | 8808 |
| 638 | Ga0495634_0015449 | 3300046642 | Bacteria | 5486 |
| 639 | Ga0495634_0034758 | 3300046642 | Bacteria | 3456 |
| 640 | Ga0495611_0067269 | 3300046648 | Bacteria | 1635 |
| 641 | Ga0495625_0094725 | 3300046660 | Bacteria | 2059 |
| 642 | Ga0495635_0017934 | 3300046663 | Bacteria | 4944 |
| 643 | Ga0495635_0025981 | 3300046663 | Bacteria | 4077 |
| 644 | Ga0495659_0020954 | 3300046664 | Bacteria | 2199 |
| 645 | Ga0495661_0125050 | 3300046665 | Bacteria | 1416 |
| 646 | Ga0495588_0024462 | 3300046674 | Bacteria | 3000 |
| 647 | Ga0495588_0040661 | 3300046674 | Bacteria | 2372 |
| 648 | Ga0495657_0007029 | 3300046675 | Bacteria | 8728 |
| 649 | Ga0495599_0000635 | 3300046678 | Bacteria | 19831 |
| 650 | Ga0495599_0011248 | 3300046678 | Bacteria | 5496 |
| 651 | Ga0495623_0019394 | 3300046679 | Bacteria | 4396 |
| 652 | Ga0495623_0026008 | 3300046679 | Bacteria | 3769 |
| 653 | Ga0495646_0002988 | 3300046680 | Bacteria | 10483 |
| 654 | Ga0495646_0026378 | 3300046680 | Bacteria | 3649 |
| 655 | Ga0495646_0100179 | 3300046680 | Bacteria | 1662 |
| 656 | Ga0495647_0000364 | 3300046681 | Bacteria | 12782 |
| 657 | Ga0495658_0001654 | 3300046683 | Bacteria | 11591 |
| 658 | Ga0495658_0085375 | 3300046683 | Bacteria | 1860 |
| 659 | Ga0495669_0039055 | 3300046684 | Bacteria | 2101 |
| 660 | Ga0495613_0077391 | 3300046689 | Bacteria | 2420 |
| 661 | Ga0495613_0114019 | 3300046689 | Bacteria | 1946 |
| 662 | Ga0495624_0001316 | 3300046690 | Bacteria | 19466 |
| 663 | Ga0495670_0139870 | 3300046691 | Bacteria | 1265 |
| 664 | Ga0495589_0076920 | 3300046794 | Bacteria | 1626 |
| 665 | Ga0495600_0000400 | 3300046809 | Bacteria | 22448 |
| 666 | Ga0495600_0034034 | 3300046809 | Bacteria | 3308 |
| 667 | Ga0495660_0090475 | 3300046810 | Bacteria | 1591 |
| 668 | Ga0495581_0001084 | 3300047315 | Bacteria | 14807 |
| 669 | Ga0495581_0103630 | 3300047315 | Bacteria | 1653 |
| 670 | Ga0495604_0001388 | 3300047317 | Bacteria | 19846 |
| 671 | Ga0495604_0037402 | 3300047317 | Bacteria | 3823 |
| 672 | Ga0495604_0213363 | 3300047317 | Bacteria | 1333 |
| 673 | Ga0495636_0055830 | 3300047318 | Bacteria | 1661 |
| 674 | Ga0495636_0163128 | 3300047318 | Bacteria | 1005 |
| 675 | Ga0495674_0003842 | 3300047319 | Bacteria | 14589 |
| 676 | Ga0495674_0035096 | 3300047319 | Bacteria | 4527 |
| 677 | Ga0495674_0039376 | 3300047319 | Bacteria | 4237 |
| 678 | Ga0495674_0118784 | 3300047319 | Bacteria | 2235 |
| 679 | Ga0495672_0013378 | 3300047320 | Bacteria | 5664 |
| 680 | Ga0495676_0033669 | 3300047321 | Bacteria | 4311 |
| 681 | Ga0495676_0045100 | 3300047321 | Bacteria | 3592 |
| 682 | Ga0495676_0149290 | 3300047321 | Bacteria | 1666 |
| 683 | Ga0495680_0002455 | 3300047322 | Bacteria | 18966 |
| 684 | Ga0495683_0122973 | 3300047323 | Bacteria | 1230 |
| 685 | Ga0495675_0002361 | 3300047444 | Bacteria | 11267 |
| 686 | Ga0495675_0003169 | 3300047444 | Bacteria | 9876 |
| 687 | Ga0495677_0060857 | 3300047445 | Bacteria | 1400 |
| 688 | Ga0495673_0018066 | 3300047469 | Bacteria | 3565 |
| 689 | Ga0495681_0038298 | 3300047470 | Bacteria | 2351 |
| 690 | Ga0495681_0081924 | 3300047470 | Bacteria | 1439 |
| 691 | Ga0495684_0000766 | 3300047471 | Bacteria | 25966 |
| 692 | Ga0495684_0049392 | 3300047471 | Bacteria | 3214 |
| 693 | Ga0495684_0067312 | 3300047471 | Bacteria | 2724 |
| 694 | Ga0495686_0056518 | 3300047472 | Bacteria | 2451 |
| 695 | Ga0495686_0140171 | 3300047472 | Bacteria | 1427 |
| 696 | Ga0495686_0148132 | 3300047472 | Bacteria | 1380 |
| 697 | Ga0495593_0000120 | 3300047673 | Bacteria | 37884 |
| 698 | Ga0495593_0000419 | 3300047673 | Bacteria | 23659 |
| 699 | Ga0495602_0028204 | 3300048088 | Bacteria | 5376 |
| 700 | Ga0495602_0142965 | 3300048088 | Bacteria | 1892 |
| 701 | Ga0495615_0009784 | 3300048090 | Bacteria | 1897 |
| 702 | Ga0495615_0012694 | 3300048090 | Bacteria | 1743 |
| 703 | Ga0496100_0187894 | 3300048903 | Bacteria | 1498 |
| 704 | Ga0496101_0047737 | 3300048904 | Bacteria | 3075 |
| 705 | Ga0496101_0086361 | 3300048904 | Bacteria | 2326 |
| 706 | Ga0496101_0117688 | 3300048904 | Bacteria | 2006 |
| 707 | Ga0496101_0206518 | 3300048904 | Bacteria | 1520 |
| 708 | Ga0496102_0001803 | 3300048905 | Bacteria | 18529 |
| 709 | Ga0496102_0093012 | 3300048905 | Bacteria | 2793 |
| 710 | Ga0496102_0109527 | 3300048905 | Bacteria | 2574 |
| 711 | Ga0496102_0124592 | 3300048905 | Bacteria | 2408 |
| 712 | Ga0496102_0191935 | 3300048905 | Bacteria | 1925 |
| 713 | Ga0496102_0242013 | 3300048905 | Bacteria | 1701 |
| 714 | Ga0496102_0244804 | 3300048905 | Bacteria | 1691 |
| 715 | Ga0496102_0359249 | 3300048905 | Bacteria | 1371 |
| 716 | Ga0496103_0074424 | 3300048906 | Bacteria | 2129 |
| 717 | Ga0496103_0090204 | 3300048906 | Bacteria | 1934 |
| 718 | Ga0496103_0150626 | 3300048906 | Bacteria | 1490 |
| 719 | Ga0496104_0003129 | 3300048907 | Bacteria | 14269 |
| 720 | Ga0496104_0363437 | 3300048907 | Bacteria | 1360 |
| 721 | Ga0496105_0026604 | 3300048908 | Bacteria | 4721 |
| 722 | Ga0496105_0254621 | 3300048908 | Bacteria | 1421 |
| 723 | Ga0496106_0005088 | 3300048909 | Bacteria | 9736 |
| 724 | Ga0496106_0006879 | 3300048909 | Bacteria | 8416 |
| 725 | Ga0496106_0014676 | 3300048909 | Bacteria | 5790 |
| 726 | Ga0496106_0158620 | 3300048909 | Bacteria | 1788 |
| 727 | Ga0496106_0238368 | 3300048909 | Bacteria | 1453 |
| 728 | Ga0496106_0299069 | 3300048909 | Bacteria | 1290 |
| 729 | Ga0496106_0367271 | 3300048909 | Bacteria | 1156 |
| 730 | Ga0496106_0426917 | 3300048909 | Bacteria | 1065 |
| 731 | Ga0496107_0054072 | 3300048910 | Bacteria | 2897 |
| 732 | Ga0496107_0149029 | 3300048910 | Bacteria | 1730 |
| 733 | Ga0496107_0366972 | 3300048910 | Bacteria | 1071 |
| 734 | Ga0496108_0000489 | 3300048911 | Bacteria | 31675 |
| 735 | Ga0496108_0029193 | 3300048911 | Bacteria | 4566 |
| 736 | Ga0496108_0120168 | 3300048911 | Bacteria | 2253 |
| 737 | Ga0496108_0190547 | 3300048911 | Bacteria | 1777 |
| 738 | Ga0496109_0002105 | 3300048912 | Bacteria | 16544 |
| 739 | Ga0496109_0022102 | 3300048912 | Bacteria | 5630 |
| 740 | Ga0496109_0054089 | 3300048912 | Bacteria | 3663 |
| 741 | Ga0496109_0059949 | 3300048912 | Bacteria | 3477 |
| 742 | Ga0496109_0182720 | 3300048912 | Bacteria | 1970 |
| 743 | Ga0496109_0392401 | 3300048912 | Bacteria | 1311 |
| 744 | Ga0496109_0437752 | 3300048912 | Bacteria | 1235 |
| 745 | Ga0496110_0003310 | 3300048913 | Bacteria | 12308 |
| 746 | Ga0496110_0013612 | 3300048913 | Bacteria | 6734 |
| 747 | Ga0496110_0065232 | 3300048913 | Bacteria | 3219 |
| 748 | Ga0496110_0104648 | 3300048913 | Bacteria | 2539 |
| 749 | Ga0496110_0120601 | 3300048913 | Bacteria | 2362 |
| 750 | Ga0496110_0146047 | 3300048913 | Bacteria | 2139 |
| 751 | Ga0496110_0337332 | 3300048913 | Bacteria | 1373 |
| 752 | Ga0496111_0038120 | 3300048914 | Bacteria | 3442 |
| 753 | Ga0496111_0117296 | 3300048914 | Bacteria | 1964 |
| 754 | Ga0496111_0135324 | 3300048914 | Bacteria | 1825 |
