F487518

General Info

Members Datasets Scaffolds Average Seq Length
986 346 1972 328

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10018371|Ga0081538_100183716
Length 356
Sequence LLVAGAPPGRVPRGAYARGVRDEHGIQAEGLVREFKGGIRAVDGIRLEVRPGEIYGFLGPNGAGKSTTVHMLTTLLPPTAGTACVAGFDVARDGAKVRAAIGAALQEAALDPLLTGREHLRLQTALHGMPKAERRERTEALLERVGLTQAADRKVRTYSGGMKRRLDLALALVHEPSILFLDEPTTGLDPQSRNALWSEVARLSGDEGVTVFLTTQYLEEADVLADRVGIIDHGRIVAEGTPGALKAEIGRPSVEAVPCNSSERAAVAEVLRRFGRPVPGSPKGVTVRLDGGEEALADVVRALETEGLHLDHLQLHSPTLDDVFLAKTGRSLEGAAEEAESRPDAESEGEPEPLRA

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
150 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
151 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
152 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
153 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
154 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
155 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
156 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
157 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
158 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
159 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
160 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
161 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
162 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
163 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
164 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
165 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
169 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
170 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
171 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
172 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
180 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
192 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
193 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
194 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
195 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
196 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
197 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
200 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
207 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
208 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
209 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
210 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
211 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
212 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
213 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
214 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
215 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
216 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
217 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
218 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
219 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
224 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
225 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
226 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
227 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
228 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
229 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
230 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
231 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
232 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
233 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
234 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
235 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
236 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
237 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
238 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
239 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
240 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
241 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
245 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
246 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
247 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
248 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
249 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
250 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
251 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
252 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
253 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
256 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
257 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
258 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
259 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
260 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
261 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
262 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
263 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
266 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
267 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
268 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
269 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
270 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
271 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
272 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
273 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
274 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
275 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
276 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
277 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
278 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
279 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
280 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
281 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
282 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
283 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
284 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
285 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
286 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
302 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
303 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
304 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
305 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
306 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
307 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
308 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
309 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
310 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
311 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
312 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
313 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
314 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
315 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
316 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
317 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
320 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
321 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
322 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
323 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
324 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
325 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
326 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
327 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
328 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
329 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
330 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
331 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
332 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
333 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
334 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
335 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
336 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
337 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
338 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
339 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
340 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
341 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
342 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
343 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
344 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
345 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
346 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.43
Nodule 0
Rhizoplane 11.05
Rhizosphere 85.4
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10018371 3300005981 Bacteria 5253
2 JGI25407J50210_10002731 3300003373 Bacteria 4198
3 JGI25407J50210_10003431 3300003373 Bacteria 3791
4 JGI25407J50210_10010599 3300003373 Bacteria 2347
5 Ga0070658_10050495 3300005327 Bacteria 3371
6 Ga0070658_10165550 3300005327 Bacteria 1856
7 Ga0070683_100001714 3300005329 Bacteria 17052
8 Ga0070683_100013143 3300005329 Bacteria 7208
9 Ga0070683_100018473 3300005329 Bacteria 6176
10 Ga0070683_100023359 3300005329 Bacteria 5530
11 Ga0070683_100043303 3300005329 Bacteria 4149
12 Ga0070683_100237672 3300005329 Bacteria 1732
13 Ga0070690_100092170 3300005330 Bacteria 1998
14 Ga0070690_100301662 3300005330 Bacteria 1149
15 Ga0068869_100006717 3300005334 Bacteria 7312
16 Ga0070680_100004037 3300005336 Bacteria 10977
17 Ga0070680_100005608 3300005336 Bacteria 9506
18 Ga0070680_100014559 3300005336 Bacteria 6152
19 Ga0070680_100037693 3300005336 Bacteria 3907
20 Ga0070682_100000080 3300005337 Bacteria 85683
21 Ga0070682_100030235 3300005337 Bacteria 3268
22 Ga0068868_100000095 3300005338 Bacteria 54537
23 Ga0068868_100220158 3300005338 Bacteria 1589
24 Ga0070660_100001494 3300005339 Bacteria 16003
25 Ga0070660_100003867 3300005339 Bacteria 10339
26 Ga0070660_100065384 3300005339 Bacteria 2830
27 Ga0070660_100136777 3300005339 Bacteria 1963
28 Ga0070660_100284427 3300005339 Bacteria 1353
29 Ga0070660_100305580 3300005339 Bacteria 1305
30 Ga0070689_100057873 3300005340 Bacteria 3010
31 Ga0070691_10008984 3300005341 Bacteria 4572
32 Ga0070691_10013863 3300005341 Bacteria 3699
33 Ga0070661_100000005 3300005344 Bacteria 220455
34 Ga0070661_100007123 3300005344 Bacteria 7712
35 Ga0070661_100063455 3300005344 Bacteria 2713
36 Ga0070661_100241349 3300005344 Bacteria 1392
37 Ga0070675_100000058 3300005354 Bacteria 66874
38 Ga0070675_100089174 3300005354 Bacteria 2582
39 Ga0070674_100000020 3300005356 Bacteria 88217
40 Ga0070674_100051096 3300005356 Bacteria 2848
41 Ga0070674_100196524 3300005356 Bacteria 1555
42 Ga0070673_100046800 3300005364 Bacteria 3362
43 Ga0070688_100000333 3300005365 Bacteria 24059
44 Ga0070688_100002793 3300005365 Bacteria 8872
45 Ga0070688_100005500 3300005365 Bacteria 6680
46 Ga0070688_100053154 3300005365 Bacteria 2533
47 Ga0070659_100026115 3300005366 Bacteria 4492
48 Ga0070659_100115029 3300005366 Bacteria 2174
49 Ga0070667_100087275 3300005367 Bacteria 2677
50 Ga0070709_10007649 3300005434 Bacteria 5931
51 Ga0070710_10029625 3300005437 Bacteria 2938
52 Ga0070711_100008345 3300005439 Bacteria 6342
53 Ga0070711_100322332 3300005439 Bacteria 1235
