F487519

General Info

Members Datasets Scaffolds Average Seq Length
986 349 985 158

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10051057|Ga0075433_100510572
Length 146
Sequence MAKHHVEATVNGDAVEFLCETEETLLDVLRDTLNLTGSKEGCASGDCGACSVTLDGRLVCSCETIEGLAKGESLHPLQKKFLEHAALQCGICTPGFLVASKALLEKNPNPTDTEIRYWLAGNLCRCTGYDKIVTAVKDAAVTLRKG

Samples

Sample ID Description Type Environment
1 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
2 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
6 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
7 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
8 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
128 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
129 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
130 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
131 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
205 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
209 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
210 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
211 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
212 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
213 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
214 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
215 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
216 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
217 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
218 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
219 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
220 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
221 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
222 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
223 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
224 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
225 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
226 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
227 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
228 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
229 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
230 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
231 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
232 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
233 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
234 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
235 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
236 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
237 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
238 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
239 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
240 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
243 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
244 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
245 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
246 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
247 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
248 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
249 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
250 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
251 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
252 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
253 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
254 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
255 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
256 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
257 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
258 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
259 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
260 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
261 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
262 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
263 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
264 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
265 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
266 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
267 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
268 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
269 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
270 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
271 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
272 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
273 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
274 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
275 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
276 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
277 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
278 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
279 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
280 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
283 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
284 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
285 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
286 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
287 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
288 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
289 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
290 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
291 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
292 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
308 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
309 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
310 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
311 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
312 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
313 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
314 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
315 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
316 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
317 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
318 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
319 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
320 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
321 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
322 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
325 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
326 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
327 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
328 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
329 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
330 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
331 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
332 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
333 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
334 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
335 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
336 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
337 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
338 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
349 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.77
Metatranscriptomes 2.13
Isolates 0.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.1
Nodule 0
Rhizoplane 2.64
Rhizosphere 96.55
Stem 0
Stem Tuber 0
Unclassified 0.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006759J45824_1047994 3300003163 Bacteria 517
2 JGI25406J46586_10007285 3300003203 Bacteria 5059
3 Ga0006777J48905_1043548 3300003308 Bacteria 733
4 JGI26129J50193_1008337 3300003349 Bacteria 752
5 JGI26143J51219_1003405 3300003502 Bacteria 734
6 JGI26141J51220_1000584 3300003503 Bacteria 2057
7 Ga0007410J51695_1025380 3300003574 Bacteria 558
8 Ga0007429J51699_1036292 3300003579 Bacteria 897
9 Ga0058862_12435877 3300004803 Bacteria 1039
10 Ga0065712_10423211 3300005290 Bacteria 710
11 Ga0065715_10296131 3300005293 Bacteria 1052
12 Ga0065707_10390724 3300005295 Bacteria 865
13 Ga0065707_10404512 3300005295 Bacteria 845
14 Ga0070676_10004015 3300005328 Bacteria 7723
15 Ga0070683_101408036 3300005329 Bacteria 670
16 Ga0070690_100209186 3300005330 Bacteria 1361
17 Ga0070690_100209579 3300005330 Bacteria 1360
18 Ga0070670_100004063 3300005331 Bacteria 12227
19 Ga0070677_10272643 3300005333 Bacteria 849
20 Ga0068869_100002574 3300005334 Bacteria 10950
21 Ga0068869_100044411 3300005334 Bacteria 3195
22 Ga0070680_100002172 3300005336 Bacteria 14454
23 Ga0070680_100004422 3300005336 Bacteria 10580
24 Ga0070680_101112701 3300005336 Bacteria 683
25 Ga0070682_100001008 3300005337 Bacteria 16310
26 Ga0068868_100010262 3300005338 Bacteria 6772
27 Ga0068868_100499687 3300005338 Bacteria 1065
28 Ga0068868_101184152 3300005338 Bacteria 706
29 Ga0070660_100000640 3300005339 Bacteria 23213
30 Ga0070660_100275412 3300005339 Bacteria 1376
31 Ga0070689_100049933 3300005340 Bacteria 3230
32 Ga0070689_100114015 3300005340 Bacteria 2153
33 Ga0070689_101315779 3300005340 Bacteria 651
34 Ga0070691_10062672 3300005341 Bacteria 1791
35 Ga0070687_100080856 3300005343 Bacteria 1773
36 Ga0070687_100118966 3300005343 Bacteria 1508
37 Ga0070687_100320400 3300005343 Bacteria 990
38 Ga0070661_100001216 3300005344 Bacteria 18158
39 Ga0070661_100951606 3300005344 Bacteria 711
40 Ga0070692_10000146 3300005345 Bacteria 17288
41 Ga0070692_10091917 3300005345 Bacteria 1651
42 Ga0070692_10376336 3300005345 Bacteria 890
43 Ga0070692_10701617 3300005345 Bacteria 681
44 Ga0070668_100275489 3300005347 Bacteria 1404
45 Ga0070669_100011392 3300005353 Bacteria 6313
46 Ga0070669_100040026 3300005353 Bacteria 3406
47 Ga0070671_100120448 3300005355 Bacteria 2208
48 Ga0070671_100518997 3300005355 Bacteria 1026
49 Ga0070671_101301815 3300005355 Bacteria 641
50 Ga0070674_100361852 3300005356 Bacteria 1175
51 Ga0070674_100446429 3300005356 Bacteria 1067
52 Ga0070673_100003150 3300005364 Bacteria 10222
53 Ga0070673_100110285 3300005364 Bacteria 2281
54 Ga0070688_100228288 3300005365 Bacteria 1316
55 Ga0070688_100666430 3300005365 Bacteria 803
56 Ga0070659_100021962 3300005366 Bacteria 4869
57 Ga0070659_100119732 3300005366 Bacteria 2131
58 Ga0070659_100322323 3300005366 Bacteria 1292
59 Ga0070667_100196926 3300005367 Bacteria 1786
60 Ga0070703_10017718 3300005406 Bacteria 2053
61 Ga0070709_10017798 3300005434 Bacteria 4083
62 Ga0070709_10223836 3300005434 Bacteria 1343
63 Ga0070701_10147423 3300005438 Bacteria 1352
64 Ga0070711_100157219 3300005439 Bacteria 1720
65 Ga0070705_100002474 3300005440 Bacteria 9285
66 Ga0070705_100012222 3300005440 Bacteria 4359
67 Ga0070705_100256428 3300005440 Bacteria 1231
68 Ga0070705_100261927 3300005440 Bacteria 1220
69 Ga0070705_100416987 3300005440 Bacteria 998
70 Ga0070705_100462297 3300005440 Bacteria 955
71 Ga0070705_100466375 3300005440 Bacteria 951
72 Ga0070705_100470174 3300005440 Bacteria 948
73 Ga0070705_100604398 3300005440 Bacteria 849
74 Ga0070700_100149986 3300005441 Bacteria 1594
75 Ga0070694_100004086 3300005444 Bacteria 8758
76 Ga0070694_100007127 3300005444 Bacteria 6807
77 Ga0070694_100062516 3300005444 Bacteria 2544
78 Ga0070694_100136691 3300005444 Bacteria 1777
79 Ga0070694_100265343 3300005444 Bacteria 1304
80 Ga0070708_100059696 3300005445 Bacteria 3401
81 Ga0070708_100139006 3300005445 Bacteria 2251
82 Ga0070708_100418011 3300005445 Bacteria 1264
83 Ga0070708_100478830 3300005445 Bacteria 1174
84 Ga0070708_100508394 3300005445 Bacteria 1136
85 Ga0070663_100000406 3300005455 Bacteria 22595
86 Ga0070663_100190403 3300005455 Bacteria 1596
87 Ga0070662_100001878 3300005457 Bacteria 12872
88 Ga0070662_100065815 3300005457 Bacteria 2658
89 Ga0070662_100163857 3300005457 Bacteria 1741
90 Ga0070681_10033286 3300005458 Bacteria 5174
91 Ga0070681_10065079 3300005458 Bacteria 3615
92 Ga0070681_10318356 3300005458 Bacteria 1465
93 Ga0068867_100011546 3300005459 Bacteria 6235
94 Ga0068867_100319072 3300005459 Bacteria 1287
95 Ga0068867_100724490 3300005459 Bacteria 880
96 Ga0070685_10141728 3300005466 Bacteria 1514
97 Ga0070706_100200412 3300005467 Bacteria 1864
98 Ga0070706_100331783 3300005467 Bacteria 1418
99 Ga0070706_100410113 3300005467 Bacteria 1261
100 Ga0070706_100834617 3300005467 Bacteria 852
101 Ga0070707_100015488 3300005468 Bacteria 7155
102 Ga0070707_100022930 3300005468 Bacteria 5903
103 Ga0070707_100062823 3300005468 Bacteria 3563
104 Ga0070707_100063778 3300005468 Bacteria 3536
105 Ga0070707_100127300 3300005468 Bacteria 2475
106 Ga0070707_100207126 3300005468 Bacteria 1911
107 Ga0070707_100361810 3300005468 Bacteria 1409
108 Ga0070707_100442938 3300005468 Bacteria 1259
109 Ga0070707_100640623 3300005468 Bacteria 1025
110 Ga0070698_100009575 3300005471 Bacteria 10367
111 Ga0070698_100012020 3300005471 Bacteria 9178
112 Ga0070698_100069460 3300005471 Bacteria 3536
113 Ga0070698_100134844 3300005471 Bacteria 2423
114 Ga0070698_100163951 3300005471 Bacteria 2165
115 Ga0070698_100183878 3300005471 Bacteria 2028
116 Ga0070699_100027897 3300005518 Bacteria 4870
117 Ga0070699_100030129 3300005518 Bacteria 4682
118 Ga0070699_100104327 3300005518 Bacteria 2486
119 Ga0070699_100131231 3300005518 Bacteria 2209
120 Ga0070699_101013109 3300005518 Bacteria 762
121 Ga0070699_101070359 3300005518 Bacteria 740
122 Ga0070699_101294756 3300005518 Bacteria 668
123 Ga0070679_100045451 3300005530 Bacteria 4376
124 Ga0070679_100344590 3300005530 Bacteria 1438
125 Ga0070679_100372990 3300005530 Bacteria 1374
126 Ga0070684_100019531 3300005535 Bacteria 5607
127 Ga0070684_100242059 3300005535 Bacteria 1648
128 Ga0070697_100144825 3300005536 Bacteria 1999
129 Ga0070697_100182414 3300005536 Bacteria 1779
130 Ga0070697_100584071 3300005536 Bacteria 981
131 Ga0070697_100988538 3300005536 Bacteria 748
132 Ga0070697_101050416 3300005536 Bacteria 724
133 Ga0068853_100001025 3300005539 Bacteria 19674
134 Ga0068853_100369474 3300005539 Bacteria 1338
135 Ga0070695_100001024 3300005545 Bacteria 15261
136 Ga0070695_100003752 3300005545 Bacteria 8861
137 Ga0070695_100009964 3300005545 Bacteria 5666
138 Ga0070695_100086829 3300005545 Bacteria 2080
139 Ga0070695_100573701 3300005545 Bacteria 882
140 Ga0070696_100001263 3300005546 Bacteria 16430
141 Ga0070696_100031968 3300005546 Bacteria 3609
142 Ga0070696_100101177 3300005546 Bacteria 2065
143 Ga0070696_101076766 3300005546 Bacteria 675
144 Ga0070693_100000283 3300005547 Bacteria 23822
145 Ga0070693_100878737 3300005547 Bacteria 670
146 Ga0070665_100721117 3300005548 Bacteria 1010
147 Ga0070665_101806334 3300005548 Bacteria 618
148 Ga0070704_100001095 3300005549 Bacteria 14047