| 755 | Ga0496111_0249230 | 3300048914 | Bacteria | 1318 |
| 756 | Ga0496112_0000015 | 3300048915 | Bacteria | 206423 |
| 757 | Ga0496112_0001918 | 3300048915 | Bacteria | 16401 |
| 758 | Ga0496112_0002702 | 3300048915 | Bacteria | 14343 |
| 759 | Ga0496112_0038437 | 3300048915 | Bacteria | 4673 |
| 760 | Ga0496112_0097212 | 3300048915 | Bacteria | 2915 |
| 761 | Ga0496113_0013883 | 3300048916 | Bacteria | 5475 |
| 762 | Ga0496113_0024191 | 3300048916 | Bacteria | 4314 |
| 763 | Ga0496113_0090147 | 3300048916 | Bacteria | 2361 |
| 764 | Ga0496113_0141387 | 3300048916 | Bacteria | 1894 |
| 765 | Ga0496113_0156802 | 3300048916 | Bacteria | 1798 |
| 766 | Ga0496114_0040283 | 3300048917 | Bacteria | 3867 |
| 767 | Ga0496114_0096292 | 3300048917 | Bacteria | 2520 |
| 768 | Ga0496114_0122395 | 3300048917 | Bacteria | 2239 |
| 769 | Ga0496115_0008944 | 3300048918 | Bacteria | 7428 |
| 770 | Ga0496115_0078751 | 3300048918 | Bacteria | 2681 |
| 771 | Ga0496115_0150684 | 3300048918 | Bacteria | 1920 |
| 772 | Ga0496115_0194441 | 3300048918 | Bacteria | 1676 |
| 773 | Ga0496116_0122458 | 3300048919 | Bacteria | 1502 |
| 774 | Ga0496116_0143726 | 3300048919 | Bacteria | 1337 |
| 775 | Ga0496117_0045804 | 3300048920 | Bacteria | 3154 |
| 776 | Ga0496117_0079333 | 3300048920 | Bacteria | 2163 |
| 777 | Ga0496118_0024960 | 3300048921 | Bacteria | 5143 |
| 778 | Ga0496118_0186683 | 3300048921 | Bacteria | 1245 |
| 779 | Ga0496119_0074108 | 3300048922 | Bacteria | 1983 |
| 780 | Ga0496119_0078447 | 3300048922 | Bacteria | 1910 |
| 781 | Ga0496119_0105608 | 3300048922 | Bacteria | 1573 |
| 782 | Ga0496119_0133008 | 3300048922 | Bacteria | 1353 |
| 783 | Ga0496120_0024597 | 3300048923 | Bacteria | 3752 |
| 784 | Ga0496120_0036759 | 3300048923 | Bacteria | 2911 |
| 785 | Ga0496121_0000423 | 3300048924 | Bacteria | 83271 |
| 786 | Ga0496121_0000786 | 3300048924 | Bacteria | 57998 |
| 787 | Ga0496121_0007421 | 3300048924 | Bacteria | 13247 |
| 788 | Ga0496121_0024035 | 3300048924 | Bacteria | 5841 |
| 789 | Ga0496121_0025033 | 3300048924 | Bacteria | 5682 |
| 790 | Ga0496121_0047595 | 3300048924 | Bacteria | 3657 |
| 791 | Ga0496121_0075538 | 3300048924 | Bacteria | 2691 |
| 792 | Ga0496121_0082258 | 3300048924 | Bacteria | 2546 |
| 793 | Ga0496121_0111142 | 3300048924 | Bacteria | 2090 |
| 794 | Ga0496121_0153967 | 3300048924 | Bacteria | 1688 |
| 795 | Ga0496122_0043747 | 3300048925 | Bacteria | 3504 |
| 796 | Ga0496122_0068887 | 3300048925 | Bacteria | 2537 |
| 797 | Ga0496123_0015148 | 3300048926 | Bacteria | 6344 |
| 798 | Ga0496123_0038344 | 3300048926 | Bacteria | 3369 |
| 799 | Ga0496123_0167882 | 3300048926 | Bacteria | 1161 |
| 800 | Ga0496124_0001593 | 3300048927 | Bacteria | 32664 |
| 801 | Ga0496124_0074254 | 3300048927 | Bacteria | 2811 |
| 802 | Ga0496124_0201352 | 3300048927 | Bacteria | 1514 |
| 803 | Ga0496124_0304529 | 3300048927 | Bacteria | 1149 |
| 804 | Ga0496125_0000136 | 3300048928 | Bacteria | 160544 |
| 805 | Ga0496125_0005117 | 3300048928 | Bacteria | 14761 |
| 806 | Ga0496125_0006320 | 3300048928 | Bacteria | 12853 |
| 807 | Ga0496125_0017029 | 3300048928 | Bacteria | 6946 |
| 808 | Ga0496125_0022131 | 3300048928 | Bacteria | 5909 |
| 809 | Ga0496125_0103548 | 3300048928 | Bacteria | 2088 |
| 810 | Ga0496126_0023465 | 3300048929 | Bacteria | 5978 |
| 811 | Ga0496126_0024069 | 3300048929 | Bacteria | 5884 |
| 812 | Ga0496126_0038548 | 3300048929 | Bacteria | 4445 |
| 813 | Ga0496126_0068807 | 3300048929 | Bacteria | 3159 |
| 814 | Ga0496126_0072836 | 3300048929 | Bacteria | 3055 |
| 815 | Ga0496126_0087116 | 3300048929 | Bacteria | 2751 |
| 816 | Ga0496126_0104032 | 3300048929 | Bacteria | 2480 |
| 817 | Ga0496126_0119044 | 3300048929 | Bacteria | 2292 |
| 818 | Ga0496126_0182386 | 3300048929 | Bacteria | 1782 |
| 819 | Ga0501031_0026397 | 3300049568 | Bacteria | 3787 |
| 820 | Ga0501031_0203827 | 3300049568 | Bacteria | 1290 |
| 821 | Ga0501032_0010560 | 3300049569 | Bacteria | 6658 |
| 822 | Ga0501032_0095074 | 3300049569 | Bacteria | 1975 |
| 823 | Ga0501032_0291089 | 3300049569 | Bacteria | 1056 |
| 824 | Ga0501033_0035144 | 3300049570 | Bacteria | 3757 |
| 825 | Ga0501033_0049938 | 3300049570 | Bacteria | 3104 |
| 826 | Ga0501033_0166711 | 3300049570 | Bacteria | 1583 |
| 827 | Ga0501034_0015387 | 3300049571 | Bacteria | 7863 |
| 828 | Ga0501034_0098131 | 3300049571 | Bacteria | 2925 |
| 829 | Ga0501034_0149927 | 3300049571 | Bacteria | 2308 |
| 830 | Ga0501034_0150221 | 3300049571 | Bacteria | 2305 |
| 831 | Ga0501034_0349274 | 3300049571 | Bacteria | 1408 |
| 832 | Ga0501036_0051626 | 3300049572 | Bacteria | 3482 |
| 833 | Ga0501036_0157941 | 3300049572 | Bacteria | 1912 |
| 834 | Ga0501036_0349503 | 3300049572 | Bacteria | 1235 |
| 835 | Ga0501037_0029576 | 3300049573 | Bacteria | 4047 |
| 836 | Ga0501037_0056096 | 3300049573 | Bacteria | 2879 |
| 837 | Ga0501038_0031073 | 3300049574 | Bacteria | 4721 |
| 838 | Ga0501038_0044142 | 3300049574 | Bacteria | 3874 |
| 839 | Ga0501038_0279885 | 3300049574 | Bacteria | 1313 |
| 840 | Ga0501040_0065785 | 3300049576 | Bacteria | 2497 |
| 841 | Ga0501042_0008575 | 3300049578 | Bacteria | 6761 |
| 842 | Ga0501043_0042774 | 3300049579 | Bacteria | 3560 |
| 843 | Ga0501043_0100630 | 3300049579 | Bacteria | 2272 |
| 844 | Ga0501043_0205655 | 3300049579 | Bacteria | 1526 |
| 845 | Ga0501046_0078270 | 3300049580 | Bacteria | 2558 |
| 846 | Ga0501047_0084929 | 3300049581 | Bacteria | 3042 |
| 847 | Ga0501047_0136951 | 3300049581 | Bacteria | 2328 |
| 848 | Ga0501048_0045118 | 3300049582 | Bacteria | 3149 |
| 849 | Ga0501048_0057296 | 3300049582 | Bacteria | 2763 |
| 850 | Ga0501067_0053201 | 3300049583 | Bacteria | 2243 |
| 851 | Ga0501069_0025024 | 3300049585 | Bacteria | 3260 |
| 852 | Ga0501070_0099502 | 3300049586 | Bacteria | 2406 |
| 853 | Ga0501070_0109604 | 3300049586 | Bacteria | 2281 |
| 854 | Ga0501071_0032121 | 3300049587 | Bacteria | 3726 |
| 855 | Ga0501073_0075704 | 3300049589 | Bacteria | 2343 |
| 856 | Ga0501074_0005077 | 3300049590 | Bacteria | 9447 |
| 857 | Ga0501075_0382022 | 3300049591 | Bacteria | 1074 |
| 858 | Ga0501079_0009435 | 3300049741 | Bacteria | 7395 |
| 859 | Ga0501080_0103274 | 3300049742 | Bacteria | 2643 |
| 860 | Ga0501083_0018549 | 3300049744 | Bacteria | 4848 |
| 861 | Ga0501035_0054458 | 3300049822 | Bacteria | 3574 |
| 862 | Ga0501035_0057786 | 3300049822 | Bacteria | 3458 |
| 863 | Ga0501035_0121456 | 3300049822 | Bacteria | 2283 |
| 864 | Ga0501044_0037590 | 3300049823 | Bacteria | 5059 |
| 865 | Ga0501044_0084757 | 3300049823 | Bacteria | 3202 |
| 866 | Ga0501044_0204729 | 3300049823 | Bacteria | 1930 |
| 867 | Ga0501045_0134990 | 3300049824 | Bacteria | 1835 |
| 868 | Ga0501045_0191489 | 3300049824 | Bacteria | 1524 |
| 869 | nmdc:mga03n38_46701_c1 | 3300050490 | Bacteria | 1913 |
| 870 | nmdc:mga00v17_4589_c1 | 3300050491 | Bacteria | 7203 |
| 871 | nmdc:mga00v17_69330_c2 | 3300050491 | Bacteria | 1738 |
| 872 | nmdc:mga00v17_93038_c1 | 3300050491 | Bacteria | 1895 |