54 Ga0070700_100021145 3300005441 Bacteria 3779
55 Ga0070708_100001181 3300005445 Bacteria 20099
56 Ga0070663_100032323 3300005455 Bacteria 3606
57 Ga0070678_100007594 3300005456 Bacteria 6440
58 Ga0070678_100100238 3300005456 Bacteria 2243
59 Ga0070662_100000363 3300005457 Bacteria 27116
60 Ga0070681_10004636 3300005458 Bacteria 13126
61 Ga0070681_10005901 3300005458 Bacteria 11857
62 Ga0070681_10008977 3300005458 Bacteria 9830
63 Ga0070681_10030842 3300005458 Bacteria 5381
64 Ga0070681_10183635 3300005458 Bacteria 2012
65 Ga0070685_10000293 3300005466 Bacteria 31562
66 Ga0070685_10003954 3300005466 Bacteria 7487
67 Ga0070685_10045930 3300005466 Bacteria 2506
68 Ga0070706_100004949 3300005467 Bacteria 12754
69 Ga0070706_100066121 3300005467 Bacteria 3344
70 Ga0070707_100001551 3300005468 Bacteria 22322
71 Ga0070698_100001638 3300005471 Bacteria 24965
72 Ga0070698_100024518 3300005471 Bacteria 6294
73 Ga0070698_100084562 3300005471 Bacteria 3161
74 Ga0070698_100351864 3300005471 Bacteria 1405
75 Ga0070699_100017223 3300005518 Bacteria 6206
76 Ga0070679_100000537 3300005530 Bacteria 32232
77 Ga0070679_100001830 3300005530 Bacteria 19170
78 Ga0070679_100041206 3300005530 Bacteria 4595
79 Ga0070679_100075881 3300005530 Bacteria 3351
80 Ga0070684_100001226 3300005535 Bacteria 18422
81 Ga0070684_100003228 3300005535 Bacteria 12193
82 Ga0070684_100081312 3300005535 Bacteria 2867
83 Ga0070684_100128869 3300005535 Bacteria 2281
84 Ga0070684_100231040 3300005535 Bacteria 1689
85 Ga0068853_100247958 3300005539 Bacteria 1633
86 Ga0070672_100000004 3300005543 Bacteria 129970
87 Ga0070672_100254547 3300005543 Bacteria 1480
88 Ga0070686_100079214 3300005544 Bacteria 2171
89 Ga0070696_100122600 3300005546 Bacteria 1883
90 Ga0070693_100000833 3300005547 Bacteria 13687
91 Ga0070693_100046964 3300005547 Bacteria 2454
92 Ga0070665_100000159 3300005548 Bacteria 122613
93 Ga0070665_100032824 3300005548 Bacteria 5223
94 Ga0070704_100076925 3300005549 Bacteria 2442
95 Ga0068855_100014350 3300005563 Bacteria 9539
96 Ga0068855_100056520 3300005563 Bacteria 4605
97 Ga0068855_100211426 3300005563 Bacteria 2179
98 Ga0070664_100375561 3300005564 Bacteria 1297
99 Ga0068857_100001285 3300005577 Bacteria 19722
100 Ga0068857_100006742 3300005577 Bacteria 9874
101 Ga0068857_100115283 3300005577 Bacteria 2417
102 Ga0068854_100115490 3300005578 Bacteria 2031
103 Ga0068854_100142366 3300005578 Bacteria 1841
104 Ga0068856_100018421 3300005614 Bacteria 6768
105 Ga0068856_100023907 3300005614 Bacteria 5944
106 Ga0068856_100042442 3300005614 Bacteria 4474
107 Ga0068856_100073050 3300005614 Bacteria 3396
108 Ga0068856_100240699 3300005614 Bacteria 1825
109 Ga0070702_100010715 3300005615 Bacteria 4529
110 Ga0068852_100000012 3300005616 Bacteria 140734
111 Ga0068852_100038655 3300005616 Bacteria 4012
112 Ga0068852_100134945 3300005616 Bacteria 2278
113 Ga0068852_100285715 3300005616 Bacteria 1592
114 Ga0068864_100345034 3300005618 Bacteria 1404
115 Ga0068866_10000002 3300005718 Bacteria 394090
116 Ga0068866_10000019 3300005718 Bacteria 64778
117 Ga0068861_100041642 3300005719 Bacteria 3441
118 Ga0068851_10004367 3300005834 Bacteria 6365
119 Ga0068851_10005192 3300005834 Bacteria 5912
120 Ga0068870_10077016 3300005840 Bacteria 1833
121 Ga0068863_100000032 3300005841 Bacteria 172402
122 Ga0068863_100170585 3300005841 Bacteria 2087
123 Ga0068858_100000049 3300005842 Bacteria 122693
124 Ga0068858_100044747 3300005842 Bacteria 4103
125 Ga0068860_100044947 3300005843 Bacteria 4209
126 Ga0068860_100063112 3300005843 Bacteria 3520
127 Ga0081455_10007120 3300005937 Bacteria 11846
128 Ga0081455_10008830 3300005937 Bacteria 10428
129 Ga0081455_10030105 3300005937 Bacteria 4938
130 Ga0081455_10052361 3300005937 Bacteria 3495
131 Ga0081455_10068826 3300005937 Bacteria 2945
132 Ga0081455_10078225 3300005937 Bacteria 2718
133 Ga0081538_10000099 3300005981 Bacteria 83947
134 Ga0081538_10000252 3300005981 Bacteria 60660
135 Ga0081538_10000297 3300005981 Bacteria 57258
136 Ga0081538_10000429 3300005981 Bacteria 47236
137 Ga0081538_10000502 3300005981 Bacteria 43774
138 Ga0081538_10000691 3300005981 Bacteria 37035
139 Ga0081538_10000804 3300005981 Bacteria 34030
140 Ga0081538_10000894 3300005981 Bacteria 32276
141 Ga0081538_10000925 3300005981 Bacteria 31656
142 Ga0081538_10001600 3300005981 Bacteria 23244
143 Ga0081538_10003180 3300005981 Bacteria 15595
144 Ga0081538_10006926 3300005981 Bacteria 9860
145 Ga0081538_10008148 3300005981 Bacteria 8942
146 Ga0081538_10008586 3300005981 Bacteria 8645
147 Ga0081538_10012000 3300005981 Bacteria 6979
148 Ga0081538_10058246 3300005981 Bacteria 2243
149 Ga0081538_10122477 3300005981 Bacteria 1246
150 Ga0081540_1000006 3300005983 Bacteria 208724
151 Ga0081539_10000062 3300005985 Bacteria 249871
152 Ga0081539_10002242 3300005985 Bacteria 28126
153 Ga0081539_10060633 3300005985 Bacteria 2076
154 Ga0070717_10096537 3300006028 Bacteria 2504
155 Ga0075365_10000014 3300006038 Bacteria 79945
156 Ga0075365_10016179 3300006038 Bacteria 4530
157 Ga0075365_10023969 3300006038 Bacteria 3844
158 Ga0075365_10062766 3300006038 Bacteria 2486
159 Ga0075365_10086269 3300006038 Bacteria 2133
160 Ga0075365_10160419 3300006038 Bacteria 1567
161 Ga0075365_10172521 3300006038 Bacteria 1510
162 Ga0075365_10243986 3300006038 Bacteria 1262
163 Ga0075364_10093685 3300006051 Bacteria 1994
164 Ga0075364_10159535 3300006051 Bacteria 1522
165 Ga0075364_10164661 3300006051 Bacteria 1498
166 Ga0075364_10215756 3300006051 Bacteria 1301
167 Ga0070715_10000012 3300006163 Bacteria 173731
168 Ga0070715_10022486 3300006163 Bacteria 2460
169 Ga0070712_100019039 3300006175 Bacteria 4468
170 Ga0070712_100185024 3300006175 Bacteria 1626
171 Ga0097621_100024560 3300006237 Bacteria 4708
172 Ga0068871_100027672 3300006358 Bacteria 4436
173 Ga0075428_100017809 3300006844 Bacteria 7849
174 Ga0075428_100078209 3300006844 Bacteria 3611
175 Ga0075428_100121552 3300006844 Bacteria 2843
176 Ga0075428_100199352 3300006844 Bacteria 2164
177 Ga0075430_100003677 3300006846 Bacteria 12874
178 Ga0075430_100077997 3300006846 Bacteria 2777
179 Ga0075430_100100857 3300006846 Bacteria 2411
180 Ga0075431_100002485 3300006847 Bacteria 17777
181 Ga0075431_100045347 3300006847 Bacteria 4533
182 Ga0075431_100152117 3300006847 Bacteria 2382
183 Ga0075431_100227289 3300006847 Bacteria 1902
184 Ga0075431_100302345 3300006847 Bacteria 1616
185 Ga0075434_100007144 3300006871 Bacteria 10320
186 Ga0075429_100007313 3300006880 Bacteria 9585
187 Ga0075429_100046393 3300006880 Bacteria 3780
188 Ga0075436_100135926 3300006914 Bacteria 1726
189 Ga0105240_10026755 3300009093 Bacteria 7565
190 Ga0105240_10049813 3300009093 Bacteria 5284
191 Ga0111539_10002085 3300009094 Bacteria 26719
192 Ga0111539_10002336 3300009094 Bacteria 25254
193 Ga0111539_10024191 3300009094 Bacteria 7458
194 Ga0105245_10000056 3300009098 Bacteria 124109
195 Ga0105245_10001677 3300009098 Bacteria 20157
196 Ga0105245_10003691 3300009098 Bacteria 13667
197 Ga0105245_10005665 3300009098 Bacteria 10974
198 Ga0105245_10005783 3300009098 Bacteria 10850
199 Ga0105245_10010311 3300009098 Bacteria 8139
200 Ga0105245_10060054 3300009098 Bacteria 3424
201 Ga0105245_10064347 3300009098 Bacteria 3314
202 Ga0105245_10386593 3300009098 Bacteria 1395
203 Ga0114129_10001119 3300009147 Bacteria 35383
204 Ga0114129_10003023 3300009147 Bacteria 23586
205 Ga0114129_10013663 3300009147 Bacteria 11570
206 Ga0114129_10023252 3300009147 Bacteria 8791
207 Ga0114129_10029378 3300009147 Bacteria 7787
208 Ga0105243_10047394 3300009148 Bacteria 3383
209 Ga0105243_10074340 3300009148 Bacteria 2756
210 Ga0105243_10099187 3300009148 Bacteria 2414
211 Ga0105243_10209206 3300009148 Bacteria 1716
212 Ga0105248_10000032 3300009177 Bacteria 201114
213 Ga0105248_10083797 3300009177 Bacteria 3586
214 Ga0105237_10163908 3300009545 Bacteria 2222
215 Ga0105237_10175697 3300009545 Bacteria 2142
216 Ga0105238_10242128 3300009551 Bacteria 1781
217 Ga0105238_10249005 3300009551 Bacteria 1755
218 Ga0105249_10011189 3300009553 Bacteria 7881
219 Ga0105028_101263 3300009993 Bacteria 2665
220 Ga0105239_10006331 3300010375 Bacteria 13766
221 Ga0105239_10093776 3300010375 Bacteria 3315
222 Ga0105239_10372906 3300010375 Bacteria 1613
223 Ga0105246_10039193 3300011119 Bacteria 3190
224 Ga0157371_10009099 3300013102 Bacteria 7848
225 Ga0157370_10214353 3300013104 Bacteria 1784
226 Ga0157369_10000099 3300013105 Bacteria 120032
227 Ga0157369_10035965 3300013105 Bacteria 5428
228 Ga0157369_10075437 3300013105 Bacteria 3616
229 Ga0157374_10006829 3300013296 Bacteria 9708
230 Ga0157374_10098614 3300013296 Bacteria 2798
231 Ga0157378_10010497 3300013297 Bacteria 8091
232 Ga0157378_10510143 3300013297 Bacteria 1202
233 Ga0157372_10026370 3300013307 Bacteria 6324
234 Ga0157372_10151411 3300013307 Bacteria 2678
235 Ga0157372_10434060 3300013307 Bacteria 1531
236 Ga0157372_10606721 3300013307 Bacteria 1276
237 Ga0157375_10010359 3300013308 Bacteria 8207
238 Ga0157375_10032670 3300013308 Bacteria 4937
239 Ga0157375_10046134 3300013308 Bacteria 4246
240 Ga0157375_10048497 3300013308 Bacteria 4155
241 Ga0157375_10600278 3300013308 Bacteria 1260
242 Ga0163163_10107630 3300014325 Bacteria 2814
243 Ga0157380_10000219 3300014326 Bacteria 34156
244 Ga0157380_10362950 3300014326 Bacteria 1360
245 Ga0157377_10005388 3300014745 Bacteria 6009
246 Ga0157377_10086554 3300014745 Bacteria 1842
247 Ga0157379_10320088 3300014968 Bacteria 1416
248 Ga0157376_10047691 3300014969 Bacteria 3538
249 Ga0157376_10096829 3300014969 Bacteria 2569
250 Ga0157376_10103402 3300014969 Bacteria 2494
251 Ga0157376_10331348 3300014969 Bacteria 1450
252 Ga0182006_1061684 3300015261 Bacteria 1413
253 Ga0163161_10000058 3300017792 Bacteria 114035
254 Ga0163161_10065977 3300017792 Bacteria 2642
255 Ga0206356_10987891 3300020070 Bacteria 1988
256 Ga0206356_11507257 3300020070 Bacteria 1649
257 Ga0206354_10224168 3300020081 Bacteria 2296
258 Ga0206353_11255590 3300020082 Bacteria 3314
259 Ga0206353_11844079 3300020082 Bacteria 5443
260 Ga0207656_10002305 3300025321 Bacteria 6410
261 Ga0207656_10117373 3300025321 Bacteria 1236
262 Ga0207642_10000001 3300025899 Bacteria 714030
263 Ga0207642_10000003 3300025899 Bacteria 650651
264 Ga0207642_10000004 3300025899 Bacteria 407822
265 Ga0207642_10000017 3300025899 Bacteria 64774
266 Ga0207642_10014374 3300025899 Bacteria 2919
267 Ga0207685_10000001 3300025905 Bacteria 604473
268 Ga0207699_10027383 3300025906 Bacteria 3155
269 Ga0207707_10003654 3300025912 Bacteria 13645
270 Ga0207707_10011148 3300025912 Bacteria 7820
271 Ga0207707_10012057 3300025912 Bacteria 7517
272 Ga0207707_10157919 3300025912 Bacteria 1983
273 Ga0207693_10001551 3300025915 Bacteria 20284
274 Ga0207693_10013240 3300025915 Bacteria 6654
275 Ga0207693_10271474 3300025915 Bacteria 1329
276 Ga0207663_10014493 3300025916 Bacteria 4318
277 Ga0207663_10066421 3300025916 Bacteria 2309
278 Ga0207663_10108944 3300025916 Bacteria 1876
279 Ga0207660_10005162 3300025917 Bacteria 8488
280 Ga0207660_10018009 3300025917 Bacteria 4704
281 Ga0207660_10047444 3300025917 Bacteria 3037
282 Ga0207660_10061128 3300025917 Bacteria 2711
283 Ga0207657_10001335 3300025919 Bacteria 26208
284 Ga0207657_10002472 3300025919 Bacteria 19995
285 Ga0207657_10003370 3300025919 Bacteria 17079
286 Ga0207657_10014368 3300025919 Bacteria 7732
287 Ga0207657_10029745 3300025919 Bacteria 4967
288 Ga0207657_10271799 3300025919 Bacteria 1347