149 Ga0070704_100046832 3300005549 Bacteria 3019
150 Ga0070704_100078534 3300005549 Bacteria 2422
151 Ga0070704_100099673 3300005549 Bacteria 2185
152 Ga0070704_100151316 3300005549 Bacteria 1825
153 Ga0070704_100222115 3300005549 Bacteria 1537
154 Ga0070704_100463494 3300005549 Bacteria 1094
155 Ga0070704_100628815 3300005549 Bacteria 946
156 Ga0070704_100886333 3300005549 Bacteria 802
157 Ga0068855_100012218 3300005563 Bacteria 10378
158 Ga0070664_100028474 3300005564 Bacteria 4647
159 Ga0070664_100436268 3300005564 Bacteria 1201
160 Ga0068857_100008128 3300005577 Bacteria 9057
161 Ga0068857_100945263 3300005577 Bacteria 828
162 Ga0068854_100002085 3300005578 Bacteria 12258
163 Ga0068854_100222754 3300005578 Bacteria 1493
164 Ga0068854_100284689 3300005578 Bacteria 1332
165 Ga0068854_101237750 3300005578 Bacteria 670
166 Ga0068856_100006402 3300005614 Bacteria 11551
167 Ga0068856_101116104 3300005614 Bacteria 806
168 Ga0070702_100248406 3300005615 Bacteria 1205
169 Ga0070702_100668533 3300005615 Bacteria 788
170 Ga0068852_100130378 3300005616 Bacteria 2315
171 Ga0068859_100007763 3300005617 Bacteria 10896
172 Ga0068859_100040934 3300005617 Bacteria 4654
173 Ga0068859_101868518 3300005617 Bacteria 663
174 Ga0068864_101619876 3300005618 Bacteria 651
175 Ga0068864_101688582 3300005618 Bacteria 638
176 Ga0068866_10148658 3300005718 Bacteria 1354
177 Ga0068866_10397631 3300005718 Bacteria 888
178 Ga0068861_100211805 3300005719 Bacteria 1633
179 Ga0068861_100850372 3300005719 Bacteria 860
180 Ga0068870_10006834 3300005840 Bacteria 5061
181 Ga0068870_10253991 3300005840 Bacteria 1091
182 Ga0068863_100133356 3300005841 Bacteria 2372
183 Ga0068858_100024588 3300005842 Bacteria 5612
184 Ga0068858_100081692 3300005842 Bacteria 3004
185 Ga0068858_102027672 3300005842 Bacteria 569
186 Ga0068860_100036613 3300005843 Bacteria 4700
187 Ga0068860_100088058 3300005843 Bacteria 2956
188 Ga0068860_100540365 3300005843 Bacteria 1167
189 Ga0068860_101272601 3300005843 Bacteria 756
190 Ga0068862_100287626 3300005844 Bacteria 1508
191 Ga0068862_100814698 3300005844 Bacteria 913
192 Ga0068862_101313559 3300005844 Bacteria 725
193 Ga0068862_101329171 3300005844 Bacteria 721
194 Ga0068862_101508571 3300005844 Bacteria 678
195 Ga0068862_101754312 3300005844 Bacteria 629
196 Ga0081455_10000433 3300005937 Bacteria 55007
197 Ga0081540_1013630 3300005983 Bacteria 5272
198 Ga0081540_1020165 3300005983 Bacteria 4021
199 Ga0081539_10000271 3300005985 Bacteria 118902
200 Ga0081539_10031960 3300005985 Bacteria 3232
201 Ga0075432_10195733 3300006058 Bacteria 798
202 Ga0070716_100007411 3300006173 Bacteria 5400
203 Ga0070712_100008516 3300006175 Bacteria 6453
204 Ga0070712_100367805 3300006175 Bacteria 1181
205 Ga0097621_100077672 3300006237 Bacteria 2757
206 Ga0097621_100334041 3300006237 Bacteria 1345
207 Ga0068871_100016719 3300006358 Bacteria 5535
208 Ga0068871_100893510 3300006358 Bacteria 823
209 Ga0075428_100002741 3300006844 Bacteria 19183
210 Ga0075428_100065646 3300006844 Bacteria 3975
211 Ga0075428_100261471 3300006844 Bacteria 1863
212 Ga0075428_100405075 3300006844 Bacteria 1462
213 Ga0075428_101005400 3300006844 Bacteria 883
214 Ga0075428_101578210 3300006844 Bacteria 686
215 Ga0075430_100000995 3300006846 Bacteria 22401
216 Ga0075430_100002448 3300006846 Bacteria 15460
217 Ga0075430_100006077 3300006846 Bacteria 10178
218 Ga0075430_100260267 3300006846 Bacteria 1437
219 Ga0075430_100764138 3300006846 Bacteria 796
220 Ga0075430_101262432 3300006846 Bacteria 608
221 Ga0075431_100000752 3300006847 Bacteria 28024
222 Ga0075431_100001235 3300006847 Bacteria 23185
223 Ga0075431_100006036 3300006847 Bacteria 12012
224 Ga0075431_100046375 3300006847 Bacteria 4481
225 Ga0075431_100076567 3300006847 Bacteria 3452
226 Ga0075431_100143192 3300006847 Bacteria 2464
227 Ga0075431_100150704 3300006847 Bacteria 2395
228 Ga0075431_100265087 3300006847 Bacteria 1742
229 Ga0075431_100437654 3300006847 Bacteria 1305
230 Ga0075431_100444681 3300006847 Bacteria 1292
231 Ga0075431_100563302 3300006847 Bacteria 1126
232 Ga0075431_101294668 3300006847 Bacteria 690
233 Ga0075433_10005518 3300006852 Bacteria 9933
234 Ga0075433_10010752 3300006852 Bacteria 7361
235 Ga0075433_10011103 3300006852 Bacteria 7243
236 Ga0075433_10011169 3300006852 Bacteria 7224
237 Ga0075433_10042460 3300006852 Bacteria 3945
238 Ga0075433_10051057 3300006852 Bacteria 3600
239 Ga0075433_10088566 3300006852 Bacteria 2735
240 Ga0075433_10216863 3300006852 Bacteria 1700
241 Ga0075433_10308921 3300006852 Bacteria 1400
242 Ga0075433_10481153 3300006852 Bacteria 1094
243 Ga0075433_10592320 3300006852 Bacteria 974
244 Ga0075433_10639867 3300006852 Bacteria 933
245 Ga0075434_100001101 3300006871 Bacteria 22162
246 Ga0075434_100006381 3300006871 Bacteria 10810
247 Ga0075434_100012476 3300006871 Bacteria 8059
248 Ga0075434_100123037 3300006871 Bacteria 2610
249 Ga0075434_100149430 3300006871 Bacteria 2356
250 Ga0075434_100169638 3300006871 Bacteria 2202
251 Ga0075434_100220229 3300006871 Bacteria 1917
252 Ga0075434_100227961 3300006871 Bacteria 1882
253 Ga0075434_100244650 3300006871 Bacteria 1814
254 Ga0075434_100275006 3300006871 Bacteria 1703
255 Ga0075434_100651464 3300006871 Bacteria 1071
256 Ga0075434_100734418 3300006871 Bacteria 1004
257 Ga0075429_100000231 3300006880 Bacteria 38094
258 Ga0075429_100004656 3300006880 Bacteria 11802
259 Ga0075429_100020795 3300006880 Bacteria 5696
260 Ga0075429_100076937 3300006880 Bacteria 2906
261 Ga0075429_100154437 3300006880 Bacteria 2010
262 Ga0075429_100670331 3300006880 Bacteria 909
263 Ga0068865_100677762 3300006881 Bacteria 879
264 Ga0075436_100003124 3300006914 Bacteria 11350
265 Ga0075436_100019659 3300006914 Bacteria 4630
266 Ga0075436_100044152 3300006914 Bacteria 3073
267 Ga0075436_100051420 3300006914 Bacteria 2844
268 Ga0075436_100109161 3300006914 Bacteria 1930
269 Ga0075436_100137139 3300006914 Bacteria 1718
270 Ga0097620_100007763 3300006931 Bacteria 10896
271 Ga0097620_100040939 3300006931 Bacteria 4654
272 Ga0097620_101869201 3300006931 Bacteria 663
273 Ga0075435_100002353 3300007076 Bacteria 12527
274 Ga0075435_100021024 3300007076 Bacteria 5012
275 Ga0075435_100022841 3300007076 Bacteria 4829
276 Ga0075435_100054365 3300007076 Bacteria 3231
277 Ga0075435_100081871 3300007076 Bacteria 2652
278 Ga0075435_100125869 3300007076 Bacteria 2142
279 Ga0075435_100145541 3300007076 Bacteria 1990
280 Ga0075435_100162891 3300007076 Bacteria 1879
281 Ga0075435_100298474 3300007076 Bacteria 1378
282 Ga0075435_100593860 3300007076 Bacteria 960
283 Ga0075435_100656691 3300007076 Bacteria 910
284 Ga0075435_100680290 3300007076 Bacteria 894
285 Ga0099794_10009756 3300007265 Bacteria 4051
286 Ga0099794_10025349 3300007265 Bacteria 2730
287 Ga0099794_10156857 3300007265 Bacteria 1157
288 Ga0105240_10217423 3300009093 Bacteria 2228
289 Ga0111539_10001442 3300009094 Bacteria 31728
290 Ga0111539_10014162 3300009094 Bacteria 9957
291 Ga0111539_10020969 3300009094 Bacteria 8046
292 Ga0111539_10031067 3300009094 Bacteria 6490
293 Ga0111539_10044400 3300009094 Bacteria 5325
294 Ga0111539_10354573 3300009094 Bacteria 1707
295 Ga0111539_10389826 3300009094 Bacteria 1622
296 Ga0111539_11845588 3300009094 Bacteria 701
297 Ga0111539_12912666 3300009094 Bacteria 554
298 Ga0105245_10065829 3300009098 Bacteria 3278
299 Ga0105245_10174146 3300009098 Bacteria 2051
300 Ga0105245_10207577 3300009098 Bacteria 1884
301 Ga0105245_10444356 3300009098 Bacteria 1304
302 Ga0105245_10931350 3300009098 Bacteria 911
303 Ga0105247_10518355 3300009101 Bacteria 871
304 Ga0114129_10000643 3300009147 Bacteria 43627
305 Ga0114129_10004885 3300009147 Bacteria 18915
306 Ga0114129_10028218 3300009147 Bacteria 7951
307 Ga0114129_10044584 3300009147 Bacteria 6238
308 Ga0114129_10044676 3300009147 Bacteria 6232
309 Ga0114129_10045389 3300009147 Bacteria 6178
310 Ga0114129_10046650 3300009147 Bacteria 6089
311 Ga0114129_10064689 3300009147 Bacteria 5104
312 Ga0114129_10079570 3300009147 Bacteria 4557
313 Ga0114129_10107834 3300009147 Bacteria 3846
314 Ga0114129_10108103 3300009147 Bacteria 3840
315 Ga0114129_10177825 3300009147 Bacteria 2897
316 Ga0114129_10285840 3300009147 Bacteria 2202
317 Ga0114129_10293245 3300009147 Bacteria 2170
318 Ga0114129_10296921 3300009147 Bacteria 2155
319 Ga0114129_10609532 3300009147 Bacteria 1413
320 Ga0114129_10673114 3300009147 Bacteria 1333
321 Ga0114129_10798473 3300009147 Bacteria 1204
322 Ga0114129_10909256 3300009147 Bacteria 1115
323 Ga0114129_11742557 3300009147 Bacteria 759
324 Ga0105243_11760599 3300009148 Bacteria 650
325 Ga0105243_11867401 3300009148 Bacteria 633
326 Ga0105241_10001312 3300009174 Bacteria 18908
327 Ga0105241_10037857 3300009174 Bacteria 3635
328 Ga0105241_10393859 3300009174 Bacteria 1213
329 Ga0105241_10474399 3300009174 Bacteria 1111
330 Ga0105242_10138777 3300009176 Bacteria 2107
331 Ga0105242_10771746 3300009176 Bacteria 948
332 Ga0105242_11307692 3300009176 Bacteria 749
333 Ga0105248_10029051 3300009177 Bacteria 6165
334 Ga0105248_12363174 3300009177 Bacteria 605
335 Ga0105237_10028013 3300009545 Bacteria 5740
336 Ga0105237_10225033 3300009545 Bacteria 1876
337 Ga0105238_10069382 3300009551 Bacteria 3525
338 Ga0105238_10474362 3300009551 Bacteria 1250
339 Ga0105249_10258039 3300009553 Bacteria 1731
340 Ga0105249_10447944 3300009553 Bacteria 1329
341 Ga0105249_10457710 3300009553 Bacteria 1315
342 Ga0105249_10678363 3300009553 Bacteria 1089
343 Ga0105249_10970744 3300009553 Bacteria 918
344 Ga0105239_10061655 3300010375 Bacteria 4116
345 Ga0105239_10350730 3300010375 Bacteria 1666
346 Ga0105239_10546863 3300010375 Bacteria 1318
347 Ga0105239_10716844 3300010375 Bacteria 1144
348 Ga0105246_10088689 3300011119 Bacteria 2223
349 Ga0105246_10251782 3300011119 Bacteria 1402
350 Ga0157373_10000457 3300013100 Bacteria 32330
351 Ga0157373_10415463 3300013100 Bacteria 965
352 Ga0157369_10217059 3300013105 Bacteria 2003
353 Ga0157374_10379589 3300013296 Bacteria 1408
354 Ga0157378_10283272 3300013297 Bacteria 1598
355 Ga0157378_10464135 3300013297 Bacteria 1259
356 Ga0157378_10517720 3300013297 Bacteria 1194
357 Ga0157378_11134476 3300013297 Bacteria 820
358 Ga0157378_11982502 3300013297 Bacteria 632
359 Ga0163162_10018030 3300013306 Bacteria 6908
360 Ga0163162_10768105 3300013306 Bacteria 1082
361 Ga0163162_12202501 3300013306 Bacteria 633
362 Ga0157372_10042124 3300013307 Bacteria 5049
363 Ga0157372_10152649 3300013307 Bacteria 2666
364 Ga0157375_10117305 3300013308 Bacteria 2767
365 Ga0157375_10273143 3300013308 Bacteria 1853
366 Ga0157375_10274923 3300013308 Bacteria 1847
367 Ga0157375_10602785 3300013308 Bacteria 1257
368 Ga0163163_10440381 3300014325 Bacteria 1363
369 Ga0163163_10506302 3300014325 Bacteria 1269
370 Ga0163163_10801063 3300014325 Bacteria 1006
371 Ga0157380_10683777 3300014326 Bacteria 1028
372 Ga0157380_11088881 3300014326 Bacteria 837
373 Ga0157377_10330796 3300014745 Bacteria 1016
374 Ga0157377_10643039 3300014745 Bacteria 762
375 Ga0157379_10500205 3300014968 Bacteria 1126
376 Ga0157379_10560579 3300014968 Bacteria 1064
377 Ga0157379_10782585 3300014968 Bacteria 900
378 Ga0157376_10014946 3300014969 Bacteria 5850
379 Ga0206356_11296602 3300020070 Bacteria 598
380 Ga0206352_10551387 3300020078 Bacteria 971
381 Ga0206352_10961566 3300020078 Bacteria 916
382 Ga0206350_10918364 3300020080 Bacteria 914
383 Ga0213873_10031999 3300021358 Bacteria 1312
384 Ga0213874_10116250 3300021377 Bacteria 904
385 Ga0213876_10073124 3300021384 Bacteria 1810
386 Ga0213875_10027992 3300021388 Bacteria 2680
387 Ga0224712_10276785 3300022467 Bacteria 780
388 Ga0207653_10004849 3300025885 Bacteria 4204
389 Ga0207653_10012619 3300025885 Bacteria 2638
390 Ga0207653_10110994 3300025885 Bacteria 979
391 Ga0207642_10186907 3300025899 Bacteria 1134
392 Ga0207642_10472198 3300025899 Bacteria 763
393 Ga0207688_10083507 3300025901 Bacteria 1827
394 Ga0207688_10208794 3300025901 Bacteria 1173
395 Ga0207685_10105949 3300025905 Bacteria 1210
396 Ga0207685_10145953 3300025905 Bacteria 1066
397 Ga0207685_10511778 3300025905 Bacteria 633
398 Ga0207699_10201774 3300025906 Bacteria 1348
399 Ga0207699_10699993 3300025906 Bacteria 742
400 Ga0207645_10000582 3300025907 Bacteria 30310
401 Ga0207643_10000688 3300025908 Bacteria 21132
402 Ga0207643_10304997 3300025908 Bacteria 992
403 Ga0207684_10009460 3300025910 Bacteria 8604
404 Ga0207684_10013814 3300025910 Bacteria 6974
405 Ga0207684_10017635 3300025910 Bacteria 6125
406 Ga0207684_10031745 3300025910 Bacteria 4493
407 Ga0207684_10064137 3300025910 Bacteria 3119
408 Ga0207684_10075117 3300025910 Bacteria 2872
409 Ga0207684_10496485 3300025910 Bacteria 1046
410 Ga0207684_10770638 3300025910 Bacteria 814
411 Ga0207654_10003437 3300025911 Bacteria 8006
412 Ga0207654_10025483 3300025911 Bacteria 3190
413 Ga0207707_10000158 3300025912 Bacteria 71112
414 Ga0207707_10535647 3300025912 Bacteria 996
415 Ga0207695_10308224 3300025913 Bacteria 1473
416 Ga0207671_10039847 3300025914 Bacteria 3479
417 Ga0207693_10008921 3300025915 Bacteria 8187
418 Ga0207693_10400419 3300025915 Bacteria 1073
419 Ga0207693_10440230 3300025915 Bacteria 1019
420 Ga0207663_10490803 3300025916 Bacteria 953
421 Ga0207663_10797557 3300025916 Bacteria 752
422 Ga0207660_10000220 3300025917 Bacteria 36783
423 Ga0207660_10012274 3300025917 Bacteria 5601
424 Ga0207660_10337425 3300025917 Bacteria 1206
425 Ga0207662_10092896 3300025918 Bacteria 1858
426 Ga0207662_10105562 3300025918 Bacteria 1751
427 Ga0207662_10744800 3300025918 Bacteria 689
428 Ga0207657_10000730 3300025919 Bacteria 34885
429 Ga0207649_10011103 3300025920 Bacteria 4958
430 Ga0207652_10000290 3300025921 Bacteria 52056
431 Ga0207652_10108409 3300025921 Bacteria 2461
432 Ga0207646_10003701 3300025922 Bacteria 17067
433 Ga0207646_10023549 3300025922 Bacteria 5654
434 Ga0207646_10086056 3300025922 Bacteria 2812
435 Ga0207646_10221487 3300025922 Bacteria 1709
436 Ga0207646_10227192 3300025922 Bacteria 1686
437 Ga0207646_10249861 3300025922 Bacteria 1602
438 Ga0207646_10275940 3300025922 Bacteria 1519
439 Ga0207646_10287084 3300025922 Bacteria 1487
440 Ga0207646_10632559 3300025922 Bacteria 959
441 Ga0207681_10022163 3300025923 Bacteria 4047
442 Ga0207681_10292339 3300025923 Bacteria 1286
443 Ga0207681_10413117 3300025923 Bacteria 1092
444 Ga0207681_10860960 3300025923 Bacteria 758
445 Ga0207694_10044685 3300025924 Bacteria 3421
446 Ga0207650_10010437 3300025925 Bacteria 6366
447 Ga0207687_10539324 3300025927 Bacteria 978
448 Ga0207687_10829134 3300025927 Bacteria 790
449 Ga0207700_10101633 3300025928 Bacteria 2294
450 Ga0207664_10179129 3300025929 Bacteria 1819
451 Ga0207690_10002732 3300025932 Bacteria 10652
452 Ga0207690_10438317 3300025932 Bacteria 1048
453 Ga0207706_10011184 3300025933 Bacteria 8182