| 873 | nmdc:mga0yw44_12452_c1 | 3300050492 | Bacteria | 4434 |
| 874 | nmdc:mga0yw44_131120_c1 | 3300050492 | Bacteria | 1623 |
| 875 | nmdc:mga0yw44_30877_c1 | 3300050492 | Bacteria | 3111 |
| 876 | nmdc:mga0yw44_45205_c1 | 3300050492 | Bacteria | 2639 |
| 877 | nmdc:mga0k408_105376_c1 | 3300050493 | Bacteria | 1665 |
| 878 | nmdc:mga0k408_110834_c1 | 3300050493 | Bacteria | 1622 |
| 879 | nmdc:mga0k408_143337_c1 | 3300050493 | Bacteria | 1422 |
| 880 | nmdc:mga06z11_111727_c1 | 3300050494 | Bacteria | 1514 |
| 881 | nmdc:mga06z11_46459_c1 | 3300050494 | Bacteria | 2201 |
| 882 | nmdc:mga04h51_28933_c1 | 3300050495 | Bacteria | 1732 |
| 883 | nmdc:mga07m45_245287_c1 | 3300050496 | Bacteria | 1042 |
| 884 | nmdc:mga07m45_46313_c1 | 3300050496 | Bacteria | 2443 |
| 885 | nmdc:mga07m45_4675_c1 | 3300050496 | Bacteria | 6719 |
| 886 | nmdc:mga08y16_173922_c1 | 3300050511 | Bacteria | 2236 |
| 887 | nmdc:mga0n895_126914_c1 | 3300050512 | Bacteria | 2575 |
| 888 | nmdc:mga0rr50_82438_c1 | 3300050513 | Bacteria | 2484 |
| 889 | Ga0495601_0019393 | 3300053077 | Bacteria | 4147 |
| 890 | Ga0495601_0034162 | 3300053077 | Bacteria | 3171 |
| 891 | Ga0495601_0196507 | 3300053077 | Bacteria | 1318 |
| 892 | Ga0495612_0014435 | 3300053078 | Bacteria | 3177 |
| 893 | Ga0495612_0070345 | 3300053078 | Bacteria | 1458 |
| 894 | Ga0500635_0098286 | 3300053080 | Bacteria | 1073 |
| 895 | Ga0495595_0005744 | 3300053084 | Bacteria | 5026 |
| 896 | Ga0495619_0004552 | 3300053085 | Bacteria | 8856 |
| 897 | Ga0500643_007421 | 3300053087 | Bacteria | 4426 |
| 898 | Ga0500644_0010381 | 3300053088 | Bacteria | 2520 |
| 899 | Ga0500644_0096081 | 3300053088 | Bacteria | 1118 |
| 900 | Ga0500647_0084833 | 3300053091 | Bacteria | 1519 |
| 901 | Ga0500583_0055049 | 3300053092 | Bacteria | 1859 |
| 902 | Ga0500651_0227913 | 3300053093 | Bacteria | 1090 |
| 903 | Ga0500566_0001223 | 3300053094 | Bacteria | 15020 |
| 904 | Ga0500566_0003804 | 3300053094 | Bacteria | 8999 |
| 905 | Ga0500566_0010050 | 3300053094 | Bacteria | 5581 |
| 906 | Ga0500566_0020729 | 3300053094 | Bacteria | 3866 |
| 907 | Ga0500566_0076480 | 3300053094 | Bacteria | 1870 |
| 908 | Ga0500641_0019753 | 3300053096 | Bacteria | 2550 |
| 909 | Ga0500650_0008217 | 3300053098 | Bacteria | 4110 |
| 910 | Ga0500554_002687 | 3300053102 | Bacteria | 3537 |
| 911 | Ga0500554_012553 | 3300053102 | Bacteria | 2133 |
| 912 | Ga0500556_0000006 | 3300053104 | Bacteria | 453982 |
| 913 | Ga0500572_000415 | 3300053111 | Bacteria | 14990 |
| 914 | Ga0500572_014670 | 3300053111 | Bacteria | 1962 |
| 915 | Ga0500591_081609 | 3300053115 | Bacteria | 1435 |
| 916 | Ga0500594_0032330 | 3300053118 | Bacteria | 1385 |
| 917 | Ga0500595_009735 | 3300053119 | Bacteria | 3864 |
| 918 | Ga0500595_015694 | 3300053119 | Bacteria | 2837 |
| 919 | Ga0500595_018065 | 3300053119 | Bacteria | 2586 |
| 920 | Ga0500595_029480 | 3300053119 | Bacteria | 1861 |
| 921 | Ga0500595_033463 | 3300053119 | Bacteria | 1706 |
| 922 | Ga0500608_002047 | 3300053122 | Bacteria | 7229 |
| 923 | Ga0500608_012388 | 3300053122 | Bacteria | 3738 |
| 924 | Ga0500642_0000004 | 3300053130 | Bacteria | 433122 |
| 925 | Ga0500655_026347 | 3300053133 | Bacteria | 1106 |
| 926 | Ga0500559_0000106 | 3300053136 | Bacteria | 65670 |
| 927 | Ga0500559_0001060 | 3300053136 | Bacteria | 16703 |
| 928 | Ga0500568_0002722 | 3300053139 | Bacteria | 10242 |
| 929 | Ga0500568_0014183 | 3300053139 | Bacteria | 3607 |
| 930 | Ga0500573_0099806 | 3300053140 | Bacteria | 1634 |
| 931 | Ga0500577_0000027 | 3300053142 | Bacteria | 36211 |
| 932 | Ga0500577_0041005 | 3300053142 | Bacteria | 1686 |
| 933 | Ga0500586_000522 | 3300053145 | Bacteria | 7721 |
| 934 | Ga0500603_001404 | 3300053150 | Bacteria | 5498 |
| 935 | Ga0500603_006415 | 3300053150 | Bacteria | 2556 |
| 936 | Ga0500603_038289 | 3300053150 | Bacteria | 1269 |
| 937 | Ga0500604_0009029 | 3300053151 | Bacteria | 2652 |
| 938 | Ga0500616_0000022 | 3300053153 | Bacteria | 460463 |
| 939 | Ga0500616_0000038 | 3300053153 | Bacteria | 386801 |
| 940 | Ga0500622_0004710 | 3300053156 | Bacteria | 8433 |
| 941 | Ga0500622_0046249 | 3300053156 | Bacteria | 2251 |
| 942 | Ga0500630_030914 | 3300053159 | Bacteria | 2633 |
| 943 | Ga0500634_0096205 | 3300053161 | Bacteria | 1491 |
| 944 | Ga0500638_013381 | 3300053162 | Bacteria | 3709 |
| 945 | Ga0500638_031306 | 3300053162 | Bacteria | 2565 |
| 946 | Ga0500639_013822 | 3300053163 | Bacteria | 4244 |
| 947 | Ga0500639_033760 | 3300053163 | Bacteria | 2704 |
| 948 | Ga0500636_0005964 | 3300053177 | Bacteria | 6980 |
| 949 | Ga0500636_0016050 | 3300053177 | Bacteria | 4413 |
| 950 | Ga0500637_0004377 | 3300053178 | Bacteria | 6696 |
| 951 | Ga0500637_0020058 | 3300053178 | Bacteria | 3614 |
| 952 | Ga0500567_076007 | 3300053723 | Bacteria | 1462 |
| 953 | Ga0500645_054444 | 3300053730 | Bacteria | 1163 |
| 954 | Ga0500552_001030 | 3300053733 | Bacteria | 2635 |
| 955 | Ga0500596_000930 | 3300053735 | Bacteria | 5843 |
| 956 | Ga0500596_007751 | 3300053735 | Bacteria | 1742 |
| 957 | Ga0501084_0021758 | 3300054114 | Bacteria | 5348 |
| 958 | Ga0500661_005155 | 3300055283 | Bacteria | 2446 |
| 959 | Ga0501082_0139935 | 3300060353 | Bacteria | 2100 |
| 960 | Ga0466962_0013365 | 3300061719 | Bacteria | 3952 |
| 961 | 2513719810 | 2513237104 | Bacteria | 10034502 |
| 962 | 2513888653 | 2513237141 | Bacteria | 8496279 |
| 963 | 2517102104 | 2517093001 | Bacteria | 9002274 |
| 964 | 2603858401 | 2602042107 | Bacteria | 6226103 |
| 965 | 2793064908 | 2791355196 | Bacteria | 7323613 |
| 966 | 2793079245 | |||
| 967 | 2841965740 | 2841957949 | Bacteria | 8652217 |
| 968 | 2842043621 | 2842038055 | Bacteria | 8002051 |
| 969 | 2842052389 | 2842045827 | Bacteria | 8006841 |
| 970 | 2857526502 | 2857524615 | Bacteria | 6615449 |
| 971 | 2874624669 | 2874620515 | Bacteria | 8290088 |
| 972 | 2876813398 | 2876808645 | Bacteria | 8824342 |
| 973 | 2879113051 | 2879110137 | Bacteria | 8907982 |
| 974 | 2885371157 | 2885366525 | Bacteria | 8326213 |
| 975 | 2885410513 | 2885409591 | Bacteria | 9235467 |
| 976 | 2888390793 | 2888388044 | Bacteria | 7304136 |
| 977 | 2889035629 | 2889033259 | Bacteria | 9099371 |
| 978 | 2893067248 | 2893066018 | Bacteria | 6158120 |
| 979 | 2904670376 | 2904666416 | Bacteria | 8226587 |
| 980 | 2904690626 | 2904690495 | Bacteria | 9412302 |
| 981 | 2908756384 | 2908756301 | Bacteria | 8864324 |
| 982 | 2919073683 | 2919073203 | Bacteria | 6531949 |
| 983 | 8006928528 | 8006926726 | Bacteria | 6749210 |
| 984 | 8006990805 | 8006984368 | Bacteria | 9651211 |
| 985 | 8016586504 | 8016583857 | Bacteria | 10421953 |
| 986 | 8056695295 | 8056689827 | Bacteria | 6712655 |
| 987 | Ga0081455_10134664 | |||
| 988 | JGI24740J21852_10005816 | |||
| 989 | JGI24737J22298_10003455 | |||
| 990 | JGI25406J46586_10001269 | |||
| 991 | JGI25406J46586_10001837 | |||
| 992 | JGI25406J46586_10005215 | |||
| 993 | JGI25153J46596_10009381 | |||