289 Ga0207649_10016170 3300025920 Bacteria 4202
290 Ga0207649_10030765 3300025920 Bacteria 3183
291 Ga0207649_10320794 3300025920 Bacteria 1138
292 Ga0207652_10000631 3300025921 Bacteria 34868
293 Ga0207652_10001944 3300025921 Bacteria 17885
294 Ga0207652_10116676 3300025921 Bacteria 2372
295 Ga0207646_10009623 3300025922 Bacteria 9534
296 Ga0207650_10025386 3300025925 Bacteria 4221
297 Ga0207650_10152474 3300025925 Bacteria 1825
298 Ga0207659_10000020 3300025926 Bacteria 151552
299 Ga0207687_10000007 3300025927 Bacteria 604185
300 Ga0207687_10000646 3300025927 Bacteria 23464
301 Ga0207687_10006484 3300025927 Bacteria 7727
302 Ga0207687_10017967 3300025927 Bacteria 4665
303 Ga0207687_10161060 3300025927 Bacteria 1722
304 Ga0207700_10000008 3300025928 Bacteria 341717
305 Ga0207700_10000016 3300025928 Bacteria 202434
306 Ga0207690_10031482 3300025932 Bacteria 3395
307 Ga0207690_10326736 3300025932 Bacteria 1207
308 Ga0207706_10000006 3300025933 Bacteria 216994
309 Ga0207706_10014837 3300025933 Bacteria 7053
310 Ga0207686_10142989 3300025934 Bacteria 1656
311 Ga0207709_10049455 3300025935 Bacteria 2566
312 Ga0207709_10060791 3300025935 Bacteria 2357
313 Ga0207670_10087786 3300025936 Bacteria 2192
314 Ga0207670_10330977 3300025936 Bacteria 1201
315 Ga0207669_10000016 3300025937 Bacteria 124532
316 Ga0207669_10000036 3300025937 Bacteria 78568
317 Ga0207669_10322612 3300025937 Bacteria 1183
318 Ga0207704_10000025 3300025938 Bacteria 135523
319 Ga0207704_10008706 3300025938 Bacteria 4867
320 Ga0207704_10076865 3300025938 Bacteria 2141
321 Ga0207691_10000020 3300025940 Bacteria 133465
322 Ga0207691_10018612 3300025940 Bacteria 6582
323 Ga0207711_10000020 3300025941 Bacteria 363325
324 Ga0207711_10134064 3300025941 Bacteria 2223
325 Ga0207689_10025225 3300025942 Bacteria 4983
326 Ga0207689_10093134 3300025942 Bacteria 2475
327 Ga0207661_10001238 3300025944 Bacteria 17056
328 Ga0207661_10001780 3300025944 Bacteria 14742
329 Ga0207661_10001949 3300025944 Bacteria 14185
330 Ga0207661_10008416 3300025944 Bacteria 7373
331 Ga0207661_10030009 3300025944 Bacteria 4182
332 Ga0207661_10151734 3300025944 Bacteria 2003
333 Ga0207679_10308269 3300025945 Bacteria 1367
334 Ga0207667_10215088 3300025949 Bacteria 1970
335 Ga0207651_10111878 3300025960 Bacteria 2051
336 Ga0207651_10220835 3300025960 Bacteria 1532
337 Ga0207640_10000285 3300025981 Bacteria 33957
338 Ga0207640_10060336 3300025981 Bacteria 2506
339 Ga0207640_10083577 3300025981 Bacteria 2189
340 Ga0207640_10206892 3300025981 Bacteria 1492
341 Ga0207640_10245438 3300025981 Bacteria 1386
342 Ga0207677_10001435 3300026023 Bacteria 12669
343 Ga0207677_10018809 3300026023 Bacteria 4155
344 Ga0207677_10052187 3300026023 Bacteria 2777
345 Ga0207703_10000053 3300026035 Bacteria 143924
346 Ga0207703_10000067 3300026035 Bacteria 125623
347 Ga0207678_10025503 3300026067 Bacteria 5161
348 Ga0207678_10210895 3300026067 Bacteria 1661
349 Ga0207708_10000757 3300026075 Bacteria 24232
350 Ga0207708_10006689 3300026075 Bacteria 8525
351 Ga0207708_10329542 3300026075 Bacteria 1248
352 Ga0207702_10000016 3300026078 Bacteria 226633
353 Ga0207702_10003815 3300026078 Bacteria 13603
354 Ga0207702_10014205 3300026078 Bacteria 6613
355 Ga0207702_10016146 3300026078 Bacteria 6181
356 Ga0207702_10016852 3300026078 Bacteria 6048
357 Ga0207702_10033585 3300026078 Bacteria 4286
358 Ga0207702_10178202 3300026078 Bacteria 1955
359 Ga0207702_10302676 3300026078 Bacteria 1518
360 Ga0207641_10000071 3300026088 Bacteria 151812
361 Ga0207641_10008529 3300026088 Bacteria 8466
362 Ga0207648_10000228 3300026089 Bacteria 60032
363 Ga0207648_10026646 3300026089 Bacteria 5135
364 Ga0207648_10043290 3300026089 Bacteria 3952
365 Ga0207676_10080307 3300026095 Bacteria 2647
366 Ga0207674_10002949 3300026116 Bacteria 21132
367 Ga0207674_10050544 3300026116 Bacteria 4247
368 Ga0207674_10072073 3300026116 Bacteria 3471
369 Ga0207675_100009465 3300026118 Bacteria 9119
370 Ga0207675_100010716 3300026118 Bacteria 8586
371 Ga0207675_100140748 3300026118 Bacteria 2292
372 Ga0207683_10000740 3300026121 Bacteria 29707
373 Ga0207683_10006404 3300026121 Bacteria 10083
374 Ga0207683_10023702 3300026121 Bacteria 5280
375 Ga0207683_10135986 3300026121 Bacteria 2212
376 Ga0207683_10172253 3300026121 Bacteria 1961
377 Ga0207683_10343832 3300026121 Bacteria 1368
378 Ga0207698_10000012 3300026142 Bacteria 260061
379 Ga0207698_10009350 3300026142 Bacteria 6246
380 Ga0207428_10191832 3300027907 Bacteria 1540
381 Ga0207428_10235228 3300027907 Bacteria 1370
382 Ga0268266_10000023 3300028379 Bacteria 501899
383 Ga0268266_10027948 3300028379 Bacteria 4798
384 Ga0268266_10066071 3300028379 Bacteria 3127
385 Ga0268266_10136436 3300028379 Bacteria 2198
386 Ga0268264_10007216 3300028381 Bacteria 9306
387 Ga0265337_1000054 3300028556 Bacteria 52183
388 Ga0265326_10000027 3300028558 Bacteria 110843
389 Ga0265323_10019618 3300028653 Bacteria 2607
390 Ga0265322_10000003 3300028654 Bacteria 468671
391 Ga0265324_10000103 3300029957 Bacteria 67507
392 Ga0314311_1122819 3300030733 Bacteria 6045
393 Ga0316179_1002117 3300030734 Bacteria 36853
394 Ga0316180_1070555 3300030736 Bacteria 5463
395 Ga0316183_1122503 3300030742 Bacteria 24386
396 Ga0316182_1020791 3300030745 Bacteria 37858
397 Ga0265332_10007198 3300031238 Bacteria 5035
398 Ga0265328_10001275 3300031239 Bacteria 11625
399 Ga0265320_10000001 3300031240 Bacteria 847191
400 Ga0265329_10002125 3300031242 Bacteria 9180
401 Ga0265331_10001895 3300031250 Bacteria 14686
402 Ga0265327_10000003 3300031251 Bacteria 852750
403 Ga0265327_10008056 3300031251 Bacteria 7945
404 Ga0265316_10020298 3300031344 Bacteria 5661
405 Ga0307408_100031047 3300031548 Bacteria 3716
406 Ga0307408_100048271 3300031548 Bacteria 3053
407 Ga0307408_100081761 3300031548 Bacteria 2416
408 Ga0307408_100239143 3300031548 Bacteria 1491
409 Ga0265314_10001375 3300031711 Bacteria 27314
410 Ga0316576_10143144 3300031727 Bacteria 1800
411 Ga0316576_10180268 3300031727 Bacteria 1593
412 Ga0307413_10002156 3300031824 Bacteria 7907
413 Ga0307413_10023303 3300031824 Bacteria 3354
414 Ga0307413_10051708 3300031824 Bacteria 2477
415 Ga0307410_10016214 3300031852 Bacteria 4438
416 Ga0307410_10058953 3300031852 Bacteria 2619
417 Ga0307410_10303937 3300031852 Bacteria 1260
418 Ga0307406_10011927 3300031901 Bacteria 4940
419 Ga0307406_10027082 3300031901 Bacteria 3450
420 Ga0307406_10038981 3300031901 Bacteria 2944
421 Ga0307407_10022196 3300031903 Bacteria 3288
422 Ga0307407_10048327 3300031903 Bacteria 2421
423 Ga0307412_10018003 3300031911 Bacteria 4241
424 Ga0307412_10241304 3300031911 Bacteria 1398
425 Ga0307409_100012362 3300031995 Bacteria 5438
426 Ga0307409_100058575 3300031995 Bacteria 2992
427 Ga0307409_100058788 3300031995 Bacteria 2988
428 Ga0307409_100090923 3300031995 Bacteria 2500
429 Ga0307409_100099462 3300031995 Bacteria 2408
430 Ga0307416_100011782 3300032002 Bacteria 5856
431 Ga0307416_100020572 3300032002 Bacteria 4713
432 Ga0307416_100028324 3300032002 Bacteria 4164
433 Ga0307416_100033278 3300032002 Bacteria 3906
434 Ga0307416_100045175 3300032002 Bacteria 3466
435 Ga0307416_100060430 3300032002 Bacteria 3086
436 Ga0307416_100114944 3300032002 Bacteria 2382
437 Ga0307416_100185584 3300032002 Bacteria 1954
438 Ga0307416_100377509 3300032002 Bacteria 1446
439 Ga0307414_10113428 3300032004 Bacteria 2069
440 Ga0307414_10120549 3300032004 Bacteria 2016
441 Ga0307411_10006677 3300032005 Bacteria 5796
442 Ga0307415_100001131 3300032126 Bacteria 12469
443 Ga0307415_100020790 3300032126 Bacteria 4016
444 Ga0307415_100076841 3300032126 Bacteria 2369
445 Ga0307415_100102523 3300032126 Bacteria 2103
446 Ga0307415_100275124 3300032126 Bacteria 1381
447 Ga0373960_0011977 3300035121 Bacteria 2147
448 Ga0373942_0030371 3300035207 Bacteria 1423
449 Ga0373931_0043963 3300035691 Bacteria 2355
450 Ga0373947_0036675 3300035725 Bacteria 2908
451 Ga0373937_0033225 3300036401 Bacteria 4684
452 Ga0373937_0074513 3300036401 Bacteria 3132
453 Ga0316584_0122658 3300036712 Bacteria 1941
454 Ga0373925_0085421 3300037068 Bacteria 2406
455 Ga0395899_0019939 3300037312 Bacteria 5088
456 Ga0395899_0066624 3300037312 Bacteria 2644
457 Ga0395899_0145260 3300037312 Bacteria 1685
458 Ga0395900_0003557 3300037418 Bacteria 16757
459 Ga0395900_0004073 3300037418 Bacteria 15587
460 Ga0395900_0006758 3300037418 Bacteria 11903
461 Ga0395900_0010351 3300037418 Bacteria 9543
462 Ga0395900_0041817 3300037418 Bacteria 4723
463 Ga0395900_0049279 3300037418 Bacteria 4339
464 Ga0395900_0081851 3300037418 Bacteria 3316
465 Ga0395900_0094819 3300037418 Bacteria 3066
466 Ga0395900_0117171 3300037418 Bacteria 2733
467 Ga0395900_0124218 3300037418 Bacteria 2647
468 Ga0395898_0001604 3300037466 Bacteria 30854
469 Ga0395898_0003445 3300037466 Bacteria 17691
470 Ga0395898_0009405 3300037466 Bacteria 10264
471 Ga0395898_0010906 3300037466 Bacteria 9483
472 Ga0395898_0011062 3300037466 Bacteria 9398
473 Ga0395898_0011171 3300037466 Bacteria 9351
474 Ga0395898_0027143 3300037466 Bacteria 5751
475 Ga0395898_0057103 3300037466 Bacteria 3804
476 Ga0395898_0077050 3300037466 Bacteria 3219
477 Ga0395898_0085211 3300037466 Bacteria 3045
478 Ga0395898_0115528 3300037466 Bacteria 2571
479 Ga0395898_0254166 3300037466 Bacteria 1676
480 Ga0395898_0267825 3300037466 Bacteria 1629
481 Ga0395898_0528300 3300037466 Bacteria 1121
482 Ga0395905_0001761 3300037471 Bacteria 25226
483 Ga0395905_0002251 3300037471 Bacteria 21694
484 Ga0395905_0010800 3300037471 Bacteria 8847
485 Ga0395905_0012564 3300037471 Bacteria 8144
486 Ga0395905_0025788 3300037471 Bacteria 5542
487 Ga0395905_0032416 3300037471 Bacteria 4914
488 Ga0395905_0035952 3300037471 Bacteria 4651
489 Ga0395905_0042430 3300037471 Bacteria 4269
490 Ga0395905_0046007 3300037471 Bacteria 4093
491 Ga0395905_0171259 3300037471 Bacteria 2039
492 Ga0395905_0401141 3300037471 Bacteria 1266
493 Ga0395901_0001420 3300038443 Bacteria 24995
494 Ga0395901_0001597 3300038443 Bacteria 23455
495 Ga0395901_0002643 3300038443 Bacteria 18106
496 Ga0395901_0006110 3300038443 Bacteria 12202
497 Ga0395901_0020676 3300038443 Bacteria 6737
498 Ga0395901_0032816 3300038443 Bacteria 5356
499 Ga0395901_0046351 3300038443 Bacteria 4515
500 Ga0395901_0064884 3300038443 Bacteria 3801
501 Ga0395901_0065706 3300038443 Bacteria 3777
502 Ga0395901_0136094 3300038443 Bacteria 2582
503 Ga0395901_0173308 3300038443 Bacteria 2263
504 Ga0395901_0235219 3300038443 Bacteria 1912
505 Ga0451853_2357732 3300041512 Bacteria 1284
506 Ga0439445_0002076 3300042004 Bacteria 4433
507 Ga0439448_0016164 3300042005 Bacteria 2269
508 Ga0439432_006638 3300042006 Bacteria 4122
509 Ga0466965_0057274 3300044683 Bacteria 1942
510 Ga0466966_0232242 3300044684 Bacteria 1113
511 Ga0466961_0026057 3300044693 Bacteria 3759
512 Ga0466961_0114028 3300044693 Bacteria 1699
513 Ga0466963_0025241 3300044694 Bacteria 3788
514 Ga0466963_0043513 3300044694 Bacteria 2953
515 Ga0466963_0130885 3300044694 Bacteria 1733
516 Ga0466964_0000890 3300044706 Bacteria 9790
517 Ga0466964_0010017 3300044706 Bacteria 3571
518 Ga0466968_0046907 3300044735 Bacteria 1836
519 Ga0466957_0003681 3300044842 Bacteria 8460
520 Ga0466957_0124802 3300044842 Bacteria 1644
521 Ga0466960_0022744 3300044901 Bacteria 2806
522 Ga0466959_0002692 3300045049 Bacteria 11414
523 Ga0466959_0055724 3300045049 Bacteria 2885
524 Ga0466958_0005927 3300045836 Bacteria 6606