454 Ga0207706_10040989 3300025933 Bacteria 4105
455 Ga0207706_10093783 3300025933 Bacteria 2640
456 Ga0207686_10159058 3300025934 Bacteria 1581
457 Ga0207709_10195812 3300025935 Bacteria 1439
458 Ga0207709_10215555 3300025935 Bacteria 1381
459 Ga0207709_10961166 3300025935 Bacteria 697
460 Ga0207670_10030455 3300025936 Bacteria 3448
461 Ga0207669_10180140 3300025937 Bacteria 1514
462 Ga0207669_10365446 3300025937 Bacteria 1120
463 Ga0207669_10580535 3300025937 Bacteria 908
464 Ga0207704_10531971 3300025938 Bacteria 952
465 Ga0207665_10002961 3300025939 Bacteria 11381
466 Ga0207691_10363241 3300025940 Bacteria 1238
467 Ga0207711_10040996 3300025941 Bacteria 3940
468 Ga0207711_10061135 3300025941 Bacteria 3248
469 Ga0207689_10000846 3300025942 Bacteria 29434
470 Ga0207689_10008358 3300025942 Bacteria 9012
471 Ga0207661_11225132 3300025944 Bacteria 690
472 Ga0207679_10000820 3300025945 Bacteria 20002
473 Ga0207679_10607726 3300025945 Bacteria 986
474 Ga0207667_10001638 3300025949 Bacteria 28188
475 Ga0207651_10017986 3300025960 Bacteria 4193
476 Ga0207651_10046301 3300025960 Bacteria 2924
477 Ga0207651_10930530 3300025960 Bacteria 775
478 Ga0207712_10777186 3300025961 Bacteria 841
479 Ga0207712_11053682 3300025961 Bacteria 723
480 Ga0207668_10012836 3300025972 Bacteria 5140
481 Ga0207640_10010928 3300025981 Bacteria 5122
482 Ga0207640_11484337 3300025981 Bacteria 609
483 Ga0207677_10039511 3300026023 Bacteria 3103
484 Ga0207703_10061345 3300026035 Bacteria 3078
485 Ga0207639_10003030 3300026041 Bacteria 11313
486 Ga0207639_10305816 3300026041 Bacteria 1407
487 Ga0207639_10310778 3300026041 Bacteria 1396
488 Ga0207678_10003638 3300026067 Bacteria 13856
489 Ga0207678_11331627 3300026067 Bacteria 635
490 Ga0207708_10126776 3300026075 Bacteria 1993
491 Ga0207708_10375408 3300026075 Bacteria 1171
492 Ga0207702_10003448 3300026078 Bacteria 14437
493 Ga0207702_10618655 3300026078 Bacteria 1063
494 Ga0207641_10187238 3300026088 Bacteria 1900
495 Ga0207648_10034307 3300026089 Bacteria 4473
496 Ga0207648_10780321 3300026089 Bacteria 889
497 Ga0207676_11065497 3300026095 Bacteria 798
498 Ga0207674_10002312 3300026116 Bacteria 24141
499 Ga0207674_10416585 3300026116 Bacteria 1298
500 Ga0207675_100230392 3300026118 Bacteria 1787
501 Ga0207683_10917339 3300026121 Bacteria 813
502 Ga0207698_10081246 3300026142 Bacteria 2615
503 Ga0207698_10730461 3300026142 Bacteria 987
504 Ga0207698_11662362 3300026142 Bacteria 654
505 Ga0209969_1003036 3300027360 Bacteria 2322
506 Ga0209981_1005574 3300027378 Bacteria 1672
507 Ga0209996_1002868 3300027395 Bacteria 2145
508 Ga0209984_1006985 3300027424 Bacteria 1395
509 Ga0210000_1046215 3300027462 Bacteria 695
510 Ga0209995_1017552 3300027471 Bacteria 1177
511 Ga0209968_1004685 3300027526 Bacteria 2049
512 Ga0209999_1000646 3300027543 Bacteria 5582
513 Ga0209970_1000762 3300027614 Bacteria 5623
514 Ga0209970_1017391 3300027614 Bacteria 1203
515 Ga0209970_1026887 3300027614 Bacteria 990
516 Ga0209983_1000526 3300027665 Bacteria 8248
517 Ga0209588_1008703 3300027671 Bacteria 3015
518 Ga0209971_1000058 3300027682 Bacteria 35412
519 Ga0209971_1013323 3300027682 Bacteria 1949
520 Ga0209971_1020168 3300027682 Bacteria 1584
521 Ga0209966_1000021 3300027695 Bacteria 68287
522 Ga0209998_10000002 3300027717 Bacteria 126355
523 Ga0209974_10004247 3300027876 Bacteria 5114
524 Ga0209974_10165271 3300027876 Bacteria 804
525 Ga0207428_10000069 3300027907 Bacteria 149507
526 Ga0207428_10001914 3300027907 Bacteria 21074
527 Ga0207428_10044235 3300027907 Bacteria 3593
528 Ga0207428_10130402 3300027907 Bacteria 1924
529 Ga0207428_10499329 3300027907 Bacteria 884
530 Ga0268266_10593184 3300028379 Bacteria 1064
531 Ga0268266_10849902 3300028379 Bacteria 882
532 Ga0268266_11003625 3300028379 Bacteria 808
533 Ga0268265_10047714 3300028380 Bacteria 3211
534 Ga0268265_11235155 3300028380 Bacteria 746
535 Ga0268264_10019088 3300028381 Bacteria 5605
536 Ga0268264_10085848 3300028381 Bacteria 2702
537 Ga0268264_11762337 3300028381 Bacteria 629
538 Ga0265328_10057182 3300031239 Bacteria 1432
539 Ga0265320_10361190 3300031240 Bacteria 641
540 Ga0265325_10021553 3300031241 Bacteria 3539
541 Ga0265325_10069363 3300031241 Bacteria 1773
542 Ga0265339_10019242 3300031249 Bacteria 4012
543 Ga0265331_10001750 3300031250 Bacteria 15608
544 Ga0307408_100023294 3300031548 Bacteria 4216
545 Ga0307408_100418767 3300031548 Bacteria 1154
546 Ga0265313_10000827 3300031595 Bacteria 31277
547 Ga0265313_10185659 3300031595 Bacteria 872
548 Ga0265314_10126304 3300031711 Bacteria 1601
549 Ga0265342_10023073 3300031712 Bacteria 3944
550 Ga0307405_11020370 3300031731 Bacteria 707
551 Ga0307409_100478148 3300031995 Bacteria 1208
552 Ga0307416_100248585 3300032002 Bacteria 1729
553 Ga0307414_11072669 3300032004 Bacteria 743
554 Ga0307411_10131601 3300032005 Bacteria 1829
555 Ga0373948_0007232 3300034817 Bacteria 1861
556 Ga0373958_0068265 3300034819 Bacteria 784
557 Ga0373959_0003425 3300034820 Bacteria 2525
558 Ga0373926_0020266 3300035083 Bacteria 2297
559 Ga0373940_0010600 3300035088 Bacteria 2171
560 Ga0373940_0079348 3300035088 Bacteria 968
561 Ga0373940_0119209 3300035088 Bacteria 817
562 Ga0373940_0140518 3300035088 Bacteria 763
563 Ga0373949_0009104 3300035090 Bacteria 2176
564 Ga0373951_0002550 3300035091 Bacteria 4577
565 Ga0373952_0037294 3300035092 Bacteria 1108
566 Ga0373936_0245159 3300035113 Bacteria 799
567 Ga0373939_0019448 3300035114 Bacteria 1833
568 Ga0373939_0156130 3300035114 Bacteria 834
569 Ga0373939_0188697 3300035114 Bacteria 773
570 Ga0373941_0011362 3300035115 Bacteria 2299
571 Ga0373945_0084629 3300035116 Bacteria 1220
572 Ga0373957_0390159 3300035120 Bacteria 598
573 Ga0373962_0028333 3300035242 Bacteria 1519
574 Ga0373962_0190887 3300035242 Bacteria 689
575 Ga0373924_0300643 3300035410 Bacteria 713
576 Ga0373924_0351443 3300035410 Bacteria 657
577 Ga0373931_0019802 3300035691 Bacteria 3362
578 Ga0373931_0033320 3300035691 Bacteria 2669
579 Ga0373931_0114603 3300035691 Bacteria 1533
580 Ga0373931_0688463 3300035691 Bacteria 674
581 Ga0373927_0004542 3300035695 Bacteria 9696
582 Ga0373927_0255030 3300035695 Bacteria 1153
583 Ga0373947_0096152 3300035725 Bacteria 1854
584 Ga0373947_0670133 3300035725 Bacteria 707
585 Ga0373937_0114911 3300036401 Bacteria 2506
586 Ga0373937_0412708 3300036401 Bacteria 1281
587 Ga0373925_0068087 3300037068 Bacteria 2686
588 Ga0373925_0179456 3300037068 Bacteria 1675
589 Ga0395899_0153428 3300037312 Bacteria 1631
590 Ga0395900_0006737 3300037418 Bacteria 11917
591 Ga0395900_0147762 3300037418 Bacteria 2403
592 Ga0395898_0010133 3300037466 Bacteria 9864
593 Ga0436364_0919003 3300037853 Bacteria 613
594 Ga0395901_0006192 3300038443 Bacteria 12122
595 Ga0395901_0520337 3300038443 Bacteria 1209
596 Ga0436365_0458953 3300039437 Bacteria 582
597 Ga0436365_0527275 3300039437 Bacteria 2897
598 Ga0436360_0096378 3300039438 Bacteria 3812
599 Ga0436363_0015138 3300039450 Bacteria 707
600 Ga0436362_1242246 3300039453 Bacteria 934
601 Ga0439466_0048642 3300041411 Bacteria 1394
602 Ga0439448_0002193 3300042005 Bacteria 5275
603 Ga0439448_0005223 3300042005 Bacteria 3698
604 Ga0439455_0006291 3300042012 Bacteria 2458
605 Ga0439463_020316 3300042016 Bacteria 1656
606 Ga0450889_002862 3300042144 Bacteria 1706
607 Ga0439458_0000918 3300042157 Bacteria 7595
608 Ga0439459_0001028 3300042438 Bacteria 3979
609 Ga0439459_0146234 3300042438 Bacteria 615
610 Ga0439460_0001936 3300042461 Bacteria 4949
611 Ga0439460_0121931 3300042461 Bacteria 853
612 Ga0439460_0131809 3300042461 Bacteria 824
613 Ga0451577_0036946 3300042876 Bacteria 4397
614 Ga0451577_0046597 3300042876 Bacteria 3878
615 Ga0451577_0107464 3300042876 Bacteria 2494
616 Ga0451577_0435454 3300042876 Bacteria 1190
617 Ga0451577_0489708 3300042876 Bacteria 1116
618 Ga0451577_0760987 3300042876 Bacteria 876
619 Ga0451577_1516345 3300042876 Bacteria 593
620 Ga0453683_0470850 3300044673 Bacteria 814
621 Ga0453683_0980389 3300044673 Bacteria 561
622 Ga0453684_0096548 3300044712 Bacteria 3630
623 Ga0453684_1671749 3300044712 Bacteria 651
624 Ga0451576_0022688 3300045051 Bacteria 6800
625 Ga0451576_0030647 3300045051 Bacteria 5746
626 Ga0451576_0161675 3300045051 Bacteria 2337
627 Ga0451576_0356019 3300045051 Bacteria 1532
628 Ga0451576_0859957 3300045051 Bacteria 952
629 Ga0495603_0226791 3300046455 Bacteria 1077
630 Ga0495580_0008477 3300046472 Bacteria 8177
631 Ga0495580_0079742 3300046472 Bacteria 2283
632 Ga0495582_0056050 3300046473 Bacteria 2172
633 Ga0495584_0258842 3300046491 Bacteria 885
634 Ga0495584_0290461 3300046491 Bacteria 831
635 Ga0495594_0239045 3300046499 Bacteria 1035
636 Ga0495594_0371188 3300046499 Bacteria 814
637 Ga0495642_0051230 3300046528 Bacteria 1698
638 Ga0495642_0074530 3300046528 Bacteria 1423
639 Ga0495665_0233727 3300046531 Bacteria 949
640 Ga0495598_0288491 3300046537 Bacteria 618
641 Ga0495625_0449338 3300046660 Bacteria 797
642 Ga0495659_0166090 3300046664 Bacteria 893
643 Ga0495658_0082401 3300046683 Bacteria 1890
644 Ga0495658_0336575 3300046683 Bacteria 958
645 Ga0495669_0082176 3300046684 Bacteria 1480
646 Ga0495669_0149190 3300046684 Bacteria 1106
647 Ga0495669_0225583 3300046684 Bacteria 898
648 Ga0495669_0399898 3300046684 Bacteria 666
649 Ga0495613_0218140 3300046689 Bacteria 1340
650 Ga0495581_0046596 3300047315 Bacteria 2506
651 Ga0495636_0050381 3300047318 Bacteria 1743
652 Ga0495674_0730644 3300047319 Bacteria 775
653 Ga0496100_0401498 3300048903 Bacteria 1044
654 Ga0496101_0254165 3300048904 Bacteria 1370
655 Ga0496101_1111565 3300048904 Bacteria 620
656 Ga0496102_0010932 3300048905 Bacteria 7819
657 Ga0496102_0066067 3300048905 Bacteria 3315
658 Ga0496102_0253381 3300048905 Bacteria 1660
659 Ga0496102_0497306 3300048905 Bacteria 1141
660 Ga0496103_0028264 3300048906 Bacteria 3402
661 Ga0496103_0554031 3300048906 Bacteria 734
662 Ga0496104_0842980 3300048907 Bacteria 822
663 Ga0496106_0136730 3300048909 Bacteria 1925
664 Ga0496106_0244983 3300048909 Bacteria 1432
665 Ga0496106_0424802 3300048909 Bacteria 1068
666 Ga0496106_0971645 3300048909 Bacteria 669
667 Ga0496107_0081233 3300048910 Bacteria 2364
668 Ga0496108_0147203 3300048911 Bacteria 2031
669 Ga0496108_0402841 3300048911 Bacteria 1195
670 Ga0496108_0456019 3300048911 Bacteria 1117
671 Ga0496108_0613880 3300048911 Bacteria 947
672 Ga0496109_0126929 3300048912 Bacteria 2379
673 Ga0496110_0273285 3300048913 Bacteria 1539
674 Ga0496110_0923881 3300048913 Bacteria 779
675 Ga0496112_0021044 3300048915 Bacteria 6195
676 Ga0496112_0062304 3300048915 Bacteria 3679
677 Ga0496113_0186441 3300048916 Bacteria 1646
678 Ga0496114_0401428 3300048917 Bacteria 1214
679 Ga0501305_085992 3300049161 Bacteria 570
680 Ga0501031_0193378 3300049568 Bacteria 1328
681 Ga0501031_0427335 3300049568 Bacteria 856
682 Ga0501032_0961727 3300049569 Bacteria 537
683 Ga0501033_0055942 3300049570 Bacteria 2917
684 Ga0501033_0093909 3300049570 Bacteria 2194
685 Ga0501033_0359677 3300049570 Bacteria 1019
686 Ga0501033_0391053 3300049570 Bacteria 971
687 Ga0501033_0445711 3300049570 Bacteria 900
688 Ga0501033_0652577 3300049570 Bacteria 719
689 Ga0501036_0005109 3300049572 Bacteria 10610
690 Ga0501036_0071970 3300049572 Bacteria 2923
691 Ga0501036_0185009 3300049572 Bacteria 1753
692 Ga0501036_0277380 3300049572 Bacteria 1403
693 Ga0501036_0426056 3300049572 Bacteria 1106
694 Ga0501036_0617865 3300049572 Bacteria 898
695 Ga0501037_0211703 3300049573 Bacteria 1367
696 Ga0501037_0370828 3300049573 Bacteria 985
697 Ga0501037_0780216 3300049573 Bacteria 632
698 Ga0501038_0048428 3300049574 Bacteria 3678
699 Ga0501038_0105155 3300049574 Bacteria 2345
700 Ga0501038_0141276 3300049574 Bacteria 1969
701 Ga0501038_0419050 3300049574 Bacteria 1033
702 Ga0501038_0946666 3300049574 Bacteria 634
703 Ga0501039_0032051 3300049575 Bacteria 4051
704 Ga0501039_0032798 3300049575 Bacteria 4006
705 Ga0501039_0038255 3300049575 Bacteria 3706
706 Ga0501039_0039920 3300049575 Bacteria 3624
707 Ga0501039_0963490 3300049575 Bacteria 663
708 Ga0501040_0009563 3300049576 Bacteria 6326
709 Ga0501040_0014292 3300049576 Bacteria 5229
710 Ga0501040_0021542 3300049576 Bacteria 4306
711 Ga0501040_0060684 3300049576 Bacteria 2599
712 Ga0501040_0186798 3300049576 Bacteria 1470
713 Ga0501040_0360763 3300049576 Bacteria 1041
714 Ga0501041_0024142 3300049577 Bacteria 3648
715 Ga0501041_0027686 3300049577 Bacteria 3416
716 Ga0501041_0033417 3300049577 Bacteria 3112
717 Ga0501041_0064102 3300049577 Bacteria 2250
718 Ga0501041_0206413 3300049577 Bacteria 1232
719 Ga0501041_0300587 3300049577 Bacteria 1011
720 Ga0501041_0443705 3300049577 Bacteria 824
721 Ga0501041_0694717 3300049577 Bacteria 651
722 Ga0501042_0039188 3300049578 Bacteria 3366
723 Ga0501042_0042966 3300049578 Bacteria 3218
724 Ga0501042_0104521 3300049578 Bacteria 2038
725 Ga0501042_0205447 3300049578 Bacteria 1420
726 Ga0501042_0512930 3300049578 Bacteria 871
727 Ga0501042_0807046 3300049578 Bacteria 683
728 Ga0501043_0406446 3300049579 Bacteria 1028
729 Ga0501046_0000240 3300049580 Bacteria 56302
730 Ga0501046_0046249 3300049580 Bacteria 3455
731 Ga0501046_0731214 3300049580 Bacteria 696
732 Ga0501047_0076459 3300049581 Bacteria 3222
733 Ga0501047_1280446 3300049581 Bacteria 547
734 Ga0501048_0037582 3300049582 Bacteria 3477
735 Ga0501048_0140718 3300049582 Bacteria 1706
736 Ga0501048_0186064 3300049582 Bacteria 1472
737 Ga0501048_0432600 3300049582 Bacteria 942
738 Ga0501048_0523030 3300049582 Bacteria 851
739 Ga0501067_0071530 3300049583 Bacteria 1921
740 Ga0501067_0283137 3300049583 Bacteria 923
741 Ga0501068_0054654 3300049584 Bacteria 2419
742 Ga0501068_0198496 3300049584 Bacteria 1272
743 Ga0501068_0256039 3300049584 Bacteria 1116
744 Ga0501068_0336008 3300049584 Bacteria 970
745 Ga0501068_0688180 3300049584 Bacteria 668
746 Ga0501068_0723670 3300049584 Bacteria 651
747 Ga0501068_1129423 3300049584 Bacteria 518
748 Ga0501070_0869376 3300049586 Bacteria 705
749 Ga0501071_0030461 3300049587 Bacteria 3817
750 Ga0501071_0031512 3300049587 Bacteria 3759
751 Ga0501071_0065147 3300049587 Bacteria 2645
752 Ga0501071_0189012 3300049587 Bacteria 1544
753 Ga0501071_0239223 3300049587 Bacteria 1369
754 Ga0501071_0246197 3300049587 Bacteria 1349
755 Ga0501071_0333749 3300049587 Bacteria 1152
756 Ga0501072_0007527 3300049588 Bacteria 8265
757 Ga0501072_0035907 3300049588 Bacteria 3884
758 Ga0501072_0139172 3300049588 Bacteria 1935
759 Ga0501072_0278407 3300049588 Bacteria 1331
760 Ga0501072_0401356 3300049588 Bacteria 1087
761 Ga0501072_0495651 3300049588 Bacteria 966
762 Ga0501073_0116445 3300049589 Bacteria 1852
763 Ga0501073_0131364 3300049589 Bacteria 1736
764 Ga0501073_0704591 3300049589 Bacteria 696
765 Ga0501074_0059181 3300049590 Bacteria 2761
766 Ga0501074_0215780 3300049590 Bacteria 1366
