F487519
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 986 | 349 | 985 | 158 |
Family's Representative Sequence
| Representative Sequence | 3300006852|Ga0075433_10051057|Ga0075433_100510572 |
| Length | 146 |
| Sequence | MAKHHVEATVNGDAVEFLCETEETLLDVLRDTLNLTGSKEGCASGDCGACSVTLDGRLVCSCETIEGLAKGESLHPLQKKFLEHAALQCGICTPGFLVASKALLEKNPNPTDTEIRYWLAGNLCRCTGYDKIVTAVKDAAVTLRKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 2 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 6 | 3300003502 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM | Metagenome | Rhizosphere |
| 7 | 3300003503 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM | Metagenome | Rhizosphere |
| 8 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 81 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 82 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 97 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 128 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 129 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 130 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 131 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 205 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 209 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 210 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 211 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 212 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 213 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 214 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 215 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 217 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 218 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 219 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 220 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 221 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 222 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 223 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 224 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 225 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 226 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 230 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 231 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 232 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 233 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 234 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 235 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 236 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 237 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 238 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 239 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 240 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 243 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 244 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 245 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 246 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 247 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 248 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 249 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 250 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 251 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 252 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 253 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 254 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 255 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 256 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 257 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 258 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 259 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 260 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 261 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 262 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 263 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 282 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 283 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 284 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 285 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 286 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 289 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 290 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 291 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 292 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 318 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 326 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.77 |
| Metatranscriptomes | 2.13 |
| Isolates | 0.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.1 |
| Nodule | 0 |
| Rhizoplane | 2.64 |
| Rhizosphere | 96.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0006759J45824_1047994 | 3300003163 | Bacteria | 517 |
| 2 | JGI25406J46586_10007285 | 3300003203 | Bacteria | 5059 |
| 3 | Ga0006777J48905_1043548 | 3300003308 | Bacteria | 733 |
| 4 | JGI26129J50193_1008337 | 3300003349 | Bacteria | 752 |
| 5 | JGI26143J51219_1003405 | 3300003502 | Bacteria | 734 |
| 6 | JGI26141J51220_1000584 | 3300003503 | Bacteria | 2057 |
| 7 | Ga0007410J51695_1025380 | 3300003574 | Bacteria | 558 |
| 8 | Ga0007429J51699_1036292 | 3300003579 | Bacteria | 897 |
| 9 | Ga0058862_12435877 | 3300004803 | Bacteria | 1039 |
| 10 | Ga0065712_10423211 | 3300005290 | Bacteria | 710 |
| 11 | Ga0065715_10296131 | 3300005293 | Bacteria | 1052 |
| 12 | Ga0065707_10390724 | 3300005295 | Bacteria | 865 |
| 13 | Ga0065707_10404512 | 3300005295 | Bacteria | 845 |
| 14 | Ga0070676_10004015 | 3300005328 | Bacteria | 7723 |
| 15 | Ga0070683_101408036 | 3300005329 | Bacteria | 670 |
| 16 | Ga0070690_100209186 | 3300005330 | Bacteria | 1361 |
| 17 | Ga0070690_100209579 | 3300005330 | Bacteria | 1360 |
| 18 | Ga0070670_100004063 | 3300005331 | Bacteria | 12227 |
| 19 | Ga0070677_10272643 | 3300005333 | Bacteria | 849 |
| 20 | Ga0068869_100002574 | 3300005334 | Bacteria | 10950 |
| 21 | Ga0068869_100044411 | 3300005334 | Bacteria | 3195 |
| 22 | Ga0070680_100002172 | 3300005336 | Bacteria | 14454 |
| 23 | Ga0070680_100004422 | 3300005336 | Bacteria | 10580 |
| 24 | Ga0070680_101112701 | 3300005336 | Bacteria | 683 |
| 25 | Ga0070682_100001008 | 3300005337 | Bacteria | 16310 |
| 26 | Ga0068868_100010262 | 3300005338 | Bacteria | 6772 |
| 27 | Ga0068868_100499687 | 3300005338 | Bacteria | 1065 |
| 28 | Ga0068868_101184152 | 3300005338 | Bacteria | 706 |
| 29 | Ga0070660_100000640 | 3300005339 | Bacteria | 23213 |
| 30 | Ga0070660_100275412 | 3300005339 | Bacteria | 1376 |
| 31 | Ga0070689_100049933 | 3300005340 | Bacteria | 3230 |
| 32 | Ga0070689_100114015 | 3300005340 | Bacteria | 2153 |
| 33 | Ga0070689_101315779 | 3300005340 | Bacteria | 651 |
| 34 | Ga0070691_10062672 | 3300005341 | Bacteria | 1791 |
| 35 | Ga0070687_100080856 | 3300005343 | Bacteria | 1773 |
| 36 | Ga0070687_100118966 | 3300005343 | Bacteria | 1508 |
| 37 | Ga0070687_100320400 | 3300005343 | Bacteria | 990 |
| 38 | Ga0070661_100001216 | 3300005344 | Bacteria | 18158 |
| 39 | Ga0070661_100951606 | 3300005344 | Bacteria | 711 |
| 40 | Ga0070692_10000146 | 3300005345 | Bacteria | 17288 |
| 41 | Ga0070692_10091917 | 3300005345 | Bacteria | 1651 |
| 42 | Ga0070692_10376336 | 3300005345 | Bacteria | 890 |
| 43 | Ga0070692_10701617 | 3300005345 | Bacteria | 681 |
| 44 | Ga0070668_100275489 | 3300005347 | Bacteria | 1404 |
| 45 | Ga0070669_100011392 | 3300005353 | Bacteria | 6313 |
| 46 | Ga0070669_100040026 | 3300005353 | Bacteria | 3406 |
| 47 | Ga0070671_100120448 | 3300005355 | Bacteria | 2208 |
| 48 | Ga0070671_100518997 | 3300005355 | Bacteria | 1026 |
| 49 | Ga0070671_101301815 | 3300005355 | Bacteria | 641 |
| 50 | Ga0070674_100361852 | 3300005356 | Bacteria | 1175 |
| 51 | Ga0070674_100446429 | 3300005356 | Bacteria | 1067 |
| 52 | Ga0070673_100003150 | 3300005364 | Bacteria | 10222 |
| 53 | Ga0070673_100110285 | 3300005364 | Bacteria | 2281 |
| 54 | Ga0070688_100228288 | 3300005365 | Bacteria | 1316 |
| 55 | Ga0070688_100666430 | 3300005365 | Bacteria | 803 |
| 56 | Ga0070659_100021962 | 3300005366 | Bacteria | 4869 |
| 57 | Ga0070659_100119732 | 3300005366 | Bacteria | 2131 |
| 58 | Ga0070659_100322323 | 3300005366 | Bacteria | 1292 |
| 59 | Ga0070667_100196926 | 3300005367 | Bacteria | 1786 |
| 60 | Ga0070703_10017718 | 3300005406 | Bacteria | 2053 |
| 61 | Ga0070709_10017798 | 3300005434 | Bacteria | 4083 |
| 62 | Ga0070709_10223836 | 3300005434 | Bacteria | 1343 |
| 63 | Ga0070701_10147423 | 3300005438 | Bacteria | 1352 |
| 64 | Ga0070711_100157219 | 3300005439 | Bacteria | 1720 |
| 65 | Ga0070705_100002474 | 3300005440 | Bacteria | 9285 |
| 66 | Ga0070705_100012222 | 3300005440 | Bacteria | 4359 |
| 67 | Ga0070705_100256428 | 3300005440 | Bacteria | 1231 |
| 68 | Ga0070705_100261927 | 3300005440 | Bacteria | 1220 |
| 69 | Ga0070705_100416987 | 3300005440 | Bacteria | 998 |
| 70 | Ga0070705_100462297 | 3300005440 | Bacteria | 955 |
| 71 | Ga0070705_100466375 | 3300005440 | Bacteria | 951 |
| 72 | Ga0070705_100470174 | 3300005440 | Bacteria | 948 |
| 73 | Ga0070705_100604398 | 3300005440 | Bacteria | 849 |
| 74 | Ga0070700_100149986 | 3300005441 | Bacteria | 1594 |
| 75 | Ga0070694_100004086 | 3300005444 | Bacteria | 8758 |
| 76 | Ga0070694_100007127 | 3300005444 | Bacteria | 6807 |
| 77 | Ga0070694_100062516 | 3300005444 | Bacteria | 2544 |
| 78 | Ga0070694_100136691 | 3300005444 | Bacteria | 1777 |
| 79 | Ga0070694_100265343 | 3300005444 | Bacteria | 1304 |
| 80 | Ga0070708_100059696 | 3300005445 | Bacteria | 3401 |
| 81 | Ga0070708_100139006 | 3300005445 | Bacteria | 2251 |
| 82 | Ga0070708_100418011 | 3300005445 | Bacteria | 1264 |
| 83 | Ga0070708_100478830 | 3300005445 | Bacteria | 1174 |
| 84 | Ga0070708_100508394 | 3300005445 | Bacteria | 1136 |
| 85 | Ga0070663_100000406 | 3300005455 | Bacteria | 22595 |
| 86 | Ga0070663_100190403 | 3300005455 | Bacteria | 1596 |
| 87 | Ga0070662_100001878 | 3300005457 | Bacteria | 12872 |
| 88 | Ga0070662_100065815 | 3300005457 | Bacteria | 2658 |
| 89 | Ga0070662_100163857 | 3300005457 | Bacteria | 1741 |
| 90 | Ga0070681_10033286 | 3300005458 | Bacteria | 5174 |
| 91 | Ga0070681_10065079 | 3300005458 | Bacteria | 3615 |
| 92 | Ga0070681_10318356 | 3300005458 | Bacteria | 1465 |
| 93 | Ga0068867_100011546 | 3300005459 | Bacteria | 6235 |
| 94 | Ga0068867_100319072 | 3300005459 | Bacteria | 1287 |
| 95 | Ga0068867_100724490 | 3300005459 | Bacteria | 880 |
| 96 | Ga0070685_10141728 | 3300005466 | Bacteria | 1514 |
| 97 | Ga0070706_100200412 | 3300005467 | Bacteria | 1864 |
| 98 | Ga0070706_100331783 | 3300005467 | Bacteria | 1418 |
| 99 | Ga0070706_100410113 | 3300005467 | Bacteria | 1261 |
| 100 | Ga0070706_100834617 | 3300005467 | Bacteria | 852 |
| 101 | Ga0070707_100015488 | 3300005468 | Bacteria | 7155 |
| 102 | Ga0070707_100022930 | 3300005468 | Bacteria | 5903 |
| 103 | Ga0070707_100062823 | 3300005468 | Bacteria | 3563 |
| 104 | Ga0070707_100063778 | 3300005468 | Bacteria | 3536 |
| 105 | Ga0070707_100127300 | 3300005468 | Bacteria | 2475 |
| 106 | Ga0070707_100207126 | 3300005468 | Bacteria | 1911 |
| 107 | Ga0070707_100361810 | 3300005468 | Bacteria | 1409 |
| 108 | Ga0070707_100442938 | 3300005468 | Bacteria | 1259 |
| 109 | Ga0070707_100640623 | 3300005468 | Bacteria | 1025 |
| 110 | Ga0070698_100009575 | 3300005471 | Bacteria | 10367 |
| 111 | Ga0070698_100012020 | 3300005471 | Bacteria | 9178 |
| 112 | Ga0070698_100069460 | 3300005471 | Bacteria | 3536 |
| 113 | Ga0070698_100134844 | 3300005471 | Bacteria | 2423 |
| 114 | Ga0070698_100163951 | 3300005471 | Bacteria | 2165 |
| 115 | Ga0070698_100183878 | 3300005471 | Bacteria | 2028 |
| 116 | Ga0070699_100027897 | 3300005518 | Bacteria | 4870 |
| 117 | Ga0070699_100030129 | 3300005518 | Bacteria | 4682 |
| 118 | Ga0070699_100104327 | 3300005518 | Bacteria | 2486 |
| 119 | Ga0070699_100131231 | 3300005518 | Bacteria | 2209 |
| 120 | Ga0070699_101013109 | 3300005518 | Bacteria | 762 |