525 Ga0466967_0000046 3300045976 Bacteria 43911
526 Ga0466967_0004872 3300045976 Bacteria 9164
527 Ga0466967_0069123 3300045976 Bacteria 3155
528 Ga0466967_0079454 3300045976 Bacteria 2957
529 Ga0466967_0092522 3300045976 Bacteria 2750
530 Ga0466967_0272881 3300045976 Bacteria 1621
531 Ga0466967_0426272 3300045976 Bacteria 1294
532 Ga0495617_006590 3300046452 Bacteria 4062
533 Ga0495627_034218 3300046453 Bacteria 1588
534 Ga0495592_0000621 3300046454 Bacteria 24971
535 Ga0495592_0083460 3300046454 Bacteria 2307
536 Ga0495603_0133104 3300046455 Bacteria 1447
537 Ga0495603_0181746 3300046455 Bacteria 1217
538 Ga0495590_0087496 3300046457 Bacteria 1101
539 Ga0495629_0005520 3300046459 Bacteria 9437
540 Ga0495629_0036832 3300046459 Bacteria 3451
541 Ga0495629_0140175 3300046459 Bacteria 1683
542 Ga0495641_0009756 3300046461 Bacteria 5666
543 Ga0495641_0015104 3300046461 Bacteria 4144
544 Ga0495641_0070282 3300046461 Bacteria 1573
545 Ga0495651_0004887 3300046462 Bacteria 10251
546 Ga0495651_0014023 3300046462 Bacteria 6199
547 Ga0495651_0090570 3300046462 Bacteria 2294
548 Ga0495653_0010741 3300046463 Bacteria 7498
549 Ga0495653_0022048 3300046463 Bacteria 5155
550 Ga0495653_0069968 3300046463 Bacteria 2627
551 Ga0495582_0000005 3300046473 Bacteria 156170
552 Ga0495582_0027982 3300046473 Bacteria 3092
553 Ga0495582_0038899 3300046473 Bacteria 2618
554 Ga0495605_0066960 3300046474 Bacteria 1705
555 Ga0495639_0047772 3300046475 Bacteria 1940
556 Ga0495664_0045067 3300046477 Bacteria 2615
557 Ga0495584_0028330 3300046491 Bacteria 2837
558 Ga0495584_0037550 3300046491 Bacteria 2449
559 Ga0495584_0076703 3300046491 Bacteria 1681
560 Ga0495594_0000013 3300046499 Bacteria 103201
561 Ga0495594_0021620 3300046499 Bacteria 3435
562 Ga0495596_0070600 3300046500 Bacteria 1357
563 Ga0495596_0097391 3300046500 Bacteria 1142
564 Ga0495608_0000031 3300046511 Bacteria 145255
565 Ga0495608_0000406 3300046511 Bacteria 30178
566 Ga0495608_0022630 3300046511 Bacteria 4310
567 Ga0495610_0000053 3300046512 Bacteria 142545
568 Ga0495618_0000068 3300046514 Bacteria 74614
569 Ga0495628_0005324 3300046516 Bacteria 11286
570 Ga0495628_0008805 3300046516 Bacteria 8638
571 Ga0495628_0039578 3300046516 Bacteria 3770
572 Ga0495628_0268974 3300046516 Bacteria 1268
573 Ga0495630_0000018 3300046517 Bacteria 186064
574 Ga0495630_0032881 3300046517 Bacteria 3867
575 Ga0495630_0100644 3300046517 Bacteria 2186
576 Ga0495631_0056015 3300046518 Bacteria 1717
577 Ga0495644_0033884 3300046523 Bacteria 1928
578 Ga0495652_0011511 3300046529 Bacteria 8000
579 Ga0495640_0001520 3300046533 Bacteria 18268
580 Ga0495640_0041629 3300046533 Bacteria 3209
581 Ga0495640_0047817 3300046533 Bacteria 2959
582 Ga0495640_0233002 3300046533 Bacteria 1158
583 Ga0495586_0000527 3300046535 Bacteria 22292
584 Ga0495586_0000620 3300046535 Bacteria 20523
585 Ga0495586_0031050 3300046535 Bacteria 2860
586 Ga0495598_0000907 3300046537 Bacteria 5706
587 Ga0495598_0040271 3300046537 Bacteria 1362
588 Ga0495597_0042995 3300046542 Bacteria 2013
589 Ga0495645_0048974 3300046543 Bacteria 3077
590 Ga0495622_0000014 3300046557 Bacteria 182142
591 Ga0495667_0004189 3300046559 Bacteria 9713
592 Ga0495667_0010495 3300046559 Bacteria 6267
593 Ga0495667_0044310 3300046559 Bacteria 2947
594 Ga0495634_0000024 3300046642 Bacteria 116230
595 Ga0495625_0000029 3300046660 Bacteria 244646
596 Ga0495635_0000009 3300046663 Bacteria 259024
597 Ga0495635_0112848 3300046663 Bacteria 1856
598 Ga0495635_0180491 3300046663 Bacteria 1435
599 Ga0495659_0006884 3300046664 Bacteria 3596
600 Ga0495588_0000198 3300046674 Bacteria 60956
601 Ga0495588_0058425 3300046674 Bacteria 1994
602 Ga0495657_0000024 3300046675 Bacteria 145255
603 Ga0495657_0004915 3300046675 Bacteria 10635
604 Ga0495657_0019467 3300046675 Bacteria 4895
605 Ga0495599_0007133 3300046678 Bacteria 6767
606 Ga0495599_0026791 3300046678 Bacteria 3613
607 Ga0495599_0031412 3300046678 Bacteria 3333
608 Ga0495599_0080868 3300046678 Bacteria 2029
609 Ga0495646_0087929 3300046680 Bacteria 1800
610 Ga0495647_0000293 3300046681 Bacteria 13969
611 Ga0495647_0090494 3300046681 Bacteria 1254
612 Ga0495658_0000019 3300046683 Bacteria 91606
613 Ga0495613_0000249 3300046689 Bacteria 50975
614 Ga0495613_0020894 3300046689 Bacteria 4880
615 Ga0495624_0000028 3300046690 Bacteria 93474
616 Ga0495624_0036177 3300046690 Bacteria 3185
617 Ga0495624_0041230 3300046690 Bacteria 2954
618 Ga0495671_0059350 3300046692 Bacteria 1891
619 Ga0495649_0015920 3300046694 Bacteria 4271
620 Ga0495600_0003314 3300046809 Bacteria 9451
621 Ga0495600_0010047 3300046809 Bacteria 5867
622 Ga0495600_0045091 3300046809 Bacteria 2876
623 Ga0495581_0000983 3300047315 Bacteria 15316
624 Ga0495604_0000056 3300047317 Bacteria 100110
625 Ga0495604_0003466 3300047317 Bacteria 12570
626 Ga0495604_0006459 3300047317 Bacteria 9300
627 Ga0495604_0009004 3300047317 Bacteria 7895
628 Ga0495604_0049521 3300047317 Bacteria 3264
629 Ga0495604_0071262 3300047317 Bacteria 2629
630 Ga0495674_0000042 3300047319 Bacteria 94820
631 Ga0495674_0007533 3300047319 Bacteria 10396
632 Ga0495674_0030284 3300047319 Bacteria 4922
633 Ga0495676_0005250 3300047321 Bacteria 11854
634 Ga0495676_0078076 3300047321 Bacteria 2522
635 Ga0495680_0000023 3300047322 Bacteria 116444
636 Ga0495680_0000421 3300047322 Bacteria 47432
637 Ga0495680_0003583 3300047322 Bacteria 15204
638 Ga0495680_0005597 3300047322 Bacteria 11781
639 Ga0495680_0021298 3300047322 Bacteria 5429
640 Ga0495675_0000209 3300047444 Bacteria 42691
641 Ga0495675_0065903 3300047444 Bacteria 2290
642 Ga0495675_0171167 3300047444 Bacteria 1334
643 Ga0495679_011414 3300047446 Bacteria 3429
644 Ga0495681_0000015 3300047470 Bacteria 183538
645 Ga0495684_0010019 3300047471 Bacteria 7327
646 Ga0495684_0010791 3300047471 Bacteria 7061
647 Ga0495602_0000228 3300048088 Bacteria 52649
648 Ga0495602_0046294 3300048088 Bacteria 3930
649 Ga0495602_0061923 3300048088 Bacteria 3249
650 Ga0495602_0130113 3300048088 Bacteria 2009
651 Ga0495602_0210737 3300048088 Bacteria 1475
652 Ga0496100_0005985 3300048903 Bacteria 6599
653 Ga0496100_0006019 3300048903 Bacteria 6584
654 Ga0496100_0120231 3300048903 Bacteria 1836
655 Ga0496100_0179643 3300048903 Bacteria 1530
656 Ga0496101_0001626 3300048904 Bacteria 13507
657 Ga0496101_0032186 3300048904 Bacteria 3689
658 Ga0496102_0001674 3300048905 Bacteria 19466
659 Ga0496102_0008240 3300048905 Bacteria 8924
660 Ga0496102_0017155 3300048905 Bacteria 6340
661 Ga0496102_0023784 3300048905 Bacteria 5444
662 Ga0496102_0027850 3300048905 Bacteria 5047
663 Ga0496102_0042632 3300048905 Bacteria 4112
664 Ga0496102_0044639 3300048905 Bacteria 4023
665 Ga0496102_0218064 3300048905 Bacteria 1798
666 Ga0496102_0282216 3300048905 Bacteria 1565
667 Ga0496103_0002323 3300048906 Bacteria 12016
668 Ga0496103_0004839 3300048906 Bacteria 8133
669 Ga0496103_0061251 3300048906 Bacteria 2340
670 Ga0496103_0080885 3300048906 Bacteria 2043
671 Ga0496103_0146001 3300048906 Bacteria 1514
672 Ga0496104_0000576 3300048907 Bacteria 31360
673 Ga0496104_0002883 3300048907 Bacteria 14819
674 Ga0496104_0007540 3300048907 Bacteria 9621
675 Ga0496104_0025674 3300048907 Bacteria 5434
676 Ga0496104_0059650 3300048907 Bacteria 3612
677 Ga0496104_0086342 3300048907 Bacteria 2995
678 Ga0496104_0167800 3300048907 Bacteria 2105
679 Ga0496104_0346090 3300048907 Bacteria 1399
680 Ga0496104_0350863 3300048907 Bacteria 1388
681 Ga0496105_0001400 3300048908 Bacteria 16942
682 Ga0496105_0001452 3300048908 Bacteria 16682
683 Ga0496105_0005013 3300048908 Bacteria 10024
684 Ga0496105_0006590 3300048908 Bacteria 8939
685 Ga0496105_0009052 3300048908 Bacteria 7768
686 Ga0496105_0117228 3300048908 Bacteria 2196
687 Ga0496105_0264236 3300048908 Bacteria 1391
688 Ga0496106_0000013 3300048909 Bacteria 202263
689 Ga0496107_0022185 3300048910 Bacteria 4486
690 Ga0496107_0026446 3300048910 Bacteria 4114
691 Ga0496107_0052198 3300048910 Bacteria 2949
692 Ga0496107_0057330 3300048910 Bacteria 2816
693 Ga0496107_0106160 3300048910 Bacteria 2062
694 Ga0496107_0174142 3300048910 Bacteria 1597
695 Ga0496107_0338919 3300048910 Bacteria 1119
696 Ga0496108_0000045 3300048911 Bacteria 137416
697 Ga0496108_0000631 3300048911 Bacteria 27478
698 Ga0496108_0001695 3300048911 Bacteria 17470
699 Ga0496108_0002798 3300048911 Bacteria 13983
700 Ga0496108_0008008 3300048911 Bacteria 8574
701 Ga0496108_0010904 3300048911 Bacteria 7378
702 Ga0496108_0020923 3300048911 Bacteria 5379
703 Ga0496108_0026529 3300048911 Bacteria 4779
704 Ga0496108_0041446 3300048911 Bacteria 3844
705 Ga0496109_0000032 3300048912 Bacteria 162984
706 Ga0496109_0000085 3300048912 Bacteria 95437
707 Ga0496109_0001613 3300048912 Bacteria 18839
708 Ga0496109_0002720 3300048912 Bacteria 14822
709 Ga0496109_0003228 3300048912 Bacteria 13577
710 Ga0496109_0028090 3300048912 Bacteria 5029
711 Ga0496109_0035376 3300048912 Bacteria 4505
712 Ga0496109_0180730 3300048912 Bacteria 1981
713 Ga0496109_0230154 3300048912 Bacteria 1744
714 Ga0496109_0280872 3300048912 Bacteria 1569
715 Ga0496109_0412684 3300048912 Bacteria 1276
716 Ga0496110_0000033 3300048913 Bacteria 65539
717 Ga0496110_0001195 3300048913 Bacteria 18498
718 Ga0496110_0001566 3300048913 Bacteria 16673
719 Ga0496110_0005612 3300048913 Bacteria 9847
720 Ga0496110_0017994 3300048913 Bacteria 5919
721 Ga0496110_0020938 3300048913 Bacteria 5525
722 Ga0496110_0027759 3300048913 Bacteria 4855
723 Ga0496110_0075847 3300048913 Bacteria 2988
724 Ga0496110_0076003 3300048913 Bacteria 2985
725 Ga0496110_0146832 3300048913 Bacteria 2134
726 Ga0496110_0155076 3300048913 Bacteria 2074
727 Ga0496110_0231305 3300048913 Bacteria 1681
728 Ga0496110_0250567 3300048913 Bacteria 1612
729 Ga0496111_0000230 3300048914 Bacteria 26717
730 Ga0496111_0002628 3300048914 Bacteria 10890
731 Ga0496111_0010363 3300048914 Bacteria 6251
732 Ga0496111_0013018 3300048914 Bacteria 5648
733 Ga0496111_0017713 3300048914 Bacteria 4926
734 Ga0496111_0043856 3300048914 Bacteria 3216
735 Ga0496111_0051808 3300048914 Bacteria 2964
736 Ga0496112_0000002 3300048915 Bacteria 782039
737 Ga0496112_0001529 3300048915 Bacteria 17832
738 Ga0496112_0017217 3300048915 Bacteria 6785
739 Ga0496112_0046356 3300048915 Bacteria 4263
740 Ga0496113_0000007 3300048916 Bacteria 95884
741 Ga0496113_0002837 3300048916 Bacteria 10193
742 Ga0496113_0009418 3300048916 Bacteria 6407
743 Ga0496113_0046175 3300048916 Bacteria 3233
744 Ga0496113_0121550 3300048916 Bacteria 2042
745 Ga0496113_0216946 3300048916 Bacteria 1524
746 Ga0496114_0000184 3300048917 Bacteria 44982
747 Ga0496114_0000466 3300048917 Bacteria 29601
748 Ga0496114_0001692 3300048917 Bacteria 16754
749 Ga0496114_0009498 3300048917 Bacteria 7719
750 Ga0496114_0012600 3300048917 Bacteria 6774
751 Ga0496114_0060025 3300048917 Bacteria 3178
752 Ga0496114_0071057 3300048917 Bacteria 2924
753 Ga0496114_0072956 3300048917 Bacteria 2888
754 Ga0496114_0157537 3300048917 Bacteria 1972
755 Ga0496115_0000001 3300048918 Bacteria 367230
756 Ga0496115_0005218 3300048918 Bacteria 9445
757 Ga0496115_0005222 3300048918 Bacteria 9440
758 Ga0496115_0008262 3300048918 Bacteria 7694
759 Ga0496115_0036943 3300048918 Bacteria 3869
760 Ga0496115_0083536 3300048918 Bacteria 2603
761 Ga0496116_0000780 3300048919 Bacteria 40473
762 Ga0496117_0015033 3300048920 Bacteria 6631
763 Ga0496118_0000174 3300048921 Bacteria 115950
764 Ga0496119_0003727 3300048922 Bacteria 15609