767 Ga0501074_0578085 3300049590 Bacteria 795
768 Ga0501074_0872746 3300049590 Bacteria 633
769 Ga0501074_0916673 3300049590 Bacteria 617
770 Ga0501075_0000012 3300049591 Bacteria 81271
771 Ga0501075_0011227 3300049591 Bacteria 6335
772 Ga0501075_0047705 3300049591 Bacteria 3218
773 Ga0501075_0060858 3300049591 Bacteria 2844
774 Ga0501075_0115352 3300049591 Bacteria 2042
775 Ga0501075_0133558 3300049591 Bacteria 1891
776 Ga0501075_0242714 3300049591 Bacteria 1373
777 Ga0501075_0272937 3300049591 Bacteria 1289
778 Ga0501075_0323388 3300049591 Bacteria 1175
779 Ga0501075_0487059 3300049591 Bacteria 941
780 Ga0501075_0603314 3300049591 Bacteria 837
781 Ga0501075_0670335 3300049591 Bacteria 790
782 Ga0501076_0000017 3300049592 Bacteria 94144
783 Ga0501076_0006954 3300049592 Bacteria 8223
784 Ga0501076_0036530 3300049592 Bacteria 3850
785 Ga0501076_0067773 3300049592 Bacteria 2850
786 Ga0501076_0121955 3300049592 Bacteria 2111
787 Ga0501076_0147370 3300049592 Bacteria 1914
788 Ga0501076_0287379 3300049592 Bacteria 1347
789 Ga0501076_0377082 3300049592 Bacteria 1166
790 Ga0501076_0601020 3300049592 Bacteria 907
791 Ga0501076_0709093 3300049592 Bacteria 830
792 Ga0501077_0058521 3300049593 Bacteria 2446
793 Ga0501077_0060344 3300049593 Bacteria 2407
794 Ga0501077_0116589 3300049593 Bacteria 1692
795 Ga0501077_0180092 3300049593 Bacteria 1343
796 Ga0501077_0196427 3300049593 Bacteria 1282
797 Ga0501077_0332972 3300049593 Bacteria 968
798 Ga0501077_0365669 3300049593 Bacteria 921
799 Ga0501077_0838831 3300049593 Bacteria 591
800 Ga0501225_0298961 3300049705 Bacteria 544
801 Ga0501079_0005994 3300049741 Bacteria 9101
802 Ga0501079_0006852 3300049741 Bacteria 8581
803 Ga0501079_0058831 3300049741 Bacteria 2965
804 Ga0501079_0078458 3300049741 Bacteria 2554
805 Ga0501079_0138649 3300049741 Bacteria 1894
806 Ga0501079_0197591 3300049741 Bacteria 1570
807 Ga0501079_0219145 3300049741 Bacteria 1486
808 Ga0501079_0963387 3300049741 Bacteria 672
809 Ga0501079_1055914 3300049741 Bacteria 640
810 Ga0501080_0066821 3300049742 Bacteria 3344
811 Ga0501080_0073623 3300049742 Bacteria 3178
812 Ga0501080_0373107 3300049742 Bacteria 1286
813 Ga0501080_0497738 3300049742 Bacteria 1089
814 Ga0501080_1755328 3300049742 Bacteria 522
815 Ga0501081_0002066 3300049743 Bacteria 12521
816 Ga0501081_0003442 3300049743 Bacteria 10097
817 Ga0501081_0013261 3300049743 Bacteria 5420
818 Ga0501081_0038292 3300049743 Bacteria 3275
819 Ga0501081_0188420 3300049743 Bacteria 1493
820 Ga0501081_0205179 3300049743 Bacteria 1430
821 Ga0501081_0265212 3300049743 Bacteria 1255
822 Ga0501081_0405481 3300049743 Bacteria 1009
823 Ga0501081_0859186 3300049743 Bacteria 683
824 Ga0501083_0031126 3300049744 Bacteria 3662
825 Ga0501083_0130108 3300049744 Bacteria 1650
826 Ga0501083_0311386 3300049744 Bacteria 1024
827 Ga0501083_0419515 3300049744 Bacteria 871
828 Ga0501035_0050571 3300049822 Bacteria 3724
829 Ga0501035_0163390 3300049822 Bacteria 1927
830 Ga0501035_1210517 3300049822 Bacteria 586
831 Ga0501044_0619678 3300049823 Bacteria 974
832 Ga0501045_0001958 3300049824 Bacteria 13907
833 Ga0501045_0029292 3300049824 Bacteria 3979
834 Ga0501045_0065298 3300049824 Bacteria 2672
835 Ga0501045_0081861 3300049824 Bacteria 2380
836 Ga0501045_0099188 3300049824 Bacteria 2155
837 Ga0501045_0107916 3300049824 Bacteria 2063
838 Ga0501045_0323108 3300049824 Bacteria 1148
839 Ga0501045_0339243 3300049824 Bacteria 1118
840 nmdc:mga0yw44_606325_c1 3300050492 Bacteria 744
841 nmdc:mga05p37_10_c2 3300050507 Bacteria 36328
842 nmdc:mga05p37_110323_c1 3300050507 Bacteria 3384
843 nmdc:mga05p37_11108_c1 3300050507 Bacteria 10702
844 nmdc:mga05p37_1150835_c1 3300050507 Bacteria 807
845 nmdc:mga05p37_1304217_c1 3300050507 Bacteria 740
846 nmdc:mga05p37_1376606_c1 3300050507 Bacteria 713
847 nmdc:mga05p37_165504_c1 3300050507 Bacteria 2699
848 nmdc:mga05p37_176241_c1 3300050507 Bacteria 2605
849 nmdc:mga05p37_215431_c2 3300050507 Bacteria 2062
850 nmdc:mga05p37_22110_c1 3300050507 Bacteria 7710
851 nmdc:mga05p37_225285_c1 3300050507 Bacteria 2261
852 nmdc:mga05p37_24187_c1 3300050507 Bacteria 7381
853 nmdc:mga05p37_3081_c1 3300050507 Bacteria 19363
854 nmdc:mga05p37_33814_c1 3300050507 Bacteria 6262
855 nmdc:mga05p37_343254_c1 3300050507 Bacteria 1760
856 nmdc:mga05p37_420359_c1 3300050507 Bacteria 1556
857 nmdc:mga05p37_473341_c1 3300050507 Bacteria 1445
858 nmdc:mga05p37_502038_c1 3300050507 Bacteria 1392
859 nmdc:mga05p37_58104_c1 3300050507 Bacteria 4764
860 nmdc:mga05p37_68726_c1 3300050507 Bacteria 4357
861 nmdc:mga05p37_72842_c1 3300050507 Bacteria 4228
862 nmdc:mga09592_124044_c1 3300050508 Bacteria 2220
863 nmdc:mga09592_139739_c1 3300050508 Bacteria 2087
864 nmdc:mga09592_24319_c1 3300050508 Bacteria 5008
865 nmdc:mga09592_298723_c1 3300050508 Bacteria 1396
866 nmdc:mga09592_64762_c1 3300050508 Bacteria 3095
867 nmdc:mga09592_679155_c1 3300050508 Bacteria 878
868 nmdc:mga09592_68297_c1 3300050508 Bacteria 3015
869 nmdc:mga09592_691_c1 3300050508 Bacteria 25783
870 nmdc:mga0qj67_20_c1 3300050509 Bacteria 109238
871 nmdc:mga0qj67_213_c1 3300050509 Bacteria 39502
872 nmdc:mga0qj67_405627_c1 3300050509 Bacteria 1100
873 nmdc:mga0qj67_4979_c1 3300050509 Bacteria 9655
874 nmdc:mga0qj67_946007_c1 3300050509 Bacteria 678
875 nmdc:mga06r32_117248_c1 3300050510 Bacteria 2624
876 nmdc:mga06r32_117406_c1 3300050510 Bacteria 2622
877 nmdc:mga06r32_124811_c1 3300050510 Bacteria 2542
878 nmdc:mga06r32_1358803_c1 3300050510 Bacteria 653
879 nmdc:mga06r32_230362_c1 3300050510 Bacteria 1841
880 nmdc:mga06r32_296559_c1 3300050510 Bacteria 1603
881 nmdc:mga06r32_386083_c1 3300050510 Bacteria 1383
882 nmdc:mga06r32_41821_c1 3300050510 Bacteria 4356
883 nmdc:mga06r32_498246_c1 3300050510 Bacteria 1195
884 nmdc:mga06r32_589473_c1 3300050510 Bacteria 1083
885 nmdc:mga06r32_974080_c1 3300050510 Bacteria 802
886 nmdc:mga08y16_100544_c1 3300050511 Bacteria 3011
887 nmdc:mga08y16_118635_c1 3300050511 Bacteria 2754
888 nmdc:mga08y16_20946_c1 3300050511 Bacteria 6903
889 nmdc:mga08y16_3030_c1 3300050511 Bacteria 17353
890 nmdc:mga08y16_39810_c1 3300050511 Bacteria 4930
891 nmdc:mga08y16_435170_c1 3300050511 Bacteria 1339
892 nmdc:mga08y16_833728_c1 3300050511 Bacteria 913
893 nmdc:mga0n895_104305_c1 3300050512 Bacteria 2848
894 nmdc:mga0n895_111044_c1 3300050512 Bacteria 2757
895 nmdc:mga0n895_163863_c1 3300050512 Bacteria 2255
896 nmdc:mga0n895_1693793_c1 3300050512 Bacteria 595
897 nmdc:mga0n895_19189_c1 3300050512 Bacteria 6349
898 nmdc:mga0n895_192746_c1 3300050512 Bacteria 2069
899 nmdc:mga0n895_210855_c1 3300050512 Bacteria 1973
900 nmdc:mga0n895_2139228_c1 3300050512 Bacteria 516
901 nmdc:mga0n895_227210_c1 3300050512 Bacteria 1895
902 nmdc:mga0n895_305864_c1 3300050512 Bacteria 1612
903 nmdc:mga0n895_450950_c1 3300050512 Bacteria 1299
904 nmdc:mga0n895_54227_c1 3300050512 Bacteria 3943
905 nmdc:mga0n895_59105_c1 3300050512 Bacteria 3783
906 nmdc:mga0n895_848231_c1 3300050512 Bacteria 902
907 nmdc:mga0rr50_122342_c1 3300050513 Bacteria 2073
908 nmdc:mga0rr50_13073_c1 3300050513 Bacteria 5390
909 nmdc:mga0rr50_136396_c1 3300050513 Bacteria 1970
910 nmdc:mga0rr50_136723_c1 3300050513 Bacteria 1968
911 nmdc:mga0rr50_183023_c1 3300050513 Bacteria 1714
912 nmdc:mga0rr50_192906_c1 3300050513 Bacteria 1671
913 nmdc:mga0rr50_234065_c1 3300050513 Bacteria 1521
914 nmdc:mga0rr50_234522_c1 3300050513 Bacteria 1519
915 nmdc:mga0rr50_24525_c1 3300050513 Bacteria 4178
916 nmdc:mga0rr50_35290_c1 3300050513 Bacteria 3590
917 nmdc:mga0rr50_670860_c1 3300050513 Bacteria 885
918 nmdc:mga0rr50_714941_c1 3300050513 Bacteria 855
919 nmdc:mga08x19_475200_c1 3300050514 Bacteria 881
920 nmdc:mga08x19_5200_c1 3300050514 Bacteria 7695
921 nmdc:mga08x19_7608_c2 3300050514 Bacteria 5574
922 nmdc:mga08x19_77092_c1 3300050514 Bacteria 2182
923 nmdc:mga0a205_107897_c1 3300050515 Bacteria 2683
924 nmdc:mga0a205_108965_c1 3300050515 Bacteria 2668
925 nmdc:mga0a205_1236124_c1 3300050515 Bacteria 595
926 nmdc:mga0a205_1419263_c1 3300050515 Bacteria 542
927 nmdc:mga0a205_155793_c1 3300050515 Bacteria 2183
928 nmdc:mga0a205_155980_c1 3300050515 Bacteria 2181
929 nmdc:mga0a205_21891_c2 3300050515 Bacteria 5708
930 nmdc:mga0a205_257705_c1 3300050515 Bacteria 1622
931 nmdc:mga0a205_280858_c1 3300050515 Bacteria 1540
932 nmdc:mga0a205_317158_c1 3300050515 Bacteria 1430
933 nmdc:mga0a205_339970_c1 3300050515 Bacteria 1370
934 nmdc:mga0a205_418275_c1 3300050515 Bacteria 1203
935 nmdc:mga0a205_434535_c1 3300050515 Bacteria 1174
936 nmdc:mga0a205_44592_c1 3300050515 Bacteria 4276
937 nmdc:mga0a205_689510_c1 3300050515 Bacteria 872
938 nmdc:mga0a205_865812_c1 3300050515 Bacteria 751
939 nmdc:mga0a205_898_c1 3300050515 Bacteria 9990
940 nmdc:mga0a205_89972_c1 3300050515 Bacteria 2966
941 nmdc:mga0a205_99806_c1 3300050515 Bacteria 2802
942 Ga0495601_0157641 3300053077 Bacteria 1483
943 Ga0495655_0077900 3300053083 Bacteria 941
944 Ga0495655_0229258 3300053083 Bacteria 618
945 Ga0501084_0001662 3300054114 Bacteria 17693
946 Ga0501084_0002436 3300054114 Bacteria 14981
947 Ga0501084_0027116 3300054114 Bacteria 4787
948 Ga0501084_0029997 3300054114 Bacteria 4549
949 Ga0501084_0078448 3300054114 Bacteria 2768
950 Ga0501084_0112610 3300054114 Bacteria 2286
951 Ga0501084_0174967 3300054114 Bacteria 1811
952 Ga0501084_0241711 3300054114 Bacteria 1524
953 Ga0501084_0469717 3300054114 Bacteria 1063
954 Ga0501084_0629801 3300054114 Bacteria 906
955 Ga0501084_0636977 3300054114 Bacteria 900
956 Ga0501084_1051042 3300054114 Bacteria 684
957 Ga0501084_1481991 3300054114 Bacteria 568
958 Ga0587073_0018764 3300059492 Bacteria 1297
959 Ga0587085_047909 3300059506 Bacteria 769
960 Ga0587094_016200 3300059513 Bacteria 1035
961 Ga0587125_037493 3300059607 Bacteria 643
962 Ga0587062_060626 3300059639 Bacteria 663
963 Ga0587069_052092 3300059642 Bacteria 731
964 Ga0587076_065070 3300059645 Bacteria 744
965 Ga0587079_017136 3300059647 Bacteria 1253
966 Ga0587119_031195 3300059658 Bacteria 729
967 Ga0587071_019649 3300060344 Bacteria 1224
968 Ga0501082_0000567 3300060353 Bacteria 32890
969 Ga0501082_0002744 3300060353 Bacteria 15383
970 Ga0501082_0063843 3300060353 Bacteria 3171
971 Ga0501082_0070395 3300060353 Bacteria 3012
972 Ga0501082_0114863 3300060353 Bacteria 2331
973 Ga0501082_0129072 3300060353 Bacteria 2193
974 Ga0501082_0232715 3300060353 Bacteria 1604
975 Ga0501082_0517397 3300060353 Bacteria 1043
976 Ga0501082_0548297 3300060353 Bacteria 1011
977 Ga0501082_1820701 3300060353 Bacteria 531
978 Ga0530510_0000004 3300061734 Bacteria 256134
979 Ga0530510_0008337 3300061734 Bacteria 7226
980 Ga0530510_0013854 3300061734 Bacteria 5678
981 Ga0530510_0029094 3300061734 Bacteria 3964
982 Ga0530510_0072726 3300061734 Bacteria 2495
983 Ga0530510_0122308 3300061734 Bacteria 1911
984 Ga0530510_0146636 3300061734 Bacteria 1741
985 Ga0530510_0985166 3300061734 Bacteria 645

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049822 Ga0501035_1210517 Ga0501035_1210517_140_574 144
2 3300049584 Ga0501068_0688180 Ga0501068_0688180_10_447 145
3 3300006852 Ga0075433_10051057 Ga0075433_100510572 146
4 3300006880 Ga0075429_100004656 Ga0075429_10000465611 146
5 3300009094 Ga0111539_10031067 Ga0111539_100310671 146
6 3300013306 Ga0163162_12202501 Ga0163162_122025011 146
7 3300027907 Ga0207428_10044235 Ga0207428_100442355 146
8 3300050507 nmdc:mga05p37_68726_c1 nmdc:mga05p37_68726_c1_2266_2742 146
9 3300050511 nmdc:mga08y16_39810_c1 nmdc:mga08y16_39810_c1_1028_1504 146
10 3300050515 nmdc:mga0a205_21891_c2 nmdc:mga0a205_21891_c2_989_1465 146
11 3300037853 Ga0436364_0919003 Ga0436364_0919003_39_497 147
12 3300039437 Ga0436365_0458953 Ga0436365_0458953_27_476 147
13 3300049573 Ga0501037_0780216 Ga0501037_0780216_173_622 149
14 3300050515 nmdc:mga0a205_1236124_c1 nmdc:mga0a205_1236124_c1_131_580 149
15 3300060353 Ga0501082_0129072 Ga0501082_0129072_1734_2183 149
16 3300042461 Ga0439460_0121931 Ga0439460_0121931_10_468 151
17 iso_pu_bacteria 2883577096 2883578823 155
18 3300025932 Ga0207690_10438317 Ga0207690_104383172 156
19 3300005334 Ga0068869_100044411 Ga0068869_1000444113 157
20 3300005336 Ga0070680_101112701 Ga0070680_1011127011 157
21 3300005338 Ga0068868_100499687 Ga0068868_1004996872 157
22 3300005338 Ga0068868_101184152 Ga0068868_1011841521 157
23 3300005345 Ga0070692_10701617 Ga0070692_107016171 157
24 3300005355 Ga0070671_101301815 Ga0070671_1013018151 157
25 3300005356 Ga0070674_100446429 Ga0070674_1004464291 157
26 3300005364 Ga0070673_100110285 Ga0070673_1001102852 157
27 3300005366 Ga0070659_100119732 Ga0070659_1001197322 157
28 3300005367 Ga0070667_100196926 Ga0070667_1001969262 157
29 3300005440 Ga0070705_100416987 Ga0070705_1004169872 157
30 3300005441 Ga0070700_100149986 Ga0070700_1001499862 157
31 3300005455 Ga0070663_100190403 Ga0070663_1001904032 157
32 3300005459 Ga0068867_100319072 Ga0068867_1003190721 157
33 3300005459 Ga0068867_100724490 Ga0068867_1007244902 157
34 3300005518 Ga0070699_101070359 Ga0070699_1010703592 157
35 3300005536 Ga0070697_100584071 Ga0070697_1005840711 157
36 3300005545 Ga0070695_100573701 Ga0070695_1005737012 157
37 3300005546 Ga0070696_100031968 Ga0070696_1000319686 157
38 3300005548 Ga0070665_101806334 Ga0070665_1018063341 157
39 3300005578 Ga0068854_100222754 Ga0068854_1002227542 157
40 3300005578 Ga0068854_101237750 Ga0068854_1012377502 157
41 3300005617 Ga0068859_100040934 Ga0068859_1000409345 157
42 3300005618 Ga0068864_101619876 Ga0068864_1016198761 157
43 3300005618 Ga0068864_101688582 Ga0068864_1016885821 157
44 3300005718 Ga0068866_10148658 Ga0068866_101486582 157
45 3300005719 Ga0068861_100850372 Ga0068861_1008503722 157
46 3300005840 Ga0068870_10253991 Ga0068870_102539912 157
47 3300005842 Ga0068858_102027672 Ga0068858_1020276721 157
48 3300005843 Ga0068860_100088058 Ga0068860_1000880582 157
49 3300005844 Ga0068862_100287626 Ga0068862_1002876262 157
50 3300006237 Ga0097621_100077672 Ga0097621_1000776722 157
51 3300006358 Ga0068871_100016719 Ga0068871_1000167192 157
52 3300006844 Ga0075428_100065646 Ga0075428_1000656462 157
53 3300006847 Ga0075431_100143192 Ga0075431_1001431924 157
54 3300006931 Ga0097620_100040939 Ga0097620_1000409392 157
55 3300009098 Ga0105245_10065829 Ga0105245_100658293 157
56 3300009098 Ga0105245_10207577 Ga0105245_102075772 157
57 3300009101 Ga0105247_10518355 Ga0105247_105183552 157
58 3300009147 Ga0114129_10028218 Ga0114129_100282182 157
59 3300009174 Ga0105241_10474399 Ga0105241_104743991 157
60 3300009176 Ga0105242_10771746 Ga0105242_107717461 157
61 3300009176 Ga0105242_11307692 Ga0105242_113076921 157
62 3300009177 Ga0105248_10029051 Ga0105248_100290515 157
63 3300009553 Ga0105249_10457710 Ga0105249_104577102 157
64 3300010375 Ga0105239_10350730 Ga0105239_103507302 157
65 3300010375 Ga0105239_10546863 Ga0105239_105468632 157