| 994 | JGI25153J46596_10031830 | |||
| 995 | JGI25153J46596_10032438 | |||
| 996 | JGI25153J46596_10034898 | |||
| 997 | rootH2_10095142 | |||
| 998 | JGI25160J50197_1020957 | |||
| 999 | JGI25160J50197_1031796 | |||
| 1000 | JGI25404J52841_10010710 | |||
| 1001 | Ga0055531_10007516 | |||
| 1002 | Ga0065165_1027884 | |||
| 1003 | Ga0065165_1030603 | |||
| 1004 | Ga0065165_1032286 | |||
| 1005 | Ga0070658_10023727 | |||
| 1006 | Ga0070683_100030491 | |||
| 1007 | Ga0070683_100044264 | |||
| 1008 | Ga0070690_100372690 | |||
| 1009 | Ga0070670_100136854 | |||
| 1010 | Ga0070670_100200985 | |||
| 1011 | Ga0068869_100179485 | |||
| 1012 | Ga0070680_100018066 | |||
| 1013 | Ga0070680_100081192 | |||
| 1014 | Ga0070682_100202985 | |||
| 1015 | Ga0068868_100017439 | |||
| 1016 | Ga0068868_100123391 | |||
| 1017 | Ga0070660_100118721 | |||
| 1018 | Ga0070660_100403070 | |||
| 1019 | Ga0070689_100271375 | |||
| 1020 | Ga0070661_100146714 | |||
| 1021 | Ga0070668_100088248 | |||
| 1022 | Ga0070668_100129749 | |||
| 1023 | Ga0070668_100154825 | |||
| 1024 | Ga0070668_100194289 | |||
| 1025 | Ga0070669_100141779 | |||
| 1026 | Ga0070669_100207161 | |||
| 1027 | Ga0070669_100405920 | |||
| 1028 | Ga0070671_100172339 | |||
| 1029 | Ga0070671_100182917 | |||
| 1030 | Ga0070674_100156801 | |||
| 1031 | Ga0070673_100279431 | |||
| 1032 | Ga0070659_100187887 | |||
| 1033 | Ga0070659_100444061 | |||
| 1034 | Ga0070667_100085231 | |||
| 1035 | Ga0070667_100249256 | |||
| 1036 | Ga0070667_100305633 | |||
| 1037 | Ga0070709_10008846 | |||
| 1038 | Ga0070714_100006113 | |||
| 1039 | Ga0070714_100013348 | |||
| 1040 | Ga0070714_100089955 | |||
| 1041 | Ga0070713_100033309 | |||
| 1042 | Ga0070713_100035723 | |||
| 1043 | Ga0070713_100046936 | |||
| 1044 | Ga0070713_100091253 | |||
| 1045 | Ga0070713_100245358 | |||
| 1046 | Ga0070710_10000629 | |||
| 1047 | Ga0070710_10002613 | |||
| 1048 | Ga0070711_100007337 | |||
| 1049 | Ga0070711_100007770 | |||
| 1050 | Ga0070711_100091165 | |||
| 1051 | Ga0070700_100101950 | |||
| 1052 | Ga0070694_100109692 | |||
| 1053 | Ga0070663_100005737 | |||
| 1054 | Ga0070663_100030169 | |||
| 1055 | Ga0070663_100082650 | |||
| 1056 | Ga0070663_100105313 | |||
| 1057 | Ga0070663_100121391 | |||
| 1058 | Ga0070663_100176525 | |||
| 1059 | Ga0070663_100223453 | |||
| 1060 | Ga0070678_100179341 | |||
| 1061 | Ga0070678_100270236 | |||
| 1062 | Ga0070662_100152209 | |||
| 1063 | Ga0070662_100349043 | |||
| 1064 | Ga0070681_10065324 | |||
| 1065 | Ga0070681_10138275 | |||
| 1066 | Ga0070681_10140700 | |||
| 1067 | Ga0070681_10286788 | |||
| 1068 | Ga0070685_10140521 | |||
| 1069 | Ga0070707_100074049 | |||
| 1070 | Ga0070707_100117076 | |||
| 1071 | Ga0070698_100270947 | |||
| 1072 | Ga0070698_100338567 | |||
| 1073 | Ga0070679_100111200 | |||
| 1074 | Ga0070679_100243743 | |||
| 1075 | Ga0070679_100334017 | |||
| 1076 | Ga0070684_100003879 | |||
| 1077 | Ga0070684_100052912 | |||
| 1078 | Ga0070684_100335350 | |||
| 1079 | Ga0068853_100001617 | |||
| 1080 | Ga0068853_100012905 | |||
| 1081 | Ga0068853_100029373 | |||
| 1082 | Ga0068853_100126841 | |||
| 1083 | Ga0068853_100180047 | |||
| 1084 | Ga0070686_100088905 | |||
| 1085 | Ga0070665_100019142 | |||
| 1086 | Ga0070665_100128458 | |||
| 1087 | Ga0070665_100277819 | |||
| 1088 | Ga0070665_100442234 | |||
| 1089 | Ga0068855_100057419 | |||
| 1090 | Ga0068855_100090885 | |||
| 1091 | Ga0068855_100188548 | |||
| 1092 | Ga0070664_100138901 | |||
| 1093 | Ga0068857_100040874 | |||
| 1094 | Ga0068857_100088196 | |||
| 1095 | Ga0068854_100026066 | |||
| 1096 | Ga0068854_100096044 | |||
| 1097 | Ga0068856_100074933 | |||
| 1098 | Ga0068856_100197610 | |||
| 1099 | Ga0068856_100231152 | |||
| 1100 | Ga0068856_100247067 | |||
| 1101 | Ga0070702_100042184 | |||
| 1102 | Ga0068852_100020357 | |||
| 1103 | Ga0068859_100177940 | |||
| 1104 | Ga0068859_100378331 | |||
| 1105 | Ga0068864_100055720 | |||
| 1106 | Ga0068864_100094342 | |||
| 1107 | Ga0068864_100325057 | |||
| 1108 | Ga0068864_100347988 | |||
| 1109 | Ga0068866_10062985 | |||
| 1110 | Ga0068866_10166041 | |||
| 1111 | Ga0068866_10269179 | |||
| 1112 | Ga0068861_100169819 | |||
| 1113 | Ga0068861_100185350 | |||
| 1114 | Ga0068861_100352524 | |||
| 1115 | Ga0068851_10004728 | |||
| 1116 | Ga0068863_100415836 | |||
| 1117 | Ga0068863_100609846 | |||
| 1118 | Ga0068858_100195042 | |||
| 1119 | Ga0068860_100001803 | |||
| 1120 | Ga0068860_100112266 | |||
| 1121 | Ga0068862_100273969 | |||
| 1122 | Ga0081455_10049478 | |||
| 1123 | Ga0081455_10050463 | |||
| 1124 | Ga0081455_10061926 | |||
| 1125 | Ga0081538_10042376 | |||
| 1126 | Ga0081540_1011691 | |||
| 1127 | Ga0081540_1014715 | |||
| 1128 | Ga0081540_1021762 | |||
| 1129 | Ga0081540_1024510 | |||
| 1130 | Ga0081540_1033318 | |||
| 1131 | Ga0081540_1035887 | |||
| 1132 | Ga0081540_1060263 | |||
| 1133 | Ga0081540_1065822 | |||
| 1134 | Ga0081539_10000064 | |||
| 1135 | Ga0081539_10002206 | |||
| 1136 | Ga0081539_10079352 | |||
| 1137 | Ga0081539_10114377 | |||
| 1138 | Ga0070717_10001080 | |||
| 1139 | Ga0075365_10066556 | |||
| 1140 | Ga0075365_10126224 | |||
| 1141 | Ga0075365_10171066 | |||
| 1142 | Ga0075365_10176074 | |||
| 1143 | Ga0075365_10221546 | |||
| 1144 | Ga0075365_10284016 | |||
| 1145 | Ga0075368_10021396 | |||
| 1146 | Ga0075363_100005325 | |||
| 1147 | Ga0075363_100030237 | |||
| 1148 | Ga0075364_10005413 | |||
| 1149 | Ga0075364_10022995 | |||
| 1150 | Ga0075364_10098288 | |||
| 1151 | Ga0075364_10139088 | |||
| 1152 | Ga0070715_10088356 | |||
| 1153 | Ga0070716_100000664 | |||
| 1154 | Ga0070716_100000748 | |||
| 1155 | Ga0070716_100068077 | |||
| 1156 | Ga0070716_100145980 | |||
| 1157 | Ga0070712_100006771 | |||
| 1158 | Ga0070712_100022828 | |||
| 1159 | Ga0070712_100061362 | |||
| 1160 | Ga0070712_100161689 | |||
| 1161 | Ga0075367_10015170 | |||
| 1162 | Ga0075367_10041093 | |||
| 1163 | Ga0075367_10114965 | |||
| 1164 | Ga0075369_10056747 | |||
| 1165 | Ga0075369_10057758 | |||
| 1166 | Ga0075369_10066856 | |||
| 1167 | Ga0075366_10085515 | |||
| 1168 | Ga0075366_10110989 | |||
| 1169 | Ga0075366_10115633 | |||
| 1170 | Ga0075370_10136286 | |||
| 1171 | Ga0075370_10163340 | |||
| 1172 | Ga0068871_100226482 | |||
| 1173 | Ga0068871_100237795 | |||
| 1174 | Ga0075434_100028847 | |||
| 1175 | Ga0075434_100502283 | |||
| 1176 | Ga0068865_100076637 | |||
| 1177 | Ga0097620_100177946 | |||
| 1178 | Ga0097620_100378367 | |||
| 1179 | Ga0099824_1035261 | |||
| 1180 | Ga0099822_1048339 | |||
| 1181 | Ga0075435_100130333 | |||
| 1182 | Ga0099795_10018310 | |||
| 1183 | Ga0099795_10022791 | |||
| 1184 | Ga0105240_10001754 | |||
| 1185 | Ga0105240_10096404 | |||
| 1186 | Ga0111539_10170198 | |||
| 1187 | Ga0105245_10047428 | |||
| 1188 | Ga0105245_10476191 | |||
| 1189 | Ga0105247_10110443 | |||
| 1190 | Ga0105243_10088250 | |||
| 1191 | Ga0105241_10002619 | |||
| 1192 | Ga0105241_10149265 | |||
| 1193 | Ga0105242_10216101 | |||
| 1194 | Ga0105242_10223162 | |||