765 Ga0496119_0004215 3300048922 Bacteria 14439
766 Ga0496120_0004252 3300048923 Bacteria 12205
767 Ga0496121_0005891 3300048924 Bacteria 15512
768 Ga0496121_0016585 3300048924 Bacteria 7593
769 Ga0496125_0013994 3300048928 Bacteria 7845
770 Ga0496126_0029904 3300048929 Bacteria 5170
771 Ga0501031_0000445 3300049568 Bacteria 23857
772 Ga0501031_0058633 3300049568 Bacteria 2508
773 Ga0501031_0140303 3300049568 Bacteria 1579
774 Ga0501032_0000876 3300049569 Bacteria 24428
775 Ga0501032_0064563 3300049569 Bacteria 2450
776 Ga0501032_0192763 3300049569 Bacteria 1332
777 Ga0501033_0000294 3300049570 Bacteria 47989
778 Ga0501033_0014207 3300049570 Bacteria 6052
779 Ga0501033_0215408 3300049570 Bacteria 1369
780 Ga0501034_0003200 3300049571 Bacteria 18796
781 Ga0501036_0001590 3300049572 Bacteria 17574
782 Ga0501036_0005562 3300049572 Bacteria 10223
783 Ga0501036_0012995 3300049572 Bacteria 6913
784 Ga0501036_0183971 3300049572 Bacteria 1758
785 Ga0501037_0000378 3300049573 Bacteria 37014
786 Ga0501037_0005716 3300049573 Bacteria 9075
787 Ga0501037_0169474 3300049573 Bacteria 1553
788 Ga0501038_0000087 3300049574 Bacteria 78741
789 Ga0501038_0008491 3300049574 Bacteria 9442
790 Ga0501038_0132419 3300049574 Bacteria 2045
791 Ga0501038_0344533 3300049574 Bacteria 1162
792 Ga0501039_0001020 3300049575 Bacteria 20404
793 Ga0501039_0003991 3300049575 Bacteria 11095
794 Ga0501039_0103067 3300049575 Bacteria 2227
795 Ga0501039_0139021 3300049575 Bacteria 1907
796 Ga0501040_0000007 3300049576 Bacteria 90368
797 Ga0501040_0000954 3300049576 Bacteria 18260
798 Ga0501040_0006120 3300049576 Bacteria 7804
799 Ga0501040_0017844 3300049576 Bacteria 4711
800 Ga0501040_0040161 3300049576 Bacteria 3183
801 Ga0501041_0000005 3300049577 Bacteria 75426
802 Ga0501041_0001093 3300049577 Bacteria 14842
803 Ga0501041_0002281 3300049577 Bacteria 10857
804 Ga0501042_0003216 3300049578 Bacteria 10205
805 Ga0501042_0003964 3300049578 Bacteria 9370
806 Ga0501042_0034208 3300049578 Bacteria 3604
807 Ga0501042_0069176 3300049578 Bacteria 2525
808 Ga0501042_0145464 3300049578 Bacteria 1709
809 Ga0501043_0000998 3300049579 Bacteria 24892
810 Ga0501043_0048746 3300049579 Bacteria 3329
811 Ga0501046_0001278 3300049580 Bacteria 24362
812 Ga0501046_0017453 3300049580 Bacteria 5990
813 Ga0501046_0028136 3300049580 Bacteria 4580
814 Ga0501047_0000592 3300049581 Bacteria 38584
815 Ga0501047_0009620 3300049581 Bacteria 9141
816 Ga0501047_0014482 3300049581 Bacteria 7501
817 Ga0501047_0084809 3300049581 Bacteria 3044
818 Ga0501048_0000018 3300049582 Bacteria 72234
819 Ga0501048_0001926 3300049582 Bacteria 15771
820 Ga0501048_0011634 3300049582 Bacteria 6563
821 Ga0501067_0000808 3300049583 Bacteria 16867
822 Ga0501067_0009559 3300049583 Bacteria 5372
823 Ga0501067_0073981 3300049583 Bacteria 1887
824 Ga0501068_0000134 3300049584 Bacteria 33588
825 Ga0501068_0011873 3300049584 Bacteria 4924
826 Ga0501068_0018498 3300049584 Bacteria 4035
827 Ga0501068_0028798 3300049584 Bacteria 3287
828 Ga0501068_0203733 3300049584 Bacteria 1255
829 Ga0501069_0000426 3300049585 Bacteria 19142
830 Ga0501069_0007694 3300049585 Bacteria 5652
831 Ga0501069_0009322 3300049585 Bacteria 5181
832 Ga0501070_0004569 3300049586 Bacteria 11863
833 Ga0501070_0005855 3300049586 Bacteria 10483
834 Ga0501070_0009281 3300049586 Bacteria 8320
835 Ga0501070_0018067 3300049586 Bacteria 5917
836 Ga0501071_0000005 3300049587 Bacteria 78747
837 Ga0501071_0001995 3300049587 Bacteria 12192
838 Ga0501071_0019490 3300049587 Bacteria 4707
839 Ga0501071_0039336 3300049587 Bacteria 3383
840 Ga0501071_0225339 3300049587 Bacteria 1412
841 Ga0501072_0000269 3300049588 Bacteria 37902
842 Ga0501072_0004831 3300049588 Bacteria 10263
843 Ga0501072_0012028 3300049588 Bacteria 6611
844 Ga0501072_0014925 3300049588 Bacteria 5954
845 Ga0501072_0035580 3300049588 Bacteria 3901
846 Ga0501072_0038239 3300049588 Bacteria 3765
847 Ga0501072_0357554 3300049588 Bacteria 1159
848 Ga0501073_0001327 3300049589 Bacteria 18226
849 Ga0501073_0033451 3300049589 Bacteria 3660
850 Ga0501073_0061038 3300049589 Bacteria 2631
851 Ga0501073_0065493 3300049589 Bacteria 2534
852 Ga0501074_0001138 3300049590 Bacteria 17415
853 Ga0501074_0044985 3300049590 Bacteria 3194
854 Ga0501074_0060672 3300049590 Bacteria 2724
855 Ga0501074_0136292 3300049590 Bacteria 1756
856 Ga0501074_0161055 3300049590 Bacteria 1603
857 Ga0501074_0164036 3300049590 Bacteria 1586
858 Ga0501075_0000009 3300049591 Bacteria 97052
859 Ga0501075_0000193 3300049591 Bacteria 31987
860 Ga0501075_0007396 3300049591 Bacteria 7619
861 Ga0501075_0021317 3300049591 Bacteria 4722
862 Ga0501075_0062138 3300049591 Bacteria 2815
863 Ga0501075_0110785 3300049591 Bacteria 2087
864 Ga0501076_0000028 3300049592 Bacteria 76828
865 Ga0501076_0001292 3300049592 Bacteria 16692
866 Ga0501076_0004133 3300049592 Bacteria 10264
867 Ga0501076_0011312 3300049592 Bacteria 6642
868 Ga0501076_0036691 3300049592 Bacteria 3841
869 Ga0501076_0137670 3300049592 Bacteria 1983
870 Ga0501076_0170136 3300049592 Bacteria 1776
871 Ga0501077_0000006 3300049593 Bacteria 119936
872 Ga0501077_0001176 3300049593 Bacteria 15828
873 Ga0501077_0020007 3300049593 Bacteria 4235
874 Ga0501077_0036690 3300049593 Bacteria 3123
875 Ga0501077_0173009 3300049593 Bacteria 1372
876 Ga0501202_029492 3300049652 Bacteria 1138
877 Ga0501079_0000881 3300049741 Bacteria 20585
878 Ga0501079_0000929 3300049741 Bacteria 20116
879 Ga0501079_0003399 3300049741 Bacteria 11682
880 Ga0501079_0025921 3300049741 Bacteria 4497
881 Ga0501079_0050832 3300049741 Bacteria 3198
882 Ga0501079_0088348 3300049741 Bacteria 2400
883 Ga0501079_0133505 3300049741 Bacteria 1932
884 Ga0501080_0000626 3300049742 Bacteria 28026
885 Ga0501080_0032292 3300049742 Bacteria 4881
886 Ga0501080_0046552 3300049742 Bacteria 4038
887 Ga0501081_0000003 3300049743 Bacteria 97558
888 Ga0501081_0000159 3300049743 Bacteria 31036
889 Ga0501081_0001137 3300049743 Bacteria 16055
890 Ga0501081_0043392 3300049743 Bacteria 3085
891 Ga0501081_0321051 3300049743 Bacteria 1138
892 Ga0501083_0001673 3300049744 Bacteria 15132
893 Ga0501083_0008047 3300049744 Bacteria 7457
894 Ga0501083_0021756 3300049744 Bacteria 4454
895 Ga0501083_0034238 3300049744 Bacteria 3474
896 Ga0501035_0000175 3300049822 Bacteria 78747
897 Ga0501035_0068212 3300049822 Bacteria 3154
898 Ga0501035_0078473 3300049822 Bacteria 2916
899 Ga0501044_0006303 3300049823 Bacteria 13113
900 Ga0501044_0038039 3300049823 Bacteria 5025
901 Ga0501044_0065287 3300049823 Bacteria 3712
902 Ga0501044_0101327 3300049823 Bacteria 2897
903 Ga0501045_0000009 3300049824 Bacteria 75255
904 Ga0501045_0002161 3300049824 Bacteria 13314
905 Ga0501045_0002370 3300049824 Bacteria 12795
906 Ga0501045_0056157 3300049824 Bacteria 2879
907 Ga0501045_0063835 3300049824 Bacteria 2703
908 Ga0501045_0083925 3300049824 Bacteria 2350
909 nmdc:mga00v17_38242_c1 3300050491 Bacteria 2868
910 nmdc:mga00v17_42955_c1 3300050491 Bacteria 2721
911 nmdc:mga00v17_87324_c1 3300050491 Bacteria 1955
912 nmdc:mga0yw44_110719_c1 3300050492 Bacteria 1759
913 nmdc:mga0yw44_16_c1 3300050492 Bacteria 80085
914 nmdc:mga0yw44_24400_c1 3300050492 Bacteria 3421
915 nmdc:mga0yw44_30503_c1 3300050492 Bacteria 3125
916 nmdc:mga06z11_159774_c1 3300050494 Bacteria 1287
917 nmdc:mga05p37_116658_c1 3300050507 Bacteria 3281
918 nmdc:mga05p37_145145_c1 3300050507 Bacteria 2906
919 nmdc:mga05p37_163019_c1 3300050507 Bacteria 2722
920 nmdc:mga05p37_43470_c1 3300050507 Bacteria 5528
921 nmdc:mga05p37_8447_c1 3300050507 Bacteria 12180
922 nmdc:mga09592_1116_c1 3300050508 Bacteria 21373
923 nmdc:mga09592_330607_c1 3300050508 Bacteria 1319
924 nmdc:mga09592_49273_c1 3300050508 Bacteria 3551
925 nmdc:mga0qj67_1508_c1 3300050509 Bacteria 16319
926 nmdc:mga0qj67_76093_c1 3300050509 Bacteria 2684
927 nmdc:mga0qj67_83580_c1 3300050509 Bacteria 2559
928 nmdc:mga0qj67_9898_c1 3300050509 Bacteria 7109
929 nmdc:mga06r32_351571_c1 3300050510 Bacteria 1458
930 nmdc:mga06r32_4240_c1 3300050510 Bacteria 12848
931 nmdc:mga06r32_60098_c1 3300050510 Bacteria 3656
932 nmdc:mga06r32_80394_c1 3300050510 Bacteria 3172
933 nmdc:mga08y16_16311_c1 3300050511 Bacteria 7809
934 nmdc:mga08y16_2936_c1 3300050511 Bacteria 17557
935 nmdc:mga08y16_368483_c1 3300050511 Bacteria 1474
936 nmdc:mga08y16_640486_c1 3300050511 Bacteria 1068
937 nmdc:mga0n895_204409_c1 3300050512 Bacteria 2006
938 nmdc:mga0rr50_2782_c1 3300050513 Bacteria 9943
939 nmdc:mga08x19_125208_c1 3300050514 Bacteria 1725
940 nmdc:mga08x19_62434_c1 3300050514 Bacteria 2416
941 nmdc:mga0a205_97616_c1 3300050515 Bacteria 2837
942 Ga0495601_0000086 3300053077 Bacteria 50421
943 Ga0495601_0030309 3300053077 Bacteria 3358
944 Ga0495601_0078139 3300053077 Bacteria 2120
945 Ga0495601_0096050 3300053077 Bacteria 1911
946 Ga0495612_0000410 3300053078 Bacteria 17077
947 Ga0495612_0005844 3300053078 Bacteria 5082
948 Ga0495612_0011495 3300053078 Bacteria 3570
949 Ga0495655_0001739 3300053083 Bacteria 3377
950 Ga0495595_0000014 3300053084 Bacteria 145255
951 Ga0495595_0000109 3300053084 Bacteria 37617
952 Ga0495595_0013656 3300053084 Bacteria 3433
953 Ga0495595_0027010 3300053084 Bacteria 2554
954 Ga0495619_0000022 3300053085 Bacteria 184144
955 Ga0495619_0000319 3300053085 Bacteria 33678
956 Ga0495619_0003097 3300053085 Bacteria 10800
957 Ga0495619_0008074 3300053085 Bacteria 6662
958 Ga0495619_0010328 3300053085 Bacteria 5876
959 Ga0495619_0143613 3300053085 Bacteria 1645
960 Ga0500641_0002398 3300053096 Bacteria 6646
961 Ga0500562_000002 3300053108 Bacteria 977234
962 Ga0500595_021781 3300053119 Bacteria 2282
963 Ga0500628_002474 3300053129 Bacteria 3052
964 Ga0501084_0001358 3300054114 Bacteria 19353
965 Ga0501084_0005874 3300054114 Bacteria 10101
966 Ga0501084_0016458 3300054114 Bacteria 6142
967 Ga0501084_0050734 3300054114 Bacteria 3471
968 Ga0501084_0352493 3300054114 Bacteria 1243
969 Ga0590071_011163 3300059421 Bacteria 2103
970 Ga0590075_003699 3300059424 Bacteria 3632
971 Ga0590077_004894 3300059426 Bacteria 2740
972 Ga0501082_0000063 3300060353 Bacteria 76891
973 Ga0501082_0001009 3300060353 Bacteria 24886
974 Ga0501082_0010791 3300060353 Bacteria 7866
975 Ga0501082_0033591 3300060353 Bacteria 4426
976 Ga0501082_0042607 3300060353 Bacteria 3913
977 Ga0501082_0047272 3300060353 Bacteria 3708
978 Ga0501082_0195502 3300060353 Bacteria 1759
979 Ga0530510_0000014 3300061734 Bacteria 106661
980 Ga0530510_0001148 3300061734 Bacteria 17568
981 Ga0530510_0014247 3300061734 Bacteria 5606
982 Ga0530510_0016425 3300061734 Bacteria 5240
983 Ga0530510_0031133 3300061734 Bacteria 3835
984 Ga0530510_0046814 3300061734 Bacteria 3125
985 Ga0530510_0154128 3300061734 Bacteria 1697
986 Ga0530510_0211494 3300061734 Bacteria 1441
987 Ga0081538_10018371
988 JGI25407J50210_10002731
989 JGI25407J50210_10003431
990 JGI25407J50210_10010599
991 Ga0070658_10050495
992 Ga0070658_10165550
993 Ga0070683_100001714
994 Ga0070683_100013143
995 Ga0070683_100018473
996 Ga0070683_100023359
997 Ga0070683_100043303
998 Ga0070683_100237672
999 Ga0070690_100092170
1000 Ga0070690_100301662
1001 Ga0068869_100006717
1002 Ga0070680_100004037
1003 Ga0070680_100005608
1004 Ga0070680_100014559
1005 Ga0070680_100037693
1006 Ga0070682_100000080
1007 Ga0070682_100030235
1008 Ga0068868_100000095
1009 Ga0068868_100220158
1010 Ga0070660_100001494
1011 Ga0070660_100003867
1012 Ga0070660_100065384
1013 Ga0070660_100136777
1014 Ga0070660_100284427