66 3300013100 Ga0157373_10415463 Ga0157373_104154632 157
67 3300013296 Ga0157374_10379589 Ga0157374_103795891 157
68 3300013297 Ga0157378_10283272 Ga0157378_102832722 157
69 3300013308 Ga0157375_10117305 Ga0157375_101173053 157
70 3300013308 Ga0157375_10602785 Ga0157375_106027852 157
71 3300014745 Ga0157377_10643039 Ga0157377_106430392 157
72 3300014969 Ga0157376_10014946 Ga0157376_100149468 157
73 3300025899 Ga0207642_10472198 Ga0207642_104721982 157
74 3300025901 Ga0207688_10208794 Ga0207688_102087942 157
75 3300025908 Ga0207643_10304997 Ga0207643_103049971 157
76 3300025917 Ga0207660_10337425 Ga0207660_103374252 157
77 3300025927 Ga0207687_10539324 Ga0207687_105393242 157
78 3300025937 Ga0207669_10580535 Ga0207669_105805352 157
79 3300025941 Ga0207711_10040996 Ga0207711_100409965 157
80 3300025942 Ga0207689_10008358 Ga0207689_100083584 157
81 3300025960 Ga0207651_10046301 Ga0207651_100463012 157
82 3300025960 Ga0207651_10930530 Ga0207651_109305302 157
83 3300025961 Ga0207712_10777186 Ga0207712_107771862 157
84 3300026089 Ga0207648_10780321 Ga0207648_107803212 157
85 3300026095 Ga0207676_11065497 Ga0207676_110654972 157
86 3300026142 Ga0207698_10730461 Ga0207698_107304612 157
87 3300028379 Ga0268266_10593184 Ga0268266_105931841 157
88 3300028379 Ga0268266_10849902 Ga0268266_108499022 157
89 3300028380 Ga0268265_10047714 Ga0268265_100477143 157
90 3300028381 Ga0268264_10085848 Ga0268264_100858482 157
91 3300042876 Ga0451577_0489708 Ga0451577_0489708_613_1086 157
92 3300045051 Ga0451576_0859957 Ga0451576_0859957_30_503 157
93 3300048911 Ga0496108_0402841 Ga0496108_0402841_593_1066 157
94 3300048917 Ga0496114_0401428 Ga0496114_0401428_481_954 157
95 3300049577 Ga0501041_0443705 Ga0501041_0443705_12_485 157
96 3300050507 nmdc:mga05p37_473341_c1 nmdc:mga05p37_473341_c1_396_869 157
97 3300050510 nmdc:mga06r32_296559_c1 nmdc:mga06r32_296559_c1_211_684 157
98 3300050510 nmdc:mga06r32_589473_c1 nmdc:mga06r32_589473_c1_92_565 157
99 3300003203 JGI25406J46586_10007285 JGI25406J46586_100072852 158
100 3300003349 JGI26129J50193_1008337 JGI26129J50193_10083371 158
101 3300003502 JGI26143J51219_1003405 JGI26143J51219_10034051 158
102 3300003503 JGI26141J51220_1000584 JGI26141J51220_10005842 158
103 3300005290 Ga0065712_10423211 Ga0065712_104232111 158
104 3300005293 Ga0065715_10296131 Ga0065715_102961312 158
105 3300005295 Ga0065707_10390724 Ga0065707_103907242 158
106 3300005295 Ga0065707_10404512 Ga0065707_104045121 158
107 3300005328 Ga0070676_10004015 Ga0070676_100040157 158
108 3300005329 Ga0070683_101408036 Ga0070683_1014080362 158
109 3300005330 Ga0070690_100209186 Ga0070690_1002091862 158
110 3300005330 Ga0070690_100209579 Ga0070690_1002095792 158
111 3300005331 Ga0070670_100004063 Ga0070670_1000040639 158
112 3300005333 Ga0070677_10272643 Ga0070677_102726432 158
113 3300005334 Ga0068869_100002574 Ga0068869_1000025748 158
114 3300005336 Ga0070680_100002172 Ga0070680_1000021727 158
115 3300005336 Ga0070680_100004422 Ga0070680_1000044222 158
116 3300005337 Ga0070682_100001008 Ga0070682_1000010089 158
117 3300005338 Ga0068868_100010262 Ga0068868_1000102629 158
118 3300005339 Ga0070660_100000640 Ga0070660_10000064018 158
119 3300005340 Ga0070689_100049933 Ga0070689_1000499332 158
120 3300005340 Ga0070689_100114015 Ga0070689_1001140152 158
121 3300005341 Ga0070691_10062672 Ga0070691_100626722 158
122 3300005343 Ga0070687_100080856 Ga0070687_1000808562 158
123 3300005343 Ga0070687_100118966 Ga0070687_1001189662 158
124 3300005343 Ga0070687_100320400 Ga0070687_1003204001 158
125 3300005344 Ga0070661_100001216 Ga0070661_10000121612 158
126 3300005345 Ga0070692_10000146 Ga0070692_1000014610 158
127 3300005345 Ga0070692_10091917 Ga0070692_100919172 158
128 3300005347 Ga0070668_100275489 Ga0070668_1002754892 158
129 3300005353 Ga0070669_100011392 Ga0070669_1000113923 158
130 3300005353 Ga0070669_100040026 Ga0070669_1000400262 158
131 3300005355 Ga0070671_100120448 Ga0070671_1001204482 158
132 3300005356 Ga0070674_100361852 Ga0070674_1003618522 158
133 3300005364 Ga0070673_100003150 Ga0070673_10000315011 158
134 3300005365 Ga0070688_100228288 Ga0070688_1002282882 158
135 3300005365 Ga0070688_100666430 Ga0070688_1006664302 158
136 3300005366 Ga0070659_100021962 Ga0070659_1000219625 158
137 3300005366 Ga0070659_100322323 Ga0070659_1003223232 158
138 3300005406 Ga0070703_10017718 Ga0070703_100177182 158
139 3300005434 Ga0070709_10223836 Ga0070709_102238362 158
140 3300005438 Ga0070701_10147423 Ga0070701_101474232 158
141 3300005439 Ga0070711_100157219 Ga0070711_1001572192 158
142 3300005440 Ga0070705_100002474 Ga0070705_1000024748 158
143 3300005440 Ga0070705_100012222 Ga0070705_1000122222 158
144 3300005440 Ga0070705_100256428 Ga0070705_1002564282 158
145 3300005440 Ga0070705_100462297 Ga0070705_1004622972 158
146 3300005440 Ga0070705_100466375 Ga0070705_1004663752 158
147 3300005440 Ga0070705_100470174 Ga0070705_1004701742 158
148 3300005440 Ga0070705_100604398 Ga0070705_1006043982 158
149 3300005444 Ga0070694_100004086 Ga0070694_1000040868 158
150 3300005444 Ga0070694_100007127 Ga0070694_1000071272 158
151 3300005444 Ga0070694_100062516 Ga0070694_1000625163 158
152 3300005444 Ga0070694_100136691 Ga0070694_1001366912 158
153 3300005444 Ga0070694_100265343 Ga0070694_1002653432 158
154 3300005445 Ga0070708_100139006 Ga0070708_1001390062 158
155 3300005445 Ga0070708_100418011 Ga0070708_1004180112 158
156 3300005445 Ga0070708_100478830 Ga0070708_1004788301 158
157 3300005445 Ga0070708_100508394 Ga0070708_1005083942 158
158 3300005455 Ga0070663_100000406 Ga0070663_1000004063 158
159 3300005457 Ga0070662_100001878 Ga0070662_1000018788 158
160 3300005457 Ga0070662_100065815 Ga0070662_1000658152 158
161 3300005457 Ga0070662_100163857 Ga0070662_1001638573 158
162 3300005458 Ga0070681_10033286 Ga0070681_100332862 158
163 3300005458 Ga0070681_10065079 Ga0070681_100650792 158
164 3300005459 Ga0068867_100011546 Ga0068867_1000115464 158
165 3300005466 Ga0070685_10141728 Ga0070685_101417282 158
166 3300005467 Ga0070706_100331783 Ga0070706_1003317832 158
167 3300005467 Ga0070706_100410113 Ga0070706_1004101132 158
168 3300005467 Ga0070706_100834617 Ga0070706_1008346172 158
169 3300005468 Ga0070707_100015488 Ga0070707_1000154884 158
170 3300005468 Ga0070707_100022930 Ga0070707_1000229309 158
171 3300005468 Ga0070707_100063778 Ga0070707_1000637785 158
172 3300005468 Ga0070707_100127300 Ga0070707_1001273002 158
173 3300005468 Ga0070707_100207126 Ga0070707_1002071262 158
174 3300005468 Ga0070707_100361810 Ga0070707_1003618102 158
175 3300005468 Ga0070707_100442938 Ga0070707_1004429382 158
176 3300005468 Ga0070707_100640623 Ga0070707_1006406232 158
177 3300005471 Ga0070698_100012020 Ga0070698_1000120206 158
178 3300005471 Ga0070698_100069460 Ga0070698_1000694604 158
179 3300005471 Ga0070698_100134844 Ga0070698_1001348442 158
180 3300005471 Ga0070698_100163951 Ga0070698_1001639512 158
181 3300005518 Ga0070699_100030129 Ga0070699_1000301294 158
182 3300005518 Ga0070699_100104327 Ga0070699_1001043272 158
183 3300005518 Ga0070699_100131231 Ga0070699_1001312313 158
184 3300005518 Ga0070699_101013109 Ga0070699_1010131091 158
185 3300005518 Ga0070699_101294756 Ga0070699_1012947562 158
186 3300005530 Ga0070679_100045451 Ga0070679_1000454512 158
187 3300005530 Ga0070679_100372990 Ga0070679_1003729902 158
188 3300005535 Ga0070684_100019531 Ga0070684_1000195317 158
189 3300005536 Ga0070697_100144825 Ga0070697_1001448253 158
190 3300005536 Ga0070697_100182414 Ga0070697_1001824141 158
191 3300005536 Ga0070697_100988538 Ga0070697_1009885382 158
192 3300005536 Ga0070697_101050416 Ga0070697_1010504162 158
193 3300005539 Ga0068853_100001025 Ga0068853_10000102510 158
194 3300005539 Ga0068853_100369474 Ga0068853_1003694742 158
195 3300005545 Ga0070695_100001024 Ga0070695_1000010246 158
196 3300005545 Ga0070695_100003752 Ga0070695_1000037523 158
197 3300005545 Ga0070695_100009964 Ga0070695_1000099643 158
198 3300005546 Ga0070696_100001263 Ga0070696_1000012638 158
199 3300005546 Ga0070696_101076766 Ga0070696_1010767662 158
200 3300005547 Ga0070693_100000283 Ga0070693_1000002835 158
201 3300005549 Ga0070704_100001095 Ga0070704_10000109511 158
202 3300005549 Ga0070704_100078534 Ga0070704_1000785342 158
203 3300005549 Ga0070704_100151316 Ga0070704_1001513162 158
204 3300005549 Ga0070704_100463494 Ga0070704_1004634942 158
205 3300005549 Ga0070704_100628815 Ga0070704_1006288152 158
206 3300005549 Ga0070704_100886333 Ga0070704_1008863332 158
207 3300005563 Ga0068855_100012218 Ga0068855_1000122187 158
208 3300005564 Ga0070664_100028474 Ga0070664_1000284746 158
209 3300005577 Ga0068857_100008128 Ga0068857_1000081286 158
210 3300005577 Ga0068857_100945263 Ga0068857_1009452631 158
211 3300005578 Ga0068854_100002085 Ga0068854_1000020853 158
212 3300005614 Ga0068856_100006402 Ga0068856_1000064026 158
213 3300005615 Ga0070702_100668533 Ga0070702_1006685331 158
214 3300005616 Ga0068852_100130378 Ga0068852_1001303782 158
215 3300005617 Ga0068859_100007763 Ga0068859_1000077639 158
216 3300005718 Ga0068866_10397631 Ga0068866_103976312 158
217 3300005719 Ga0068861_100211805 Ga0068861_1002118052 158
218 3300005840 Ga0068870_10006834 Ga0068870_100068343 158
219 3300005841 Ga0068863_100133356 Ga0068863_1001333563 158
220 3300005842 Ga0068858_100024588 Ga0068858_1000245883 158
221 3300005842 Ga0068858_100081692 Ga0068858_1000816922 158
222 3300005843 Ga0068860_100036613 Ga0068860_1000366132 158
223 3300005843 Ga0068860_100540365 Ga0068860_1005403652 158
224 3300005844 Ga0068862_100814698 Ga0068862_1008146982 158
225 3300005844 Ga0068862_101313559 Ga0068862_1013135592 158
226 3300005844 Ga0068862_101329171 Ga0068862_1013291712 158
227 3300005844 Ga0068862_101508571 Ga0068862_1015085711 158
228 3300005844 Ga0068862_101754312 Ga0068862_1017543121 158
229 3300005937 Ga0081455_10000433 Ga0081455_1000043357 158
230 3300005983 Ga0081540_1013630 Ga0081540_10136302 158
231 3300005983 Ga0081540_1020165 Ga0081540_10201652 158
232 3300005985 Ga0081539_10000271 Ga0081539_10000271104 158
233 3300005985 Ga0081539_10031960 Ga0081539_100319604 158
234 3300006058 Ga0075432_10195733 Ga0075432_101957331 158
235 3300006173 Ga0070716_100007411 Ga0070716_1000074114 158
236 3300006175 Ga0070712_100008516 Ga0070712_1000085162 158
237 3300006237 Ga0097621_100334041 Ga0097621_1003340412 158
238 3300006844 Ga0075428_100002741 Ga0075428_1000027418 158
239 3300006844 Ga0075428_100405075 Ga0075428_1004050752 158
240 3300006844 Ga0075428_101005400 Ga0075428_1010054002 158
241 3300006844 Ga0075428_101578210 Ga0075428_1015782102 158
242 3300006846 Ga0075430_100000995 Ga0075430_10000099521 158
243 3300006846 Ga0075430_100002448 Ga0075430_1000024488 158
244 3300006846 Ga0075430_100260267 Ga0075430_1002602672 158
245 3300006846 Ga0075430_100764138 Ga0075430_1007641382 158
246 3300006846 Ga0075430_101262432 Ga0075430_1012624322 158
247 3300006847 Ga0075431_100000752 Ga0075431_1000007523 158
248 3300006847 Ga0075431_100001235 Ga0075431_10000123511 158
249 3300006847 Ga0075431_100076567 Ga0075431_1000765673 158
250 3300006847 Ga0075431_100150704 Ga0075431_1001507042 158
251 3300006847 Ga0075431_100265087 Ga0075431_1002650872 158
252 3300006847 Ga0075431_100437654 Ga0075431_1004376542 158
253 3300006847 Ga0075431_100444681 Ga0075431_1004446812 158
254 3300006847 Ga0075431_100563302 Ga0075431_1005633022 158
255 3300006852 Ga0075433_10005518 Ga0075433_100055182 158
256 3300006852 Ga0075433_10010752 Ga0075433_100107524 158
257 3300006852 Ga0075433_10011103 Ga0075433_100111038 158
258 3300006852 Ga0075433_10011169 Ga0075433_100111694 158
259 3300006852 Ga0075433_10042460 Ga0075433_100424603 158
260 3300006852 Ga0075433_10088566 Ga0075433_100885665 158
261 3300006852 Ga0075433_10216863 Ga0075433_102168632 158
262 3300006852 Ga0075433_10639867 Ga0075433_106398672 158
263 3300006871 Ga0075434_100001101 Ga0075434_1000011015 158
264 3300006871 Ga0075434_100006381 Ga0075434_1000063815 158
265 3300006871 Ga0075434_100012476 Ga0075434_1000124762 158
266 3300006871 Ga0075434_100123037 Ga0075434_1001230372 158
267 3300006871 Ga0075434_100149430 Ga0075434_1001494302 158
268 3300006871 Ga0075434_100169638 Ga0075434_1001696382 158
269 3300006871 Ga0075434_100651464 Ga0075434_1006514642 158
270 3300006871 Ga0075434_100734418 Ga0075434_1007344182 158
271 3300006880 Ga0075429_100020795 Ga0075429_1000207954 158
272 3300006880 Ga0075429_100076937 Ga0075429_1000769372 158
273 3300006880 Ga0075429_100154437 Ga0075429_1001544372 158
274 3300006880 Ga0075429_100670331 Ga0075429_1006703312 158
275 3300006881 Ga0068865_100677762 Ga0068865_1006777622 158
276 3300006914 Ga0075436_100003124 Ga0075436_10000312410 158
277 3300006914 Ga0075436_100044152 Ga0075436_1000441522 158
278 3300006914 Ga0075436_100051420 Ga0075436_1000514202 158
279 3300006914 Ga0075436_100109161 Ga0075436_1001091612 158
280 3300006914 Ga0075436_100137139 Ga0075436_1001371392 158
281 3300006931 Ga0097620_100007763 Ga0097620_1000077639 158
282 3300007076 Ga0075435_100002353 Ga0075435_10000235314 158
283 3300007076 Ga0075435_100021024 Ga0075435_1000210242 158
284 3300007076 Ga0075435_100022841 Ga0075435_1000228412 158
285 3300007076 Ga0075435_100054365 Ga0075435_1000543653 158
286 3300007076 Ga0075435_100081871 Ga0075435_1000818712 158
287 3300007076 Ga0075435_100125869 Ga0075435_1001258692 158
288 3300007076 Ga0075435_100145541 Ga0075435_1001455412 158
289 3300007076 Ga0075435_100162891 Ga0075435_1001628912 158
290 3300007076 Ga0075435_100298474 Ga0075435_1002984742 158
291 3300007076 Ga0075435_100656691 Ga0075435_1006566912 158
292 3300007076 Ga0075435_100680290 Ga0075435_1006802902 158
293 3300007265 Ga0099794_10009756 Ga0099794_100097563 158
294 3300007265 Ga0099794_10025349 Ga0099794_100253492 158
295 3300007265 Ga0099794_10156857 Ga0099794_101568572 158
296 3300009094 Ga0111539_10001442 Ga0111539_1000144225 158
297 3300009094 Ga0111539_10014162 Ga0111539_1001416214 158
298 3300009094 Ga0111539_10020969 Ga0111539_100209696 158
299 3300009094 Ga0111539_10354573 Ga0111539_103545732 158
300 3300009094 Ga0111539_10389826 Ga0111539_103898262 158
301 3300009094 Ga0111539_12912666 Ga0111539_129126661 158
302 3300009098 Ga0105245_10174146 Ga0105245_101741462 158
303 3300009098 Ga0105245_10444356 Ga0105245_104443562 158
304 3300009098 Ga0105245_10931350 Ga0105245_109313502 158
305 3300009147 Ga0114129_10000643 Ga0114129_1000064333 158
306 3300009147 Ga0114129_10004885 Ga0114129_100048852 158
307 3300009147 Ga0114129_10044584 Ga0114129_100445845 158
308 3300009147 Ga0114129_10044676 Ga0114129_100446767 158
309 3300009147 Ga0114129_10046650 Ga0114129_100466502 158
310 3300009147 Ga0114129_10064689 Ga0114129_100646892 158
311 3300009147 Ga0114129_10079570 Ga0114129_100795706 158