| 121 | Ga0070699_101070359 | 3300005518 | Bacteria | 740 |
| 122 | Ga0070699_101294756 | 3300005518 | Bacteria | 668 |
| 123 | Ga0070679_100045451 | 3300005530 | Bacteria | 4376 |
| 124 | Ga0070679_100344590 | 3300005530 | Bacteria | 1438 |
| 125 | Ga0070679_100372990 | 3300005530 | Bacteria | 1374 |
| 126 | Ga0070684_100019531 | 3300005535 | Bacteria | 5607 |
| 127 | Ga0070684_100242059 | 3300005535 | Bacteria | 1648 |
| 128 | Ga0070697_100144825 | 3300005536 | Bacteria | 1999 |
| 129 | Ga0070697_100182414 | 3300005536 | Bacteria | 1779 |
| 130 | Ga0070697_100584071 | 3300005536 | Bacteria | 981 |
| 131 | Ga0070697_100988538 | 3300005536 | Bacteria | 748 |
| 132 | Ga0070697_101050416 | 3300005536 | Bacteria | 724 |
| 133 | Ga0068853_100001025 | 3300005539 | Bacteria | 19674 |
| 134 | Ga0068853_100369474 | 3300005539 | Bacteria | 1338 |
| 135 | Ga0070695_100001024 | 3300005545 | Bacteria | 15261 |
| 136 | Ga0070695_100003752 | 3300005545 | Bacteria | 8861 |
| 137 | Ga0070695_100009964 | 3300005545 | Bacteria | 5666 |
| 138 | Ga0070695_100086829 | 3300005545 | Bacteria | 2080 |
| 139 | Ga0070695_100573701 | 3300005545 | Bacteria | 882 |
| 140 | Ga0070696_100001263 | 3300005546 | Bacteria | 16430 |
| 141 | Ga0070696_100031968 | 3300005546 | Bacteria | 3609 |
| 142 | Ga0070696_100101177 | 3300005546 | Bacteria | 2065 |
| 143 | Ga0070696_101076766 | 3300005546 | Bacteria | 675 |
| 144 | Ga0070693_100000283 | 3300005547 | Bacteria | 23822 |
| 145 | Ga0070693_100878737 | 3300005547 | Bacteria | 670 |
| 146 | Ga0070665_100721117 | 3300005548 | Bacteria | 1010 |
| 147 | Ga0070665_101806334 | 3300005548 | Bacteria | 618 |
| 148 | Ga0070704_100001095 | 3300005549 | Bacteria | 14047 |
| 149 | Ga0070704_100046832 | 3300005549 | Bacteria | 3019 |
| 150 | Ga0070704_100078534 | 3300005549 | Bacteria | 2422 |
| 151 | Ga0070704_100099673 | 3300005549 | Bacteria | 2185 |
| 152 | Ga0070704_100151316 | 3300005549 | Bacteria | 1825 |
| 153 | Ga0070704_100222115 | 3300005549 | Bacteria | 1537 |
| 154 | Ga0070704_100463494 | 3300005549 | Bacteria | 1094 |
| 155 | Ga0070704_100628815 | 3300005549 | Bacteria | 946 |
| 156 | Ga0070704_100886333 | 3300005549 | Bacteria | 802 |
| 157 | Ga0068855_100012218 | 3300005563 | Bacteria | 10378 |
| 158 | Ga0070664_100028474 | 3300005564 | Bacteria | 4647 |
| 159 | Ga0070664_100436268 | 3300005564 | Bacteria | 1201 |
| 160 | Ga0068857_100008128 | 3300005577 | Bacteria | 9057 |
| 161 | Ga0068857_100945263 | 3300005577 | Bacteria | 828 |
| 162 | Ga0068854_100002085 | 3300005578 | Bacteria | 12258 |
| 163 | Ga0068854_100222754 | 3300005578 | Bacteria | 1493 |
| 164 | Ga0068854_100284689 | 3300005578 | Bacteria | 1332 |
| 165 | Ga0068854_101237750 | 3300005578 | Bacteria | 670 |
| 166 | Ga0068856_100006402 | 3300005614 | Bacteria | 11551 |
| 167 | Ga0068856_101116104 | 3300005614 | Bacteria | 806 |
| 168 | Ga0070702_100248406 | 3300005615 | Bacteria | 1205 |
| 169 | Ga0070702_100668533 | 3300005615 | Bacteria | 788 |
| 170 | Ga0068852_100130378 | 3300005616 | Bacteria | 2315 |
| 171 | Ga0068859_100007763 | 3300005617 | Bacteria | 10896 |
| 172 | Ga0068859_100040934 | 3300005617 | Bacteria | 4654 |
| 173 | Ga0068859_101868518 | 3300005617 | Bacteria | 663 |
| 174 | Ga0068864_101619876 | 3300005618 | Bacteria | 651 |
| 175 | Ga0068864_101688582 | 3300005618 | Bacteria | 638 |
| 176 | Ga0068866_10148658 | 3300005718 | Bacteria | 1354 |
| 177 | Ga0068866_10397631 | 3300005718 | Bacteria | 888 |
| 178 | Ga0068861_100211805 | 3300005719 | Bacteria | 1633 |
| 179 | Ga0068861_100850372 | 3300005719 | Bacteria | 860 |
| 180 | Ga0068870_10006834 | 3300005840 | Bacteria | 5061 |
| 181 | Ga0068870_10253991 | 3300005840 | Bacteria | 1091 |
| 182 | Ga0068863_100133356 | 3300005841 | Bacteria | 2372 |
| 183 | Ga0068858_100024588 | 3300005842 | Bacteria | 5612 |
| 184 | Ga0068858_100081692 | 3300005842 | Bacteria | 3004 |
| 185 | Ga0068858_102027672 | 3300005842 | Bacteria | 569 |
| 186 | Ga0068860_100036613 | 3300005843 | Bacteria | 4700 |
| 187 | Ga0068860_100088058 | 3300005843 | Bacteria | 2956 |
| 188 | Ga0068860_100540365 | 3300005843 | Bacteria | 1167 |
| 189 | Ga0068860_101272601 | 3300005843 | Bacteria | 756 |
| 190 | Ga0068862_100287626 | 3300005844 | Bacteria | 1508 |
| 191 | Ga0068862_100814698 | 3300005844 | Bacteria | 913 |
| 192 | Ga0068862_101313559 | 3300005844 | Bacteria | 725 |
| 193 | Ga0068862_101329171 | 3300005844 | Bacteria | 721 |
| 194 | Ga0068862_101508571 | 3300005844 | Bacteria | 678 |
| 195 | Ga0068862_101754312 | 3300005844 | Bacteria | 629 |
| 196 | Ga0081455_10000433 | 3300005937 | Bacteria | 55007 |
| 197 | Ga0081540_1013630 | 3300005983 | Bacteria | 5272 |
| 198 | Ga0081540_1020165 | 3300005983 | Bacteria | 4021 |
| 199 | Ga0081539_10000271 | 3300005985 | Bacteria | 118902 |
| 200 | Ga0081539_10031960 | 3300005985 | Bacteria | 3232 |
| 201 | Ga0075432_10195733 | 3300006058 | Bacteria | 798 |
| 202 | Ga0070716_100007411 | 3300006173 | Bacteria | 5400 |
| 203 | Ga0070712_100008516 | 3300006175 | Bacteria | 6453 |
| 204 | Ga0070712_100367805 | 3300006175 | Bacteria | 1181 |
| 205 | Ga0097621_100077672 | 3300006237 | Bacteria | 2757 |
| 206 | Ga0097621_100334041 | 3300006237 | Bacteria | 1345 |
| 207 | Ga0068871_100016719 | 3300006358 | Bacteria | 5535 |
| 208 | Ga0068871_100893510 | 3300006358 | Bacteria | 823 |
| 209 | Ga0075428_100002741 | 3300006844 | Bacteria | 19183 |
| 210 | Ga0075428_100065646 | 3300006844 | Bacteria | 3975 |
| 211 | Ga0075428_100261471 | 3300006844 | Bacteria | 1863 |
| 212 | Ga0075428_100405075 | 3300006844 | Bacteria | 1462 |
| 213 | Ga0075428_101005400 | 3300006844 | Bacteria | 883 |
| 214 | Ga0075428_101578210 | 3300006844 | Bacteria | 686 |
| 215 | Ga0075430_100000995 | 3300006846 | Bacteria | 22401 |
| 216 | Ga0075430_100002448 | 3300006846 | Bacteria | 15460 |
| 217 | Ga0075430_100006077 | 3300006846 | Bacteria | 10178 |
| 218 | Ga0075430_100260267 | 3300006846 | Bacteria | 1437 |
| 219 | Ga0075430_100764138 | 3300006846 | Bacteria | 796 |
| 220 | Ga0075430_101262432 | 3300006846 | Bacteria | 608 |
| 221 | Ga0075431_100000752 | 3300006847 | Bacteria | 28024 |
| 222 | Ga0075431_100001235 | 3300006847 | Bacteria | 23185 |
| 223 | Ga0075431_100006036 | 3300006847 | Bacteria | 12012 |
| 224 | Ga0075431_100046375 | 3300006847 | Bacteria | 4481 |
| 225 | Ga0075431_100076567 | 3300006847 | Bacteria | 3452 |
| 226 | Ga0075431_100143192 | 3300006847 | Bacteria | 2464 |
| 227 | Ga0075431_100150704 | 3300006847 | Bacteria | 2395 |
| 228 | Ga0075431_100265087 | 3300006847 | Bacteria | 1742 |
| 229 | Ga0075431_100437654 | 3300006847 | Bacteria | 1305 |
| 230 | Ga0075431_100444681 | 3300006847 | Bacteria | 1292 |
| 231 | Ga0075431_100563302 | 3300006847 | Bacteria | 1126 |
| 232 | Ga0075431_101294668 | 3300006847 | Bacteria | 690 |
| 233 | Ga0075433_10005518 | 3300006852 | Bacteria | 9933 |
| 234 | Ga0075433_10010752 | 3300006852 | Bacteria | 7361 |
| 235 | Ga0075433_10011103 | 3300006852 | Bacteria | 7243 |
| 236 | Ga0075433_10011169 | 3300006852 | Bacteria | 7224 |
| 237 | Ga0075433_10042460 | 3300006852 | Bacteria | 3945 |
| 238 | Ga0075433_10051057 | 3300006852 | Bacteria | 3600 |
| 239 | Ga0075433_10088566 | 3300006852 | Bacteria | 2735 |
| 240 | Ga0075433_10216863 | 3300006852 | Bacteria | 1700 |
| 241 | Ga0075433_10308921 | 3300006852 | Bacteria | 1400 |
| 242 | Ga0075433_10481153 | 3300006852 | Bacteria | 1094 |
| 243 | Ga0075433_10592320 | 3300006852 | Bacteria | 974 |
| 244 | Ga0075433_10639867 | 3300006852 | Bacteria | 933 |
| 245 | Ga0075434_100001101 | 3300006871 | Bacteria | 22162 |
| 246 | Ga0075434_100006381 | 3300006871 | Bacteria | 10810 |
| 247 | Ga0075434_100012476 | 3300006871 | Bacteria | 8059 |
| 248 | Ga0075434_100123037 | 3300006871 | Bacteria | 2610 |
| 249 | Ga0075434_100149430 | 3300006871 | Bacteria | 2356 |
| 250 | Ga0075434_100169638 | 3300006871 | Bacteria | 2202 |
| 251 | Ga0075434_100220229 | 3300006871 | Bacteria | 1917 |
| 252 | Ga0075434_100227961 | 3300006871 | Bacteria | 1882 |
| 253 | Ga0075434_100244650 | 3300006871 | Bacteria | 1814 |
| 254 | Ga0075434_100275006 | 3300006871 | Bacteria | 1703 |
| 255 | Ga0075434_100651464 | 3300006871 | Bacteria | 1071 |
| 256 | Ga0075434_100734418 | 3300006871 | Bacteria | 1004 |
| 257 | Ga0075429_100000231 | 3300006880 | Bacteria | 38094 |
| 258 | Ga0075429_100004656 | 3300006880 | Bacteria | 11802 |
| 259 | Ga0075429_100020795 | 3300006880 | Bacteria | 5696 |
| 260 | Ga0075429_100076937 | 3300006880 | Bacteria | 2906 |
| 261 | Ga0075429_100154437 | 3300006880 | Bacteria | 2010 |
| 262 | Ga0075429_100670331 | 3300006880 | Bacteria | 909 |
| 263 | Ga0068865_100677762 | 3300006881 | Bacteria | 879 |
| 264 | Ga0075436_100003124 | 3300006914 | Bacteria | 11350 |
| 265 | Ga0075436_100019659 | 3300006914 | Bacteria | 4630 |
| 266 | Ga0075436_100044152 | 3300006914 | Bacteria | 3073 |
| 267 | Ga0075436_100051420 | 3300006914 | Bacteria | 2844 |
| 268 | Ga0075436_100109161 | 3300006914 | Bacteria | 1930 |
| 269 | Ga0075436_100137139 | 3300006914 | Bacteria | 1718 |
| 270 | Ga0097620_100007763 | 3300006931 | Bacteria | 10896 |
| 271 | Ga0097620_100040939 | 3300006931 | Bacteria | 4654 |
| 272 | Ga0097620_101869201 | 3300006931 | Bacteria | 663 |
| 273 | Ga0075435_100002353 | 3300007076 | Bacteria | 12527 |
| 274 | Ga0075435_100021024 | 3300007076 | Bacteria | 5012 |
| 275 | Ga0075435_100022841 | 3300007076 | Bacteria | 4829 |
| 276 | Ga0075435_100054365 | 3300007076 | Bacteria | 3231 |
| 277 | Ga0075435_100081871 | 3300007076 | Bacteria | 2652 |
| 278 | Ga0075435_100125869 | 3300007076 | Bacteria | 2142 |
| 279 | Ga0075435_100145541 | 3300007076 | Bacteria | 1990 |
| 280 | Ga0075435_100162891 | 3300007076 | Bacteria | 1879 |
| 281 | Ga0075435_100298474 | 3300007076 | Bacteria | 1378 |
| 282 | Ga0075435_100593860 | 3300007076 | Bacteria | 960 |
| 283 | Ga0075435_100656691 | 3300007076 | Bacteria | 910 |
| 284 | Ga0075435_100680290 | 3300007076 | Bacteria | 894 |
| 285 | Ga0099794_10009756 | 3300007265 | Bacteria | 4051 |
| 286 | Ga0099794_10025349 | 3300007265 | Bacteria | 2730 |
| 287 | Ga0099794_10156857 | 3300007265 | Bacteria | 1157 |
| 288 | Ga0105240_10217423 | 3300009093 | Bacteria | 2228 |
| 289 | Ga0111539_10001442 | 3300009094 | Bacteria | 31728 |
| 290 | Ga0111539_10014162 | 3300009094 | Bacteria | 9957 |
| 291 | Ga0111539_10020969 | 3300009094 | Bacteria | 8046 |
| 292 | Ga0111539_10031067 | 3300009094 | Bacteria | 6490 |
| 293 | Ga0111539_10044400 | 3300009094 | Bacteria | 5325 |
| 294 | Ga0111539_10354573 | 3300009094 | Bacteria | 1707 |
| 295 | Ga0111539_10389826 | 3300009094 | Bacteria | 1622 |
| 296 | Ga0111539_11845588 | 3300009094 | Bacteria | 701 |
| 297 | Ga0111539_12912666 | 3300009094 | Bacteria | 554 |
| 298 | Ga0105245_10065829 | 3300009098 | Bacteria | 3278 |
| 299 | Ga0105245_10174146 | 3300009098 | Bacteria | 2051 |
| 300 | Ga0105245_10207577 | 3300009098 | Bacteria | 1884 |
| 301 | Ga0105245_10444356 | 3300009098 | Bacteria | 1304 |
| 302 | Ga0105245_10931350 | 3300009098 | Bacteria | 911 |
| 303 | Ga0105247_10518355 | 3300009101 | Bacteria | 871 |
| 304 | Ga0114129_10000643 | 3300009147 | Bacteria | 43627 |
| 305 | Ga0114129_10004885 | 3300009147 | Bacteria | 18915 |
| 306 | Ga0114129_10028218 | 3300009147 | Bacteria | 7951 |
| 307 | Ga0114129_10044584 | 3300009147 | Bacteria | 6238 |
| 308 | Ga0114129_10044676 | 3300009147 | Bacteria | 6232 |
| 309 | Ga0114129_10045389 | 3300009147 | Bacteria | 6178 |
| 310 | Ga0114129_10046650 | 3300009147 | Bacteria | 6089 |
| 311 | Ga0114129_10064689 | 3300009147 | Bacteria | 5104 |
| 312 | Ga0114129_10079570 | 3300009147 | Bacteria | 4557 |
| 313 | Ga0114129_10107834 | 3300009147 | Bacteria | 3846 |
| 314 | Ga0114129_10108103 | 3300009147 | Bacteria | 3840 |
| 315 | Ga0114129_10177825 | 3300009147 | Bacteria | 2897 |
| 316 | Ga0114129_10285840 | 3300009147 | Bacteria | 2202 |
| 317 | Ga0114129_10293245 | 3300009147 | Bacteria | 2170 |
| 318 | Ga0114129_10296921 | 3300009147 | Bacteria | 2155 |
| 319 | Ga0114129_10609532 | 3300009147 | Bacteria | 1413 |