1015 Ga0070660_100305580
1016 Ga0070689_100057873
1017 Ga0070691_10008984
1018 Ga0070691_10013863
1019 Ga0070661_100000005
1020 Ga0070661_100007123
1021 Ga0070661_100063455
1022 Ga0070661_100241349
1023 Ga0070675_100000058
1024 Ga0070675_100089174
1025 Ga0070674_100000020
1026 Ga0070674_100051096
1027 Ga0070674_100196524
1028 Ga0070673_100046800
1029 Ga0070688_100000333
1030 Ga0070688_100002793
1031 Ga0070688_100005500
1032 Ga0070688_100053154
1033 Ga0070659_100026115
1034 Ga0070659_100115029
1035 Ga0070667_100087275
1036 Ga0070709_10007649
1037 Ga0070710_10029625
1038 Ga0070711_100008345
1039 Ga0070711_100322332
1040 Ga0070700_100021145
1041 Ga0070708_100001181
1042 Ga0070663_100032323
1043 Ga0070678_100007594
1044 Ga0070678_100100238
1045 Ga0070662_100000363
1046 Ga0070681_10004636
1047 Ga0070681_10005901
1048 Ga0070681_10008977
1049 Ga0070681_10030842
1050 Ga0070681_10183635
1051 Ga0070685_10000293
1052 Ga0070685_10003954
1053 Ga0070685_10045930
1054 Ga0070706_100004949
1055 Ga0070706_100066121
1056 Ga0070707_100001551
1057 Ga0070698_100001638
1058 Ga0070698_100024518
1059 Ga0070698_100084562
1060 Ga0070698_100351864
1061 Ga0070699_100017223
1062 Ga0070679_100000537
1063 Ga0070679_100001830
1064 Ga0070679_100041206
1065 Ga0070679_100075881
1066 Ga0070684_100001226
1067 Ga0070684_100003228
1068 Ga0070684_100081312
1069 Ga0070684_100128869
1070 Ga0070684_100231040
1071 Ga0068853_100247958
1072 Ga0070672_100000004
1073 Ga0070672_100254547
1074 Ga0070686_100079214
1075 Ga0070696_100122600
1076 Ga0070693_100000833
1077 Ga0070693_100046964
1078 Ga0070665_100000159
1079 Ga0070665_100032824
1080 Ga0070704_100076925
1081 Ga0068855_100014350
1082 Ga0068855_100056520
1083 Ga0068855_100211426
1084 Ga0070664_100375561
1085 Ga0068857_100001285
1086 Ga0068857_100006742
1087 Ga0068857_100115283
1088 Ga0068854_100115490
1089 Ga0068854_100142366
1090 Ga0068856_100018421
1091 Ga0068856_100023907
1092 Ga0068856_100042442
1093 Ga0068856_100073050
1094 Ga0068856_100240699
1095 Ga0070702_100010715
1096 Ga0068852_100000012
1097 Ga0068852_100038655
1098 Ga0068852_100134945
1099 Ga0068852_100285715
1100 Ga0068864_100345034
1101 Ga0068866_10000002
1102 Ga0068866_10000019
1103 Ga0068861_100041642
1104 Ga0068851_10004367
1105 Ga0068851_10005192
1106 Ga0068870_10077016
1107 Ga0068863_100000032
1108 Ga0068863_100170585
1109 Ga0068858_100000049
1110 Ga0068858_100044747
1111 Ga0068860_100044947
1112 Ga0068860_100063112
1113 Ga0081455_10007120
1114 Ga0081455_10008830
1115 Ga0081455_10030105
1116 Ga0081455_10052361
1117 Ga0081455_10068826
1118 Ga0081455_10078225
1119 Ga0081538_10000099
1120 Ga0081538_10000252
1121 Ga0081538_10000297
1122 Ga0081538_10000429
1123 Ga0081538_10000502
1124 Ga0081538_10000691
1125 Ga0081538_10000804
1126 Ga0081538_10000894
1127 Ga0081538_10000925
1128 Ga0081538_10001600
1129 Ga0081538_10003180
1130 Ga0081538_10006926
1131 Ga0081538_10008148
1132 Ga0081538_10008586
1133 Ga0081538_10012000
1134 Ga0081538_10058246
1135 Ga0081538_10122477
1136 Ga0081540_1000006
1137 Ga0081539_10000062
1138 Ga0081539_10002242
1139 Ga0081539_10060633
1140 Ga0070717_10096537
1141 Ga0075365_10000014
1142 Ga0075365_10016179
1143 Ga0075365_10023969
1144 Ga0075365_10062766
1145 Ga0075365_10086269
1146 Ga0075365_10160419
1147 Ga0075365_10172521
1148 Ga0075365_10243986
1149 Ga0075364_10093685
1150 Ga0075364_10159535
1151 Ga0075364_10164661
1152 Ga0075364_10215756
1153 Ga0070715_10000012
1154 Ga0070715_10022486
1155 Ga0070712_100019039
1156 Ga0070712_100185024
1157 Ga0097621_100024560
1158 Ga0068871_100027672
1159 Ga0075428_100017809
1160 Ga0075428_100078209
1161 Ga0075428_100121552
1162 Ga0075428_100199352
1163 Ga0075430_100003677
1164 Ga0075430_100077997
1165 Ga0075430_100100857
1166 Ga0075431_100002485
1167 Ga0075431_100045347
1168 Ga0075431_100152117
1169 Ga0075431_100227289
1170 Ga0075431_100302345
1171 Ga0075434_100007144
1172 Ga0075429_100007313
1173 Ga0075429_100046393
1174 Ga0075436_100135926
1175 Ga0105240_10026755
1176 Ga0105240_10049813
1177 Ga0111539_10002085
1178 Ga0111539_10002336
1179 Ga0111539_10024191
1180 Ga0105245_10000056
1181 Ga0105245_10001677
1182 Ga0105245_10003691
1183 Ga0105245_10005665
1184 Ga0105245_10005783
1185 Ga0105245_10010311
1186 Ga0105245_10060054
1187 Ga0105245_10064347
1188 Ga0105245_10386593
1189 Ga0114129_10001119
1190 Ga0114129_10003023
1191 Ga0114129_10013663
1192 Ga0114129_10023252
1193 Ga0114129_10029378
1194 Ga0105243_10047394
1195 Ga0105243_10074340
1196 Ga0105243_10099187
1197 Ga0105243_10209206
1198 Ga0105248_10000032
1199 Ga0105248_10083797
1200 Ga0105237_10163908
1201 Ga0105237_10175697
1202 Ga0105238_10242128
1203 Ga0105238_10249005
1204 Ga0105249_10011189
1205 Ga0105028_101263
1206 Ga0105239_10006331
1207 Ga0105239_10093776
1208 Ga0105239_10372906
1209 Ga0105246_10039193
1210 Ga0157371_10009099
1211 Ga0157370_10214353
1212 Ga0157369_10000099
1213 Ga0157369_10035965
1214 Ga0157369_10075437
1215 Ga0157374_10006829
1216 Ga0157374_10098614
1217 Ga0157378_10010497
1218 Ga0157378_10510143
1219 Ga0157372_10026370
1220 Ga0157372_10151411
1221 Ga0157372_10434060
1222 Ga0157372_10606721
1223 Ga0157375_10010359
1224 Ga0157375_10032670
1225 Ga0157375_10046134
1226 Ga0157375_10048497
1227 Ga0157375_10600278
1228 Ga0163163_10107630
1229 Ga0157380_10000219
1230 Ga0157380_10362950
1231 Ga0157377_10005388
1232 Ga0157377_10086554
1233 Ga0157379_10320088
1234 Ga0157376_10047691
1235 Ga0157376_10096829
1236 Ga0157376_10103402
1237 Ga0157376_10331348
1238 Ga0182006_1061684
1239 Ga0163161_10000058
1240 Ga0163161_10065977
1241 Ga0206356_10987891
1242 Ga0206356_11507257
1243 Ga0206354_10224168
1244 Ga0206353_11255590
1245 Ga0206353_11844079
1246 Ga0207656_10002305
1247 Ga0207656_10117373
1248 Ga0207642_10000001
1249 Ga0207642_10000003
1250 Ga0207642_10000004
1251 Ga0207642_10000017
1252 Ga0207642_10014374
1253 Ga0207685_10000001
1254 Ga0207699_10027383
1255 Ga0207707_10003654
1256 Ga0207707_10011148
1257 Ga0207707_10012057
1258 Ga0207707_10157919
1259 Ga0207693_10001551
1260 Ga0207693_10013240
1261 Ga0207693_10271474
1262 Ga0207663_10014493
1263 Ga0207663_10066421
1264 Ga0207663_10108944
1265 Ga0207660_10005162
1266 Ga0207660_10018009
1267 Ga0207660_10047444
1268 Ga0207660_10061128
1269 Ga0207657_10001335
1270 Ga0207657_10002472
1271 Ga0207657_10003370
1272 Ga0207657_10014368
1273 Ga0207657_10029745
1274 Ga0207657_10271799
1275 Ga0207649_10016170
1276 Ga0207649_10030765
1277 Ga0207649_10320794
1278 Ga0207652_10000631
1279 Ga0207652_10001944
1280 Ga0207652_10116676
1281 Ga0207646_10009623
1282 Ga0207650_10025386
1283 Ga0207650_10152474
1284 Ga0207659_10000020
1285 Ga0207687_10000007
1286 Ga0207687_10000646
1287 Ga0207687_10006484
1288 Ga0207687_10017967
1289 Ga0207687_10161060
1290 Ga0207700_10000008
1291 Ga0207700_10000016
1292 Ga0207690_10031482
1293 Ga0207690_10326736
1294 Ga0207706_10000006
1295 Ga0207706_10014837
1296 Ga0207686_10142989
1297 Ga0207709_10049455
1298 Ga0207709_10060791
1299 Ga0207670_10087786
1300 Ga0207670_10330977
1301 Ga0207669_10000016
1302 Ga0207669_10000036
1303 Ga0207669_10322612
1304 Ga0207704_10000025
1305 Ga0207704_10008706
1306 Ga0207704_10076865
1307 Ga0207691_10000020
1308 Ga0207691_10018612
1309 Ga0207711_10000020
1310 Ga0207711_10134064
1311 Ga0207689_10025225
1312 Ga0207689_10093134
1313 Ga0207661_10001238
1314 Ga0207661_10001780
1315 Ga0207661_10001949
1316 Ga0207661_10008416
1317 Ga0207661_10030009
1318 Ga0207661_10151734
1319 Ga0207679_10308269
1320 Ga0207667_10215088
1321 Ga0207651_10111878
1322 Ga0207651_10220835
1323 Ga0207640_10000285
1324 Ga0207640_10060336
1325 Ga0207640_10083577
1326 Ga0207640_10206892
1327 Ga0207640_10245438
1328 Ga0207677_10001435
1329 Ga0207677_10018809
1330 Ga0207677_10052187
1331 Ga0207703_10000053
1332 Ga0207703_10000067
1333 Ga0207678_10025503
1334 Ga0207678_10210895
1335 Ga0207708_10000757
1336 Ga0207708_10006689
1337 Ga0207708_10329542
1338 Ga0207702_10000016
1339 Ga0207702_10003815
1340 Ga0207702_10014205
1341 Ga0207702_10016146
1342 Ga0207702_10016852
1343 Ga0207702_10033585
1344 Ga0207702_10178202
1345 Ga0207702_10302676
1346 Ga0207641_10000071
1347 Ga0207641_10008529
1348 Ga0207648_10000228
1349 Ga0207648_10026646
1350 Ga0207648_10043290
1351 Ga0207676_10080307
1352 Ga0207674_10002949
1353 Ga0207674_10050544
1354 Ga0207674_10072073
1355 Ga0207675_100009465
1356 Ga0207675_100010716
1357 Ga0207675_100140748
1358 Ga0207683_10000740
1359 Ga0207683_10006404
1360 Ga0207683_10023702
1361 Ga0207683_10135986
1362 Ga0207683_10172253
1363 Ga0207683_10343832
1364 Ga0207698_10000012
1365 Ga0207698_10009350
1366 Ga0207428_10191832
1367 Ga0207428_10235228
1368 Ga0268266_10000023
1369 Ga0268266_10027948
1370 Ga0268266_10066071
1371 Ga0268266_10136436
1372 Ga0268264_10007216
1373 Ga0265337_1000054
1374 Ga0265326_10000027
1375 Ga0265323_10019618
1376 Ga0265322_10000003
1377 Ga0265324_10000103
1378 Ga0314311_1122819
1379 Ga0316179_1002117
1380 Ga0316180_1070555
1381 Ga0316183_1122503
1382 Ga0316182_1020791
1383 Ga0265332_10007198
1384 Ga0265328_10001275
1385 Ga0265320_10000001
1386 Ga0265329_10002125
1387 Ga0265331_10001895
1388 Ga0265327_10000003
1389 Ga0265327_10008056
1390 Ga0265316_10020298
1391 Ga0307408_100031047
1392 Ga0307408_100048271
1393 Ga0307408_100081761
1394 Ga0307408_100239143
1395 Ga0265314_10001375
1396 Ga0316576_10143144
1397 Ga0316576_10180268
1398 Ga0307413_10002156
1399 Ga0307413_10023303
1400 Ga0307413_10051708
1401 Ga0307410_10016214
1402 Ga0307410_10058953
1403 Ga0307410_10303937
1404 Ga0307406_10011927
1405 Ga0307406_10027082
1406 Ga0307406_10038981
1407 Ga0307407_10022196
1408 Ga0307407_10048327
1409 Ga0307412_10018003
1410 Ga0307412_10241304
1411 Ga0307409_100012362
1412 Ga0307409_100058575
1413 Ga0307409_100058788
1414 Ga0307409_100090923
1415 Ga0307409_100099462
1416 Ga0307416_100011782
1417 Ga0307416_100020572
1418 Ga0307416_100028324
1419 Ga0307416_100033278
1420 Ga0307416_100045175
1421 Ga0307416_100060430
1422 Ga0307416_100114944
1423 Ga0307416_100185584
1424 Ga0307416_100377509
1425 Ga0307414_10113428
1426 Ga0307414_10120549
1427 Ga0307411_10006677
1428 Ga0307415_100001131
1429 Ga0307415_100020790
1430 Ga0307415_100076841
1431 Ga0307415_100102523
1432 Ga0307415_100275124
1433 Ga0373960_0011977
1434 Ga0373942_0030371
1435 Ga0373931_0043963
1436 Ga0373947_0036675
1437 Ga0373937_0033225
1438 Ga0373937_0074513
1439 Ga0316584_0122658
1440 Ga0373925_0085421
1441 Ga0395899_0019939
1442 Ga0395899_0066624
1443 Ga0395899_0145260
1444 Ga0395900_0003557
1445 Ga0395900_0004073
1446 Ga0395900_0006758
1447 Ga0395900_0010351
1448 Ga0395900_0041817
1449 Ga0395900_0049279
1450 Ga0395900_0081851
1451 Ga0395900_0094819
1452 Ga0395900_0117171
1453 Ga0395900_0124218
1454 Ga0395898_0001604
1455 Ga0395898_0003445
1456 Ga0395898_0009405
1457 Ga0395898_0010906
1458 Ga0395898_0011062
1459 Ga0395898_0011171
1460 Ga0395898_0027143
1461 Ga0395898_0057103
1462 Ga0395898_0077050
1463 Ga0395898_0085211
1464 Ga0395898_0115528
1465 Ga0395898_0254166
1466 Ga0395898_0267825
1467 Ga0395898_0528300
1468 Ga0395905_0001761
1469 Ga0395905_0002251
1470 Ga0395905_0010800
1471 Ga0395905_0012564
1472 Ga0395905_0025788
1473 Ga0395905_0032416
1474 Ga0395905_0035952
1475 Ga0395905_0042430
1476 Ga0395905_0046007
1477 Ga0395905_0171259
1478 Ga0395905_0401141
1479 Ga0395901_0001420
1480 Ga0395901_0001597
1481 Ga0395901_0002643
1482 Ga0395901_0006110
1483 Ga0395901_0020676
1484 Ga0395901_0032816
1485 Ga0395901_0046351