312 3300009147 Ga0114129_10107834 Ga0114129_101078346 158
313 3300009147 Ga0114129_10285840 Ga0114129_102858402 158
314 3300009147 Ga0114129_10293245 Ga0114129_102932452 158
315 3300009147 Ga0114129_10296921 Ga0114129_102969213 158
316 3300009147 Ga0114129_10609532 Ga0114129_106095322 158
317 3300009147 Ga0114129_10673114 Ga0114129_106731142 158
318 3300009147 Ga0114129_10909256 Ga0114129_109092562 158
319 3300009148 Ga0105243_11760599 Ga0105243_117605991 158
320 3300009148 Ga0105243_11867401 Ga0105243_118674012 158
321 3300009174 Ga0105241_10001312 Ga0105241_1000131211 158
322 3300009174 Ga0105241_10037857 Ga0105241_100378572 158
323 3300009174 Ga0105241_10393859 Ga0105241_103938592 158
324 3300009177 Ga0105248_12363174 Ga0105248_123631742 158
325 3300009545 Ga0105237_10028013 Ga0105237_100280135 158
326 3300009545 Ga0105237_10225033 Ga0105237_102250332 158
327 3300009551 Ga0105238_10474362 Ga0105238_104743622 158
328 3300009553 Ga0105249_10258039 Ga0105249_102580392 158
329 3300009553 Ga0105249_10447944 Ga0105249_104479442 158
330 3300009553 Ga0105249_10678363 Ga0105249_106783632 158
331 3300009553 Ga0105249_10970744 Ga0105249_109707442 158
332 3300010375 Ga0105239_10061655 Ga0105239_100616556 158
333 3300010375 Ga0105239_10716844 Ga0105239_107168442 158
334 3300011119 Ga0105246_10088689 Ga0105246_100886892 158
335 3300011119 Ga0105246_10251782 Ga0105246_102517822 158
336 3300013100 Ga0157373_10000457 Ga0157373_1000045719 158
337 3300013297 Ga0157378_10464135 Ga0157378_104641352 158
338 3300013297 Ga0157378_10517720 Ga0157378_105177202 158
339 3300013297 Ga0157378_11134476 Ga0157378_111344761 158
340 3300013306 Ga0163162_10018030 Ga0163162_100180302 158
341 3300013306 Ga0163162_10768105 Ga0163162_107681052 158
342 3300013307 Ga0157372_10042124 Ga0157372_100421243 158
343 3300013307 Ga0157372_10152649 Ga0157372_101526492 158
344 3300013308 Ga0157375_10273143 Ga0157375_102731432 158
345 3300013308 Ga0157375_10274923 Ga0157375_102749232 158
346 3300014325 Ga0163163_10801063 Ga0163163_108010632 158
347 3300014326 Ga0157380_10683777 Ga0157380_106837772 158
348 3300014326 Ga0157380_11088881 Ga0157380_110888811 158
349 3300014745 Ga0157377_10330796 Ga0157377_103307962 158
350 3300014968 Ga0157379_10500205 Ga0157379_105002052 158
351 3300014968 Ga0157379_10560579 Ga0157379_105605792 158
352 3300014968 Ga0157379_10782585 Ga0157379_107825852 158
353 3300025885 Ga0207653_10004849 Ga0207653_100048492 158
354 3300025885 Ga0207653_10012619 Ga0207653_100126192 158
355 3300025885 Ga0207653_10110994 Ga0207653_101109942 158
356 3300025899 Ga0207642_10186907 Ga0207642_101869071 158
357 3300025901 Ga0207688_10083507 Ga0207688_100835073 158
358 3300025905 Ga0207685_10145953 Ga0207685_101459532 158
359 3300025905 Ga0207685_10511778 Ga0207685_105117781 158
360 3300025906 Ga0207699_10201774 Ga0207699_102017742 158
361 3300025907 Ga0207645_10000582 Ga0207645_100005829 158
362 3300025908 Ga0207643_10000688 Ga0207643_1000068815 158
363 3300025910 Ga0207684_10017635 Ga0207684_100176352 158
364 3300025910 Ga0207684_10031745 Ga0207684_100317453 158
365 3300025910 Ga0207684_10064137 Ga0207684_100641372 158
366 3300025910 Ga0207684_10075117 Ga0207684_100751173 158
367 3300025910 Ga0207684_10496485 Ga0207684_104964852 158
368 3300025910 Ga0207684_10770638 Ga0207684_107706382 158
369 3300025911 Ga0207654_10003437 Ga0207654_100034374 158
370 3300025911 Ga0207654_10025483 Ga0207654_100254832 158
371 3300025912 Ga0207707_10000158 Ga0207707_1000015811 158
372 3300025914 Ga0207671_10039847 Ga0207671_100398472 158
373 3300025915 Ga0207693_10008921 Ga0207693_100089217 158
374 3300025916 Ga0207663_10797557 Ga0207663_107975572 158
375 3300025917 Ga0207660_10000220 Ga0207660_1000022019 158
376 3300025917 Ga0207660_10012274 Ga0207660_100122744 158
377 3300025918 Ga0207662_10092896 Ga0207662_100928962 158
378 3300025918 Ga0207662_10105562 Ga0207662_101055622 158
379 3300025918 Ga0207662_10744800 Ga0207662_107448002 158
380 3300025919 Ga0207657_10000730 Ga0207657_1000073010 158
381 3300025920 Ga0207649_10011103 Ga0207649_100111032 158
382 3300025921 Ga0207652_10000290 Ga0207652_1000029041 158
383 3300025922 Ga0207646_10023549 Ga0207646_100235496 158
384 3300025922 Ga0207646_10086056 Ga0207646_100860564 158
385 3300025922 Ga0207646_10221487 Ga0207646_102214872 158
386 3300025922 Ga0207646_10227192 Ga0207646_102271922 158
387 3300025922 Ga0207646_10249861 Ga0207646_102498612 158
388 3300025922 Ga0207646_10275940 Ga0207646_102759402 158
389 3300025922 Ga0207646_10287084 Ga0207646_102870842 158
390 3300025922 Ga0207646_10632559 Ga0207646_106325592 158
391 3300025923 Ga0207681_10022163 Ga0207681_100221632 158
392 3300025923 Ga0207681_10292339 Ga0207681_102923391 158
393 3300025923 Ga0207681_10413117 Ga0207681_104131172 158
394 3300025923 Ga0207681_10860960 Ga0207681_108609602 158
395 3300025925 Ga0207650_10010437 Ga0207650_100104374 158
396 3300025927 Ga0207687_10829134 Ga0207687_108291342 158
397 3300025932 Ga0207690_10002732 Ga0207690_100027328 158
398 3300025933 Ga0207706_10011184 Ga0207706_100111842 158
399 3300025933 Ga0207706_10040989 Ga0207706_100409892 158
400 3300025933 Ga0207706_10093783 Ga0207706_100937832 158
401 3300025935 Ga0207709_10195812 Ga0207709_101958122 158
402 3300025935 Ga0207709_10215555 Ga0207709_102155552 158
403 3300025935 Ga0207709_10961166 Ga0207709_109611662 158
404 3300025936 Ga0207670_10030455 Ga0207670_100304553 158
405 3300025937 Ga0207669_10180140 Ga0207669_101801402 158
406 3300025937 Ga0207669_10365446 Ga0207669_103654462 158
407 3300025938 Ga0207704_10531971 Ga0207704_105319712 158
408 3300025939 Ga0207665_10002961 Ga0207665_100029619 158
409 3300025940 Ga0207691_10363241 Ga0207691_103632412 158
410 3300025941 Ga0207711_10061135 Ga0207711_100611353 158
411 3300025942 Ga0207689_10000846 Ga0207689_100008468 158
412 3300025944 Ga0207661_11225132 Ga0207661_112251321 158
413 3300025945 Ga0207679_10000820 Ga0207679_100008205 158
414 3300025949 Ga0207667_10001638 Ga0207667_1000163820 158
415 3300025960 Ga0207651_10017986 Ga0207651_100179864 158
416 3300025961 Ga0207712_11053682 Ga0207712_110536822 158
417 3300025972 Ga0207668_10012836 Ga0207668_100128362 158
418 3300025981 Ga0207640_10010928 Ga0207640_100109283 158
419 3300025981 Ga0207640_11484337 Ga0207640_114843371 158
420 3300026023 Ga0207677_10039511 Ga0207677_100395113 158
421 3300026035 Ga0207703_10061345 Ga0207703_100613452 158
422 3300026041 Ga0207639_10003030 Ga0207639_100030304 158
423 3300026041 Ga0207639_10310778 Ga0207639_103107782 158
424 3300026067 Ga0207678_10003638 Ga0207678_100036386 158
425 3300026067 Ga0207678_11331627 Ga0207678_113316271 158
426 3300026075 Ga0207708_10126776 Ga0207708_101267762 158
427 3300026075 Ga0207708_10375408 Ga0207708_103754082 158
428 3300026078 Ga0207702_10003448 Ga0207702_100034489 158
429 3300026078 Ga0207702_10618655 Ga0207702_106186552 158
430 3300026088 Ga0207641_10187238 Ga0207641_101872382 158
431 3300026089 Ga0207648_10034307 Ga0207648_100343074 158
432 3300026116 Ga0207674_10002312 Ga0207674_1000231218 158
433 3300026116 Ga0207674_10416585 Ga0207674_104165852 158
434 3300026118 Ga0207675_100230392 Ga0207675_1002303922 158
435 3300026121 Ga0207683_10917339 Ga0207683_109173392 158
436 3300026142 Ga0207698_10081246 Ga0207698_100812462 158
437 3300027360 Ga0209969_1003036 Ga0209969_10030362 158
438 3300027378 Ga0209981_1005574 Ga0209981_10055742 158
439 3300027395 Ga0209996_1002868 Ga0209996_10028682 158
440 3300027424 Ga0209984_1006985 Ga0209984_10069852 158
441 3300027462 Ga0210000_1046215 Ga0210000_10462152 158
442 3300027471 Ga0209995_1017552 Ga0209995_10175522 158
443 3300027526 Ga0209968_1004685 Ga0209968_10046852 158
444 3300027543 Ga0209999_1000646 Ga0209999_10006463 158
445 3300027614 Ga0209970_1000762 Ga0209970_10007623 158
446 3300027614 Ga0209970_1017391 Ga0209970_10173912 158
447 3300027614 Ga0209970_1026887 Ga0209970_10268872 158
448 3300027665 Ga0209983_1000526 Ga0209983_10005267 158
449 3300027671 Ga0209588_1008703 Ga0209588_10087032 158
450 3300027682 Ga0209971_1000058 Ga0209971_100005834 158
451 3300027682 Ga0209971_1013323 Ga0209971_10133232 158
452 3300027682 Ga0209971_1020168 Ga0209971_10201682 158
453 3300027695 Ga0209966_1000021 Ga0209966_100002135 158
454 3300027717 Ga0209998_10000002 Ga0209998_1000000285 158
455 3300027876 Ga0209974_10004247 Ga0209974_100042472 158
456 3300027876 Ga0209974_10165271 Ga0209974_101652712 158
457 3300027907 Ga0207428_10000069 Ga0207428_10000069135 158
458 3300027907 Ga0207428_10001914 Ga0207428_100019148 158
459 3300027907 Ga0207428_10130402 Ga0207428_101304023 158
460 3300027907 Ga0207428_10499329 Ga0207428_104993292 158
461 3300028380 Ga0268265_11235155 Ga0268265_112351552 158
462 3300028381 Ga0268264_10019088 Ga0268264_100190883 158
463 3300028381 Ga0268264_11762337 Ga0268264_117623371 158
464 3300031548 Ga0307408_100023294 Ga0307408_1000232945 158
465 3300031548 Ga0307408_100418767 Ga0307408_1004187672 158
466 3300031711 Ga0265314_10126304 Ga0265314_101263041 158
467 3300031731 Ga0307405_11020370 Ga0307405_110203702 158
468 3300031995 Ga0307409_100478148 Ga0307409_1004781482 158
469 3300032002 Ga0307416_100248585 Ga0307416_1002485852 158
470 3300032004 Ga0307414_11072669 Ga0307414_110726692 158
471 3300032005 Ga0307411_10131601 Ga0307411_101316012 158
472 3300034817 Ga0373948_0007232 Ga0373948_0007232_1074_1550 158
473 3300034819 Ga0373958_0068265 Ga0373958_0068265_77_553 158
474 3300034820 Ga0373959_0003425 Ga0373959_0003425_1939_2415 158
475 3300035083 Ga0373926_0020266 Ga0373926_0020266_1717_2196 158
476 3300035088 Ga0373940_0010600 Ga0373940_0010600_1440_1916 158
477 3300035088 Ga0373940_0079348 Ga0373940_0079348_174_650 158
478 3300035088 Ga0373940_0140518 Ga0373940_0140518_37_513 158
479 3300035090 Ga0373949_0009104 Ga0373949_0009104_331_807 158
480 3300035091 Ga0373951_0002550 Ga0373951_0002550_2648_3124 158
481 3300035092 Ga0373952_0037294 Ga0373952_0037294_13_489 158
482 3300035114 Ga0373939_0019448 Ga0373939_0019448_329_805 158
483 3300035114 Ga0373939_0156130 Ga0373939_0156130_206_682 158
484 3300035114 Ga0373939_0188697 Ga0373939_0188697_41_517 158
485 3300035115 Ga0373941_0011362 Ga0373941_0011362_376_852 158
486 3300035120 Ga0373957_0390159 Ga0373957_0390159_90_566 158
487 3300035242 Ga0373962_0028333 Ga0373962_0028333_134_610 158
488 3300035242 Ga0373962_0190887 Ga0373962_0190887_86_562 158
489 3300035410 Ga0373924_0300643 Ga0373924_0300643_156_632 158
490 3300035410 Ga0373924_0351443 Ga0373924_0351443_24_500 158
491 3300035691 Ga0373931_0019802 Ga0373931_0019802_2384_2860 158
492 3300035691 Ga0373931_0033320 Ga0373931_0033320_2061_2537 158
493 3300035691 Ga0373931_0114603 Ga0373931_0114603_519_995 158
494 3300035691 Ga0373931_0688463 Ga0373931_0688463_89_565 158
495 3300035695 Ga0373927_0004542 Ga0373927_0004542_8437_8916 158
496 3300035695 Ga0373927_0255030 Ga0373927_0255030_285_761 158
497 3300035725 Ga0373947_0096152 Ga0373947_0096152_495_974 158
498 3300036401 Ga0373937_0114911 Ga0373937_0114911_1602_2078 158
499 3300037068 Ga0373925_0068087 Ga0373925_0068087_1290_1769 158
500 3300037418 Ga0395900_0147762 Ga0395900_0147762_1504_1980 158
501 3300042005 Ga0439448_0002193 Ga0439448_0002193_1710_2186 158
502 3300042005 Ga0439448_0005223 Ga0439448_0005223_139_615 158
503 3300042012 Ga0439455_0006291 Ga0439455_0006291_772_1248 158
504 3300042016 Ga0439463_020316 Ga0439463_020316_712_1188 158
505 3300042144 Ga0450889_002862 Ga0450889_002862_667_1143 158
506 3300042157 Ga0439458_0000918 Ga0439458_0000918_2391_2867 158
507 3300042438 Ga0439459_0001028 Ga0439459_0001028_2792_3268 158
508 3300042461 Ga0439460_0001936 Ga0439460_0001936_3913_4389 158
509 3300042461 Ga0439460_0131809 Ga0439460_0131809_205_681 158
510 3300042876 Ga0451577_0036946 Ga0451577_0036946_367_843 158
511 3300042876 Ga0451577_0046597 Ga0451577_0046597_1041_1517 158
512 3300042876 Ga0451577_0107464 Ga0451577_0107464_331_807 158
513 3300042876 Ga0451577_0435454 Ga0451577_0435454_188_664 158
514 3300042876 Ga0451577_0760987 Ga0451577_0760987_225_701 158
515 3300042876 Ga0451577_1516345 Ga0451577_1516345_26_508 158
516 3300044673 Ga0453683_0470850 Ga0453683_0470850_37_513 158
517 3300044673 Ga0453683_0980389 Ga0453683_0980389_70_546 158
518 3300044712 Ga0453684_0096548 Ga0453684_0096548_1086_1562 158
519 3300044712 Ga0453684_1671749 Ga0453684_1671749_136_612 158
520 3300045051 Ga0451576_0022688 Ga0451576_0022688_2604_3080 158
521 3300045051 Ga0451576_0030647 Ga0451576_0030647_4579_5055 158
522 3300045051 Ga0451576_0161675 Ga0451576_0161675_439_915 158
523 3300045051 Ga0451576_0356019 Ga0451576_0356019_914_1390 158
524 3300046455 Ga0495603_0226791 Ga0495603_0226791_52_528 158
525 3300046472 Ga0495580_0008477 Ga0495580_0008477_5881_6357 158
526 3300046472 Ga0495580_0079742 Ga0495580_0079742_204_680 158
527 3300046473 Ga0495582_0056050 Ga0495582_0056050_1202_1681 158
528 3300046491 Ga0495584_0290461 Ga0495584_0290461_113_589 158
529 3300046499 Ga0495594_0239045 Ga0495594_0239045_337_813 158
530 3300046499 Ga0495594_0371188 Ga0495594_0371188_133_612 158
531 3300046528 Ga0495642_0051230 Ga0495642_0051230_685_1161 158
532 3300046528 Ga0495642_0074530 Ga0495642_0074530_375_851 158
533 3300046531 Ga0495665_0233727 Ga0495665_0233727_204_683 158
534 3300046537 Ga0495598_0288491 Ga0495598_0288491_48_524 158
535 3300046660 Ga0495625_0449338 Ga0495625_0449338_139_618 158
536 3300046664 Ga0495659_0166090 Ga0495659_0166090_83_559 158
537 3300046683 Ga0495658_0082401 Ga0495658_0082401_285_764 158
538 3300046684 Ga0495669_0082176 Ga0495669_0082176_481_957 158
539 3300046684 Ga0495669_0149190 Ga0495669_0149190_121_597 158
540 3300046684 Ga0495669_0225583 Ga0495669_0225583_225_701 158
541 3300046684 Ga0495669_0399898 Ga0495669_0399898_18_494 158
542 3300046689 Ga0495613_0218140 Ga0495613_0218140_577_1053 158
543 3300047315 Ga0495581_0046596 Ga0495581_0046596_1877_2356 158
544 3300047318 Ga0495636_0050381 Ga0495636_0050381_275_751 158
545 3300047319 Ga0495674_0730644 Ga0495674_0730644_38_514 158
546 3300048905 Ga0496102_0010932 Ga0496102_0010932_2442_2918 158
547 3300048905 Ga0496102_0066067 Ga0496102_0066067_2317_2793 158
548 3300048905 Ga0496102_0253381 Ga0496102_0253381_246_722 158
549 3300048906 Ga0496103_0028264 Ga0496103_0028264_619_1095 158
550 3300048906 Ga0496103_0554031 Ga0496103_0554031_76_552 158
551 3300048907 Ga0496104_0842980 Ga0496104_0842980_329_805 158
552 3300048909 Ga0496106_0244983 Ga0496106_0244983_695_1171 158
553 3300048909 Ga0496106_0971645 Ga0496106_0971645_151_627 158
554 3300048910 Ga0496107_0081233 Ga0496107_0081233_1453_1929 158
555 3300048911 Ga0496108_0147203 Ga0496108_0147203_1312_1788 158
556 3300048911 Ga0496108_0613880 Ga0496108_0613880_376_852 158
557 3300048912 Ga0496109_0126929 Ga0496109_0126929_1663_2139 158