| 320 | Ga0114129_10673114 | 3300009147 | Bacteria | 1333 |
| 321 | Ga0114129_10798473 | 3300009147 | Bacteria | 1204 |
| 322 | Ga0114129_10909256 | 3300009147 | Bacteria | 1115 |
| 323 | Ga0114129_11742557 | 3300009147 | Bacteria | 759 |
| 324 | Ga0105243_11760599 | 3300009148 | Bacteria | 650 |
| 325 | Ga0105243_11867401 | 3300009148 | Bacteria | 633 |
| 326 | Ga0105241_10001312 | 3300009174 | Bacteria | 18908 |
| 327 | Ga0105241_10037857 | 3300009174 | Bacteria | 3635 |
| 328 | Ga0105241_10393859 | 3300009174 | Bacteria | 1213 |
| 329 | Ga0105241_10474399 | 3300009174 | Bacteria | 1111 |
| 330 | Ga0105242_10138777 | 3300009176 | Bacteria | 2107 |
| 331 | Ga0105242_10771746 | 3300009176 | Bacteria | 948 |
| 332 | Ga0105242_11307692 | 3300009176 | Bacteria | 749 |
| 333 | Ga0105248_10029051 | 3300009177 | Bacteria | 6165 |
| 334 | Ga0105248_12363174 | 3300009177 | Bacteria | 605 |
| 335 | Ga0105237_10028013 | 3300009545 | Bacteria | 5740 |
| 336 | Ga0105237_10225033 | 3300009545 | Bacteria | 1876 |
| 337 | Ga0105238_10069382 | 3300009551 | Bacteria | 3525 |
| 338 | Ga0105238_10474362 | 3300009551 | Bacteria | 1250 |
| 339 | Ga0105249_10258039 | 3300009553 | Bacteria | 1731 |
| 340 | Ga0105249_10447944 | 3300009553 | Bacteria | 1329 |
| 341 | Ga0105249_10457710 | 3300009553 | Bacteria | 1315 |
| 342 | Ga0105249_10678363 | 3300009553 | Bacteria | 1089 |
| 343 | Ga0105249_10970744 | 3300009553 | Bacteria | 918 |
| 344 | Ga0105239_10061655 | 3300010375 | Bacteria | 4116 |
| 345 | Ga0105239_10350730 | 3300010375 | Bacteria | 1666 |
| 346 | Ga0105239_10546863 | 3300010375 | Bacteria | 1318 |
| 347 | Ga0105239_10716844 | 3300010375 | Bacteria | 1144 |
| 348 | Ga0105246_10088689 | 3300011119 | Bacteria | 2223 |
| 349 | Ga0105246_10251782 | 3300011119 | Bacteria | 1402 |
| 350 | Ga0157373_10000457 | 3300013100 | Bacteria | 32330 |
| 351 | Ga0157373_10415463 | 3300013100 | Bacteria | 965 |
| 352 | Ga0157369_10217059 | 3300013105 | Bacteria | 2003 |
| 353 | Ga0157374_10379589 | 3300013296 | Bacteria | 1408 |
| 354 | Ga0157378_10283272 | 3300013297 | Bacteria | 1598 |
| 355 | Ga0157378_10464135 | 3300013297 | Bacteria | 1259 |
| 356 | Ga0157378_10517720 | 3300013297 | Bacteria | 1194 |
| 357 | Ga0157378_11134476 | 3300013297 | Bacteria | 820 |
| 358 | Ga0157378_11982502 | 3300013297 | Bacteria | 632 |
| 359 | Ga0163162_10018030 | 3300013306 | Bacteria | 6908 |
| 360 | Ga0163162_10768105 | 3300013306 | Bacteria | 1082 |
| 361 | Ga0163162_12202501 | 3300013306 | Bacteria | 633 |
| 362 | Ga0157372_10042124 | 3300013307 | Bacteria | 5049 |
| 363 | Ga0157372_10152649 | 3300013307 | Bacteria | 2666 |
| 364 | Ga0157375_10117305 | 3300013308 | Bacteria | 2767 |
| 365 | Ga0157375_10273143 | 3300013308 | Bacteria | 1853 |
| 366 | Ga0157375_10274923 | 3300013308 | Bacteria | 1847 |
| 367 | Ga0157375_10602785 | 3300013308 | Bacteria | 1257 |
| 368 | Ga0163163_10440381 | 3300014325 | Bacteria | 1363 |
| 369 | Ga0163163_10506302 | 3300014325 | Bacteria | 1269 |
| 370 | Ga0163163_10801063 | 3300014325 | Bacteria | 1006 |
| 371 | Ga0157380_10683777 | 3300014326 | Bacteria | 1028 |
| 372 | Ga0157380_11088881 | 3300014326 | Bacteria | 837 |
| 373 | Ga0157377_10330796 | 3300014745 | Bacteria | 1016 |
| 374 | Ga0157377_10643039 | 3300014745 | Bacteria | 762 |
| 375 | Ga0157379_10500205 | 3300014968 | Bacteria | 1126 |
| 376 | Ga0157379_10560579 | 3300014968 | Bacteria | 1064 |
| 377 | Ga0157379_10782585 | 3300014968 | Bacteria | 900 |
| 378 | Ga0157376_10014946 | 3300014969 | Bacteria | 5850 |
| 379 | Ga0206356_11296602 | 3300020070 | Bacteria | 598 |
| 380 | Ga0206352_10551387 | 3300020078 | Bacteria | 971 |
| 381 | Ga0206352_10961566 | 3300020078 | Bacteria | 916 |
| 382 | Ga0206350_10918364 | 3300020080 | Bacteria | 914 |
| 383 | Ga0213873_10031999 | 3300021358 | Bacteria | 1312 |
| 384 | Ga0213874_10116250 | 3300021377 | Bacteria | 904 |
| 385 | Ga0213876_10073124 | 3300021384 | Bacteria | 1810 |
| 386 | Ga0213875_10027992 | 3300021388 | Bacteria | 2680 |
| 387 | Ga0224712_10276785 | 3300022467 | Bacteria | 780 |
| 388 | Ga0207653_10004849 | 3300025885 | Bacteria | 4204 |
| 389 | Ga0207653_10012619 | 3300025885 | Bacteria | 2638 |
| 390 | Ga0207653_10110994 | 3300025885 | Bacteria | 979 |
| 391 | Ga0207642_10186907 | 3300025899 | Bacteria | 1134 |
| 392 | Ga0207642_10472198 | 3300025899 | Bacteria | 763 |
| 393 | Ga0207688_10083507 | 3300025901 | Bacteria | 1827 |
| 394 | Ga0207688_10208794 | 3300025901 | Bacteria | 1173 |
| 395 | Ga0207685_10105949 | 3300025905 | Bacteria | 1210 |
| 396 | Ga0207685_10145953 | 3300025905 | Bacteria | 1066 |
| 397 | Ga0207685_10511778 | 3300025905 | Bacteria | 633 |
| 398 | Ga0207699_10201774 | 3300025906 | Bacteria | 1348 |
| 399 | Ga0207699_10699993 | 3300025906 | Bacteria | 742 |
| 400 | Ga0207645_10000582 | 3300025907 | Bacteria | 30310 |
| 401 | Ga0207643_10000688 | 3300025908 | Bacteria | 21132 |
| 402 | Ga0207643_10304997 | 3300025908 | Bacteria | 992 |
| 403 | Ga0207684_10009460 | 3300025910 | Bacteria | 8604 |
| 404 | Ga0207684_10013814 | 3300025910 | Bacteria | 6974 |
| 405 | Ga0207684_10017635 | 3300025910 | Bacteria | 6125 |
| 406 | Ga0207684_10031745 | 3300025910 | Bacteria | 4493 |
| 407 | Ga0207684_10064137 | 3300025910 | Bacteria | 3119 |
| 408 | Ga0207684_10075117 | 3300025910 | Bacteria | 2872 |
| 409 | Ga0207684_10496485 | 3300025910 | Bacteria | 1046 |
| 410 | Ga0207684_10770638 | 3300025910 | Bacteria | 814 |
| 411 | Ga0207654_10003437 | 3300025911 | Bacteria | 8006 |
| 412 | Ga0207654_10025483 | 3300025911 | Bacteria | 3190 |
| 413 | Ga0207707_10000158 | 3300025912 | Bacteria | 71112 |
| 414 | Ga0207707_10535647 | 3300025912 | Bacteria | 996 |
| 415 | Ga0207695_10308224 | 3300025913 | Bacteria | 1473 |
| 416 | Ga0207671_10039847 | 3300025914 | Bacteria | 3479 |
| 417 | Ga0207693_10008921 | 3300025915 | Bacteria | 8187 |
| 418 | Ga0207693_10400419 | 3300025915 | Bacteria | 1073 |
| 419 | Ga0207693_10440230 | 3300025915 | Bacteria | 1019 |
| 420 | Ga0207663_10490803 | 3300025916 | Bacteria | 953 |
| 421 | Ga0207663_10797557 | 3300025916 | Bacteria | 752 |
| 422 | Ga0207660_10000220 | 3300025917 | Bacteria | 36783 |
| 423 | Ga0207660_10012274 | 3300025917 | Bacteria | 5601 |
| 424 | Ga0207660_10337425 | 3300025917 | Bacteria | 1206 |
| 425 | Ga0207662_10092896 | 3300025918 | Bacteria | 1858 |
| 426 | Ga0207662_10105562 | 3300025918 | Bacteria | 1751 |
| 427 | Ga0207662_10744800 | 3300025918 | Bacteria | 689 |
| 428 | Ga0207657_10000730 | 3300025919 | Bacteria | 34885 |
| 429 | Ga0207649_10011103 | 3300025920 | Bacteria | 4958 |
| 430 | Ga0207652_10000290 | 3300025921 | Bacteria | 52056 |
| 431 | Ga0207652_10108409 | 3300025921 | Bacteria | 2461 |
| 432 | Ga0207646_10003701 | 3300025922 | Bacteria | 17067 |
| 433 | Ga0207646_10023549 | 3300025922 | Bacteria | 5654 |
| 434 | Ga0207646_10086056 | 3300025922 | Bacteria | 2812 |
| 435 | Ga0207646_10221487 | 3300025922 | Bacteria | 1709 |
| 436 | Ga0207646_10227192 | 3300025922 | Bacteria | 1686 |
| 437 | Ga0207646_10249861 | 3300025922 | Bacteria | 1602 |
| 438 | Ga0207646_10275940 | 3300025922 | Bacteria | 1519 |
| 439 | Ga0207646_10287084 | 3300025922 | Bacteria | 1487 |
| 440 | Ga0207646_10632559 | 3300025922 | Bacteria | 959 |
| 441 | Ga0207681_10022163 | 3300025923 | Bacteria | 4047 |
| 442 | Ga0207681_10292339 | 3300025923 | Bacteria | 1286 |
| 443 | Ga0207681_10413117 | 3300025923 | Bacteria | 1092 |
| 444 | Ga0207681_10860960 | 3300025923 | Bacteria | 758 |
| 445 | Ga0207694_10044685 | 3300025924 | Bacteria | 3421 |
| 446 | Ga0207650_10010437 | 3300025925 | Bacteria | 6366 |
| 447 | Ga0207687_10539324 | 3300025927 | Bacteria | 978 |
| 448 | Ga0207687_10829134 | 3300025927 | Bacteria | 790 |
| 449 | Ga0207700_10101633 | 3300025928 | Bacteria | 2294 |
| 450 | Ga0207664_10179129 | 3300025929 | Bacteria | 1819 |
| 451 | Ga0207690_10002732 | 3300025932 | Bacteria | 10652 |
| 452 | Ga0207690_10438317 | 3300025932 | Bacteria | 1048 |
| 453 | Ga0207706_10011184 | 3300025933 | Bacteria | 8182 |
| 454 | Ga0207706_10040989 | 3300025933 | Bacteria | 4105 |
| 455 | Ga0207706_10093783 | 3300025933 | Bacteria | 2640 |
| 456 | Ga0207686_10159058 | 3300025934 | Bacteria | 1581 |
| 457 | Ga0207709_10195812 | 3300025935 | Bacteria | 1439 |
| 458 | Ga0207709_10215555 | 3300025935 | Bacteria | 1381 |
| 459 | Ga0207709_10961166 | 3300025935 | Bacteria | 697 |
| 460 | Ga0207670_10030455 | 3300025936 | Bacteria | 3448 |
| 461 | Ga0207669_10180140 | 3300025937 | Bacteria | 1514 |
| 462 | Ga0207669_10365446 | 3300025937 | Bacteria | 1120 |
| 463 | Ga0207669_10580535 | 3300025937 | Bacteria | 908 |
| 464 | Ga0207704_10531971 | 3300025938 | Bacteria | 952 |
| 465 | Ga0207665_10002961 | 3300025939 | Bacteria | 11381 |
| 466 | Ga0207691_10363241 | 3300025940 | Bacteria | 1238 |
| 467 | Ga0207711_10040996 | 3300025941 | Bacteria | 3940 |
| 468 | Ga0207711_10061135 | 3300025941 | Bacteria | 3248 |
| 469 | Ga0207689_10000846 | 3300025942 | Bacteria | 29434 |
| 470 | Ga0207689_10008358 | 3300025942 | Bacteria | 9012 |
| 471 | Ga0207661_11225132 | 3300025944 | Bacteria | 690 |
| 472 | Ga0207679_10000820 | 3300025945 | Bacteria | 20002 |
| 473 | Ga0207679_10607726 | 3300025945 | Bacteria | 986 |
| 474 | Ga0207667_10001638 | 3300025949 | Bacteria | 28188 |
| 475 | Ga0207651_10017986 | 3300025960 | Bacteria | 4193 |
| 476 | Ga0207651_10046301 | 3300025960 | Bacteria | 2924 |
| 477 | Ga0207651_10930530 | 3300025960 | Bacteria | 775 |
| 478 | Ga0207712_10777186 | 3300025961 | Bacteria | 841 |
| 479 | Ga0207712_11053682 | 3300025961 | Bacteria | 723 |
| 480 | Ga0207668_10012836 | 3300025972 | Bacteria | 5140 |
| 481 | Ga0207640_10010928 | 3300025981 | Bacteria | 5122 |
| 482 | Ga0207640_11484337 | 3300025981 | Bacteria | 609 |
| 483 | Ga0207677_10039511 | 3300026023 | Bacteria | 3103 |
| 484 | Ga0207703_10061345 | 3300026035 | Bacteria | 3078 |
| 485 | Ga0207639_10003030 | 3300026041 | Bacteria | 11313 |
| 486 | Ga0207639_10305816 | 3300026041 | Bacteria | 1407 |
| 487 | Ga0207639_10310778 | 3300026041 | Bacteria | 1396 |
| 488 | Ga0207678_10003638 | 3300026067 | Bacteria | 13856 |
| 489 | Ga0207678_11331627 | 3300026067 | Bacteria | 635 |
| 490 | Ga0207708_10126776 | 3300026075 | Bacteria | 1993 |
| 491 | Ga0207708_10375408 | 3300026075 | Bacteria | 1171 |
| 492 | Ga0207702_10003448 | 3300026078 | Bacteria | 14437 |
| 493 | Ga0207702_10618655 | 3300026078 | Bacteria | 1063 |
| 494 | Ga0207641_10187238 | 3300026088 | Bacteria | 1900 |
| 495 | Ga0207648_10034307 | 3300026089 | Bacteria | 4473 |
| 496 | Ga0207648_10780321 | 3300026089 | Bacteria | 889 |
| 497 | Ga0207676_11065497 | 3300026095 | Bacteria | 798 |
| 498 | Ga0207674_10002312 | 3300026116 | Bacteria | 24141 |
| 499 | Ga0207674_10416585 | 3300026116 | Bacteria | 1298 |
| 500 | Ga0207675_100230392 | 3300026118 | Bacteria | 1787 |
| 501 | Ga0207683_10917339 | 3300026121 | Bacteria | 813 |
| 502 | Ga0207698_10081246 | 3300026142 | Bacteria | 2615 |
| 503 | Ga0207698_10730461 | 3300026142 | Bacteria | 987 |
| 504 | Ga0207698_11662362 | 3300026142 | Bacteria | 654 |
| 505 | Ga0209969_1003036 | 3300027360 | Bacteria | 2322 |
| 506 | Ga0209981_1005574 | 3300027378 | Bacteria | 1672 |
| 507 | Ga0209996_1002868 | 3300027395 | Bacteria | 2145 |
| 508 | Ga0209984_1006985 | 3300027424 | Bacteria | 1395 |
| 509 | Ga0210000_1046215 | 3300027462 | Bacteria | 695 |
| 510 | Ga0209995_1017552 | 3300027471 | Bacteria | 1177 |
| 511 | Ga0209968_1004685 | 3300027526 | Bacteria | 2049 |
| 512 | Ga0209999_1000646 | 3300027543 | Bacteria | 5582 |
| 513 | Ga0209970_1000762 | 3300027614 | Bacteria | 5623 |
| 514 | Ga0209970_1017391 | 3300027614 | Bacteria | 1203 |
| 515 | Ga0209970_1026887 | 3300027614 | Bacteria | 990 |
| 516 | Ga0209983_1000526 | 3300027665 | Bacteria | 8248 |
| 517 | Ga0209588_1008703 | 3300027671 | Bacteria | 3015 |
| 518 | Ga0209971_1000058 | 3300027682 | Bacteria | 35412 |
| 519 | Ga0209971_1013323 | 3300027682 | Bacteria | 1949 |
| 520 | Ga0209971_1020168 | 3300027682 | Bacteria | 1584 |
| 521 | Ga0209966_1000021 | 3300027695 | Bacteria | 68287 |
| 522 | Ga0209998_10000002 | 3300027717 | Bacteria | 126355 |