| 1195 | Ga0105242_10306837 | |||
| 1196 | Ga0105248_10169571 | |||
| 1197 | Ga0105248_10269055 | |||
| 1198 | Ga0105248_10305134 | |||
| 1199 | Ga0105248_10385848 | |||
| 1200 | Ga0105237_10005399 | |||
| 1201 | Ga0105237_10056521 | |||
| 1202 | Ga0105237_10155584 | |||
| 1203 | Ga0105237_10427826 | |||
| 1204 | Ga0105237_10436441 | |||
| 1205 | Ga0105238_10001086 | |||
| 1206 | Ga0105238_10012034 | |||
| 1207 | Ga0105238_10041846 | |||
| 1208 | Ga0105238_10046561 | |||
| 1209 | Ga0105238_10090291 | |||
| 1210 | Ga0105238_10259535 | |||
| 1211 | Ga0105239_10087195 | |||
| 1212 | Ga0105239_10089479 | |||
| 1213 | Ga0105239_10095047 | |||
| 1214 | Ga0105239_10118948 | |||
| 1215 | Ga0105239_10123251 | |||
| 1216 | Ga0105239_10201621 | |||
| 1217 | Ga0105239_10582780 | |||
| 1218 | Ga0105246_10055737 | |||
| 1219 | Ga0105246_10094231 | |||
| 1220 | Ga0105246_10156765 | |||
| 1221 | Ga0157370_10148044 | |||
| 1222 | Ga0157370_10179694 | |||
| 1223 | Ga0157369_10010838 | |||
| 1224 | Ga0157369_10206061 | |||
| 1225 | Ga0157374_10232416 | |||
| 1226 | Ga0157374_10242658 | |||
| 1227 | Ga0163162_10091446 | |||
| 1228 | Ga0163162_10134721 | |||
| 1229 | Ga0163162_10314595 | |||
| 1230 | Ga0157372_10244664 | |||
| 1231 | Ga0157375_10014475 | |||
| 1232 | Ga0157375_10459482 | |||
| 1233 | Ga0163163_10151405 | |||
| 1234 | Ga0163163_10272647 | |||
| 1235 | Ga0157380_10275534 | |||
| 1236 | Ga0157380_10309704 | |||
| 1237 | Ga0157380_10464666 | |||
| 1238 | Ga0157377_10121907 | |||
| 1239 | Ga0157379_10149877 | |||
| 1240 | Ga0157379_10183167 | |||
| 1241 | Ga0157379_10451192 | |||
| 1242 | Ga0157376_10285751 | |||
| 1243 | Ga0163161_10271152 | |||
| 1244 | Ga0214544_1000056 | |||
| 1245 | Ga0214542_1000071 | |||
| 1246 | Ga0214545_1000033 | |||
| 1247 | Ga0214543_1000105 | |||
| 1248 | Ga0213876_10001803 | |||
| 1249 | Ga0213876_10140647 | |||
| 1250 | Ga0209563_103943 | |||
| 1251 | Ga0209677_102065 | |||
| 1252 | Ga0209677_103578 | |||
| 1253 | Ga0209455_1002169 | |||
| 1254 | Ga0209455_1005163 | |||
| 1255 | Ga0209564_1000494 | |||
| 1256 | Ga0209564_1004819 | |||
| 1257 | Ga0209564_1014152 | |||
| 1258 | Ga0209758_1000293 | |||
| 1259 | Ga0209758_1000363 | |||
| 1260 | Ga0209758_1002182 | |||
| 1261 | Ga0209758_1002431 | |||
| 1262 | Ga0209758_1007289 | |||
| 1263 | Ga0209758_1020122 | |||
| 1264 | Ga0209758_1021319 | |||
| 1265 | Ga0209758_1043810 | |||
| 1266 | Ga0209758_1044141 | |||
| 1267 | Ga0209256_1025597 | |||
| 1268 | Ga0207426_1000628 | |||
| 1269 | Ga0207426_1021037 | |||
| 1270 | Ga0207426_1032857 | |||
| 1271 | Ga0209051_1049651 | |||
| 1272 | Ga0209257_1004770 | |||
| 1273 | Ga0207656_10003723 | |||
| 1274 | Ga0207656_10034381 | |||
| 1275 | Ga0207653_10037315 | |||
| 1276 | Ga0207692_10000489 | |||
| 1277 | Ga0207692_10001833 | |||
| 1278 | Ga0207692_10146904 | |||
| 1279 | Ga0207688_10094818 | |||
| 1280 | Ga0207688_10119321 | |||
| 1281 | Ga0207647_10005928 | |||
| 1282 | Ga0207647_10022688 | |||
| 1283 | Ga0207647_10112955 | |||
| 1284 | Ga0207685_10017251 | |||
| 1285 | Ga0207699_10004893 | |||
| 1286 | Ga0207699_10177335 | |||
| 1287 | Ga0207645_10054999 | |||
| 1288 | Ga0207654_10000175 | |||
| 1289 | Ga0207654_10057116 | |||
| 1290 | Ga0207654_10114889 | |||
| 1291 | Ga0207654_10275673 | |||
| 1292 | Ga0207707_10006420 | |||
| 1293 | Ga0207707_10094981 | |||
| 1294 | Ga0207707_10174435 | |||
| 1295 | Ga0207695_10009236 | |||
| 1296 | Ga0207695_10069546 | |||
| 1297 | Ga0207695_10182037 | |||
| 1298 | Ga0207695_10349839 | |||
| 1299 | Ga0207671_10049421 | |||
| 1300 | Ga0207671_10066601 | |||
| 1301 | Ga0207671_10068734 | |||
| 1302 | Ga0207671_10072485 | |||
| 1303 | Ga0207671_10117218 | |||
| 1304 | Ga0207671_10187877 | |||
| 1305 | Ga0207693_10011033 | |||
| 1306 | Ga0207693_10011474 | |||
| 1307 | Ga0207693_10015141 | |||
| 1308 | Ga0207693_10022773 | |||
| 1309 | Ga0207663_10058429 | |||
| 1310 | Ga0207663_10062979 | |||
| 1311 | Ga0207663_10116758 | |||
| 1312 | Ga0207663_10396334 | |||
| 1313 | Ga0207660_10006956 | |||
| 1314 | Ga0207660_10107988 | |||
| 1315 | Ga0207660_10180179 | |||
| 1316 | Ga0207660_10208081 | |||
| 1317 | Ga0207662_10162946 | |||
| 1318 | Ga0207657_10004312 | |||
| 1319 | Ga0207657_10030642 | |||
| 1320 | Ga0207657_10181769 | |||
| 1321 | Ga0207657_10189204 | |||
| 1322 | Ga0207652_10010962 | |||
| 1323 | Ga0207652_10103551 | |||
| 1324 | Ga0207652_10275043 | |||
| 1325 | Ga0207652_10358357 | |||
| 1326 | Ga0207646_10062005 | |||
| 1327 | Ga0207681_10341544 | |||
| 1328 | Ga0207694_10000226 | |||
| 1329 | Ga0207694_10018472 | |||
| 1330 | Ga0207694_10062964 | |||
| 1331 | Ga0207694_10086361 | |||
| 1332 | Ga0207650_10090200 | |||
| 1333 | Ga0207659_10350710 | |||
| 1334 | Ga0207687_10144393 | |||
| 1335 | Ga0207687_10159431 | |||
| 1336 | Ga0207700_10027465 | |||
| 1337 | Ga0207700_10053782 | |||
| 1338 | Ga0207700_10083890 | |||
| 1339 | Ga0207700_10147668 | |||
| 1340 | Ga0207700_10249354 | |||
| 1341 | Ga0207700_10302826 | |||
| 1342 | Ga0207664_10004352 | |||
| 1343 | Ga0207664_10042658 | |||
| 1344 | Ga0207664_10043916 | |||
| 1345 | Ga0207664_10239471 | |||
| 1346 | Ga0207644_10052228 | |||
| 1347 | Ga0207644_10214732 | |||
| 1348 | Ga0207644_10218990 | |||
| 1349 | Ga0207690_10296022 | |||
| 1350 | Ga0207706_10080388 | |||
| 1351 | Ga0207706_10239310 | |||
| 1352 | Ga0207686_10243828 | |||
| 1353 | Ga0207709_10189716 | |||
| 1354 | Ga0207670_10103182 | |||
| 1355 | Ga0207665_10000235 | |||
| 1356 | Ga0207665_10001984 | |||
| 1357 | Ga0207665_10105429 | |||
| 1358 | Ga0207665_10167723 | |||
| 1359 | Ga0207691_10089157 | |||
| 1360 | Ga0207711_10220555 | |||
| 1361 | Ga0207711_10254365 | |||
| 1362 | Ga0207689_10145962 | |||
| 1363 | Ga0207689_10203379 | |||
| 1364 | Ga0207689_10325570 | |||
| 1365 | Ga0207661_10001179 | |||
| 1366 | Ga0207661_10039390 | |||
| 1367 | Ga0207679_10247549 | |||
| 1368 | Ga0207679_10265154 | |||
| 1369 | Ga0207667_10004170 | |||
| 1370 | Ga0207667_10004673 | |||
| 1371 | Ga0207667_10010892 | |||
| 1372 | Ga0207667_10047542 | |||
| 1373 | Ga0207667_10153908 | |||
| 1374 | Ga0207667_10186840 | |||
| 1375 | Ga0207667_10363491 | |||
| 1376 | Ga0207668_10081435 | |||
| 1377 | Ga0207668_10115575 | |||
| 1378 | Ga0207640_10004452 | |||
| 1379 | Ga0207640_10021376 | |||
| 1380 | Ga0207658_10147266 | |||
| 1381 | Ga0207677_10013346 | |||
| 1382 | Ga0207703_10138291 | |||
| 1383 | Ga0207639_10006164 | |||
| 1384 | Ga0207639_10019626 | |||
| 1385 | Ga0207639_10021327 | |||
| 1386 | Ga0207639_10104816 | |||
| 1387 | Ga0207639_10308097 | |||
| 1388 | Ga0207678_10052756 | |||
| 1389 | Ga0207678_10060689 | |||
| 1390 | Ga0207678_10068056 | |||
| 1391 | Ga0207678_10121258 | |||
| 1392 | Ga0207678_10169969 | |||
| 1393 | Ga0207678_10190307 | |||
| 1394 | Ga0207678_10204927 | |||
| 1395 | Ga0207678_10209987 | |||
| 1396 | Ga0207678_10259286 | |||
| 1397 | Ga0207708_10175218 | |||
| 1398 | Ga0207708_10294888 | |||
| 1399 | Ga0207702_10000004 | |||
| 1400 | Ga0207702_10052064 | |||