558 3300048913 Ga0496110_0273285 Ga0496110_0273285_996_1472 158
559 3300048913 Ga0496110_0923881 Ga0496110_0923881_68_544 158
560 3300048915 Ga0496112_0021044 Ga0496112_0021044_1163_1639 158
561 3300048916 Ga0496113_0186441 Ga0496113_0186441_983_1459 158
562 3300049568 Ga0501031_0193378 Ga0501031_0193378_492_968 158
563 3300049568 Ga0501031_0427335 Ga0501031_0427335_59_535 158
564 3300049569 Ga0501032_0961727 Ga0501032_0961727_12_488 158
565 3300049570 Ga0501033_0055942 Ga0501033_0055942_11_487 158
566 3300049570 Ga0501033_0093909 Ga0501033_0093909_672_1148 158
567 3300049570 Ga0501033_0359677 Ga0501033_0359677_363_839 158
568 3300049570 Ga0501033_0391053 Ga0501033_0391053_360_836 158
569 3300049570 Ga0501033_0445711 Ga0501033_0445711_37_513 158
570 3300049570 Ga0501033_0652577 Ga0501033_0652577_108_584 158
571 3300049572 Ga0501036_0005109 Ga0501036_0005109_6390_6866 158
572 3300049572 Ga0501036_0185009 Ga0501036_0185009_437_913 158
573 3300049572 Ga0501036_0277380 Ga0501036_0277380_685_1161 158
574 3300049572 Ga0501036_0426056 Ga0501036_0426056_71_547 158
575 3300049572 Ga0501036_0617865 Ga0501036_0617865_409_885 158
576 3300049573 Ga0501037_0211703 Ga0501037_0211703_328_804 158
577 3300049573 Ga0501037_0370828 Ga0501037_0370828_343_819 158
578 3300049574 Ga0501038_0048428 Ga0501038_0048428_2671_3147 158
579 3300049574 Ga0501038_0141276 Ga0501038_0141276_1071_1547 158
580 3300049574 Ga0501038_0419050 Ga0501038_0419050_23_499 158
581 3300049574 Ga0501038_0946666 Ga0501038_0946666_90_566 158
582 3300049575 Ga0501039_0032051 Ga0501039_0032051_1304_1780 158
583 3300049575 Ga0501039_0032798 Ga0501039_0032798_1223_1699 158
584 3300049575 Ga0501039_0038255 Ga0501039_0038255_3100_3576 158
585 3300049575 Ga0501039_0039920 Ga0501039_0039920_689_1165 158
586 3300049576 Ga0501040_0009563 Ga0501040_0009563_2303_2779 158
587 3300049576 Ga0501040_0014292 Ga0501040_0014292_636_1112 158
588 3300049576 Ga0501040_0021542 Ga0501040_0021542_3694_4170 158
589 3300049576 Ga0501040_0060684 Ga0501040_0060684_871_1347 158
590 3300049576 Ga0501040_0186798 Ga0501040_0186798_789_1265 158
591 3300049576 Ga0501040_0360763 Ga0501040_0360763_172_648 158
592 3300049577 Ga0501041_0027686 Ga0501041_0027686_441_917 158
593 3300049577 Ga0501041_0033417 Ga0501041_0033417_1632_2108 158
594 3300049577 Ga0501041_0064102 Ga0501041_0064102_1232_1708 158
595 3300049577 Ga0501041_0206413 Ga0501041_0206413_300_779 158
596 3300049577 Ga0501041_0300587 Ga0501041_0300587_116_592 158
597 3300049578 Ga0501042_0039188 Ga0501042_0039188_2810_3286 158
598 3300049578 Ga0501042_0042966 Ga0501042_0042966_2193_2669 158
599 3300049578 Ga0501042_0205447 Ga0501042_0205447_576_1052 158
600 3300049578 Ga0501042_0512930 Ga0501042_0512930_280_756 158
601 3300049578 Ga0501042_0807046 Ga0501042_0807046_22_498 158
602 3300049579 Ga0501043_0406446 Ga0501043_0406446_167_643 158
603 3300049580 Ga0501046_0000240 Ga0501046_0000240_13670_14146 158
604 3300049580 Ga0501046_0731214 Ga0501046_0731214_44_520 158
605 3300049581 Ga0501047_0076459 Ga0501047_0076459_342_818 158
606 3300049582 Ga0501048_0140718 Ga0501048_0140718_248_724 158
607 3300049582 Ga0501048_0186064 Ga0501048_0186064_319_795 158
608 3300049583 Ga0501067_0071530 Ga0501067_0071530_120_596 158
609 3300049583 Ga0501067_0283137 Ga0501067_0283137_392_868 158
610 3300049584 Ga0501068_0198496 Ga0501068_0198496_50_526 158
611 3300049584 Ga0501068_0256039 Ga0501068_0256039_278_754 158
612 3300049584 Ga0501068_1129423 Ga0501068_1129423_25_501 158
613 3300049587 Ga0501071_0030461 Ga0501071_0030461_628_1104 158
614 3300049587 Ga0501071_0031512 Ga0501071_0031512_1395_1871 158
615 3300049587 Ga0501071_0065147 Ga0501071_0065147_1263_1739 158
616 3300049587 Ga0501071_0239223 Ga0501071_0239223_400_876 158
617 3300049587 Ga0501071_0246197 Ga0501071_0246197_409_885 158
618 3300049587 Ga0501071_0333749 Ga0501071_0333749_460_936 158
619 3300049588 Ga0501072_0007527 Ga0501072_0007527_3130_3606 158
620 3300049588 Ga0501072_0035907 Ga0501072_0035907_2230_2706 158
621 3300049588 Ga0501072_0139172 Ga0501072_0139172_96_572 158
622 3300049588 Ga0501072_0278407 Ga0501072_0278407_173_649 158
623 3300049588 Ga0501072_0401356 Ga0501072_0401356_33_509 158
624 3300049588 Ga0501072_0495651 Ga0501072_0495651_405_881 158
625 3300049589 Ga0501073_0131364 Ga0501073_0131364_410_886 158
626 3300049589 Ga0501073_0704591 Ga0501073_0704591_53_529 158
627 3300049590 Ga0501074_0059181 Ga0501074_0059181_352_828 158
628 3300049590 Ga0501074_0215780 Ga0501074_0215780_433_909 158
629 3300049590 Ga0501074_0578085 Ga0501074_0578085_300_776 158
630 3300049590 Ga0501074_0872746 Ga0501074_0872746_11_487 158
631 3300049590 Ga0501074_0916673 Ga0501074_0916673_125_601 158
632 3300049591 Ga0501075_0000012 Ga0501075_0000012_58524_59000 158
633 3300049591 Ga0501075_0011227 Ga0501075_0011227_4935_5411 158
634 3300049591 Ga0501075_0047705 Ga0501075_0047705_2085_2561 158
635 3300049591 Ga0501075_0115352 Ga0501075_0115352_1485_1961 158
636 3300049591 Ga0501075_0242714 Ga0501075_0242714_244_720 158
637 3300049591 Ga0501075_0487059 Ga0501075_0487059_430_906 158
638 3300049591 Ga0501075_0603314 Ga0501075_0603314_238_714 158
639 3300049591 Ga0501075_0670335 Ga0501075_0670335_148_624 158
640 3300049592 Ga0501076_0000017 Ga0501076_0000017_35945_36421 158
641 3300049592 Ga0501076_0006954 Ga0501076_0006954_7402_7878 158
642 3300049592 Ga0501076_0036530 Ga0501076_0036530_3236_3712 158
643 3300049592 Ga0501076_0067773 Ga0501076_0067773_1415_1891 158
644 3300049592 Ga0501076_0121955 Ga0501076_0121955_569_1045 158
645 3300049592 Ga0501076_0147370 Ga0501076_0147370_468_944 158
646 3300049592 Ga0501076_0287379 Ga0501076_0287379_480_956 158
647 3300049592 Ga0501076_0377082 Ga0501076_0377082_497_973 158
648 3300049592 Ga0501076_0601020 Ga0501076_0601020_47_523 158
649 3300049592 Ga0501076_0709093 Ga0501076_0709093_97_573 158
650 3300049593 Ga0501077_0060344 Ga0501077_0060344_1360_1836 158
651 3300049593 Ga0501077_0116589 Ga0501077_0116589_909_1385 158
652 3300049593 Ga0501077_0180092 Ga0501077_0180092_755_1231 158
653 3300049593 Ga0501077_0332972 Ga0501077_0332972_17_493 158
654 3300049593 Ga0501077_0365669 Ga0501077_0365669_404_880 158
655 3300049593 Ga0501077_0838831 Ga0501077_0838831_94_570 158
656 3300049705 Ga0501225_0298961 Ga0501225_0298961_47_523 158
657 3300049741 Ga0501079_0005994 Ga0501079_0005994_8088_8564 158
658 3300049741 Ga0501079_0006852 Ga0501079_0006852_3199_3675 158
659 3300049741 Ga0501079_0078458 Ga0501079_0078458_1911_2387 158
660 3300049741 Ga0501079_0138649 Ga0501079_0138649_520_996 158
661 3300049741 Ga0501079_0197591 Ga0501079_0197591_131_607 158
662 3300049741 Ga0501079_0219145 Ga0501079_0219145_981_1457 158
663 3300049741 Ga0501079_0963387 Ga0501079_0963387_74_550 158
664 3300049741 Ga0501079_1055914 Ga0501079_1055914_131_607 158
665 3300049742 Ga0501080_0073623 Ga0501080_0073623_1683_2159 158
666 3300049742 Ga0501080_0373107 Ga0501080_0373107_780_1256 158
667 3300049742 Ga0501080_0497738 Ga0501080_0497738_142_618 158
668 3300049742 Ga0501080_1755328 Ga0501080_1755328_13_489 158
669 3300049743 Ga0501081_0002066 Ga0501081_0002066_6962_7438 158
670 3300049743 Ga0501081_0013261 Ga0501081_0013261_4612_5088 158
671 3300049743 Ga0501081_0038292 Ga0501081_0038292_1872_2348 158
672 3300049743 Ga0501081_0188420 Ga0501081_0188420_306_782 158
673 3300049743 Ga0501081_0205179 Ga0501081_0205179_758_1234 158
674 3300049743 Ga0501081_0265212 Ga0501081_0265212_392_868 158
675 3300049743 Ga0501081_0405481 Ga0501081_0405481_379_855 158
676 3300049743 Ga0501081_0859186 Ga0501081_0859186_61_537 158
677 3300049744 Ga0501083_0031126 Ga0501083_0031126_1040_1516 158
678 3300049744 Ga0501083_0130108 Ga0501083_0130108_141_617 158
679 3300049744 Ga0501083_0311386 Ga0501083_0311386_444_920 158
680 3300049744 Ga0501083_0419515 Ga0501083_0419515_243_719 158
681 3300049822 Ga0501035_0050571 Ga0501035_0050571_2911_3387 158
682 3300049822 Ga0501035_0163390 Ga0501035_0163390_630_1112 158
683 3300049823 Ga0501044_0619678 Ga0501044_0619678_488_964 158
684 3300049824 Ga0501045_0001958 Ga0501045_0001958_13312_13788 158
685 3300049824 Ga0501045_0029292 Ga0501045_0029292_627_1103 158
686 3300049824 Ga0501045_0065298 Ga0501045_0065298_594_1070 158
687 3300049824 Ga0501045_0099188 Ga0501045_0099188_598_1074 158
688 3300049824 Ga0501045_0107916 Ga0501045_0107916_335_811 158
689 3300049824 Ga0501045_0323108 Ga0501045_0323108_406_882 158
690 3300049824 Ga0501045_0339243 Ga0501045_0339243_97_573 158
691 3300050492 nmdc:mga0yw44_606325_c1 nmdc:mga0yw44_606325_c1_81_560 158
692 3300050507 nmdc:mga05p37_10_c2 nmdc:mga05p37_10_c2_24589_25065 158
693 3300050507 nmdc:mga05p37_110323_c1 nmdc:mga05p37_110323_c1_2353_2829 158
694 3300050507 nmdc:mga05p37_11108_c1 nmdc:mga05p37_11108_c1_5888_6364 158
695 3300050507 nmdc:mga05p37_1150835_c1 nmdc:mga05p37_1150835_c1_131_607 158
696 3300050507 nmdc:mga05p37_1304217_c1 nmdc:mga05p37_1304217_c1_131_607 158
697 3300050507 nmdc:mga05p37_215431_c2 nmdc:mga05p37_215431_c2_918_1394 158
698 3300050507 nmdc:mga05p37_22110_c1 nmdc:mga05p37_22110_c1_6309_6785 158
699 3300050507 nmdc:mga05p37_225285_c1 nmdc:mga05p37_225285_c1_1669_2145 158
700 3300050507 nmdc:mga05p37_24187_c1 nmdc:mga05p37_24187_c1_2985_3461 158
701 3300050507 nmdc:mga05p37_3081_c1 nmdc:mga05p37_3081_c1_2979_3455 158
702 3300050507 nmdc:mga05p37_343254_c1 nmdc:mga05p37_343254_c1_64_540 158
703 3300050507 nmdc:mga05p37_420359_c1 nmdc:mga05p37_420359_c1_756_1232 158
704 3300050507 nmdc:mga05p37_502038_c1 nmdc:mga05p37_502038_c1_535_1011 158
705 3300050507 nmdc:mga05p37_58104_c1 nmdc:mga05p37_58104_c1_4232_4708 158
706 3300050508 nmdc:mga09592_124044_c1 nmdc:mga09592_124044_c1_1219_1695 158
707 3300050508 nmdc:mga09592_139739_c1 nmdc:mga09592_139739_c1_1126_1602 158
708 3300050508 nmdc:mga09592_24319_c1 nmdc:mga09592_24319_c1_4441_4917 158
709 3300050508 nmdc:mga09592_298723_c1 nmdc:mga09592_298723_c1_815_1291 158
710 3300050508 nmdc:mga09592_64762_c1 nmdc:mga09592_64762_c1_1124_1600 158
711 3300050508 nmdc:mga09592_68297_c1 nmdc:mga09592_68297_c1_725_1201 158
712 3300050509 nmdc:mga0qj67_20_c1 nmdc:mga0qj67_20_c1_22181_22660 158
713 3300050509 nmdc:mga0qj67_405627_c1 nmdc:mga0qj67_405627_c1_490_966 158
714 3300050509 nmdc:mga0qj67_4979_c1 nmdc:mga0qj67_4979_c1_3654_4130 158
715 3300050509 nmdc:mga0qj67_946007_c1 nmdc:mga0qj67_946007_c1_108_584 158
716 3300050510 nmdc:mga06r32_117248_c1 nmdc:mga06r32_117248_c1_279_755 158
717 3300050510 nmdc:mga06r32_117406_c1 nmdc:mga06r32_117406_c1_967_1443 158
718 3300050510 nmdc:mga06r32_124811_c1 nmdc:mga06r32_124811_c1_662_1138 158
719 3300050510 nmdc:mga06r32_1358803_c1 nmdc:mga06r32_1358803_c1_15_491 158
720 3300050510 nmdc:mga06r32_386083_c1 nmdc:mga06r32_386083_c1_891_1367 158
721 3300050510 nmdc:mga06r32_41821_c1 nmdc:mga06r32_41821_c1_3567_4043 158
722 3300050510 nmdc:mga06r32_498246_c1 nmdc:mga06r32_498246_c1_352_828 158
723 3300050510 nmdc:mga06r32_974080_c1 nmdc:mga06r32_974080_c1_38_514 158
724 3300050511 nmdc:mga08y16_118635_c1 nmdc:mga08y16_118635_c1_322_798 158
725 3300050511 nmdc:mga08y16_20946_c1 nmdc:mga08y16_20946_c1_3962_4438 158
726 3300050511 nmdc:mga08y16_3030_c1 nmdc:mga08y16_3030_c1_11733_12209 158
727 3300050511 nmdc:mga08y16_435170_c1 nmdc:mga08y16_435170_c1_250_726 158
728 3300050511 nmdc:mga08y16_833728_c1 nmdc:mga08y16_833728_c1_116_592 158
729 3300050512 nmdc:mga0n895_104305_c1 nmdc:mga0n895_104305_c1_522_998 158
730 3300050512 nmdc:mga0n895_1693793_c1 nmdc:mga0n895_1693793_c1_71_547 158
731 3300050512 nmdc:mga0n895_19189_c1 nmdc:mga0n895_19189_c1_3848_4324 158
732 3300050512 nmdc:mga0n895_210855_c1 nmdc:mga0n895_210855_c1_263_739 158
733 3300050512 nmdc:mga0n895_2139228_c1 nmdc:mga0n895_2139228_c1_28_504 158
734 3300050512 nmdc:mga0n895_227210_c1 nmdc:mga0n895_227210_c1_601_1077 158
735 3300050512 nmdc:mga0n895_305864_c1 nmdc:mga0n895_305864_c1_344_820 158
736 3300050512 nmdc:mga0n895_450950_c1 nmdc:mga0n895_450950_c1_211_687 158
737 3300050512 nmdc:mga0n895_59105_c1 nmdc:mga0n895_59105_c1_2114_2590 158
738 3300050512 nmdc:mga0n895_848231_c1 nmdc:mga0n895_848231_c1_192_668 158
739 3300050513 nmdc:mga0rr50_13073_c1 nmdc:mga0rr50_13073_c1_676_1152 158
740 3300050513 nmdc:mga0rr50_136396_c1 nmdc:mga0rr50_136396_c1_171_647 158
741 3300050513 nmdc:mga0rr50_136723_c1 nmdc:mga0rr50_136723_c1_436_912 158
742 3300050513 nmdc:mga0rr50_183023_c1 nmdc:mga0rr50_183023_c1_638_1114 158
743 3300050513 nmdc:mga0rr50_192906_c1 nmdc:mga0rr50_192906_c1_522_998 158
744 3300050513 nmdc:mga0rr50_234065_c1 nmdc:mga0rr50_234065_c1_27_503 158
745 3300050513 nmdc:mga0rr50_234522_c1 nmdc:mga0rr50_234522_c1_722_1198 158
746 3300050513 nmdc:mga0rr50_24525_c1 nmdc:mga0rr50_24525_c1_1539_2015 158
747 3300050513 nmdc:mga0rr50_35290_c1 nmdc:mga0rr50_35290_c1_269_745 158
748 3300050513 nmdc:mga0rr50_670860_c1 nmdc:mga0rr50_670860_c1_243_719 158
749 3300050513 nmdc:mga0rr50_714941_c1 nmdc:mga0rr50_714941_c1_191_667 158
750 3300050514 nmdc:mga08x19_475200_c1 nmdc:mga08x19_475200_c1_281_757 158
751 3300050514 nmdc:mga08x19_5200_c1 nmdc:mga08x19_5200_c1_6698_7174 158
752 3300050514 nmdc:mga08x19_7608_c2 nmdc:mga08x19_7608_c2_3012_3488 158
753 3300050514 nmdc:mga08x19_77092_c1 nmdc:mga08x19_77092_c1_598_1074 158
754 3300050515 nmdc:mga0a205_107897_c1 nmdc:mga0a205_107897_c1_2087_2563 158
755 3300050515 nmdc:mga0a205_108965_c1 nmdc:mga0a205_108965_c1_2065_2541 158
756 3300050515 nmdc:mga0a205_1419263_c1 nmdc:mga0a205_1419263_c1_45_521 158
757 3300050515 nmdc:mga0a205_257705_c1 nmdc:mga0a205_257705_c1_794_1270 158
758 3300050515 nmdc:mga0a205_280858_c1 nmdc:mga0a205_280858_c1_750_1226 158
759 3300050515 nmdc:mga0a205_339970_c1 nmdc:mga0a205_339970_c1_603_1079 158
760 3300050515 nmdc:mga0a205_418275_c1 nmdc:mga0a205_418275_c1_29_505 158
761 3300050515 nmdc:mga0a205_44592_c1 nmdc:mga0a205_44592_c1_1108_1584 158
762 3300050515 nmdc:mga0a205_689510_c1 nmdc:mga0a205_689510_c1_244_720 158
763 3300050515 nmdc:mga0a205_898_c1 nmdc:mga0a205_898_c1_7494_7970 158
764 3300050515 nmdc:mga0a205_89972_c1 nmdc:mga0a205_89972_c1_201_677 158
765 3300050515 nmdc:mga0a205_99806_c1 nmdc:mga0a205_99806_c1_2118_2594 158
766 3300053083 Ga0495655_0077900 Ga0495655_0077900_55_534 158
767 3300053083 Ga0495655_0229258 Ga0495655_0229258_130_606 158
768 3300054114 Ga0501084_0001662 Ga0501084_0001662_14208_14684 158
769 3300054114 Ga0501084_0002436 Ga0501084_0002436_1348_1824 158
770 3300054114 Ga0501084_0027116 Ga0501084_0027116_3225_3701 158
771 3300054114 Ga0501084_0029997 Ga0501084_0029997_920_1396 158
772 3300054114 Ga0501084_0112610 Ga0501084_0112610_31_507 158
773 3300054114 Ga0501084_0241711 Ga0501084_0241711_116_592 158
774 3300054114 Ga0501084_0629801 Ga0501084_0629801_336_812 158
775 3300054114 Ga0501084_0636977 Ga0501084_0636977_344_820 158