| 523 | Ga0209974_10004247 | 3300027876 | Bacteria | 5114 |
| 524 | Ga0209974_10165271 | 3300027876 | Bacteria | 804 |
| 525 | Ga0207428_10000069 | 3300027907 | Bacteria | 149507 |
| 526 | Ga0207428_10001914 | 3300027907 | Bacteria | 21074 |
| 527 | Ga0207428_10044235 | 3300027907 | Bacteria | 3593 |
| 528 | Ga0207428_10130402 | 3300027907 | Bacteria | 1924 |
| 529 | Ga0207428_10499329 | 3300027907 | Bacteria | 884 |
| 530 | Ga0268266_10593184 | 3300028379 | Bacteria | 1064 |
| 531 | Ga0268266_10849902 | 3300028379 | Bacteria | 882 |
| 532 | Ga0268266_11003625 | 3300028379 | Bacteria | 808 |
| 533 | Ga0268265_10047714 | 3300028380 | Bacteria | 3211 |
| 534 | Ga0268265_11235155 | 3300028380 | Bacteria | 746 |
| 535 | Ga0268264_10019088 | 3300028381 | Bacteria | 5605 |
| 536 | Ga0268264_10085848 | 3300028381 | Bacteria | 2702 |
| 537 | Ga0268264_11762337 | 3300028381 | Bacteria | 629 |
| 538 | Ga0265328_10057182 | 3300031239 | Bacteria | 1432 |
| 539 | Ga0265320_10361190 | 3300031240 | Bacteria | 641 |
| 540 | Ga0265325_10021553 | 3300031241 | Bacteria | 3539 |
| 541 | Ga0265325_10069363 | 3300031241 | Bacteria | 1773 |
| 542 | Ga0265339_10019242 | 3300031249 | Bacteria | 4012 |
| 543 | Ga0265331_10001750 | 3300031250 | Bacteria | 15608 |
| 544 | Ga0307408_100023294 | 3300031548 | Bacteria | 4216 |
| 545 | Ga0307408_100418767 | 3300031548 | Bacteria | 1154 |
| 546 | Ga0265313_10000827 | 3300031595 | Bacteria | 31277 |
| 547 | Ga0265313_10185659 | 3300031595 | Bacteria | 872 |
| 548 | Ga0265314_10126304 | 3300031711 | Bacteria | 1601 |
| 549 | Ga0265342_10023073 | 3300031712 | Bacteria | 3944 |
| 550 | Ga0307405_11020370 | 3300031731 | Bacteria | 707 |
| 551 | Ga0307409_100478148 | 3300031995 | Bacteria | 1208 |
| 552 | Ga0307416_100248585 | 3300032002 | Bacteria | 1729 |
| 553 | Ga0307414_11072669 | 3300032004 | Bacteria | 743 |
| 554 | Ga0307411_10131601 | 3300032005 | Bacteria | 1829 |
| 555 | Ga0373948_0007232 | 3300034817 | Bacteria | 1861 |
| 556 | Ga0373958_0068265 | 3300034819 | Bacteria | 784 |
| 557 | Ga0373959_0003425 | 3300034820 | Bacteria | 2525 |
| 558 | Ga0373926_0020266 | 3300035083 | Bacteria | 2297 |
| 559 | Ga0373940_0010600 | 3300035088 | Bacteria | 2171 |
| 560 | Ga0373940_0079348 | 3300035088 | Bacteria | 968 |
| 561 | Ga0373940_0119209 | 3300035088 | Bacteria | 817 |
| 562 | Ga0373940_0140518 | 3300035088 | Bacteria | 763 |
| 563 | Ga0373949_0009104 | 3300035090 | Bacteria | 2176 |
| 564 | Ga0373951_0002550 | 3300035091 | Bacteria | 4577 |
| 565 | Ga0373952_0037294 | 3300035092 | Bacteria | 1108 |
| 566 | Ga0373936_0245159 | 3300035113 | Bacteria | 799 |
| 567 | Ga0373939_0019448 | 3300035114 | Bacteria | 1833 |
| 568 | Ga0373939_0156130 | 3300035114 | Bacteria | 834 |
| 569 | Ga0373939_0188697 | 3300035114 | Bacteria | 773 |
| 570 | Ga0373941_0011362 | 3300035115 | Bacteria | 2299 |
| 571 | Ga0373945_0084629 | 3300035116 | Bacteria | 1220 |
| 572 | Ga0373957_0390159 | 3300035120 | Bacteria | 598 |
| 573 | Ga0373962_0028333 | 3300035242 | Bacteria | 1519 |
| 574 | Ga0373962_0190887 | 3300035242 | Bacteria | 689 |
| 575 | Ga0373924_0300643 | 3300035410 | Bacteria | 713 |
| 576 | Ga0373924_0351443 | 3300035410 | Bacteria | 657 |
| 577 | Ga0373931_0019802 | 3300035691 | Bacteria | 3362 |
| 578 | Ga0373931_0033320 | 3300035691 | Bacteria | 2669 |
| 579 | Ga0373931_0114603 | 3300035691 | Bacteria | 1533 |
| 580 | Ga0373931_0688463 | 3300035691 | Bacteria | 674 |
| 581 | Ga0373927_0004542 | 3300035695 | Bacteria | 9696 |
| 582 | Ga0373927_0255030 | 3300035695 | Bacteria | 1153 |
| 583 | Ga0373947_0096152 | 3300035725 | Bacteria | 1854 |
| 584 | Ga0373947_0670133 | 3300035725 | Bacteria | 707 |
| 585 | Ga0373937_0114911 | 3300036401 | Bacteria | 2506 |
| 586 | Ga0373937_0412708 | 3300036401 | Bacteria | 1281 |
| 587 | Ga0373925_0068087 | 3300037068 | Bacteria | 2686 |
| 588 | Ga0373925_0179456 | 3300037068 | Bacteria | 1675 |
| 589 | Ga0395899_0153428 | 3300037312 | Bacteria | 1631 |
| 590 | Ga0395900_0006737 | 3300037418 | Bacteria | 11917 |
| 591 | Ga0395900_0147762 | 3300037418 | Bacteria | 2403 |
| 592 | Ga0395898_0010133 | 3300037466 | Bacteria | 9864 |
| 593 | Ga0436364_0919003 | 3300037853 | Bacteria | 613 |
| 594 | Ga0395901_0006192 | 3300038443 | Bacteria | 12122 |
| 595 | Ga0395901_0520337 | 3300038443 | Bacteria | 1209 |
| 596 | Ga0436365_0458953 | 3300039437 | Bacteria | 582 |
| 597 | Ga0436365_0527275 | 3300039437 | Bacteria | 2897 |
| 598 | Ga0436360_0096378 | 3300039438 | Bacteria | 3812 |
| 599 | Ga0436363_0015138 | 3300039450 | Bacteria | 707 |
| 600 | Ga0436362_1242246 | 3300039453 | Bacteria | 934 |
| 601 | Ga0439466_0048642 | 3300041411 | Bacteria | 1394 |
| 602 | Ga0439448_0002193 | 3300042005 | Bacteria | 5275 |
| 603 | Ga0439448_0005223 | 3300042005 | Bacteria | 3698 |
| 604 | Ga0439455_0006291 | 3300042012 | Bacteria | 2458 |
| 605 | Ga0439463_020316 | 3300042016 | Bacteria | 1656 |
| 606 | Ga0450889_002862 | 3300042144 | Bacteria | 1706 |
| 607 | Ga0439458_0000918 | 3300042157 | Bacteria | 7595 |
| 608 | Ga0439459_0001028 | 3300042438 | Bacteria | 3979 |
| 609 | Ga0439459_0146234 | 3300042438 | Bacteria | 615 |
| 610 | Ga0439460_0001936 | 3300042461 | Bacteria | 4949 |
| 611 | Ga0439460_0121931 | 3300042461 | Bacteria | 853 |
| 612 | Ga0439460_0131809 | 3300042461 | Bacteria | 824 |
| 613 | Ga0451577_0036946 | 3300042876 | Bacteria | 4397 |
| 614 | Ga0451577_0046597 | 3300042876 | Bacteria | 3878 |
| 615 | Ga0451577_0107464 | 3300042876 | Bacteria | 2494 |
| 616 | Ga0451577_0435454 | 3300042876 | Bacteria | 1190 |
| 617 | Ga0451577_0489708 | 3300042876 | Bacteria | 1116 |
| 618 | Ga0451577_0760987 | 3300042876 | Bacteria | 876 |
| 619 | Ga0451577_1516345 | 3300042876 | Bacteria | 593 |
| 620 | Ga0453683_0470850 | 3300044673 | Bacteria | 814 |
| 621 | Ga0453683_0980389 | 3300044673 | Bacteria | 561 |
| 622 | Ga0453684_0096548 | 3300044712 | Bacteria | 3630 |
| 623 | Ga0453684_1671749 | 3300044712 | Bacteria | 651 |
| 624 | Ga0451576_0022688 | 3300045051 | Bacteria | 6800 |
| 625 | Ga0451576_0030647 | 3300045051 | Bacteria | 5746 |
| 626 | Ga0451576_0161675 | 3300045051 | Bacteria | 2337 |
| 627 | Ga0451576_0356019 | 3300045051 | Bacteria | 1532 |
| 628 | Ga0451576_0859957 | 3300045051 | Bacteria | 952 |
| 629 | Ga0495603_0226791 | 3300046455 | Bacteria | 1077 |
| 630 | Ga0495580_0008477 | 3300046472 | Bacteria | 8177 |
| 631 | Ga0495580_0079742 | 3300046472 | Bacteria | 2283 |
| 632 | Ga0495582_0056050 | 3300046473 | Bacteria | 2172 |
| 633 | Ga0495584_0258842 | 3300046491 | Bacteria | 885 |
| 634 | Ga0495584_0290461 | 3300046491 | Bacteria | 831 |
| 635 | Ga0495594_0239045 | 3300046499 | Bacteria | 1035 |
| 636 | Ga0495594_0371188 | 3300046499 | Bacteria | 814 |
| 637 | Ga0495642_0051230 | 3300046528 | Bacteria | 1698 |
| 638 | Ga0495642_0074530 | 3300046528 | Bacteria | 1423 |
| 639 | Ga0495665_0233727 | 3300046531 | Bacteria | 949 |
| 640 | Ga0495598_0288491 | 3300046537 | Bacteria | 618 |
| 641 | Ga0495625_0449338 | 3300046660 | Bacteria | 797 |
| 642 | Ga0495659_0166090 | 3300046664 | Bacteria | 893 |
| 643 | Ga0495658_0082401 | 3300046683 | Bacteria | 1890 |
| 644 | Ga0495658_0336575 | 3300046683 | Bacteria | 958 |
| 645 | Ga0495669_0082176 | 3300046684 | Bacteria | 1480 |
| 646 | Ga0495669_0149190 | 3300046684 | Bacteria | 1106 |
| 647 | Ga0495669_0225583 | 3300046684 | Bacteria | 898 |
| 648 | Ga0495669_0399898 | 3300046684 | Bacteria | 666 |
| 649 | Ga0495613_0218140 | 3300046689 | Bacteria | 1340 |
| 650 | Ga0495581_0046596 | 3300047315 | Bacteria | 2506 |
| 651 | Ga0495636_0050381 | 3300047318 | Bacteria | 1743 |
| 652 | Ga0495674_0730644 | 3300047319 | Bacteria | 775 |
| 653 | Ga0496100_0401498 | 3300048903 | Bacteria | 1044 |
| 654 | Ga0496101_0254165 | 3300048904 | Bacteria | 1370 |
| 655 | Ga0496101_1111565 | 3300048904 | Bacteria | 620 |
| 656 | Ga0496102_0010932 | 3300048905 | Bacteria | 7819 |
| 657 | Ga0496102_0066067 | 3300048905 | Bacteria | 3315 |
| 658 | Ga0496102_0253381 | 3300048905 | Bacteria | 1660 |
| 659 | Ga0496102_0497306 | 3300048905 | Bacteria | 1141 |
| 660 | Ga0496103_0028264 | 3300048906 | Bacteria | 3402 |
| 661 | Ga0496103_0554031 | 3300048906 | Bacteria | 734 |
| 662 | Ga0496104_0842980 | 3300048907 | Bacteria | 822 |
| 663 | Ga0496106_0136730 | 3300048909 | Bacteria | 1925 |
| 664 | Ga0496106_0244983 | 3300048909 | Bacteria | 1432 |
| 665 | Ga0496106_0424802 | 3300048909 | Bacteria | 1068 |
| 666 | Ga0496106_0971645 | 3300048909 | Bacteria | 669 |
| 667 | Ga0496107_0081233 | 3300048910 | Bacteria | 2364 |
| 668 | Ga0496108_0147203 | 3300048911 | Bacteria | 2031 |
| 669 | Ga0496108_0402841 | 3300048911 | Bacteria | 1195 |
| 670 | Ga0496108_0456019 | 3300048911 | Bacteria | 1117 |
| 671 | Ga0496108_0613880 | 3300048911 | Bacteria | 947 |
| 672 | Ga0496109_0126929 | 3300048912 | Bacteria | 2379 |
| 673 | Ga0496110_0273285 | 3300048913 | Bacteria | 1539 |
| 674 | Ga0496110_0923881 | 3300048913 | Bacteria | 779 |
| 675 | Ga0496112_0021044 | 3300048915 | Bacteria | 6195 |
| 676 | Ga0496112_0062304 | 3300048915 | Bacteria | 3679 |
| 677 | Ga0496113_0186441 | 3300048916 | Bacteria | 1646 |
| 678 | Ga0496114_0401428 | 3300048917 | Bacteria | 1214 |
| 679 | Ga0501305_085992 | 3300049161 | Bacteria | 570 |
| 680 | Ga0501031_0193378 | 3300049568 | Bacteria | 1328 |
| 681 | Ga0501031_0427335 | 3300049568 | Bacteria | 856 |
| 682 | Ga0501032_0961727 | 3300049569 | Bacteria | 537 |
| 683 | Ga0501033_0055942 | 3300049570 | Bacteria | 2917 |
| 684 | Ga0501033_0093909 | 3300049570 | Bacteria | 2194 |
| 685 | Ga0501033_0359677 | 3300049570 | Bacteria | 1019 |
| 686 | Ga0501033_0391053 | 3300049570 | Bacteria | 971 |
| 687 | Ga0501033_0445711 | 3300049570 | Bacteria | 900 |
| 688 | Ga0501033_0652577 | 3300049570 | Bacteria | 719 |
| 689 | Ga0501036_0005109 | 3300049572 | Bacteria | 10610 |
| 690 | Ga0501036_0071970 | 3300049572 | Bacteria | 2923 |
| 691 | Ga0501036_0185009 | 3300049572 | Bacteria | 1753 |
| 692 | Ga0501036_0277380 | 3300049572 | Bacteria | 1403 |
| 693 | Ga0501036_0426056 | 3300049572 | Bacteria | 1106 |
| 694 | Ga0501036_0617865 | 3300049572 | Bacteria | 898 |
| 695 | Ga0501037_0211703 | 3300049573 | Bacteria | 1367 |
| 696 | Ga0501037_0370828 | 3300049573 | Bacteria | 985 |
| 697 | Ga0501037_0780216 | 3300049573 | Bacteria | 632 |
| 698 | Ga0501038_0048428 | 3300049574 | Bacteria | 3678 |
| 699 | Ga0501038_0105155 | 3300049574 | Bacteria | 2345 |
| 700 | Ga0501038_0141276 | 3300049574 | Bacteria | 1969 |
| 701 | Ga0501038_0419050 | 3300049574 | Bacteria | 1033 |
| 702 | Ga0501038_0946666 | 3300049574 | Bacteria | 634 |
| 703 | Ga0501039_0032051 | 3300049575 | Bacteria | 4051 |
| 704 | Ga0501039_0032798 | 3300049575 | Bacteria | 4006 |
| 705 | Ga0501039_0038255 | 3300049575 | Bacteria | 3706 |
| 706 | Ga0501039_0039920 | 3300049575 | Bacteria | 3624 |
| 707 | Ga0501039_0963490 | 3300049575 | Bacteria | 663 |
| 708 | Ga0501040_0009563 | 3300049576 | Bacteria | 6326 |
| 709 | Ga0501040_0014292 | 3300049576 | Bacteria | 5229 |
| 710 | Ga0501040_0021542 | 3300049576 | Bacteria | 4306 |
| 711 | Ga0501040_0060684 | 3300049576 | Bacteria | 2599 |
| 712 | Ga0501040_0186798 | 3300049576 | Bacteria | 1470 |
| 713 | Ga0501040_0360763 | 3300049576 | Bacteria | 1041 |
| 714 | Ga0501041_0024142 | 3300049577 | Bacteria | 3648 |
| 715 | Ga0501041_0027686 | 3300049577 | Bacteria | 3416 |
| 716 | Ga0501041_0033417 | 3300049577 | Bacteria | 3112 |
| 717 | Ga0501041_0064102 | 3300049577 | Bacteria | 2250 |
| 718 | Ga0501041_0206413 | 3300049577 | Bacteria | 1232 |
| 719 | Ga0501041_0300587 | 3300049577 | Bacteria | 1011 |
| 720 | Ga0501041_0443705 | 3300049577 | Bacteria | 824 |
| 721 | Ga0501041_0694717 | 3300049577 | Bacteria | 651 |
| 722 | Ga0501042_0039188 | 3300049578 | Bacteria | 3366 |
| 723 | Ga0501042_0042966 | 3300049578 | Bacteria | 3218 |
| 724 | Ga0501042_0104521 | 3300049578 | Bacteria | 2038 |
| 725 | Ga0501042_0205447 | 3300049578 | Bacteria | 1420 |
| 726 | Ga0501042_0512930 | 3300049578 | Bacteria | 871 |
| 727 | Ga0501042_0807046 | 3300049578 | Bacteria | 683 |