| 1401 | Ga0207702_10530611 | |||
| 1402 | Ga0207641_10127533 | |||
| 1403 | Ga0207641_10251432 | |||
| 1404 | Ga0207641_10569331 | |||
| 1405 | Ga0207648_10286296 | |||
| 1406 | Ga0207648_10351005 | |||
| 1407 | Ga0207676_10158453 | |||
| 1408 | Ga0207676_10317651 | |||
| 1409 | Ga0207674_10008354 | |||
| 1410 | Ga0207674_10021710 | |||
| 1411 | Ga0207674_10035034 | |||
| 1412 | Ga0207674_10231467 | |||
| 1413 | Ga0207674_10388239 | |||
| 1414 | Ga0207675_100199827 | |||
| 1415 | Ga0207683_10061295 | |||
| 1416 | Ga0207683_10117340 | |||
| 1417 | Ga0207683_10227305 | |||
| 1418 | Ga0207683_10248661 | |||
| 1419 | Ga0207698_10025144 | |||
| 1420 | Ga0207698_10297811 | |||
| 1421 | Ga0209389_1045303 | |||
| 1422 | Ga0209589_1000032 | |||
| 1423 | Ga0209813_10052997 | |||
| 1424 | Ga0268266_10002812 | |||
| 1425 | Ga0268266_10029434 | |||
| 1426 | Ga0268266_10159216 | |||
| 1427 | Ga0268265_10175233 | |||
| 1428 | Ga0268265_10219803 | |||
| 1429 | Ga0268265_10266720 | |||
| 1430 | Ga0268264_10000157 | |||
| 1431 | Ga0265337_1016358 | |||
| 1432 | Ga0265318_10012173 | |||
| 1433 | Ga0265323_10001778 | |||
| 1434 | Ga0265336_10000235 | |||
| 1435 | Ga0307517_10000563 | |||
| 1436 | Ga0307515_10008720 | |||
| 1437 | Ga0307515_10216473 | |||
| 1438 | Ga0307515_10306556 | |||
| 1439 | Ga0265338_10005155 | |||
| 1440 | Ga0265330_10028933 | |||
| 1441 | Ga0265330_10031347 | |||
| 1442 | Ga0265330_10038596 | |||
| 1443 | Ga0265325_10013306 | |||
| 1444 | Ga0265340_10018279 | |||
| 1445 | Ga0265339_10004403 | |||
| 1446 | Ga0265339_10031070 | |||
| 1447 | Ga0265331_10124615 | |||
| 1448 | Ga0265331_10140112 | |||
| 1449 | Ga0265316_10045955 | |||
| 1450 | Ga0307513_10112840 | |||
| 1451 | Ga0307509_10146627 | |||
| 1452 | Ga0307508_10111626 | |||
| 1453 | Ga0307508_10197490 | |||
| 1454 | Ga0265314_10003979 | |||
| 1455 | Ga0265314_10039691 | |||
| 1456 | Ga0265314_10056041 | |||
| 1457 | Ga0307516_10008798 | |||
| 1458 | Ga0307516_10029494 | |||
| 1459 | Ga0307516_10072493 | |||
| 1460 | Ga0307516_10123753 | |||
| 1461 | Ga0307516_10150815 | |||
| 1462 | Ga0307405_10122141 | |||
| 1463 | Ga0307412_10021273 | |||
| 1464 | Ga0307409_100188945 | |||
| 1465 | Ga0307416_100731718 | |||
| 1466 | Ga0307414_10274834 | |||
| 1467 | Ga0307415_100137369 | |||
| 1468 | Ga0307507_10127820 | |||
| 1469 | Ga0307510_10016268 | |||
| 1470 | Ga0373929_0011781 | |||
| 1471 | Ga0373934_0014023 | |||
| 1472 | Ga0373934_0017026 | |||
| 1473 | Ga0373923_0036024 | |||
| 1474 | Ga0373923_0054605 | |||
| 1475 | Ga0373923_0059945 | |||
| 1476 | Ga0373923_0097735 | |||
| 1477 | Ga0373932_0020184 | |||
| 1478 | Ga0373945_0004476 | |||
| 1479 | Ga0373945_0014361 | |||
| 1480 | Ga0373945_0048748 | |||
| 1481 | Ga0373953_0002371 | |||
| 1482 | Ga0373953_0017348 | |||
| 1483 | Ga0373954_0000485 | |||
| 1484 | Ga0373954_0011861 | |||
| 1485 | Ga0373956_0002322 | |||
| 1486 | Ga0373957_0002098 | |||
| 1487 | Ga0373943_0041100 | |||
| 1488 | Ga0373946_0006060 | |||
| 1489 | Ga0373946_0026634 | |||
| 1490 | Ga0373955_0001048 | |||
| 1491 | Ga0373955_0020825 | |||
| 1492 | Ga0373955_0029460 | |||
| 1493 | Ga0373924_0010097 | |||
| 1494 | Ga0373931_0001548 | |||
| 1495 | Ga0373935_0053046 | |||
| 1496 | Ga0373927_0003498 | |||
| 1497 | Ga0373927_0022428 | |||
| 1498 | Ga0373927_0062796 | |||
| 1499 | Ga0373927_0101520 | |||
| 1500 | Ga0373933_0000118 | |||
| 1501 | Ga0373933_0006053 | |||
| 1502 | Ga0373933_0097317 | |||
| 1503 | Ga0373947_0004053 | |||
| 1504 | Ga0373947_0009689 | |||
| 1505 | Ga0373947_0021326 | |||
| 1506 | Ga0373947_0041568 | |||
| 1507 | Ga0373947_0046047 | |||
| 1508 | Ga0373947_0133742 | |||
| 1509 | Ga0373937_0012128 | |||
| 1510 | Ga0373937_0300788 | |||
| 1511 | Ga0373925_0033366 | |||
| 1512 | Ga0373925_0106535 | |||
| 1513 | Ga0373925_0249118 | |||
| 1514 | Ga0395899_0021904 | |||
| 1515 | Ga0395900_0021426 | |||
| 1516 | Ga0395900_0139445 | |||
| 1517 | Ga0395900_0166459 | |||
| 1518 | Ga0395898_0173338 | |||
| 1519 | Ga0395905_0023934 | |||
| 1520 | Ga0395905_0108510 | |||
| 1521 | Ga0395901_0181332 | |||
| 1522 | Ga0395901_0306555 | |||
| 1523 | Ga0395901_0431503 | |||
| 1524 | Ga0436365_0361268 | |||
| 1525 | Ga0436365_0517722 | |||
| 1526 | Ga0436360_0293778 | |||
| 1527 | Ga0436361_1023898 | |||
| 1528 | Ga0436363_1514070 | |||
| 1529 | Ga0436362_1162178 | |||
| 1530 | Ga0439465_0068274 | |||
| 1531 | Ga0451853_0973839 | |||
| 1532 | Ga0466965_0017444 | |||
| 1533 | Ga0466963_0044606 | |||
| 1534 | Ga0466970_0065407 | |||
| 1535 | Ga0466959_0195472 | |||
| 1536 | Ga0466967_0044378 | |||
| 1537 | Ga0466967_0131367 | |||
| 1538 | Ga0495592_0000993 | |||
| 1539 | Ga0495592_0024966 | |||
| 1540 | Ga0495603_0000826 | |||
| 1541 | Ga0495603_0003332 | |||
| 1542 | Ga0495603_0011755 | |||
| 1543 | Ga0495603_0038493 | |||
| 1544 | Ga0495603_0041753 | |||
| 1545 | Ga0495603_0189697 | |||
| 1546 | Ga0495590_0033206 | |||
| 1547 | Ga0495629_0000337 | |||
| 1548 | Ga0495629_0000587 | |||
| 1549 | Ga0495629_0046968 | |||
| 1550 | Ga0495629_0098022 | |||
| 1551 | Ga0495629_0230143 | |||
| 1552 | Ga0495638_0009712 | |||
| 1553 | Ga0495638_0051601 | |||
| 1554 | Ga0495638_0166544 | |||
| 1555 | Ga0495641_0003504 | |||
| 1556 | Ga0495651_0003587 | |||
| 1557 | Ga0495651_0039355 | |||
| 1558 | Ga0495651_0044737 | |||
| 1559 | Ga0495651_0088120 | |||
| 1560 | Ga0495653_0010108 | |||
| 1561 | Ga0495653_0030974 | |||
| 1562 | Ga0495653_0081954 | |||
| 1563 | Ga0495580_0025540 | |||
| 1564 | Ga0495582_0000018 | |||
| 1565 | Ga0495582_0057510 | |||
| 1566 | Ga0495639_0000272 | |||
| 1567 | Ga0495639_0041989 | |||
| 1568 | Ga0495662_0002085 | |||
| 1569 | Ga0495662_0013233 | |||
| 1570 | Ga0495664_0006563 | |||
| 1571 | Ga0495664_0020862 | |||
| 1572 | Ga0495664_0071543 | |||
| 1573 | Ga0495664_0238881 | |||
| 1574 | Ga0495584_0091861 | |||
| 1575 | Ga0495585_0035860 | |||
| 1576 | Ga0495594_0000155 | |||
| 1577 | Ga0495594_0075554 | |||
| 1578 | Ga0495594_0109963 | |||
| 1579 | Ga0495583_0042472 | |||
| 1580 | Ga0495606_0000676 | |||
| 1581 | Ga0495606_0117167 | |||
| 1582 | Ga0495606_0153692 | |||
| 1583 | Ga0495608_0001320 | |||
| 1584 | Ga0495608_0051601 | |||
| 1585 | Ga0495616_0016900 | |||
| 1586 | Ga0495616_0025703 | |||
| 1587 | Ga0495618_0004991 | |||
| 1588 | Ga0495620_0040570 | |||
| 1589 | Ga0495628_0010505 | |||
| 1590 | Ga0495628_0016528 | |||
| 1591 | Ga0495628_0064930 | |||
| 1592 | Ga0495630_0018269 | |||
| 1593 | Ga0495630_0079856 | |||
| 1594 | Ga0495630_0119514 | |||
| 1595 | Ga0495631_0055303 | |||
| 1596 | Ga0495632_0061977 | |||
| 1597 | Ga0495643_0014351 | |||
| 1598 | Ga0495648_0001519 | |||
| 1599 | Ga0495648_0189502 | |||
| 1600 | Ga0495666_0151344 | |||
| 1601 | Ga0495666_0162627 | |||
| 1602 | Ga0495652_0001922 | |||
| 1603 | Ga0495652_0025697 | |||
| 1604 | Ga0495652_0047147 | |||
| 1605 | Ga0495654_0032538 | |||
| 1606 | Ga0495665_0009932 | |||
| 1607 | Ga0495640_0020760 | |||
| 1608 | Ga0495640_0038318 | |||