1486 Ga0395901_0064884
1487 Ga0395901_0065706
1488 Ga0395901_0136094
1489 Ga0395901_0173308
1490 Ga0395901_0235219
1491 Ga0451853_2357732
1492 Ga0439445_0002076
1493 Ga0439448_0016164
1494 Ga0439432_006638
1495 Ga0466965_0057274
1496 Ga0466966_0232242
1497 Ga0466961_0026057
1498 Ga0466961_0114028
1499 Ga0466963_0025241
1500 Ga0466963_0043513
1501 Ga0466963_0130885
1502 Ga0466964_0000890
1503 Ga0466964_0010017
1504 Ga0466968_0046907
1505 Ga0466957_0003681
1506 Ga0466957_0124802
1507 Ga0466960_0022744
1508 Ga0466959_0002692
1509 Ga0466959_0055724
1510 Ga0466958_0005927
1511 Ga0466967_0000046
1512 Ga0466967_0004872
1513 Ga0466967_0069123
1514 Ga0466967_0079454
1515 Ga0466967_0092522
1516 Ga0466967_0272881
1517 Ga0466967_0426272
1518 Ga0495617_006590
1519 Ga0495627_034218
1520 Ga0495592_0000621
1521 Ga0495592_0083460
1522 Ga0495603_0133104
1523 Ga0495603_0181746
1524 Ga0495590_0087496
1525 Ga0495629_0005520
1526 Ga0495629_0036832
1527 Ga0495629_0140175
1528 Ga0495641_0009756
1529 Ga0495641_0015104
1530 Ga0495641_0070282
1531 Ga0495651_0004887
1532 Ga0495651_0014023
1533 Ga0495651_0090570
1534 Ga0495653_0010741
1535 Ga0495653_0022048
1536 Ga0495653_0069968
1537 Ga0495582_0000005
1538 Ga0495582_0027982
1539 Ga0495582_0038899
1540 Ga0495605_0066960
1541 Ga0495639_0047772
1542 Ga0495664_0045067
1543 Ga0495584_0028330
1544 Ga0495584_0037550
1545 Ga0495584_0076703
1546 Ga0495594_0000013
1547 Ga0495594_0021620
1548 Ga0495596_0070600
1549 Ga0495596_0097391
1550 Ga0495608_0000031
1551 Ga0495608_0000406
1552 Ga0495608_0022630
1553 Ga0495610_0000053
1554 Ga0495618_0000068
1555 Ga0495628_0005324
1556 Ga0495628_0008805
1557 Ga0495628_0039578
1558 Ga0495628_0268974
1559 Ga0495630_0000018
1560 Ga0495630_0032881
1561 Ga0495630_0100644
1562 Ga0495631_0056015
1563 Ga0495644_0033884
1564 Ga0495652_0011511
1565 Ga0495640_0001520
1566 Ga0495640_0041629
1567 Ga0495640_0047817
1568 Ga0495640_0233002
1569 Ga0495586_0000527
1570 Ga0495586_0000620
1571 Ga0495586_0031050
1572 Ga0495598_0000907
1573 Ga0495598_0040271
1574 Ga0495597_0042995
1575 Ga0495645_0048974
1576 Ga0495622_0000014
1577 Ga0495667_0004189
1578 Ga0495667_0010495
1579 Ga0495667_0044310
1580 Ga0495634_0000024
1581 Ga0495625_0000029
1582 Ga0495635_0000009
1583 Ga0495635_0112848
1584 Ga0495635_0180491
1585 Ga0495659_0006884
1586 Ga0495588_0000198
1587 Ga0495588_0058425
1588 Ga0495657_0000024
1589 Ga0495657_0004915
1590 Ga0495657_0019467
1591 Ga0495599_0007133
1592 Ga0495599_0026791
1593 Ga0495599_0031412
1594 Ga0495599_0080868
1595 Ga0495646_0087929
1596 Ga0495647_0000293
1597 Ga0495647_0090494
1598 Ga0495658_0000019
1599 Ga0495613_0000249
1600 Ga0495613_0020894
1601 Ga0495624_0000028
1602 Ga0495624_0036177
1603 Ga0495624_0041230
1604 Ga0495671_0059350
1605 Ga0495649_0015920
1606 Ga0495600_0003314
1607 Ga0495600_0010047
1608 Ga0495600_0045091
1609 Ga0495581_0000983
1610 Ga0495604_0000056
1611 Ga0495604_0003466
1612 Ga0495604_0006459
1613 Ga0495604_0009004
1614 Ga0495604_0049521
1615 Ga0495604_0071262
1616 Ga0495674_0000042
1617 Ga0495674_0007533
1618 Ga0495674_0030284
1619 Ga0495676_0005250
1620 Ga0495676_0078076
1621 Ga0495680_0000023
1622 Ga0495680_0000421
1623 Ga0495680_0003583
1624 Ga0495680_0005597
1625 Ga0495680_0021298
1626 Ga0495675_0000209
1627 Ga0495675_0065903
1628 Ga0495675_0171167
1629 Ga0495679_011414
1630 Ga0495681_0000015
1631 Ga0495684_0010019
1632 Ga0495684_0010791
1633 Ga0495602_0000228
1634 Ga0495602_0046294
1635 Ga0495602_0061923
1636 Ga0495602_0130113
1637 Ga0495602_0210737
1638 Ga0496100_0005985
1639 Ga0496100_0006019
1640 Ga0496100_0120231
1641 Ga0496100_0179643
1642 Ga0496101_0001626
1643 Ga0496101_0032186
1644 Ga0496102_0001674
1645 Ga0496102_0008240
1646 Ga0496102_0017155
1647 Ga0496102_0023784
1648 Ga0496102_0027850
1649 Ga0496102_0042632
1650 Ga0496102_0044639
1651 Ga0496102_0218064
1652 Ga0496102_0282216
1653 Ga0496103_0002323
1654 Ga0496103_0004839
1655 Ga0496103_0061251
1656 Ga0496103_0080885
1657 Ga0496103_0146001
1658 Ga0496104_0000576
1659 Ga0496104_0002883
1660 Ga0496104_0007540
1661 Ga0496104_0025674
1662 Ga0496104_0059650
1663 Ga0496104_0086342
1664 Ga0496104_0167800
1665 Ga0496104_0346090
1666 Ga0496104_0350863
1667 Ga0496105_0001400
1668 Ga0496105_0001452
1669 Ga0496105_0005013
1670 Ga0496105_0006590
1671 Ga0496105_0009052
1672 Ga0496105_0117228
1673 Ga0496105_0264236
1674 Ga0496106_0000013
1675 Ga0496107_0022185
1676 Ga0496107_0026446
1677 Ga0496107_0052198
1678 Ga0496107_0057330
1679 Ga0496107_0106160
1680 Ga0496107_0174142
1681 Ga0496107_0338919
1682 Ga0496108_0000045
1683 Ga0496108_0000631
1684 Ga0496108_0001695
1685 Ga0496108_0002798
1686 Ga0496108_0008008
1687 Ga0496108_0010904
1688 Ga0496108_0020923
1689 Ga0496108_0026529
1690 Ga0496108_0041446
1691 Ga0496109_0000032
1692 Ga0496109_0000085
1693 Ga0496109_0001613
1694 Ga0496109_0002720
1695 Ga0496109_0003228
1696 Ga0496109_0028090
1697 Ga0496109_0035376
1698 Ga0496109_0180730
1699 Ga0496109_0230154
1700 Ga0496109_0280872
1701 Ga0496109_0412684
1702 Ga0496110_0000033
1703 Ga0496110_0001195
1704 Ga0496110_0001566
1705 Ga0496110_0005612
1706 Ga0496110_0017994
1707 Ga0496110_0020938
1708 Ga0496110_0027759
1709 Ga0496110_0075847
1710 Ga0496110_0076003
1711 Ga0496110_0146832
1712 Ga0496110_0155076
1713 Ga0496110_0231305
1714 Ga0496110_0250567
1715 Ga0496111_0000230
1716 Ga0496111_0002628
1717 Ga0496111_0010363
1718 Ga0496111_0013018
1719 Ga0496111_0017713
1720 Ga0496111_0043856
1721 Ga0496111_0051808
1722 Ga0496112_0000002
1723 Ga0496112_0001529
1724 Ga0496112_0017217
1725 Ga0496112_0046356
1726 Ga0496113_0000007
1727 Ga0496113_0002837
1728 Ga0496113_0009418
1729 Ga0496113_0046175
1730 Ga0496113_0121550
1731 Ga0496113_0216946
1732 Ga0496114_0000184
1733 Ga0496114_0000466
1734 Ga0496114_0001692
1735 Ga0496114_0009498
1736 Ga0496114_0012600
1737 Ga0496114_0060025
1738 Ga0496114_0071057
1739 Ga0496114_0072956
1740 Ga0496114_0157537
1741 Ga0496115_0000001
1742 Ga0496115_0005218
1743 Ga0496115_0005222
1744 Ga0496115_0008262
1745 Ga0496115_0036943
1746 Ga0496115_0083536
1747 Ga0496116_0000780
1748 Ga0496117_0015033
1749 Ga0496118_0000174
1750 Ga0496119_0003727
1751 Ga0496119_0004215
1752 Ga0496120_0004252
1753 Ga0496121_0005891
1754 Ga0496121_0016585
1755 Ga0496125_0013994
1756 Ga0496126_0029904
1757 Ga0501031_0000445
1758 Ga0501031_0058633
1759 Ga0501031_0140303
1760 Ga0501032_0000876
1761 Ga0501032_0064563
1762 Ga0501032_0192763
1763 Ga0501033_0000294
1764 Ga0501033_0014207
1765 Ga0501033_0215408
1766 Ga0501034_0003200
1767 Ga0501036_0001590
1768 Ga0501036_0005562
1769 Ga0501036_0012995
1770 Ga0501036_0183971
1771 Ga0501037_0000378
1772 Ga0501037_0005716
1773 Ga0501037_0169474
1774 Ga0501038_0000087
1775 Ga0501038_0008491
1776 Ga0501038_0132419
1777 Ga0501038_0344533
1778 Ga0501039_0001020
1779 Ga0501039_0003991
1780 Ga0501039_0103067
1781 Ga0501039_0139021
1782 Ga0501040_0000007
1783 Ga0501040_0000954
1784 Ga0501040_0006120
1785 Ga0501040_0017844
1786 Ga0501040_0040161
1787 Ga0501041_0000005
1788 Ga0501041_0001093
1789 Ga0501041_0002281
1790 Ga0501042_0003216
1791 Ga0501042_0003964
1792 Ga0501042_0034208
1793 Ga0501042_0069176
1794 Ga0501042_0145464
1795 Ga0501043_0000998
1796 Ga0501043_0048746
1797 Ga0501046_0001278
1798 Ga0501046_0017453
1799 Ga0501046_0028136
1800 Ga0501047_0000592
1801 Ga0501047_0009620
1802 Ga0501047_0014482
1803 Ga0501047_0084809
1804 Ga0501048_0000018
1805 Ga0501048_0001926
1806 Ga0501048_0011634
1807 Ga0501067_0000808
1808 Ga0501067_0009559
1809 Ga0501067_0073981
1810 Ga0501068_0000134
1811 Ga0501068_0011873
1812 Ga0501068_0018498
1813 Ga0501068_0028798
1814 Ga0501068_0203733
1815 Ga0501069_0000426
1816 Ga0501069_0007694
1817 Ga0501069_0009322
1818 Ga0501070_0004569
1819 Ga0501070_0005855
1820 Ga0501070_0009281
1821 Ga0501070_0018067
1822 Ga0501071_0000005
1823 Ga0501071_0001995
1824 Ga0501071_0019490
1825 Ga0501071_0039336
1826 Ga0501071_0225339
1827 Ga0501072_0000269
1828 Ga0501072_0004831
1829 Ga0501072_0012028
1830 Ga0501072_0014925
1831 Ga0501072_0035580
1832 Ga0501072_0038239
1833 Ga0501072_0357554
1834 Ga0501073_0001327
1835 Ga0501073_0033451
1836 Ga0501073_0061038
1837 Ga0501073_0065493
1838 Ga0501074_0001138
1839 Ga0501074_0044985
1840 Ga0501074_0060672
1841 Ga0501074_0136292
1842 Ga0501074_0161055
1843 Ga0501074_0164036
1844 Ga0501075_0000009
1845 Ga0501075_0000193
1846 Ga0501075_0007396
1847 Ga0501075_0021317
1848 Ga0501075_0062138
1849 Ga0501075_0110785
1850 Ga0501076_0000028
1851 Ga0501076_0001292
1852 Ga0501076_0004133
1853 Ga0501076_0011312
1854 Ga0501076_0036691
1855 Ga0501076_0137670
1856 Ga0501076_0170136
1857 Ga0501077_0000006
1858 Ga0501077_0001176
1859 Ga0501077_0020007
1860 Ga0501077_0036690
1861 Ga0501077_0173009
1862 Ga0501202_029492
1863 Ga0501079_0000881
1864 Ga0501079_0000929
1865 Ga0501079_0003399
1866 Ga0501079_0025921
1867 Ga0501079_0050832
1868 Ga0501079_0088348
1869 Ga0501079_0133505
1870 Ga0501080_0000626
1871 Ga0501080_0032292
1872 Ga0501080_0046552
1873 Ga0501081_0000003
1874 Ga0501081_0000159
1875 Ga0501081_0001137
1876 Ga0501081_0043392
1877 Ga0501081_0321051
1878 Ga0501083_0001673
1879 Ga0501083_0008047
1880 Ga0501083_0021756
1881 Ga0501083_0034238
1882 Ga0501035_0000175
1883 Ga0501035_0068212
1884 Ga0501035_0078473
1885 Ga0501044_0006303
1886 Ga0501044_0038039
1887 Ga0501044_0065287
1888 Ga0501044_0101327
1889 Ga0501045_0000009
1890 Ga0501045_0002161
1891 Ga0501045_0002370
1892 Ga0501045_0056157
1893 Ga0501045_0063835
1894 Ga0501045_0083925
1895 nmdc:mga00v17_38242_c1
1896 nmdc:mga00v17_42955_c1
1897 nmdc:mga00v17_87324_c1
1898 nmdc:mga0yw44_110719_c1
1899 nmdc:mga0yw44_16_c1
1900 nmdc:mga0yw44_24400_c1
1901 nmdc:mga0yw44_30503_c1
1902 nmdc:mga06z11_159774_c1
1903 nmdc:mga05p37_116658_c1
1904 nmdc:mga05p37_145145_c1
1905 nmdc:mga05p37_163019_c1
1906 nmdc:mga05p37_43470_c1
1907 nmdc:mga05p37_8447_c1
1908 nmdc:mga09592_1116_c1
1909 nmdc:mga09592_330607_c1
1910 nmdc:mga09592_49273_c1
1911 nmdc:mga0qj67_1508_c1
1912 nmdc:mga0qj67_76093_c1
1913 nmdc:mga0qj67_83580_c1
1914 nmdc:mga0qj67_9898_c1
1915 nmdc:mga06r32_351571_c1
1916 nmdc:mga06r32_4240_c1
1917 nmdc:mga06r32_60098_c1
1918 nmdc:mga06r32_80394_c1
1919 nmdc:mga08y16_16311_c1
1920 nmdc:mga08y16_2936_c1
1921 nmdc:mga08y16_368483_c1
1922 nmdc:mga08y16_640486_c1
1923 nmdc:mga0n895_204409_c1
1924 nmdc:mga0rr50_2782_c1
1925 nmdc:mga08x19_125208_c1
1926 nmdc:mga08x19_62434_c1
1927 nmdc:mga0a205_97616_c1
1928 Ga0495601_0000086
1929 Ga0495601_0030309
1930 Ga0495601_0078139
1931 Ga0495601_0096050
1932 Ga0495612_0000410
1933 Ga0495612_0005844
1934 Ga0495612_0011495
1935 Ga0495655_0001739
1936 Ga0495595_0000014
1937 Ga0495595_0000109
1938 Ga0495595_0013656
1939 Ga0495595_0027010
1940 Ga0495619_0000022
1941 Ga0495619_0000319
1942 Ga0495619_0003097
1943 Ga0495619_0008074
1944 Ga0495619_0010328
1945 Ga0495619_0143613
1946 Ga0500641_0002398
1947 Ga0500562_000002
1948 Ga0500595_021781
1949 Ga0500628_002474
1950 Ga0501084_0001358
1951 Ga0501084_0005874
1952 Ga0501084_0016458
1953 Ga0501084_0050734
1954 Ga0501084_0352493
1955 Ga0590071_011163
1956 Ga0590075_003699
1957 Ga0590077_004894
1958 Ga0501082_0000063
1959 Ga0501082_0001009
1960 Ga0501082_0010791
1961 Ga0501082_0033591
1962 Ga0501082_0042607
1963 Ga0501082_0047272
1964 Ga0501082_0195502
1965 Ga0530510_0000014
1966 Ga0530510_0001148
1967 Ga0530510_0014247
1968 Ga0530510_0016425
1969 Ga0530510_0031133
1970 Ga0530510_0046814
1971 Ga0530510_0154128
1972 Ga0530510_0211494