776 3300054114 Ga0501084_1051042 Ga0501084_1051042_59_535 158
777 3300054114 Ga0501084_1481991 Ga0501084_1481991_48_524 158
778 3300060353 Ga0501082_0000567 Ga0501082_0000567_392_868 158
779 3300060353 Ga0501082_0002744 Ga0501082_0002744_7383_7859 158
780 3300060353 Ga0501082_0070395 Ga0501082_0070395_14_490 158
781 3300060353 Ga0501082_0114863 Ga0501082_0114863_195_671 158
782 3300060353 Ga0501082_0517397 Ga0501082_0517397_175_651 158
783 3300060353 Ga0501082_0548297 Ga0501082_0548297_487_963 158
784 3300061734 Ga0530510_0000004 Ga0530510_0000004_115652_116128 158
785 3300061734 Ga0530510_0008337 Ga0530510_0008337_3778_4254 158
786 3300061734 Ga0530510_0013854 Ga0530510_0013854_4525_5001 158
787 3300061734 Ga0530510_0072726 Ga0530510_0072726_481_957 158
788 3300061734 Ga0530510_0122308 Ga0530510_0122308_1338_1814 158
789 3300061734 Ga0530510_0146636 Ga0530510_0146636_543_1019 158
790 3300061734 Ga0530510_0985166 Ga0530510_0985166_152_628 158
791 3300005340 Ga0070689_101315779 Ga0070689_1013157791 159
792 3300005434 Ga0070709_10017798 Ga0070709_100177983 159
793 3300005440 Ga0070705_100261927 Ga0070705_1002619272 159
794 3300005458 Ga0070681_10318356 Ga0070681_103183561 159
795 3300005467 Ga0070706_100200412 Ga0070706_1002004122 159
796 3300005471 Ga0070698_100183878 Ga0070698_1001838782 159
797 3300005545 Ga0070695_100086829 Ga0070695_1000868292 159
798 3300005546 Ga0070696_100101177 Ga0070696_1001011772 159
799 3300005548 Ga0070665_100721117 Ga0070665_1007211172 159
800 3300005549 Ga0070704_100222115 Ga0070704_1002221152 159
801 3300005617 Ga0068859_101868518 Ga0068859_1018685181 159
802 3300005843 Ga0068860_101272601 Ga0068860_1012726012 159
803 3300006358 Ga0068871_100893510 Ga0068871_1008935102 159
804 3300006871 Ga0075434_100220229 Ga0075434_1002202292 159
805 3300006871 Ga0075434_100227961 Ga0075434_1002279612 159
806 3300006931 Ga0097620_101869201 Ga0097620_1018692012 159
807 3300009094 Ga0111539_10044400 Ga0111539_100444002 159
808 3300009147 Ga0114129_10798473 Ga0114129_107984732 159
809 3300009147 Ga0114129_11742557 Ga0114129_117425572 159
810 3300009176 Ga0105242_10138777 Ga0105242_101387772 159
811 3300009551 Ga0105238_10069382 Ga0105238_100693823 159
812 3300013105 Ga0157369_10217059 Ga0157369_102170592 159
813 3300013297 Ga0157378_11982502 Ga0157378_119825022 159
814 3300014325 Ga0163163_10506302 Ga0163163_105063022 159
815 3300025905 Ga0207685_10105949 Ga0207685_101059492 159
816 3300025910 Ga0207684_10013814 Ga0207684_100138146 159
817 3300025912 Ga0207707_10535647 Ga0207707_105356472 159
818 3300025915 Ga0207693_10400419 Ga0207693_104004192 159
819 3300025924 Ga0207694_10044685 Ga0207694_100446853 159
820 3300025934 Ga0207686_10159058 Ga0207686_101590582 159
821 3300026041 Ga0207639_10305816 Ga0207639_103058161 159
822 3300026142 Ga0207698_11662362 Ga0207698_116623621 159
823 3300028379 Ga0268266_11003625 Ga0268266_110036252 159
824 3300031239 Ga0265328_10057182 Ga0265328_100571822 159
825 3300031240 Ga0265320_10361190 Ga0265320_103611901 159
826 3300031241 Ga0265325_10069363 Ga0265325_100693632 159
827 3300031249 Ga0265339_10019242 Ga0265339_100192423 159
828 3300031250 Ga0265331_10001750 Ga0265331_100017509 159
829 3300031595 Ga0265313_10000827 Ga0265313_1000082726 159
830 3300031712 Ga0265342_10023073 Ga0265342_100230733 159
831 3300035088 Ga0373940_0119209 Ga0373940_0119209_67_552 159
832 3300035113 Ga0373936_0245159 Ga0373936_0245159_81_560 159
833 3300035116 Ga0373945_0084629 Ga0373945_0084629_690_1169 159
834 3300035725 Ga0373947_0670133 Ga0373947_0670133_41_520 159
835 3300036401 Ga0373937_0412708 Ga0373937_0412708_702_1181 159
836 3300037068 Ga0373925_0179456 Ga0373925_0179456_372_851 159
837 3300042438 Ga0439459_0146234 Ga0439459_0146234_84_566 159
838 3300046491 Ga0495584_0258842 Ga0495584_0258842_150_635 159
839 3300046683 Ga0495658_0336575 Ga0495658_0336575_207_686 159
840 3300048903 Ga0496100_0401498 Ga0496100_0401498_151_636 159
841 3300048904 Ga0496101_1111565 Ga0496101_1111565_58_543 159
842 3300048909 Ga0496106_0424802 Ga0496106_0424802_517_999 159
843 3300049575 Ga0501039_0963490 Ga0501039_0963490_172_651 159
844 3300050507 nmdc:mga05p37_1376606_c1 nmdc:mga05p37_1376606_c1_53_538 159
845 3300050507 nmdc:mga05p37_165504_c1 nmdc:mga05p37_165504_c1_697_1182 159
846 3300050511 nmdc:mga08y16_100544_c1 nmdc:mga08y16_100544_c1_1715_2200 159
847 3300050512 nmdc:mga0n895_163863_c1 nmdc:mga0n895_163863_c1_947_1432 159
848 3300050512 nmdc:mga0n895_54227_c1 nmdc:mga0n895_54227_c1_3097_3582 159
849 3300050513 nmdc:mga0rr50_122342_c1 nmdc:mga0rr50_122342_c1_1410_1895 159
850 3300050515 nmdc:mga0a205_865812_c1 nmdc:mga0a205_865812_c1_212_697 159
851 3300005344 Ga0070661_100951606 Ga0070661_1009516061 160
852 3300005445 Ga0070708_100059696 Ga0070708_1000596964 160
853 3300005468 Ga0070707_100062823 Ga0070707_1000628234 160
854 3300005471 Ga0070698_100009575 Ga0070698_1000095752 160
855 3300005518 Ga0070699_100027897 Ga0070699_1000278974 160
856 3300005549 Ga0070704_100099673 Ga0070704_1000996732 160
857 3300006175 Ga0070712_100367805 Ga0070712_1003678052 160
858 3300006844 Ga0075428_100261471 Ga0075428_1002614713 160
859 3300006846 Ga0075430_100006077 Ga0075430_10000607710 160
860 3300006847 Ga0075431_100006036 Ga0075431_10000603612 160
861 3300006847 Ga0075431_100046375 Ga0075431_1000463753 160
862 3300006852 Ga0075433_10481153 Ga0075433_104811532 160
863 3300006852 Ga0075433_10592320 Ga0075433_105923202 160
864 3300006871 Ga0075434_100244650 Ga0075434_1002446502 160
865 3300006871 Ga0075434_100275006 Ga0075434_1002750062 160
866 3300006880 Ga0075429_100000231 Ga0075429_1000002317 160
867 3300006914 Ga0075436_100019659 Ga0075436_1000196595 160
868 3300007076 Ga0075435_100593860 Ga0075435_1005938602 160
869 3300009094 Ga0111539_11845588 Ga0111539_118455881 160
870 3300009147 Ga0114129_10045389 Ga0114129_100453892 160
871 3300009147 Ga0114129_10108103 Ga0114129_101081034 160
872 3300025906 Ga0207699_10699993 Ga0207699_106999931 160
873 3300025910 Ga0207684_10009460 Ga0207684_1000946010 160
874 3300025915 Ga0207693_10440230 Ga0207693_104402302 160
875 3300025916 Ga0207663_10490803 Ga0207663_104908032 160
876 3300025922 Ga0207646_10003701 Ga0207646_1000370112 160
877 3300025928 Ga0207700_10101633 Ga0207700_101016332 160
878 3300025929 Ga0207664_10179129 Ga0207664_101791292 160
879 3300031595 Ga0265313_10185659 Ga0265313_101856592 160
880 3300037312 Ga0395899_0153428 Ga0395899_0153428_1023_1508 160
881 3300037418 Ga0395900_0006737 Ga0395900_0006737_4822_5307 160
882 3300037466 Ga0395898_0010133 Ga0395898_0010133_9333_9818 160
883 3300038443 Ga0395901_0006192 Ga0395901_0006192_11610_12095 160
884 3300041411 Ga0439466_0048642 Ga0439466_0048642_626_1108 160
885 3300049161 Ga0501305_085992 Ga0501305_085992_24_527 160
886 3300049572 Ga0501036_0071970 Ga0501036_0071970_1386_1868 160
887 3300049574 Ga0501038_0105155 Ga0501038_0105155_899_1381 160
888 3300049577 Ga0501041_0024142 Ga0501041_0024142_1729_2211 160
889 3300049577 Ga0501041_0694717 Ga0501041_0694717_133_618 160
890 3300049578 Ga0501042_0104521 Ga0501042_0104521_115_600 160
891 3300049580 Ga0501046_0046249 Ga0501046_0046249_2014_2496 160
892 3300049582 Ga0501048_0037582 Ga0501048_0037582_981_1463 160
893 3300049582 Ga0501048_0432600 Ga0501048_0432600_69_554 160
894 3300049582 Ga0501048_0523030 Ga0501048_0523030_320_805 160
895 3300049584 Ga0501068_0054654 Ga0501068_0054654_525_1007 160
896 3300049584 Ga0501068_0336008 Ga0501068_0336008_174_659 160
897 3300049584 Ga0501068_0723670 Ga0501068_0723670_34_519 160
898 3300049587 Ga0501071_0189012 Ga0501071_0189012_12_494 160
899 3300049589 Ga0501073_0116445 Ga0501073_0116445_1135_1617 160
900 3300049591 Ga0501075_0060858 Ga0501075_0060858_1079_1561 160
901 3300049591 Ga0501075_0133558 Ga0501075_0133558_1082_1567 160
902 3300049591 Ga0501075_0272937 Ga0501075_0272937_52_537 160
903 3300049591 Ga0501075_0323388 Ga0501075_0323388_379_864 160
904 3300049593 Ga0501077_0058521 Ga0501077_0058521_381_863 160
905 3300049593 Ga0501077_0196427 Ga0501077_0196427_514_999 160
906 3300049741 Ga0501079_0058831 Ga0501079_0058831_1547_2029 160
907 3300049742 Ga0501080_0066821 Ga0501080_0066821_1393_1875 160
908 3300049743 Ga0501081_0003442 Ga0501081_0003442_1533_2015 160
909 3300049824 Ga0501045_0081861 Ga0501045_0081861_309_791 160
910 3300050507 nmdc:mga05p37_176241_c1 nmdc:mga05p37_176241_c1_894_1379 160
911 3300050507 nmdc:mga05p37_33814_c1 nmdc:mga05p37_33814_c1_673_1158 160
912 3300050507 nmdc:mga05p37_72842_c1 nmdc:mga05p37_72842_c1_3571_4056 160
913 3300050508 nmdc:mga09592_679155_c1 nmdc:mga09592_679155_c1_201_695 160
914 3300050508 nmdc:mga09592_691_c1 nmdc:mga09592_691_c1_6341_6826 160
915 3300050509 nmdc:mga0qj67_213_c1 nmdc:mga0qj67_213_c1_30043_30528 160
916 3300050510 nmdc:mga06r32_230362_c1 nmdc:mga06r32_230362_c1_389_874 160
917 3300050512 nmdc:mga0n895_192746_c1 nmdc:mga0n895_192746_c1_515_1000 160
918 3300050515 nmdc:mga0a205_317158_c1 nmdc:mga0a205_317158_c1_32_517 160
919 3300050515 nmdc:mga0a205_434535_c1 nmdc:mga0a205_434535_c1_289_774 160
920 3300054114 Ga0501084_0078448 Ga0501084_0078448_119_604 160
921 3300054114 Ga0501084_0174967 Ga0501084_0174967_395_877 160
922 3300054114 Ga0501084_0469717 Ga0501084_0469717_541_1026 160
923 3300060353 Ga0501082_0063843 Ga0501082_0063843_972_1454 160
924 3300060353 Ga0501082_0232715 Ga0501082_0232715_396_881 160
925 3300060353 Ga0501082_1820701 Ga0501082_1820701_21_503 160
926 3300061734 Ga0530510_0029094 Ga0530510_0029094_1415_1897 160
927 3300003163 Ga0006759J45824_1047994 Ga0006759J45824_10479941 161
928 3300003308 Ga0006777J48905_1043548 Ga0006777J48905_10435482 161
929 3300003574 Ga0007410J51695_1025380 Ga0007410J51695_10253801 161
930 3300003579 Ga0007429J51699_1036292 Ga0007429J51699_10362922 161
931 3300004803 Ga0058862_12435877 Ga0058862_124358772 161
932 3300005339 Ga0070660_100275412 Ga0070660_1002754121 161
933 3300005345 Ga0070692_10376336 Ga0070692_103763362 161
934 3300005355 Ga0070671_100518997 Ga0070671_1005189971 161
935 3300005530 Ga0070679_100344590 Ga0070679_1003445901 161
936 3300005535 Ga0070684_100242059 Ga0070684_1002420592 161
937 3300005547 Ga0070693_100878737 Ga0070693_1008787371 161
938 3300005549 Ga0070704_100046832 Ga0070704_1000468322 161
939 3300005564 Ga0070664_100436268 Ga0070664_1004362682 161
940 3300005578 Ga0068854_100284689 Ga0068854_1002846892 161
941 3300005614 Ga0068856_101116104 Ga0068856_1011161041 161
942 3300005615 Ga0070702_100248406 Ga0070702_1002484062 161
943 3300006847 Ga0075431_101294668 Ga0075431_1012946682 161
944 3300006852 Ga0075433_10308921 Ga0075433_103089212 161
945 3300009093 Ga0105240_10217423 Ga0105240_102174232 161
946 3300009147 Ga0114129_10177825 Ga0114129_101778252 161
947 3300014325 Ga0163163_10440381 Ga0163163_104403812 161
948 3300020070 Ga0206356_11296602 Ga0206356_112966021 161
949 3300020078 Ga0206352_10551387 Ga0206352_105513871 161
950 3300020078 Ga0206352_10961566 Ga0206352_109615662 161
951 3300020080 Ga0206350_10918364 Ga0206350_109183641 161
952 3300021358 Ga0213873_10031999 Ga0213873_100319992 161
953 3300021377 Ga0213874_10116250 Ga0213874_101162502 161
954 3300021384 Ga0213876_10073124 Ga0213876_100731242 161
955 3300021388 Ga0213875_10027992 Ga0213875_100279923 161
956 3300022467 Ga0224712_10276785 Ga0224712_102767852 161
957 3300025913 Ga0207695_10308224 Ga0207695_103082242 161
958 3300025921 Ga0207652_10108409 Ga0207652_101084094 161
959 3300025945 Ga0207679_10607726 Ga0207679_106077262 161
960 3300031241 Ga0265325_10021553 Ga0265325_100215531 161
961 3300038443 Ga0395901_0520337 Ga0395901_0520337_458_943 161
962 3300039437 Ga0436365_0527275 Ga0436365_0527275_731_1216 161
963 3300039438 Ga0436360_0096378 Ga0436360_0096378_1608_2093 161
964 3300039450 Ga0436363_0015138 Ga0436363_0015138_161_646 161
965 3300039453 Ga0436362_1242246 Ga0436362_1242246_427_912 161
966 3300048904 Ga0496101_0254165 Ga0496101_0254165_470_958 161
967 3300048905 Ga0496102_0497306 Ga0496102_0497306_471_959 161
968 3300048909 Ga0496106_0136730 Ga0496106_0136730_1409_1897 161
969 3300048911 Ga0496108_0456019 Ga0496108_0456019_337_825 161
970 3300048915 Ga0496112_0062304 Ga0496112_0062304_1683_2171 161
971 3300049581 Ga0501047_1280446 Ga0501047_1280446_25_510 161
972 3300049586 Ga0501070_0869376 Ga0501070_0869376_109_594 161
973 3300050512 nmdc:mga0n895_111044_c1 nmdc:mga0n895_111044_c1_2087_2575 161
974 3300050515 nmdc:mga0a205_155793_c1 nmdc:mga0a205_155793_c1_205_693 161
975 3300050515 nmdc:mga0a205_155980_c1 nmdc:mga0a205_155980_c1_945_1433 161
976 3300053077 Ga0495601_0157641 Ga0495601_0157641_151_636 161
977 3300059492 Ga0587073_0018764 Ga0587073_0018764_572_1057 161
978 3300059506 Ga0587085_047909 Ga0587085_047909_105_590 161
979 3300059513 Ga0587094_016200 Ga0587094_016200_356_841 161
980 3300059607 Ga0587125_037493 Ga0587125_037493_128_625 161
981 3300059639 Ga0587062_060626 Ga0587062_060626_39_542 161
982 3300059642 Ga0587069_052092 Ga0587069_052092_234_719 161
983 3300059645 Ga0587076_065070 Ga0587076_065070_56_553 161
984 3300059647 Ga0587079_017136 Ga0587079_017136_194_679 161
985 3300059658 Ga0587119_031195 Ga0587119_031195_188_691 161
986 3300060344 Ga0587071_019649 Ga0587071_019649_178_663 161

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

64

137

0.95

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

8

89

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9288 3 157
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9285 2 156
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9274 3 156
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.9217 3 155
3hrd-assembly1.cif.gz_H crystal structure of nicotinate dehydrogenase 0.9193 1 156
ID Description Score Start End Superfamily
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9458 81 155 1.10.150.120
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9419 81 155 1.10.150.120
1ffuD02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9394 81 155 1.10.150.120
1n60A02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.939 81 157 1.10.150.120
3hrdH02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9382 80 156 1.10.150.120
ID Description Score Start End GO Terms
AF-A0A177QCX2-F1-model_v4 Ferredoxin 0.946 1 155 GO:0016491
GO:0046872
GO:0051537
AF-A0A3E0P8F5-F1-model_v4 (2Fe-2S)-binding protein 0.9457 2 160 GO:0016491
GO:0046872
GO:0051537
AF-A0A1F6C3A9-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 0.9455 2 160 GO:0016491
GO:0046872
GO:0051537
AF-A0A2S8FBI0-F1-model_v4 Ferredoxin 0.9445 2 161 GO:0016491
GO:0046872
GO:0051537
AF-A0A523P1N6-F1-model_v4 (2Fe-2S)-binding protein 0.9441 1 157 GO:0016491
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
89.5 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map