| 728 | Ga0501043_0406446 | 3300049579 | Bacteria | 1028 |
| 729 | Ga0501046_0000240 | 3300049580 | Bacteria | 56302 |
| 730 | Ga0501046_0046249 | 3300049580 | Bacteria | 3455 |
| 731 | Ga0501046_0731214 | 3300049580 | Bacteria | 696 |
| 732 | Ga0501047_0076459 | 3300049581 | Bacteria | 3222 |
| 733 | Ga0501047_1280446 | 3300049581 | Bacteria | 547 |
| 734 | Ga0501048_0037582 | 3300049582 | Bacteria | 3477 |
| 735 | Ga0501048_0140718 | 3300049582 | Bacteria | 1706 |
| 736 | Ga0501048_0186064 | 3300049582 | Bacteria | 1472 |
| 737 | Ga0501048_0432600 | 3300049582 | Bacteria | 942 |
| 738 | Ga0501048_0523030 | 3300049582 | Bacteria | 851 |
| 739 | Ga0501067_0071530 | 3300049583 | Bacteria | 1921 |
| 740 | Ga0501067_0283137 | 3300049583 | Bacteria | 923 |
| 741 | Ga0501068_0054654 | 3300049584 | Bacteria | 2419 |
| 742 | Ga0501068_0198496 | 3300049584 | Bacteria | 1272 |
| 743 | Ga0501068_0256039 | 3300049584 | Bacteria | 1116 |
| 744 | Ga0501068_0336008 | 3300049584 | Bacteria | 970 |
| 745 | Ga0501068_0688180 | 3300049584 | Bacteria | 668 |
| 746 | Ga0501068_0723670 | 3300049584 | Bacteria | 651 |
| 747 | Ga0501068_1129423 | 3300049584 | Bacteria | 518 |
| 748 | Ga0501070_0869376 | 3300049586 | Bacteria | 705 |
| 749 | Ga0501071_0030461 | 3300049587 | Bacteria | 3817 |
| 750 | Ga0501071_0031512 | 3300049587 | Bacteria | 3759 |
| 751 | Ga0501071_0065147 | 3300049587 | Bacteria | 2645 |
| 752 | Ga0501071_0189012 | 3300049587 | Bacteria | 1544 |
| 753 | Ga0501071_0239223 | 3300049587 | Bacteria | 1369 |
| 754 | Ga0501071_0246197 | 3300049587 | Bacteria | 1349 |
| 755 | Ga0501071_0333749 | 3300049587 | Bacteria | 1152 |
| 756 | Ga0501072_0007527 | 3300049588 | Bacteria | 8265 |
| 757 | Ga0501072_0035907 | 3300049588 | Bacteria | 3884 |
| 758 | Ga0501072_0139172 | 3300049588 | Bacteria | 1935 |
| 759 | Ga0501072_0278407 | 3300049588 | Bacteria | 1331 |
| 760 | Ga0501072_0401356 | 3300049588 | Bacteria | 1087 |
| 761 | Ga0501072_0495651 | 3300049588 | Bacteria | 966 |
| 762 | Ga0501073_0116445 | 3300049589 | Bacteria | 1852 |
| 763 | Ga0501073_0131364 | 3300049589 | Bacteria | 1736 |
| 764 | Ga0501073_0704591 | 3300049589 | Bacteria | 696 |
| 765 | Ga0501074_0059181 | 3300049590 | Bacteria | 2761 |
| 766 | Ga0501074_0215780 | 3300049590 | Bacteria | 1366 |
| 767 | Ga0501074_0578085 | 3300049590 | Bacteria | 795 |
| 768 | Ga0501074_0872746 | 3300049590 | Bacteria | 633 |
| 769 | Ga0501074_0916673 | 3300049590 | Bacteria | 617 |
| 770 | Ga0501075_0000012 | 3300049591 | Bacteria | 81271 |
| 771 | Ga0501075_0011227 | 3300049591 | Bacteria | 6335 |
| 772 | Ga0501075_0047705 | 3300049591 | Bacteria | 3218 |
| 773 | Ga0501075_0060858 | 3300049591 | Bacteria | 2844 |
| 774 | Ga0501075_0115352 | 3300049591 | Bacteria | 2042 |
| 775 | Ga0501075_0133558 | 3300049591 | Bacteria | 1891 |
| 776 | Ga0501075_0242714 | 3300049591 | Bacteria | 1373 |
| 777 | Ga0501075_0272937 | 3300049591 | Bacteria | 1289 |
| 778 | Ga0501075_0323388 | 3300049591 | Bacteria | 1175 |
| 779 | Ga0501075_0487059 | 3300049591 | Bacteria | 941 |
| 780 | Ga0501075_0603314 | 3300049591 | Bacteria | 837 |
| 781 | Ga0501075_0670335 | 3300049591 | Bacteria | 790 |
| 782 | Ga0501076_0000017 | 3300049592 | Bacteria | 94144 |
| 783 | Ga0501076_0006954 | 3300049592 | Bacteria | 8223 |
| 784 | Ga0501076_0036530 | 3300049592 | Bacteria | 3850 |
| 785 | Ga0501076_0067773 | 3300049592 | Bacteria | 2850 |
| 786 | Ga0501076_0121955 | 3300049592 | Bacteria | 2111 |
| 787 | Ga0501076_0147370 | 3300049592 | Bacteria | 1914 |
| 788 | Ga0501076_0287379 | 3300049592 | Bacteria | 1347 |
| 789 | Ga0501076_0377082 | 3300049592 | Bacteria | 1166 |
| 790 | Ga0501076_0601020 | 3300049592 | Bacteria | 907 |
| 791 | Ga0501076_0709093 | 3300049592 | Bacteria | 830 |
| 792 | Ga0501077_0058521 | 3300049593 | Bacteria | 2446 |
| 793 | Ga0501077_0060344 | 3300049593 | Bacteria | 2407 |
| 794 | Ga0501077_0116589 | 3300049593 | Bacteria | 1692 |
| 795 | Ga0501077_0180092 | 3300049593 | Bacteria | 1343 |
| 796 | Ga0501077_0196427 | 3300049593 | Bacteria | 1282 |
| 797 | Ga0501077_0332972 | 3300049593 | Bacteria | 968 |
| 798 | Ga0501077_0365669 | 3300049593 | Bacteria | 921 |
| 799 | Ga0501077_0838831 | 3300049593 | Bacteria | 591 |
| 800 | Ga0501225_0298961 | 3300049705 | Bacteria | 544 |
| 801 | Ga0501079_0005994 | 3300049741 | Bacteria | 9101 |
| 802 | Ga0501079_0006852 | 3300049741 | Bacteria | 8581 |
| 803 | Ga0501079_0058831 | 3300049741 | Bacteria | 2965 |
| 804 | Ga0501079_0078458 | 3300049741 | Bacteria | 2554 |
| 805 | Ga0501079_0138649 | 3300049741 | Bacteria | 1894 |
| 806 | Ga0501079_0197591 | 3300049741 | Bacteria | 1570 |
| 807 | Ga0501079_0219145 | 3300049741 | Bacteria | 1486 |
| 808 | Ga0501079_0963387 | 3300049741 | Bacteria | 672 |
| 809 | Ga0501079_1055914 | 3300049741 | Bacteria | 640 |
| 810 | Ga0501080_0066821 | 3300049742 | Bacteria | 3344 |
| 811 | Ga0501080_0073623 | 3300049742 | Bacteria | 3178 |
| 812 | Ga0501080_0373107 | 3300049742 | Bacteria | 1286 |
| 813 | Ga0501080_0497738 | 3300049742 | Bacteria | 1089 |
| 814 | Ga0501080_1755328 | 3300049742 | Bacteria | 522 |
| 815 | Ga0501081_0002066 | 3300049743 | Bacteria | 12521 |
| 816 | Ga0501081_0003442 | 3300049743 | Bacteria | 10097 |
| 817 | Ga0501081_0013261 | 3300049743 | Bacteria | 5420 |
| 818 | Ga0501081_0038292 | 3300049743 | Bacteria | 3275 |
| 819 | Ga0501081_0188420 | 3300049743 | Bacteria | 1493 |
| 820 | Ga0501081_0205179 | 3300049743 | Bacteria | 1430 |
| 821 | Ga0501081_0265212 | 3300049743 | Bacteria | 1255 |
| 822 | Ga0501081_0405481 | 3300049743 | Bacteria | 1009 |
| 823 | Ga0501081_0859186 | 3300049743 | Bacteria | 683 |
| 824 | Ga0501083_0031126 | 3300049744 | Bacteria | 3662 |
| 825 | Ga0501083_0130108 | 3300049744 | Bacteria | 1650 |
| 826 | Ga0501083_0311386 | 3300049744 | Bacteria | 1024 |
| 827 | Ga0501083_0419515 | 3300049744 | Bacteria | 871 |
| 828 | Ga0501035_0050571 | 3300049822 | Bacteria | 3724 |
| 829 | Ga0501035_0163390 | 3300049822 | Bacteria | 1927 |
| 830 | Ga0501035_1210517 | 3300049822 | Bacteria | 586 |
| 831 | Ga0501044_0619678 | 3300049823 | Bacteria | 974 |
| 832 | Ga0501045_0001958 | 3300049824 | Bacteria | 13907 |
| 833 | Ga0501045_0029292 | 3300049824 | Bacteria | 3979 |
| 834 | Ga0501045_0065298 | 3300049824 | Bacteria | 2672 |
| 835 | Ga0501045_0081861 | 3300049824 | Bacteria | 2380 |
| 836 | Ga0501045_0099188 | 3300049824 | Bacteria | 2155 |
| 837 | Ga0501045_0107916 | 3300049824 | Bacteria | 2063 |
| 838 | Ga0501045_0323108 | 3300049824 | Bacteria | 1148 |
| 839 | Ga0501045_0339243 | 3300049824 | Bacteria | 1118 |
| 840 | nmdc:mga0yw44_606325_c1 | 3300050492 | Bacteria | 744 |
| 841 | nmdc:mga05p37_10_c2 | 3300050507 | Bacteria | 36328 |
| 842 | nmdc:mga05p37_110323_c1 | 3300050507 | Bacteria | 3384 |
| 843 | nmdc:mga05p37_11108_c1 | 3300050507 | Bacteria | 10702 |
| 844 | nmdc:mga05p37_1150835_c1 | 3300050507 | Bacteria | 807 |
| 845 | nmdc:mga05p37_1304217_c1 | 3300050507 | Bacteria | 740 |
| 846 | nmdc:mga05p37_1376606_c1 | 3300050507 | Bacteria | 713 |
| 847 | nmdc:mga05p37_165504_c1 | 3300050507 | Bacteria | 2699 |
| 848 | nmdc:mga05p37_176241_c1 | 3300050507 | Bacteria | 2605 |
| 849 | nmdc:mga05p37_215431_c2 | 3300050507 | Bacteria | 2062 |
| 850 | nmdc:mga05p37_22110_c1 | 3300050507 | Bacteria | 7710 |
| 851 | nmdc:mga05p37_225285_c1 | 3300050507 | Bacteria | 2261 |
| 852 | nmdc:mga05p37_24187_c1 | 3300050507 | Bacteria | 7381 |
| 853 | nmdc:mga05p37_3081_c1 | 3300050507 | Bacteria | 19363 |
| 854 | nmdc:mga05p37_33814_c1 | 3300050507 | Bacteria | 6262 |
| 855 | nmdc:mga05p37_343254_c1 | 3300050507 | Bacteria | 1760 |
| 856 | nmdc:mga05p37_420359_c1 | 3300050507 | Bacteria | 1556 |
| 857 | nmdc:mga05p37_473341_c1 | 3300050507 | Bacteria | 1445 |
| 858 | nmdc:mga05p37_502038_c1 | 3300050507 | Bacteria | 1392 |
| 859 | nmdc:mga05p37_58104_c1 | 3300050507 | Bacteria | 4764 |
| 860 | nmdc:mga05p37_68726_c1 | 3300050507 | Bacteria | 4357 |
| 861 | nmdc:mga05p37_72842_c1 | 3300050507 | Bacteria | 4228 |
| 862 | nmdc:mga09592_124044_c1 | 3300050508 | Bacteria | 2220 |
| 863 | nmdc:mga09592_139739_c1 | 3300050508 | Bacteria | 2087 |
| 864 | nmdc:mga09592_24319_c1 | 3300050508 | Bacteria | 5008 |
| 865 | nmdc:mga09592_298723_c1 | 3300050508 | Bacteria | 1396 |
| 866 | nmdc:mga09592_64762_c1 | 3300050508 | Bacteria | 3095 |
| 867 | nmdc:mga09592_679155_c1 | 3300050508 | Bacteria | 878 |
| 868 | nmdc:mga09592_68297_c1 | 3300050508 | Bacteria | 3015 |
| 869 | nmdc:mga09592_691_c1 | 3300050508 | Bacteria | 25783 |
| 870 | nmdc:mga0qj67_20_c1 | 3300050509 | Bacteria | 109238 |
| 871 | nmdc:mga0qj67_213_c1 | 3300050509 | Bacteria | 39502 |
| 872 | nmdc:mga0qj67_405627_c1 | 3300050509 | Bacteria | 1100 |
| 873 | nmdc:mga0qj67_4979_c1 | 3300050509 | Bacteria | 9655 |
| 874 | nmdc:mga0qj67_946007_c1 | 3300050509 | Bacteria | 678 |
| 875 | nmdc:mga06r32_117248_c1 | 3300050510 | Bacteria | 2624 |
| 876 | nmdc:mga06r32_117406_c1 | 3300050510 | Bacteria | 2622 |
| 877 | nmdc:mga06r32_124811_c1 | 3300050510 | Bacteria | 2542 |
| 878 | nmdc:mga06r32_1358803_c1 | 3300050510 | Bacteria | 653 |
| 879 | nmdc:mga06r32_230362_c1 | 3300050510 | Bacteria | 1841 |
| 880 | nmdc:mga06r32_296559_c1 | 3300050510 | Bacteria | 1603 |
| 881 | nmdc:mga06r32_386083_c1 | 3300050510 | Bacteria | 1383 |
| 882 | nmdc:mga06r32_41821_c1 | 3300050510 | Bacteria | 4356 |
| 883 | nmdc:mga06r32_498246_c1 | 3300050510 | Bacteria | 1195 |
| 884 | nmdc:mga06r32_589473_c1 | 3300050510 | Bacteria | 1083 |
| 885 | nmdc:mga06r32_974080_c1 | 3300050510 | Bacteria | 802 |
| 886 | nmdc:mga08y16_100544_c1 | 3300050511 | Bacteria | 3011 |
| 887 | nmdc:mga08y16_118635_c1 | 3300050511 | Bacteria | 2754 |
| 888 | nmdc:mga08y16_20946_c1 | 3300050511 | Bacteria | 6903 |
| 889 | nmdc:mga08y16_3030_c1 | 3300050511 | Bacteria | 17353 |
| 890 | nmdc:mga08y16_39810_c1 | 3300050511 | Bacteria | 4930 |
| 891 | nmdc:mga08y16_435170_c1 | 3300050511 | Bacteria | 1339 |
| 892 | nmdc:mga08y16_833728_c1 | 3300050511 | Bacteria | 913 |
| 893 | nmdc:mga0n895_104305_c1 | 3300050512 | Bacteria | 2848 |
| 894 | nmdc:mga0n895_111044_c1 | 3300050512 | Bacteria | 2757 |
| 895 | nmdc:mga0n895_163863_c1 | 3300050512 | Bacteria | 2255 |
| 896 | nmdc:mga0n895_1693793_c1 | 3300050512 | Bacteria | 595 |
| 897 | nmdc:mga0n895_19189_c1 | 3300050512 | Bacteria | 6349 |
| 898 | nmdc:mga0n895_192746_c1 | 3300050512 | Bacteria | 2069 |
| 899 | nmdc:mga0n895_210855_c1 | 3300050512 | Bacteria | 1973 |
| 900 | nmdc:mga0n895_2139228_c1 | 3300050512 | Bacteria | 516 |
| 901 | nmdc:mga0n895_227210_c1 | 3300050512 | Bacteria | 1895 |
| 902 | nmdc:mga0n895_305864_c1 | 3300050512 | Bacteria | 1612 |
| 903 | nmdc:mga0n895_450950_c1 | 3300050512 | Bacteria | 1299 |
| 904 | nmdc:mga0n895_54227_c1 | 3300050512 | Bacteria | 3943 |
| 905 | nmdc:mga0n895_59105_c1 | 3300050512 | Bacteria | 3783 |
| 906 | nmdc:mga0n895_848231_c1 | 3300050512 | Bacteria | 902 |
| 907 | nmdc:mga0rr50_122342_c1 | 3300050513 | Bacteria | 2073 |
| 908 | nmdc:mga0rr50_13073_c1 | 3300050513 | Bacteria | 5390 |
| 909 | nmdc:mga0rr50_136396_c1 | 3300050513 | Bacteria | 1970 |
| 910 | nmdc:mga0rr50_136723_c1 | 3300050513 | Bacteria | 1968 |
| 911 | nmdc:mga0rr50_183023_c1 | 3300050513 | Bacteria | 1714 |
| 912 | nmdc:mga0rr50_192906_c1 | 3300050513 | Bacteria | 1671 |
| 913 | nmdc:mga0rr50_234065_c1 | 3300050513 | Bacteria | 1521 |
| 914 | nmdc:mga0rr50_234522_c1 | 3300050513 | Bacteria | 1519 |
| 915 | nmdc:mga0rr50_24525_c1 | 3300050513 | Bacteria | 4178 |
| 916 | nmdc:mga0rr50_35290_c1 | 3300050513 | Bacteria | 3590 |
| 917 | nmdc:mga0rr50_670860_c1 | 3300050513 | Bacteria | 885 |
| 918 | nmdc:mga0rr50_714941_c1 | 3300050513 | Bacteria | 855 |
| 919 | nmdc:mga08x19_475200_c1 | 3300050514 | Bacteria | 881 |
| 920 | nmdc:mga08x19_5200_c1 | 3300050514 | Bacteria | 7695 |
| 921 | nmdc:mga08x19_7608_c2 | 3300050514 | Bacteria | 5574 |
| 922 | nmdc:mga08x19_77092_c1 | 3300050514 | Bacteria | 2182 |
| 923 | nmdc:mga0a205_107897_c1 | 3300050515 | Bacteria | 2683 |
| 924 | nmdc:mga0a205_108965_c1 | 3300050515 | Bacteria | 2668 |