| 1609 | Ga0495640_0122210 | |||
| 1610 | Ga0495587_0003825 | |||
| 1611 | Ga0495645_0121085 | |||
| 1612 | Ga0495622_0006549 | |||
| 1613 | Ga0495622_0010378 | |||
| 1614 | Ga0495622_0090200 | |||
| 1615 | Ga0495633_0098374 | |||
| 1616 | Ga0495633_0137069 | |||
| 1617 | Ga0495667_0000270 | |||
| 1618 | Ga0495667_0083208 | |||
| 1619 | Ga0495656_0003938 | |||
| 1620 | Ga0495656_0023834 | |||
| 1621 | Ga0495656_0139055 | |||
| 1622 | Ga0495634_0005445 | |||
| 1623 | Ga0495634_0006589 | |||
| 1624 | Ga0495634_0015449 | |||
| 1625 | Ga0495634_0034758 | |||
| 1626 | Ga0495611_0067269 | |||
| 1627 | Ga0495625_0094725 | |||
| 1628 | Ga0495635_0017934 | |||
| 1629 | Ga0495635_0025981 | |||
| 1630 | Ga0495659_0020954 | |||
| 1631 | Ga0495661_0125050 | |||
| 1632 | Ga0495588_0024462 | |||
| 1633 | Ga0495588_0040661 | |||
| 1634 | Ga0495657_0007029 | |||
| 1635 | Ga0495599_0000635 | |||
| 1636 | Ga0495599_0011248 | |||
| 1637 | Ga0495623_0019394 | |||
| 1638 | Ga0495623_0026008 | |||
| 1639 | Ga0495646_0002988 | |||
| 1640 | Ga0495646_0026378 | |||
| 1641 | Ga0495646_0100179 | |||
| 1642 | Ga0495647_0000364 | |||
| 1643 | Ga0495658_0001654 | |||
| 1644 | Ga0495658_0085375 | |||
| 1645 | Ga0495669_0039055 | |||
| 1646 | Ga0495613_0077391 | |||
| 1647 | Ga0495613_0114019 | |||
| 1648 | Ga0495624_0001316 | |||
| 1649 | Ga0495670_0139870 | |||
| 1650 | Ga0495589_0076920 | |||
| 1651 | Ga0495600_0000400 | |||
| 1652 | Ga0495600_0034034 | |||
| 1653 | Ga0495660_0090475 | |||
| 1654 | Ga0495581_0001084 | |||
| 1655 | Ga0495581_0103630 | |||
| 1656 | Ga0495604_0001388 | |||
| 1657 | Ga0495604_0037402 | |||
| 1658 | Ga0495604_0213363 | |||
| 1659 | Ga0495636_0055830 | |||
| 1660 | Ga0495636_0163128 | |||
| 1661 | Ga0495674_0003842 | |||
| 1662 | Ga0495674_0035096 | |||
| 1663 | Ga0495674_0039376 | |||
| 1664 | Ga0495674_0118784 | |||
| 1665 | Ga0495672_0013378 | |||
| 1666 | Ga0495676_0033669 | |||
| 1667 | Ga0495676_0045100 | |||
| 1668 | Ga0495676_0149290 | |||
| 1669 | Ga0495680_0002455 | |||
| 1670 | Ga0495683_0122973 | |||
| 1671 | Ga0495675_0002361 | |||
| 1672 | Ga0495675_0003169 | |||
| 1673 | Ga0495677_0060857 | |||
| 1674 | Ga0495673_0018066 | |||
| 1675 | Ga0495681_0038298 | |||
| 1676 | Ga0495681_0081924 | |||
| 1677 | Ga0495684_0000766 | |||
| 1678 | Ga0495684_0049392 | |||
| 1679 | Ga0495684_0067312 | |||
| 1680 | Ga0495686_0056518 | |||
| 1681 | Ga0495686_0140171 | |||
| 1682 | Ga0495686_0148132 | |||
| 1683 | Ga0495593_0000120 | |||
| 1684 | Ga0495593_0000419 | |||
| 1685 | Ga0495602_0028204 | |||
| 1686 | Ga0495602_0142965 | |||
| 1687 | Ga0495615_0009784 | |||
| 1688 | Ga0495615_0012694 | |||
| 1689 | Ga0496100_0187894 | |||
| 1690 | Ga0496101_0047737 | |||
| 1691 | Ga0496101_0086361 | |||
| 1692 | Ga0496101_0117688 | |||
| 1693 | Ga0496101_0206518 | |||
| 1694 | Ga0496102_0001803 | |||
| 1695 | Ga0496102_0093012 | |||
| 1696 | Ga0496102_0109527 | |||
| 1697 | Ga0496102_0124592 | |||
| 1698 | Ga0496102_0191935 | |||
| 1699 | Ga0496102_0242013 | |||
| 1700 | Ga0496102_0244804 | |||
| 1701 | Ga0496102_0359249 | |||
| 1702 | Ga0496103_0074424 | |||
| 1703 | Ga0496103_0090204 | |||
| 1704 | Ga0496103_0150626 | |||
| 1705 | Ga0496104_0003129 | |||
| 1706 | Ga0496104_0363437 | |||
| 1707 | Ga0496105_0026604 | |||
| 1708 | Ga0496105_0254621 | |||
| 1709 | Ga0496106_0005088 | |||
| 1710 | Ga0496106_0006879 | |||
| 1711 | Ga0496106_0014676 | |||
| 1712 | Ga0496106_0158620 | |||
| 1713 | Ga0496106_0238368 | |||
| 1714 | Ga0496106_0299069 | |||
| 1715 | Ga0496106_0367271 | |||
| 1716 | Ga0496106_0426917 | |||
| 1717 | Ga0496107_0054072 | |||
| 1718 | Ga0496107_0149029 | |||
| 1719 | Ga0496107_0366972 | |||
| 1720 | Ga0496108_0000489 | |||
| 1721 | Ga0496108_0029193 | |||
| 1722 | Ga0496108_0120168 | |||
| 1723 | Ga0496108_0190547 | |||
| 1724 | Ga0496109_0002105 | |||
| 1725 | Ga0496109_0022102 | |||
| 1726 | Ga0496109_0054089 | |||
| 1727 | Ga0496109_0059949 | |||
| 1728 | Ga0496109_0182720 | |||
| 1729 | Ga0496109_0392401 | |||
| 1730 | Ga0496109_0437752 | |||
| 1731 | Ga0496110_0003310 | |||
| 1732 | Ga0496110_0013612 | |||
| 1733 | Ga0496110_0065232 | |||
| 1734 | Ga0496110_0104648 | |||
| 1735 | Ga0496110_0120601 | |||
| 1736 | Ga0496110_0146047 | |||
| 1737 | Ga0496110_0337332 | |||
| 1738 | Ga0496111_0038120 | |||
| 1739 | Ga0496111_0117296 | |||
| 1740 | Ga0496111_0135324 | |||
| 1741 | Ga0496111_0249230 | |||
| 1742 | Ga0496112_0000015 | |||
| 1743 | Ga0496112_0001918 | |||
| 1744 | Ga0496112_0002702 | |||
| 1745 | Ga0496112_0038437 | |||
| 1746 | Ga0496112_0097212 | |||
| 1747 | Ga0496113_0013883 | |||
| 1748 | Ga0496113_0024191 | |||
| 1749 | Ga0496113_0090147 | |||
| 1750 | Ga0496113_0141387 | |||
| 1751 | Ga0496113_0156802 | |||
| 1752 | Ga0496114_0040283 | |||
| 1753 | Ga0496114_0096292 | |||
| 1754 | Ga0496114_0122395 | |||
| 1755 | Ga0496115_0008944 | |||
| 1756 | Ga0496115_0078751 | |||
| 1757 | Ga0496115_0150684 | |||
| 1758 | Ga0496115_0194441 | |||
| 1759 | Ga0496116_0122458 | |||
| 1760 | Ga0496116_0143726 | |||
| 1761 | Ga0496117_0045804 | |||
| 1762 | Ga0496117_0079333 | |||
| 1763 | Ga0496118_0024960 | |||
| 1764 | Ga0496118_0186683 | |||
| 1765 | Ga0496119_0074108 | |||
| 1766 | Ga0496119_0078447 | |||
| 1767 | Ga0496119_0105608 | |||
| 1768 | Ga0496119_0133008 | |||
| 1769 | Ga0496120_0024597 | |||
| 1770 | Ga0496120_0036759 | |||
| 1771 | Ga0496121_0000423 | |||
| 1772 | Ga0496121_0000786 | |||
| 1773 | Ga0496121_0007421 | |||
| 1774 | Ga0496121_0024035 | |||
| 1775 | Ga0496121_0025033 | |||
| 1776 | Ga0496121_0047595 | |||
| 1777 | Ga0496121_0075538 | |||
| 1778 | Ga0496121_0082258 | |||
| 1779 | Ga0496121_0111142 | |||
| 1780 | Ga0496121_0153967 | |||
| 1781 | Ga0496122_0043747 | |||
| 1782 | Ga0496122_0068887 | |||
| 1783 | Ga0496123_0015148 | |||
| 1784 | Ga0496123_0038344 | |||
| 1785 | Ga0496123_0167882 | |||
| 1786 | Ga0496124_0001593 | |||
| 1787 | Ga0496124_0074254 | |||
| 1788 | Ga0496124_0201352 | |||
| 1789 | Ga0496124_0304529 | |||
| 1790 | Ga0496125_0000136 | |||
| 1791 | Ga0496125_0005117 | |||
| 1792 | Ga0496125_0006320 | |||
| 1793 | Ga0496125_0017029 | |||
| 1794 | Ga0496125_0022131 | |||
| 1795 | Ga0496125_0103548 | |||
| 1796 | Ga0496126_0023465 | |||
| 1797 | Ga0496126_0024069 | |||
| 1798 | Ga0496126_0038548 | |||
| 1799 | Ga0496126_0068807 | |||
| 1800 | Ga0496126_0072836 | |||
| 1801 | Ga0496126_0087116 | |||
| 1802 | Ga0496126_0104032 | |||
| 1803 | Ga0496126_0119044 | |||
| 1804 | Ga0496126_0182386 | |||
| 1805 | Ga0501031_0026397 | |||
| 1806 | Ga0501031_0203827 | |||
| 1807 | Ga0501032_0010560 | |||
| 1808 | Ga0501032_0095074 | |||
| 1809 | Ga0501032_0291089 | |||
| 1810 | Ga0501033_0035144 | |||
| 1811 | Ga0501033_0049938 | |||
| 1812 | Ga0501033_0166711 | |||
| 1813 | Ga0501034_0015387 | |||
| 1814 | Ga0501034_0098131 | |||
| 1815 | Ga0501034_0149927 | |||
| 1816 | Ga0501034_0150221 | |||
| 1817 | Ga0501034_0349274 | |||
| 1818 | Ga0501036_0051626 | |||
| 1819 | Ga0501036_0157941 | |||