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

42

186

0.98

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

104

220

0.84

PF13732

DUF4162

Domain of unknown function (DUF4162)

240

328

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9466 6 229
7x0q-assembly1.cif.gz_B crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.9436 6 227
8eop-assembly1.cif.gz_A cryo-em structure of nanodisc reconstituted human abca7 eq mutant in atp bound closed state 0.9428 5 229
8hps-assembly1.cif.gz_D lpqy-sugabc in state 5 0.9386 7 227
8hpr-assembly1.cif.gz_C lpqy-sugabc in state 4 0.9369 7 227
ID Description Score Start End Superfamily
af_A4HRM7_2286_2560_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9828 4 231 3.40.50.300
af_A4I2P8_1496_1744_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9793 2 229 3.40.50.300
af_P0A9U1_321_563_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9704 4 229 3.40.50.300
af_P78363_1926_2175_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9694 7 231 3.40.50.300
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9662 7 229 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1I2M2I1-F1-model_v4 ABC-2 type transport system ATP-binding protein/oleandomycin transport system ATP-binding protein 0.9817 7 226 GO:0005524
GO:0016887
AF-A0A1D2R6P7-F1-model_v4 ABC transporter domain-containing protein 0.9782 7 230 GO:0005524
GO:0016887
AF-A0A7C6CAI4-F1-model_v4 ABC transporter ATP-binding protein 0.9781 7 230 GO:0005524
GO:0016887
AF-A0A7V5DKD2-F1-model_v4 Heme ABC exporter ATP-binding protein CcmA 0.9742 7 222 GO:0005524
GO:0016887
GO:0017004
GO:0022857
AF-A0A4Q7PN08-F1-model_v4 deleted 0.9733 6 229

Map