| 925 | nmdc:mga0a205_1236124_c1 | 3300050515 | Bacteria | 595 |
| 926 | nmdc:mga0a205_1419263_c1 | 3300050515 | Bacteria | 542 |
| 927 | nmdc:mga0a205_155793_c1 | 3300050515 | Bacteria | 2183 |
| 928 | nmdc:mga0a205_155980_c1 | 3300050515 | Bacteria | 2181 |
| 929 | nmdc:mga0a205_21891_c2 | 3300050515 | Bacteria | 5708 |
| 930 | nmdc:mga0a205_257705_c1 | 3300050515 | Bacteria | 1622 |
| 931 | nmdc:mga0a205_280858_c1 | 3300050515 | Bacteria | 1540 |
| 932 | nmdc:mga0a205_317158_c1 | 3300050515 | Bacteria | 1430 |
| 933 | nmdc:mga0a205_339970_c1 | 3300050515 | Bacteria | 1370 |
| 934 | nmdc:mga0a205_418275_c1 | 3300050515 | Bacteria | 1203 |
| 935 | nmdc:mga0a205_434535_c1 | 3300050515 | Bacteria | 1174 |
| 936 | nmdc:mga0a205_44592_c1 | 3300050515 | Bacteria | 4276 |
| 937 | nmdc:mga0a205_689510_c1 | 3300050515 | Bacteria | 872 |
| 938 | nmdc:mga0a205_865812_c1 | 3300050515 | Bacteria | 751 |
| 939 | nmdc:mga0a205_898_c1 | 3300050515 | Bacteria | 9990 |
| 940 | nmdc:mga0a205_89972_c1 | 3300050515 | Bacteria | 2966 |
| 941 | nmdc:mga0a205_99806_c1 | 3300050515 | Bacteria | 2802 |
| 942 | Ga0495601_0157641 | 3300053077 | Bacteria | 1483 |
| 943 | Ga0495655_0077900 | 3300053083 | Bacteria | 941 |
| 944 | Ga0495655_0229258 | 3300053083 | Bacteria | 618 |
| 945 | Ga0501084_0001662 | 3300054114 | Bacteria | 17693 |
| 946 | Ga0501084_0002436 | 3300054114 | Bacteria | 14981 |
| 947 | Ga0501084_0027116 | 3300054114 | Bacteria | 4787 |
| 948 | Ga0501084_0029997 | 3300054114 | Bacteria | 4549 |
| 949 | Ga0501084_0078448 | 3300054114 | Bacteria | 2768 |
| 950 | Ga0501084_0112610 | 3300054114 | Bacteria | 2286 |
| 951 | Ga0501084_0174967 | 3300054114 | Bacteria | 1811 |
| 952 | Ga0501084_0241711 | 3300054114 | Bacteria | 1524 |
| 953 | Ga0501084_0469717 | 3300054114 | Bacteria | 1063 |
| 954 | Ga0501084_0629801 | 3300054114 | Bacteria | 906 |
| 955 | Ga0501084_0636977 | 3300054114 | Bacteria | 900 |
| 956 | Ga0501084_1051042 | 3300054114 | Bacteria | 684 |
| 957 | Ga0501084_1481991 | 3300054114 | Bacteria | 568 |
| 958 | Ga0587073_0018764 | 3300059492 | Bacteria | 1297 |
| 959 | Ga0587085_047909 | 3300059506 | Bacteria | 769 |
| 960 | Ga0587094_016200 | 3300059513 | Bacteria | 1035 |
| 961 | Ga0587125_037493 | 3300059607 | Bacteria | 643 |
| 962 | Ga0587062_060626 | 3300059639 | Bacteria | 663 |
| 963 | Ga0587069_052092 | 3300059642 | Bacteria | 731 |
| 964 | Ga0587076_065070 | 3300059645 | Bacteria | 744 |
| 965 | Ga0587079_017136 | 3300059647 | Bacteria | 1253 |
| 966 | Ga0587119_031195 | 3300059658 | Bacteria | 729 |
| 967 | Ga0587071_019649 | 3300060344 | Bacteria | 1224 |
| 968 | Ga0501082_0000567 | 3300060353 | Bacteria | 32890 |
| 969 | Ga0501082_0002744 | 3300060353 | Bacteria | 15383 |
| 970 | Ga0501082_0063843 | 3300060353 | Bacteria | 3171 |
| 971 | Ga0501082_0070395 | 3300060353 | Bacteria | 3012 |
| 972 | Ga0501082_0114863 | 3300060353 | Bacteria | 2331 |
| 973 | Ga0501082_0129072 | 3300060353 | Bacteria | 2193 |
| 974 | Ga0501082_0232715 | 3300060353 | Bacteria | 1604 |
| 975 | Ga0501082_0517397 | 3300060353 | Bacteria | 1043 |
| 976 | Ga0501082_0548297 | 3300060353 | Bacteria | 1011 |
| 977 | Ga0501082_1820701 | 3300060353 | Bacteria | 531 |
| 978 | Ga0530510_0000004 | 3300061734 | Bacteria | 256134 |
| 979 | Ga0530510_0008337 | 3300061734 | Bacteria | 7226 |
| 980 | Ga0530510_0013854 | 3300061734 | Bacteria | 5678 |
| 981 | Ga0530510_0029094 | 3300061734 | Bacteria | 3964 |
| 982 | Ga0530510_0072726 | 3300061734 | Bacteria | 2495 |
| 983 | Ga0530510_0122308 | 3300061734 | Bacteria | 1911 |
| 984 | Ga0530510_0146636 | 3300061734 | Bacteria | 1741 |
| 985 | Ga0530510_0985166 | 3300061734 | Bacteria | 645 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049822 | Ga0501035_1210517 | Ga0501035_1210517_140_574 | 144 |
| 2 | 3300049584 | Ga0501068_0688180 | Ga0501068_0688180_10_447 | 145 |
| 3 | 3300006852 | Ga0075433_10051057 | Ga0075433_100510572 | 146 |
| 4 | 3300006880 | Ga0075429_100004656 | Ga0075429_10000465611 | 146 |
| 5 | 3300009094 | Ga0111539_10031067 | Ga0111539_100310671 | 146 |
| 6 | 3300013306 | Ga0163162_12202501 | Ga0163162_122025011 | 146 |
| 7 | 3300027907 | Ga0207428_10044235 | Ga0207428_100442355 | 146 |
| 8 | 3300050507 | nmdc:mga05p37_68726_c1 | nmdc:mga05p37_68726_c1_2266_2742 | 146 |
| 9 | 3300050511 | nmdc:mga08y16_39810_c1 | nmdc:mga08y16_39810_c1_1028_1504 | 146 |
| 10 | 3300050515 | nmdc:mga0a205_21891_c2 | nmdc:mga0a205_21891_c2_989_1465 | 146 |
| 11 | 3300037853 | Ga0436364_0919003 | Ga0436364_0919003_39_497 | 147 |
| 12 | 3300039437 | Ga0436365_0458953 | Ga0436365_0458953_27_476 | 147 |
| 13 | 3300049573 | Ga0501037_0780216 | Ga0501037_0780216_173_622 | 149 |
| 14 | 3300050515 | nmdc:mga0a205_1236124_c1 | nmdc:mga0a205_1236124_c1_131_580 | 149 |
| 15 | 3300060353 | Ga0501082_0129072 | Ga0501082_0129072_1734_2183 | 149 |
| 16 | 3300042461 | Ga0439460_0121931 | Ga0439460_0121931_10_468 | 151 |
| 17 | iso_pu_bacteria | 2883577096 | 2883578823 | 155 |
| 18 | 3300025932 | Ga0207690_10438317 | Ga0207690_104383172 | 156 |
| 19 | 3300005334 | Ga0068869_100044411 | Ga0068869_1000444113 | 157 |
| 20 | 3300005336 | Ga0070680_101112701 | Ga0070680_1011127011 | 157 |
| 21 | 3300005338 | Ga0068868_100499687 | Ga0068868_1004996872 | 157 |
| 22 | 3300005338 | Ga0068868_101184152 | Ga0068868_1011841521 | 157 |
| 23 | 3300005345 | Ga0070692_10701617 | Ga0070692_107016171 | 157 |
| 24 | 3300005355 | Ga0070671_101301815 | Ga0070671_1013018151 | 157 |
| 25 | 3300005356 | Ga0070674_100446429 | Ga0070674_1004464291 | 157 |
| 26 | 3300005364 | Ga0070673_100110285 | Ga0070673_1001102852 | 157 |
| 27 | 3300005366 | Ga0070659_100119732 | Ga0070659_1001197322 | 157 |
| 28 | 3300005367 | Ga0070667_100196926 | Ga0070667_1001969262 | 157 |
| 29 | 3300005440 | Ga0070705_100416987 | Ga0070705_1004169872 | 157 |
| 30 | 3300005441 | Ga0070700_100149986 | Ga0070700_1001499862 | 157 |
| 31 | 3300005455 | Ga0070663_100190403 | Ga0070663_1001904032 | 157 |
| 32 | 3300005459 | Ga0068867_100319072 | Ga0068867_1003190721 | 157 |
| 33 | 3300005459 | Ga0068867_100724490 | Ga0068867_1007244902 | 157 |
| 34 | 3300005518 | Ga0070699_101070359 | Ga0070699_1010703592 | 157 |
| 35 | 3300005536 | Ga0070697_100584071 | Ga0070697_1005840711 | 157 |
| 36 | 3300005545 | Ga0070695_100573701 | Ga0070695_1005737012 | 157 |
| 37 | 3300005546 | Ga0070696_100031968 | Ga0070696_1000319686 | 157 |
| 38 | 3300005548 | Ga0070665_101806334 | Ga0070665_1018063341 | 157 |
| 39 | 3300005578 | Ga0068854_100222754 | Ga0068854_1002227542 | 157 |
| 40 | 3300005578 | Ga0068854_101237750 | Ga0068854_1012377502 | 157 |
| 41 | 3300005617 | Ga0068859_100040934 | Ga0068859_1000409345 | 157 |
| 42 | 3300005618 | Ga0068864_101619876 | Ga0068864_1016198761 | 157 |
| 43 | 3300005618 | Ga0068864_101688582 | Ga0068864_1016885821 | 157 |
| 44 | 3300005718 | Ga0068866_10148658 | Ga0068866_101486582 | 157 |
| 45 | 3300005719 | Ga0068861_100850372 | Ga0068861_1008503722 | 157 |
| 46 | 3300005840 | Ga0068870_10253991 | Ga0068870_102539912 | 157 |
| 47 | 3300005842 | Ga0068858_102027672 | Ga0068858_1020276721 | 157 |
| 48 | 3300005843 | Ga0068860_100088058 | Ga0068860_1000880582 | 157 |
| 49 | 3300005844 | Ga0068862_100287626 | Ga0068862_1002876262 | 157 |
| 50 | 3300006237 | Ga0097621_100077672 | Ga0097621_1000776722 | 157 |
| 51 | 3300006358 | Ga0068871_100016719 | Ga0068871_1000167192 | 157 |
| 52 | 3300006844 | Ga0075428_100065646 | Ga0075428_1000656462 | 157 |
| 53 | 3300006847 | Ga0075431_100143192 | Ga0075431_1001431924 | 157 |
| 54 | 3300006931 | Ga0097620_100040939 | Ga0097620_1000409392 | 157 |
| 55 | 3300009098 | Ga0105245_10065829 | Ga0105245_100658293 | 157 |
| 56 | 3300009098 | Ga0105245_10207577 | Ga0105245_102075772 | 157 |
| 57 | 3300009101 | Ga0105247_10518355 | Ga0105247_105183552 | 157 |
| 58 | 3300009147 | Ga0114129_10028218 | Ga0114129_100282182 | 157 |
| 59 | 3300009174 | Ga0105241_10474399 | Ga0105241_104743991 | 157 |
| 60 | 3300009176 | Ga0105242_10771746 | Ga0105242_107717461 | 157 |
| 61 | 3300009176 | Ga0105242_11307692 | Ga0105242_113076921 | 157 |
| 62 | 3300009177 | Ga0105248_10029051 | Ga0105248_100290515 | 157 |
| 63 | 3300009553 | Ga0105249_10457710 | Ga0105249_104577102 | 157 |
| 64 | 3300010375 | Ga0105239_10350730 | Ga0105239_103507302 | 157 |
| 65 | 3300010375 | Ga0105239_10546863 | Ga0105239_105468632 | 157 |
| 66 | 3300013100 | Ga0157373_10415463 | Ga0157373_104154632 | 157 |
| 67 | 3300013296 | Ga0157374_10379589 | Ga0157374_103795891 | 157 |
| 68 | 3300013297 | Ga0157378_10283272 | Ga0157378_102832722 | 157 |
| 69 | 3300013308 | Ga0157375_10117305 | Ga0157375_101173053 | 157 |
| 70 | 3300013308 | Ga0157375_10602785 | Ga0157375_106027852 | 157 |
| 71 | 3300014745 | Ga0157377_10643039 | Ga0157377_106430392 | 157 |
| 72 | 3300014969 | Ga0157376_10014946 | Ga0157376_100149468 | 157 |
| 73 | 3300025899 | Ga0207642_10472198 | Ga0207642_104721982 | 157 |
| 74 | 3300025901 | Ga0207688_10208794 | Ga0207688_102087942 | 157 |
| 75 | 3300025908 | Ga0207643_10304997 | Ga0207643_103049971 | 157 |
| 76 | 3300025917 | Ga0207660_10337425 | Ga0207660_103374252 | 157 |
| 77 | 3300025927 | Ga0207687_10539324 | Ga0207687_105393242 | 157 |
| 78 | 3300025937 | Ga0207669_10580535 | Ga0207669_105805352 | 157 |
| 79 | 3300025941 | Ga0207711_10040996 | Ga0207711_100409965 | 157 |
| 80 | 3300025942 | Ga0207689_10008358 | Ga0207689_100083584 | 157 |
| 81 | 3300025960 | Ga0207651_10046301 | Ga0207651_100463012 | 157 |
| 82 | 3300025960 | Ga0207651_10930530 | Ga0207651_109305302 | 157 |
| 83 | 3300025961 | Ga0207712_10777186 | Ga0207712_107771862 | 157 |
| 84 | 3300026089 | Ga0207648_10780321 | Ga0207648_107803212 | 157 |
| 85 | 3300026095 | Ga0207676_11065497 | Ga0207676_110654972 | 157 |
| 86 | 3300026142 | Ga0207698_10730461 | Ga0207698_107304612 | 157 |
| 87 | 3300028379 | Ga0268266_10593184 | Ga0268266_105931841 | 157 |
| 88 | 3300028379 | Ga0268266_10849902 | Ga0268266_108499022 | 157 |
| 89 | 3300028380 | Ga0268265_10047714 | Ga0268265_100477143 | 157 |
| 90 | 3300028381 | Ga0268264_10085848 | Ga0268264_100858482 | 157 |
| 91 | 3300042876 | Ga0451577_0489708 | Ga0451577_0489708_613_1086 | 157 |
| 92 | 3300045051 | Ga0451576_0859957 | Ga0451576_0859957_30_503 | 157 |
| 93 | 3300048911 | Ga0496108_0402841 | Ga0496108_0402841_593_1066 | 157 |
| 94 | 3300048917 | Ga0496114_0401428 | Ga0496114_0401428_481_954 | 157 |
| 95 | 3300049577 | Ga0501041_0443705 | Ga0501041_0443705_12_485 | 157 |
| 96 | 3300050507 | nmdc:mga05p37_473341_c1 | nmdc:mga05p37_473341_c1_396_869 | 157 |
| 97 | 3300050510 | nmdc:mga06r32_296559_c1 | nmdc:mga06r32_296559_c1_211_684 | 157 |
| 98 | 3300050510 | nmdc:mga06r32_589473_c1 | nmdc:mga06r32_589473_c1_92_565 | 157 |
| 99 | 3300003203 | JGI25406J46586_10007285 | JGI25406J46586_100072852 | 158 |
| 100 | 3300003349 | JGI26129J50193_1008337 | JGI26129J50193_10083371 | 158 |
| 101 | 3300003502 | JGI26143J51219_1003405 | JGI26143J51219_10034051 | 158 |
| 102 | 3300003503 | JGI26141J51220_1000584 | JGI26141J51220_10005842 | 158 |
| 103 | 3300005290 | Ga0065712_10423211 | Ga0065712_104232111 | 158 |
| 104 | 3300005293 | Ga0065715_10296131 | Ga0065715_102961312 | 158 |
| 105 | 3300005295 | Ga0065707_10390724 | Ga0065707_103907242 | 158 |
| 106 | 3300005295 | Ga0065707_10404512 | Ga0065707_104045121 | 158 |
| 107 | 3300005328 | Ga0070676_10004015 | Ga0070676_100040157 | 158 |
| 108 | 3300005329 | Ga0070683_101408036 | Ga0070683_1014080362 | 158 |
| 109 | 3300005330 | Ga0070690_100209186 | Ga0070690_1002091862 | 158 |
| 110 | 3300005330 | Ga0070690_100209579 | Ga0070690_1002095792 | 158 |
| 111 | 3300005331 | Ga0070670_100004063 | Ga0070670_1000040639 | 158 |
| 112 | 3300005333 | Ga0070677_10272643 | Ga0070677_102726432 | 158 |
| 113 | 3300005334 | Ga0068869_100002574 | Ga0068869_1000025748 | 158 |
| 114 | 3300005336 | Ga0070680_100002172 | Ga0070680_1000021727 | 158 |
| 115 | 3300005336 | Ga0070680_100004422 | Ga0070680_1000044222 | 158 |
| 116 | 3300005337 | Ga0070682_100001008 | Ga0070682_1000010089 | 158 |
| 117 | 3300005338 | Ga0068868_100010262 | Ga0068868_1000102629 | 158 |