| 1820 | Ga0501036_0349503 | |||
| 1821 | Ga0501037_0029576 | |||
| 1822 | Ga0501037_0056096 | |||
| 1823 | Ga0501038_0031073 | |||
| 1824 | Ga0501038_0044142 | |||
| 1825 | Ga0501038_0279885 | |||
| 1826 | Ga0501040_0065785 | |||
| 1827 | Ga0501042_0008575 | |||
| 1828 | Ga0501043_0042774 | |||
| 1829 | Ga0501043_0100630 | |||
| 1830 | Ga0501043_0205655 | |||
| 1831 | Ga0501046_0078270 | |||
| 1832 | Ga0501047_0084929 | |||
| 1833 | Ga0501047_0136951 | |||
| 1834 | Ga0501048_0045118 | |||
| 1835 | Ga0501048_0057296 | |||
| 1836 | Ga0501067_0053201 | |||
| 1837 | Ga0501069_0025024 | |||
| 1838 | Ga0501070_0099502 | |||
| 1839 | Ga0501070_0109604 | |||
| 1840 | Ga0501071_0032121 | |||
| 1841 | Ga0501073_0075704 | |||
| 1842 | Ga0501074_0005077 | |||
| 1843 | Ga0501075_0382022 | |||
| 1844 | Ga0501079_0009435 | |||
| 1845 | Ga0501080_0103274 | |||
| 1846 | Ga0501083_0018549 | |||
| 1847 | Ga0501035_0054458 | |||
| 1848 | Ga0501035_0057786 | |||
| 1849 | Ga0501035_0121456 | |||
| 1850 | Ga0501044_0037590 | |||
| 1851 | Ga0501044_0084757 | |||
| 1852 | Ga0501044_0204729 | |||
| 1853 | Ga0501045_0134990 | |||
| 1854 | Ga0501045_0191489 | |||
| 1855 | nmdc:mga03n38_46701_c1 | |||
| 1856 | nmdc:mga00v17_4589_c1 | |||
| 1857 | nmdc:mga00v17_69330_c2 | |||
| 1858 | nmdc:mga00v17_93038_c1 | |||
| 1859 | nmdc:mga0yw44_12452_c1 | |||
| 1860 | nmdc:mga0yw44_131120_c1 | |||
| 1861 | nmdc:mga0yw44_30877_c1 | |||
| 1862 | nmdc:mga0yw44_45205_c1 | |||
| 1863 | nmdc:mga0k408_105376_c1 | |||
| 1864 | nmdc:mga0k408_110834_c1 | |||
| 1865 | nmdc:mga0k408_143337_c1 | |||
| 1866 | nmdc:mga06z11_111727_c1 | |||
| 1867 | nmdc:mga06z11_46459_c1 | |||
| 1868 | nmdc:mga04h51_28933_c1 | |||
| 1869 | nmdc:mga07m45_245287_c1 | |||
| 1870 | nmdc:mga07m45_46313_c1 | |||
| 1871 | nmdc:mga07m45_4675_c1 | |||
| 1872 | nmdc:mga08y16_173922_c1 | |||
| 1873 | nmdc:mga0n895_126914_c1 | |||
| 1874 | nmdc:mga0rr50_82438_c1 | |||
| 1875 | Ga0495601_0019393 | |||
| 1876 | Ga0495601_0034162 | |||
| 1877 | Ga0495601_0196507 | |||
| 1878 | Ga0495612_0014435 | |||
| 1879 | Ga0495612_0070345 | |||
| 1880 | Ga0500635_0098286 | |||
| 1881 | Ga0495595_0005744 | |||
| 1882 | Ga0495619_0004552 | |||
| 1883 | Ga0500643_007421 | |||
| 1884 | Ga0500644_0010381 | |||
| 1885 | Ga0500644_0096081 | |||
| 1886 | Ga0500647_0084833 | |||
| 1887 | Ga0500583_0055049 | |||
| 1888 | Ga0500651_0227913 | |||
| 1889 | Ga0500566_0001223 | |||
| 1890 | Ga0500566_0003804 | |||
| 1891 | Ga0500566_0010050 | |||
| 1892 | Ga0500566_0020729 | |||
| 1893 | Ga0500566_0076480 | |||
| 1894 | Ga0500641_0019753 | |||
| 1895 | Ga0500650_0008217 | |||
| 1896 | Ga0500554_002687 | |||
| 1897 | Ga0500554_012553 | |||
| 1898 | Ga0500556_0000006 | |||
| 1899 | Ga0500572_000415 | |||
| 1900 | Ga0500572_014670 | |||
| 1901 | Ga0500591_081609 | |||
| 1902 | Ga0500594_0032330 | |||
| 1903 | Ga0500595_009735 | |||
| 1904 | Ga0500595_015694 | |||
| 1905 | Ga0500595_018065 | |||
| 1906 | Ga0500595_029480 | |||
| 1907 | Ga0500595_033463 | |||
| 1908 | Ga0500608_002047 | |||
| 1909 | Ga0500608_012388 | |||
| 1910 | Ga0500642_0000004 | |||
| 1911 | Ga0500655_026347 | |||
| 1912 | Ga0500559_0000106 | |||
| 1913 | Ga0500559_0001060 | |||
| 1914 | Ga0500568_0002722 | |||
| 1915 | Ga0500568_0014183 | |||
| 1916 | Ga0500573_0099806 | |||
| 1917 | Ga0500577_0000027 | |||
| 1918 | Ga0500577_0041005 | |||
| 1919 | Ga0500586_000522 | |||
| 1920 | Ga0500603_001404 | |||
| 1921 | Ga0500603_006415 | |||
| 1922 | Ga0500603_038289 | |||
| 1923 | Ga0500604_0009029 | |||
| 1924 | Ga0500616_0000022 | |||
| 1925 | Ga0500616_0000038 | |||
| 1926 | Ga0500622_0004710 | |||
| 1927 | Ga0500622_0046249 | |||
| 1928 | Ga0500630_030914 | |||
| 1929 | Ga0500634_0096205 | |||
| 1930 | Ga0500638_013381 | |||
| 1931 | Ga0500638_031306 | |||
| 1932 | Ga0500639_013822 | |||
| 1933 | Ga0500639_033760 | |||
| 1934 | Ga0500636_0005964 | |||
| 1935 | Ga0500636_0016050 | |||
| 1936 | Ga0500637_0004377 | |||
| 1937 | Ga0500637_0020058 | |||
| 1938 | Ga0500567_076007 | |||
| 1939 | Ga0500645_054444 | |||
| 1940 | Ga0500552_001030 | |||
| 1941 | Ga0500596_000930 | |||
| 1942 | Ga0500596_007751 | |||
| 1943 | Ga0501084_0021758 | |||
| 1944 | Ga0500661_005155 | |||
| 1945 | Ga0501082_0139935 | |||
| 1946 | Ga0466962_0013365 | |||
| 1947 | 2513719810 | |||
| 1948 | 2513888653 | |||
| 1949 | 2517102104 | |||
| 1950 | 2603858401 | |||
| 1951 | 2793064908 | |||
| 1952 | 2793079245 | |||
| 1953 | 2841965740 | |||
| 1954 | 2842043621 | |||
| 1955 | 2842052389 | |||
| 1956 | 2857526502 | |||
| 1957 | 2874624669 | |||
| 1958 | 2876813398 | |||
| 1959 | 2879113051 | |||
| 1960 | 2885371157 | |||
| 1961 | 2885410513 | |||
| 1962 | 2888390793 | |||
| 1963 | 2889035629 | |||
| 1964 | 2893067248 | |||
| 1965 | 2904670376 | |||
| 1966 | 2904690626 | |||
| 1967 | 2908756384 | |||
| 1968 | 2919073683 | |||
| 1969 | 8006928528 | |||
| 1970 | 8006990805 | |||
| 1971 | 8016586504 | |||
| 1972 | 8056695295 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1uyv-assembly1.cif.gz_A-2 | acetyl-coa carboxylase carboxyltransferase domain l1705i/v1967i mutant | 0.8707 | 61 | 136 |
| 1uyv-assembly2.cif.gz_B | acetyl-coa carboxylase carboxyltransferase domain l1705i/v1967i mutant | 0.8602 | 61 | 136 |
| 4g2r-assembly1.cif.gz_A | crystal structure of the carboxyltransferase subunit of acc (accd6) in complex with inhibitor haloxyfop from mycobacterium tuberculosis | 0.8567 | 61 | 137 |
| 4g2r-assembly1.cif.gz_B | crystal structure of the carboxyltransferase subunit of acc (accd6) in complex with inhibitor haloxyfop from mycobacterium tuberculosis | 0.8561 | 61 | 136 |
| 6tzv-assembly3.cif.gz_E | crystal structure of the carboxyltransferase subunit of acc (accd6) in complex with inhibitor phenyl-cyclodiaone from mycobacterium tuberculosis | 0.8517 | 61 | 134 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9C9C0_371_523_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.916 | 44 | 143 | 3.90.226.10 |
| 4fb8A01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.8399 | 61 | 136 | 3.90.226.10 |
| 3bezC03 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.821 | 44 | 259 | 3.90.226.10 |
| 4kwbC01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.805 | 43 | 264 | 3.90.226.10 |
| af_P9WPC3_1_214_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.7992 | 48 | 238 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536G5J8-F1-model_v4 | S49 family peptidase | 0.9228 | 40 | 143 |
GO:0006508
GO:0008236 |
| AF-A0A350XYH0-F1-model_v4 | ATP-dependent Clp protease proteolytic subunit | 0.8407 | 48 | 235 |
GO:0004176
GO:0004252 GO:0006515 GO:0009368 GO:0051117 |
| AF-A0A3D0WUJ5-F1-model_v4 | Signal peptide peptidase SppA | 0.8391 | 32 | 137 |
GO:0006465
GO:0008236 GO:0016020 |
| AF-A0A6L5DFQ3-F1-model_v4 | deleted | 0.8265 | 44 | 263 |
|
| AF-A0A353BVJ5-F1-model_v4 | ATP-dependent Clp protease proteolytic subunit | 0.8115 | 45 | 236 |
GO:0004176
GO:0004252 GO:0006515 GO:0009368 GO:0051117 |