| 118 | 3300005339 | Ga0070660_100000640 | Ga0070660_10000064018 | 158 |
| 119 | 3300005340 | Ga0070689_100049933 | Ga0070689_1000499332 | 158 |
| 120 | 3300005340 | Ga0070689_100114015 | Ga0070689_1001140152 | 158 |
| 121 | 3300005341 | Ga0070691_10062672 | Ga0070691_100626722 | 158 |
| 122 | 3300005343 | Ga0070687_100080856 | Ga0070687_1000808562 | 158 |
| 123 | 3300005343 | Ga0070687_100118966 | Ga0070687_1001189662 | 158 |
| 124 | 3300005343 | Ga0070687_100320400 | Ga0070687_1003204001 | 158 |
| 125 | 3300005344 | Ga0070661_100001216 | Ga0070661_10000121612 | 158 |
| 126 | 3300005345 | Ga0070692_10000146 | Ga0070692_1000014610 | 158 |
| 127 | 3300005345 | Ga0070692_10091917 | Ga0070692_100919172 | 158 |
| 128 | 3300005347 | Ga0070668_100275489 | Ga0070668_1002754892 | 158 |
| 129 | 3300005353 | Ga0070669_100011392 | Ga0070669_1000113923 | 158 |
| 130 | 3300005353 | Ga0070669_100040026 | Ga0070669_1000400262 | 158 |
| 131 | 3300005355 | Ga0070671_100120448 | Ga0070671_1001204482 | 158 |
| 132 | 3300005356 | Ga0070674_100361852 | Ga0070674_1003618522 | 158 |
| 133 | 3300005364 | Ga0070673_100003150 | Ga0070673_10000315011 | 158 |
| 134 | 3300005365 | Ga0070688_100228288 | Ga0070688_1002282882 | 158 |
| 135 | 3300005365 | Ga0070688_100666430 | Ga0070688_1006664302 | 158 |
| 136 | 3300005366 | Ga0070659_100021962 | Ga0070659_1000219625 | 158 |
| 137 | 3300005366 | Ga0070659_100322323 | Ga0070659_1003223232 | 158 |
| 138 | 3300005406 | Ga0070703_10017718 | Ga0070703_100177182 | 158 |
| 139 | 3300005434 | Ga0070709_10223836 | Ga0070709_102238362 | 158 |
| 140 | 3300005438 | Ga0070701_10147423 | Ga0070701_101474232 | 158 |
| 141 | 3300005439 | Ga0070711_100157219 | Ga0070711_1001572192 | 158 |
| 142 | 3300005440 | Ga0070705_100002474 | Ga0070705_1000024748 | 158 |
| 143 | 3300005440 | Ga0070705_100012222 | Ga0070705_1000122222 | 158 |
| 144 | 3300005440 | Ga0070705_100256428 | Ga0070705_1002564282 | 158 |
| 145 | 3300005440 | Ga0070705_100462297 | Ga0070705_1004622972 | 158 |
| 146 | 3300005440 | Ga0070705_100466375 | Ga0070705_1004663752 | 158 |
| 147 | 3300005440 | Ga0070705_100470174 | Ga0070705_1004701742 | 158 |
| 148 | 3300005440 | Ga0070705_100604398 | Ga0070705_1006043982 | 158 |
| 149 | 3300005444 | Ga0070694_100004086 | Ga0070694_1000040868 | 158 |
| 150 | 3300005444 | Ga0070694_100007127 | Ga0070694_1000071272 | 158 |
| 151 | 3300005444 | Ga0070694_100062516 | Ga0070694_1000625163 | 158 |
| 152 | 3300005444 | Ga0070694_100136691 | Ga0070694_1001366912 | 158 |
| 153 | 3300005444 | Ga0070694_100265343 | Ga0070694_1002653432 | 158 |
| 154 | 3300005445 | Ga0070708_100139006 | Ga0070708_1001390062 | 158 |
| 155 | 3300005445 | Ga0070708_100418011 | Ga0070708_1004180112 | 158 |
| 156 | 3300005445 | Ga0070708_100478830 | Ga0070708_1004788301 | 158 |
| 157 | 3300005445 | Ga0070708_100508394 | Ga0070708_1005083942 | 158 |
| 158 | 3300005455 | Ga0070663_100000406 | Ga0070663_1000004063 | 158 |
| 159 | 3300005457 | Ga0070662_100001878 | Ga0070662_1000018788 | 158 |
| 160 | 3300005457 | Ga0070662_100065815 | Ga0070662_1000658152 | 158 |
| 161 | 3300005457 | Ga0070662_100163857 | Ga0070662_1001638573 | 158 |
| 162 | 3300005458 | Ga0070681_10033286 | Ga0070681_100332862 | 158 |
| 163 | 3300005458 | Ga0070681_10065079 | Ga0070681_100650792 | 158 |
| 164 | 3300005459 | Ga0068867_100011546 | Ga0068867_1000115464 | 158 |
| 165 | 3300005466 | Ga0070685_10141728 | Ga0070685_101417282 | 158 |
| 166 | 3300005467 | Ga0070706_100331783 | Ga0070706_1003317832 | 158 |
| 167 | 3300005467 | Ga0070706_100410113 | Ga0070706_1004101132 | 158 |
| 168 | 3300005467 | Ga0070706_100834617 | Ga0070706_1008346172 | 158 |
| 169 | 3300005468 | Ga0070707_100015488 | Ga0070707_1000154884 | 158 |
| 170 | 3300005468 | Ga0070707_100022930 | Ga0070707_1000229309 | 158 |
| 171 | 3300005468 | Ga0070707_100063778 | Ga0070707_1000637785 | 158 |
| 172 | 3300005468 | Ga0070707_100127300 | Ga0070707_1001273002 | 158 |
| 173 | 3300005468 | Ga0070707_100207126 | Ga0070707_1002071262 | 158 |
| 174 | 3300005468 | Ga0070707_100361810 | Ga0070707_1003618102 | 158 |
| 175 | 3300005468 | Ga0070707_100442938 | Ga0070707_1004429382 | 158 |
| 176 | 3300005468 | Ga0070707_100640623 | Ga0070707_1006406232 | 158 |
| 177 | 3300005471 | Ga0070698_100012020 | Ga0070698_1000120206 | 158 |
| 178 | 3300005471 | Ga0070698_100069460 | Ga0070698_1000694604 | 158 |
| 179 | 3300005471 | Ga0070698_100134844 | Ga0070698_1001348442 | 158 |
| 180 | 3300005471 | Ga0070698_100163951 | Ga0070698_1001639512 | 158 |
| 181 | 3300005518 | Ga0070699_100030129 | Ga0070699_1000301294 | 158 |
| 182 | 3300005518 | Ga0070699_100104327 | Ga0070699_1001043272 | 158 |
| 183 | 3300005518 | Ga0070699_100131231 | Ga0070699_1001312313 | 158 |
| 184 | 3300005518 | Ga0070699_101013109 | Ga0070699_1010131091 | 158 |
| 185 | 3300005518 | Ga0070699_101294756 | Ga0070699_1012947562 | 158 |
| 186 | 3300005530 | Ga0070679_100045451 | Ga0070679_1000454512 | 158 |
| 187 | 3300005530 | Ga0070679_100372990 | Ga0070679_1003729902 | 158 |
| 188 | 3300005535 | Ga0070684_100019531 | Ga0070684_1000195317 | 158 |
| 189 | 3300005536 | Ga0070697_100144825 | Ga0070697_1001448253 | 158 |
| 190 | 3300005536 | Ga0070697_100182414 | Ga0070697_1001824141 | 158 |
| 191 | 3300005536 | Ga0070697_100988538 | Ga0070697_1009885382 | 158 |
| 192 | 3300005536 | Ga0070697_101050416 | Ga0070697_1010504162 | 158 |
| 193 | 3300005539 | Ga0068853_100001025 | Ga0068853_10000102510 | 158 |
| 194 | 3300005539 | Ga0068853_100369474 | Ga0068853_1003694742 | 158 |
| 195 | 3300005545 | Ga0070695_100001024 | Ga0070695_1000010246 | 158 |
| 196 | 3300005545 | Ga0070695_100003752 | Ga0070695_1000037523 | 158 |
| 197 | 3300005545 | Ga0070695_100009964 | Ga0070695_1000099643 | 158 |
| 198 | 3300005546 | Ga0070696_100001263 | Ga0070696_1000012638 | 158 |
| 199 | 3300005546 | Ga0070696_101076766 | Ga0070696_1010767662 | 158 |
| 200 | 3300005547 | Ga0070693_100000283 | Ga0070693_1000002835 | 158 |
| 201 | 3300005549 | Ga0070704_100001095 | Ga0070704_10000109511 | 158 |
| 202 | 3300005549 | Ga0070704_100078534 | Ga0070704_1000785342 | 158 |
| 203 | 3300005549 | Ga0070704_100151316 | Ga0070704_1001513162 | 158 |
| 204 | 3300005549 | Ga0070704_100463494 | Ga0070704_1004634942 | 158 |
| 205 | 3300005549 | Ga0070704_100628815 | Ga0070704_1006288152 | 158 |
| 206 | 3300005549 | Ga0070704_100886333 | Ga0070704_1008863332 | 158 |
| 207 | 3300005563 | Ga0068855_100012218 | Ga0068855_1000122187 | 158 |
| 208 | 3300005564 | Ga0070664_100028474 | Ga0070664_1000284746 | 158 |
| 209 | 3300005577 | Ga0068857_100008128 | Ga0068857_1000081286 | 158 |
| 210 | 3300005577 | Ga0068857_100945263 | Ga0068857_1009452631 | 158 |
| 211 | 3300005578 | Ga0068854_100002085 | Ga0068854_1000020853 | 158 |
| 212 | 3300005614 | Ga0068856_100006402 | Ga0068856_1000064026 | 158 |
| 213 | 3300005615 | Ga0070702_100668533 | Ga0070702_1006685331 | 158 |
| 214 | 3300005616 | Ga0068852_100130378 | Ga0068852_1001303782 | 158 |
| 215 | 3300005617 | Ga0068859_100007763 | Ga0068859_1000077639 | 158 |
| 216 | 3300005718 | Ga0068866_10397631 | Ga0068866_103976312 | 158 |
| 217 | 3300005719 | Ga0068861_100211805 | Ga0068861_1002118052 | 158 |
| 218 | 3300005840 | Ga0068870_10006834 | Ga0068870_100068343 | 158 |
| 219 | 3300005841 | Ga0068863_100133356 | Ga0068863_1001333563 | 158 |
| 220 | 3300005842 | Ga0068858_100024588 | Ga0068858_1000245883 | 158 |
| 221 | 3300005842 | Ga0068858_100081692 | Ga0068858_1000816922 | 158 |
| 222 | 3300005843 | Ga0068860_100036613 | Ga0068860_1000366132 | 158 |
| 223 | 3300005843 | Ga0068860_100540365 | Ga0068860_1005403652 | 158 |
| 224 | 3300005844 | Ga0068862_100814698 | Ga0068862_1008146982 | 158 |
| 225 | 3300005844 | Ga0068862_101313559 | Ga0068862_1013135592 | 158 |
| 226 | 3300005844 | Ga0068862_101329171 | Ga0068862_1013291712 | 158 |
| 227 | 3300005844 | Ga0068862_101508571 | Ga0068862_1015085711 | 158 |
| 228 | 3300005844 | Ga0068862_101754312 | Ga0068862_1017543121 | 158 |
| 229 | 3300005937 | Ga0081455_10000433 | Ga0081455_1000043357 | 158 |
| 230 | 3300005983 | Ga0081540_1013630 | Ga0081540_10136302 | 158 |
| 231 | 3300005983 | Ga0081540_1020165 | Ga0081540_10201652 | 158 |
| 232 | 3300005985 | Ga0081539_10000271 | Ga0081539_10000271104 | 158 |
| 233 | 3300005985 | Ga0081539_10031960 | Ga0081539_100319604 | 158 |
| 234 | 3300006058 | Ga0075432_10195733 | Ga0075432_101957331 | 158 |
| 235 | 3300006173 | Ga0070716_100007411 | Ga0070716_1000074114 | 158 |
| 236 | 3300006175 | Ga0070712_100008516 | Ga0070712_1000085162 | 158 |
| 237 | 3300006237 | Ga0097621_100334041 | Ga0097621_1003340412 | 158 |
| 238 | 3300006844 | Ga0075428_100002741 | Ga0075428_1000027418 | 158 |
| 239 | 3300006844 | Ga0075428_100405075 | Ga0075428_1004050752 | 158 |
| 240 | 3300006844 | Ga0075428_101005400 | Ga0075428_1010054002 | 158 |
| 241 | 3300006844 | Ga0075428_101578210 | Ga0075428_1015782102 | 158 |
| 242 | 3300006846 | Ga0075430_100000995 | Ga0075430_10000099521 | 158 |
| 243 | 3300006846 | Ga0075430_100002448 | Ga0075430_1000024488 | 158 |
| 244 | 3300006846 | Ga0075430_100260267 | Ga0075430_1002602672 | 158 |
| 245 | 3300006846 | Ga0075430_100764138 | Ga0075430_1007641382 | 158 |
| 246 | 3300006846 | Ga0075430_101262432 | Ga0075430_1012624322 | 158 |
| 247 | 3300006847 | Ga0075431_100000752 | Ga0075431_1000007523 | 158 |
| 248 | 3300006847 | Ga0075431_100001235 | Ga0075431_10000123511 | 158 |
| 249 | 3300006847 | Ga0075431_100076567 | Ga0075431_1000765673 | 158 |
| 250 | 3300006847 | Ga0075431_100150704 | Ga0075431_1001507042 | 158 |
| 251 | 3300006847 | Ga0075431_100265087 | Ga0075431_1002650872 | 158 |
| 252 | 3300006847 | Ga0075431_100437654 | Ga0075431_1004376542 | 158 |
| 253 | 3300006847 | Ga0075431_100444681 | Ga0075431_1004446812 | 158 |
| 254 | 3300006847 | Ga0075431_100563302 | Ga0075431_1005633022 | 158 |
| 255 | 3300006852 | Ga0075433_10005518 | Ga0075433_100055182 | 158 |
| 256 | 3300006852 | Ga0075433_10010752 | Ga0075433_100107524 | 158 |
| 257 | 3300006852 | Ga0075433_10011103 | Ga0075433_100111038 | 158 |
| 258 | 3300006852 | Ga0075433_10011169 | Ga0075433_100111694 | 158 |
| 259 | 3300006852 | Ga0075433_10042460 | Ga0075433_100424603 | 158 |
| 260 | 3300006852 | Ga0075433_10088566 | Ga0075433_100885665 | 158 |
| 261 | 3300006852 | Ga0075433_10216863 | Ga0075433_102168632 | 158 |
| 262 | 3300006852 | Ga0075433_10639867 | Ga0075433_106398672 | 158 |
| 263 | 3300006871 | Ga0075434_100001101 | Ga0075434_1000011015 | 158 |
| 264 | 3300006871 | Ga0075434_100006381 | Ga0075434_1000063815 | 158 |
| 265 | 3300006871 | Ga0075434_100012476 | Ga0075434_1000124762 | 158 |
| 266 | 3300006871 | Ga0075434_100123037 | Ga0075434_1001230372 | 158 |
| 267 | 3300006871 | Ga0075434_100149430 | Ga0075434_1001494302 | 158 |
| 268 | 3300006871 | Ga0075434_100169638 | Ga0075434_1001696382 | 158 |
| 269 | 3300006871 | Ga0075434_100651464 | Ga0075434_1006514642 | 158 |
| 270 | 3300006871 | Ga0075434_100734418 | Ga0075434_1007344182 | 158 |
| 271 | 3300006880 | Ga0075429_100020795 | Ga0075429_1000207954 | 158 |
| 272 | 3300006880 | Ga0075429_100076937 | Ga0075429_1000769372 | 158 |
| 273 | 3300006880 | Ga0075429_100154437 | Ga0075429_1001544372 | 158 |
| 274 | 3300006880 | Ga0075429_100670331 | Ga0075429_1006703312 | 158 |
| 275 | 3300006881 | Ga0068865_100677762 | Ga0068865_1006777622 | 158 |
| 276 | 3300006914 | Ga0075436_100003124 | Ga0075436_10000312410 | 158 |
| 277 | 3300006914 | Ga0075436_100044152 | Ga0075436_1000441522 | 158 |
| 278 | 3300006914 | Ga0075436_100051420 | Ga0075436_1000514202 | 158 |
| 279 | 3300006914 | Ga0075436_100109161 | Ga0075436_1001091612 | 158 |
| 280 | 3300006914 | Ga0075436_100137139 | Ga0075436_1001371392 | 158 |
| 281 | 3300006931 | Ga0097620_100007763 | Ga0097620_1000077639 | 158 |
| 282 | 3300007076 | Ga0075435_100002353 | Ga0075435_10000235314 | 158 |
| 283 | 3300007076 | Ga0075435_100021024 | Ga0075435_1000210242 | 158 |
| 284 | 3300007076 | Ga0075435_100022841 | Ga0075435_1000228412 | 158 |
| 285 | 3300007076 | Ga0075435_100054365 | Ga0075435_1000543653 | 158 |
| 286 | 3300007076 | Ga0075435_100081871 | Ga0075435_1000818712 | 158 |
| 287 | 3300007076 | Ga0075435_100125869 | Ga0075435_1001258692 | 158 |
| 288 | 3300007076 | Ga0075435_100145541 | Ga0075435_1001455412 | 158 |
| 289 | 3300007076 | Ga0075435_100162891 | Ga0075435_1001628912 | 158 |
| 290 | 3300007076 | Ga0075435_100298474 | Ga0075435_1002984742 | 158 |
| 291 | 3300007076 | Ga0075435_100656691 | Ga0075435_1006566912 | 158 |
| 292 | 3300007076 | Ga0075435_100680290 | Ga0075435_1006802902 | 158 |
| 293 | 3300007265 | Ga0099794_10009756 | Ga0099794_100097563 | 158 |
| 294 | 3300007265 | Ga0099794_10025349 | Ga0099794_100253492 | 158 |
| 295 | 3300007265 | Ga0099794_10156857 | Ga0099794_101568572 | 158 |
| 296 | 3300009094 | Ga0111539_10001442 | Ga0111539_1000144225 | 158 |
| 297 | 3300009094 | Ga0111539_10014162 | Ga0111539_1001416214 | 158 |
| 298 | 3300009094 | Ga0111539_10020969 | Ga0111539_100209696 | 158 |
| 299 | 3300009094 | Ga0111539_10354573 | Ga0111539_103545732 | 158 |
| 300 | 3300009094 | Ga0111539_10389826 | Ga0111539_103898262 | 158 |
| 301 | 3300009094 | Ga0111539_12912666 | Ga0111539_129126661 | 158 |
| 302 | 3300009098 | Ga0105245_10174146 | Ga0105245_101741462 | 158 |
| 303 | 3300009098 | Ga0105245_10444356 | Ga0105245_104443562 | 158 |
| 304 | 3300009098 | Ga0105245_10931350 | Ga0105245_109313502 | 158 |
| 305 | 3300009147 | Ga0114129_10000643 | Ga0114129_1000064333 | 158 |
| 306 | 3300009147 | Ga0114129_10004885 | Ga0114129_100048852 | 158 |
| 307 | 3300009147 | Ga0114129_10044584 | Ga0114129_100445845 | 158 |
| 308 | 3300009147 | Ga0114129_10044676 | Ga0114129_100446767 | 158 |
| 309 | 3300009147 | Ga0114129_10046650 | Ga0114129_100466502 | 158 |
| 310 | 3300009147 | Ga0114129_10064689 | Ga0114129_100646892 | 158 |
| 311 | 3300009147 | Ga0114129_10079570 | Ga0114129_100795706 | 158 |
| 312 | 3300009147 | Ga0114129_10107834 | Ga0114129_101078346 | 158 |
| 313 | 3300009147 | Ga0114129_10285840 | Ga0114129_102858402 | 158 |
| 314 | 3300009147 | Ga0114129_10293245 | Ga0114129_102932452 | 158 |
| 315 | 3300009147 | Ga0114129_10296921 | Ga0114129_102969213 | 158 |
| 316 | 3300009147 | Ga0114129_10609532 | Ga0114129_106095322 | 158 |
| 317 | 3300009147 | Ga0114129_10673114 | Ga0114129_106731142 | 158 |
| 318 | 3300009147 | Ga0114129_10909256 | Ga0114129_109092562 | 158 |
| 319 | 3300009148 | Ga0105243_11760599 | Ga0105243_117605991 | 158 |
| 320 | 3300009148 | Ga0105243_11867401 | Ga0105243_118674012 | 158 |
| 321 | 3300009174 | Ga0105241_10001312 | Ga0105241_1000131211 | 158 |
| 322 | 3300009174 | Ga0105241_10037857 | Ga0105241_100378572 | 158 |
| 323 | 3300009174 | Ga0105241_10393859 | Ga0105241_103938592 | 158 |
| 324 | 3300009177 | Ga0105248_12363174 | Ga0105248_123631742 | 158 |
| 325 | 3300009545 | Ga0105237_10028013 | Ga0105237_100280135 | 158 |
| 326 | 3300009545 | Ga0105237_10225033 | Ga0105237_102250332 | 158 |
| 327 | 3300009551 | Ga0105238_10474362 | Ga0105238_104743622 | 158 |
| 328 | 3300009553 | Ga0105249_10258039 | Ga0105249_102580392 | 158 |
| 329 | 3300009553 | Ga0105249_10447944 | Ga0105249_104479442 | 158 |
| 330 | 3300009553 | Ga0105249_10678363 | Ga0105249_106783632 | 158 |
| 331 | 3300009553 | Ga0105249_10970744 | Ga0105249_109707442 | 158 |
| 332 | 3300010375 | Ga0105239_10061655 | Ga0105239_100616556 | 158 |
| 333 | 3300010375 | Ga0105239_10716844 | Ga0105239_107168442 | 158 |
| 334 | 3300011119 | Ga0105246_10088689 | Ga0105246_100886892 | 158 |
| 335 | 3300011119 | Ga0105246_10251782 | Ga0105246_102517822 | 158 |
| 336 | 3300013100 | Ga0157373_10000457 | Ga0157373_1000045719 | 158 |
| 337 | 3300013297 | Ga0157378_10464135 | Ga0157378_104641352 | 158 |
| 338 | 3300013297 | Ga0157378_10517720 | Ga0157378_105177202 | 158 |
| 339 | 3300013297 | Ga0157378_11134476 | Ga0157378_111344761 | 158 |
| 340 | 3300013306 | Ga0163162_10018030 | Ga0163162_100180302 | 158 |
| 341 | 3300013306 | Ga0163162_10768105 | Ga0163162_107681052 | 158 |
| 342 | 3300013307 | Ga0157372_10042124 | Ga0157372_100421243 | 158 |
| 343 | 3300013307 | Ga0157372_10152649 | Ga0157372_101526492 | 158 |
| 344 | 3300013308 | Ga0157375_10273143 | Ga0157375_102731432 | 158 |
| 345 | 3300013308 | Ga0157375_10274923 | Ga0157375_102749232 | 158 |
| 346 | 3300014325 | Ga0163163_10801063 | Ga0163163_108010632 | 158 |
| 347 | 3300014326 | Ga0157380_10683777 | Ga0157380_106837772 | 158 |
| 348 | 3300014326 | Ga0157380_11088881 | Ga0157380_110888811 | 158 |
| 349 | 3300014745 | Ga0157377_10330796 | Ga0157377_103307962 | 158 |
| 350 | 3300014968 | Ga0157379_10500205 | Ga0157379_105002052 | 158 |
| 351 | 3300014968 | Ga0157379_10560579 | Ga0157379_105605792 | 158 |
| 352 | 3300014968 | Ga0157379_10782585 | Ga0157379_107825852 | 158 |
| 353 | 3300025885 | Ga0207653_10004849 | Ga0207653_100048492 | 158 |
| 354 | 3300025885 | Ga0207653_10012619 | Ga0207653_100126192 | 158 |
| 355 | 3300025885 | Ga0207653_10110994 | Ga0207653_101109942 | 158 |
| 356 | 3300025899 | Ga0207642_10186907 | Ga0207642_101869071 | 158 |
| 357 | 3300025901 | Ga0207688_10083507 | Ga0207688_100835073 | 158 |
| 358 | 3300025905 | Ga0207685_10145953 | Ga0207685_101459532 | 158 |
| 359 | 3300025905 | Ga0207685_10511778 | Ga0207685_105117781 | 158 |
| 360 | 3300025906 | Ga0207699_10201774 | Ga0207699_102017742 | 158 |
| 361 | 3300025907 | Ga0207645_10000582 | Ga0207645_100005829 | 158 |
| 362 | 3300025908 | Ga0207643_10000688 | Ga0207643_1000068815 | 158 |
| 363 | 3300025910 | Ga0207684_10017635 | Ga0207684_100176352 | 158 |
| 364 | 3300025910 | Ga0207684_10031745 | Ga0207684_100317453 | 158 |
| 365 | 3300025910 | Ga0207684_10064137 | Ga0207684_100641372 | 158 |
| 366 | 3300025910 | Ga0207684_10075117 | Ga0207684_100751173 | 158 |
| 367 | 3300025910 | Ga0207684_10496485 | Ga0207684_104964852 | 158 |
| 368 | 3300025910 | Ga0207684_10770638 | Ga0207684_107706382 | 158 |
| 369 | 3300025911 | Ga0207654_10003437 | Ga0207654_100034374 | 158 |
| 370 | 3300025911 | Ga0207654_10025483 | Ga0207654_100254832 | 158 |
| 371 | 3300025912 | Ga0207707_10000158 | Ga0207707_1000015811 | 158 |
| 372 | 3300025914 | Ga0207671_10039847 | Ga0207671_100398472 | 158 |
| 373 | 3300025915 | Ga0207693_10008921 | Ga0207693_100089217 | 158 |
| 374 | 3300025916 | Ga0207663_10797557 | Ga0207663_107975572 | 158 |
| 375 | 3300025917 | Ga0207660_10000220 | Ga0207660_1000022019 | 158 |
| 376 | 3300025917 | Ga0207660_10012274 | Ga0207660_100122744 | 158 |
| 377 | 3300025918 | Ga0207662_10092896 | Ga0207662_100928962 | 158 |
| 378 | 3300025918 | Ga0207662_10105562 | Ga0207662_101055622 | 158 |
| 379 | 3300025918 | Ga0207662_10744800 | Ga0207662_107448002 | 158 |
| 380 | 3300025919 | Ga0207657_10000730 | Ga0207657_1000073010 | 158 |
| 381 | 3300025920 | Ga0207649_10011103 | Ga0207649_100111032 | 158 |
| 382 | 3300025921 | Ga0207652_10000290 | Ga0207652_1000029041 | 158 |
| 383 | 3300025922 | Ga0207646_10023549 | Ga0207646_100235496 | 158 |
| 384 | 3300025922 | Ga0207646_10086056 | Ga0207646_100860564 | 158 |
| 385 | 3300025922 | Ga0207646_10221487 | Ga0207646_102214872 | 158 |
| 386 | 3300025922 | Ga0207646_10227192 | Ga0207646_102271922 | 158 |
| 387 | 3300025922 | Ga0207646_10249861 | Ga0207646_102498612 | 158 |
| 388 | 3300025922 | Ga0207646_10275940 | Ga0207646_102759402 | 158 |
| 389 | 3300025922 | Ga0207646_10287084 | Ga0207646_102870842 | 158 |
| 390 | 3300025922 | Ga0207646_10632559 | Ga0207646_106325592 | 158 |
| 391 | 3300025923 | Ga0207681_10022163 | Ga0207681_100221632 | 158 |
| 392 | 3300025923 | Ga0207681_10292339 | Ga0207681_102923391 | 158 |
| 393 | 3300025923 | Ga0207681_10413117 | Ga0207681_104131172 | 158 |
| 394 | 3300025923 | Ga0207681_10860960 | Ga0207681_108609602 | 158 |
| 395 | 3300025925 | Ga0207650_10010437 | Ga0207650_100104374 | 158 |
| 396 | 3300025927 | Ga0207687_10829134 | Ga0207687_108291342 | 158 |
| 397 | 3300025932 | Ga0207690_10002732 | Ga0207690_100027328 | 158 |
| 398 | 3300025933 | Ga0207706_10011184 | Ga0207706_100111842 | 158 |
| 399 | 3300025933 | Ga0207706_10040989 | Ga0207706_100409892 | 158 |
| 400 | 3300025933 | Ga0207706_10093783 | Ga0207706_100937832 | 158 |
| 401 | 3300025935 | Ga0207709_10195812 | Ga0207709_101958122 | 158 |
| 402 | 3300025935 | Ga0207709_10215555 | Ga0207709_102155552 | 158 |
| 403 | 3300025935 | Ga0207709_10961166 | Ga0207709_109611662 | 158 |
| 404 | 3300025936 | Ga0207670_10030455 | Ga0207670_100304553 | 158 |
| 405 | 3300025937 | Ga0207669_10180140 | Ga0207669_101801402 | 158 |
| 406 | 3300025937 | Ga0207669_10365446 | Ga0207669_103654462 | 158 |
| 407 | 3300025938 | Ga0207704_10531971 | Ga0207704_105319712 | 158 |
| 408 | 3300025939 | Ga0207665_10002961 | Ga0207665_100029619 | 158 |
| 409 | 3300025940 | Ga0207691_10363241 | Ga0207691_103632412 | 158 |
| 410 | 3300025941 | Ga0207711_10061135 | Ga0207711_100611353 | 158 |
| 411 | 3300025942 | Ga0207689_10000846 | Ga0207689_100008468 | 158 |
| 412 | 3300025944 | Ga0207661_11225132 | Ga0207661_112251321 | 158 |
| 413 | 3300025945 | Ga0207679_10000820 | Ga0207679_100008205 | 158 |
| 414 | 3300025949 | Ga0207667_10001638 | Ga0207667_1000163820 | 158 |
| 415 | 3300025960 | Ga0207651_10017986 | Ga0207651_100179864 | 158 |
| 416 | 3300025961 | Ga0207712_11053682 | Ga0207712_110536822 | 158 |
| 417 | 3300025972 | Ga0207668_10012836 | Ga0207668_100128362 | 158 |
| 418 | 3300025981 | Ga0207640_10010928 | Ga0207640_100109283 | 158 |
| 419 | 3300025981 | Ga0207640_11484337 | Ga0207640_114843371 | 158 |
| 420 | 3300026023 | Ga0207677_10039511 | Ga0207677_100395113 | 158 |
| 421 | 3300026035 | Ga0207703_10061345 | Ga0207703_100613452 | 158 |
| 422 | 3300026041 | Ga0207639_10003030 | Ga0207639_100030304 | 158 |
| 423 | 3300026041 | Ga0207639_10310778 | Ga0207639_103107782 | 158 |
| 424 | 3300026067 | Ga0207678_10003638 | Ga0207678_100036386 | 158 |
| 425 | 3300026067 | Ga0207678_11331627 | Ga0207678_113316271 | 158 |
| 426 | 3300026075 | Ga0207708_10126776 | Ga0207708_101267762 | 158 |
| 427 | 3300026075 | Ga0207708_10375408 | Ga0207708_103754082 | 158 |
| 428 | 3300026078 | Ga0207702_10003448 | Ga0207702_100034489 | 158 |
| 429 | 3300026078 | Ga0207702_10618655 | Ga0207702_106186552 | 158 |
| 430 | 3300026088 | Ga0207641_10187238 | Ga0207641_101872382 | 158 |
| 431 | 3300026089 | Ga0207648_10034307 | Ga0207648_100343074 | 158 |
| 432 | 3300026116 | Ga0207674_10002312 | Ga0207674_1000231218 | 158 |
| 433 | 3300026116 | Ga0207674_10416585 | Ga0207674_104165852 | 158 |
| 434 | 3300026118 | Ga0207675_100230392 | Ga0207675_1002303922 | 158 |
| 435 | 3300026121 | Ga0207683_10917339 | Ga0207683_109173392 | 158 |
| 436 | 3300026142 | Ga0207698_10081246 | Ga0207698_100812462 | 158 |
| 437 | 3300027360 | Ga0209969_1003036 | Ga0209969_10030362 | 158 |
| 438 | 3300027378 | Ga0209981_1005574 | Ga0209981_10055742 | 158 |
| 439 | 3300027395 | Ga0209996_1002868 | Ga0209996_10028682 | 158 |
| 440 | 3300027424 | Ga0209984_1006985 | Ga0209984_10069852 | 158 |
| 441 | 3300027462 | Ga0210000_1046215 | Ga0210000_10462152 | 158 |
| 442 | 3300027471 | Ga0209995_1017552 | Ga0209995_10175522 | 158 |
| 443 | 3300027526 | Ga0209968_1004685 | Ga0209968_10046852 | 158 |
| 444 | 3300027543 | Ga0209999_1000646 | Ga0209999_10006463 | 158 |
| 445 | 3300027614 | Ga0209970_1000762 | Ga0209970_10007623 | 158 |
| 446 | 3300027614 | Ga0209970_1017391 | Ga0209970_10173912 | 158 |
| 447 | 3300027614 | Ga0209970_1026887 | Ga0209970_10268872 | 158 |
| 448 | 3300027665 | Ga0209983_1000526 | Ga0209983_10005267 | 158 |
| 449 | 3300027671 | Ga0209588_1008703 | Ga0209588_10087032 | 158 |
| 450 | 3300027682 | Ga0209971_1000058 | Ga0209971_100005834 | 158 |
| 451 | 3300027682 | Ga0209971_1013323 | Ga0209971_10133232 | 158 |
| 452 | 3300027682 | Ga0209971_1020168 | Ga0209971_10201682 | 158 |
| 453 | 3300027695 | Ga0209966_1000021 | Ga0209966_100002135 | 158 |
| 454 | 3300027717 | Ga0209998_10000002 | Ga0209998_1000000285 | 158 |
| 455 | 3300027876 | Ga0209974_10004247 | Ga0209974_100042472 | 158 |
| 456 | 3300027876 | Ga0209974_10165271 | Ga0209974_101652712 | 158 |
| 457 | 3300027907 | Ga0207428_10000069 | Ga0207428_10000069135 | 158 |
| 458 | 3300027907 | Ga0207428_10001914 | Ga0207428_100019148 | 158 |
| 459 | 3300027907 | Ga0207428_10130402 | Ga0207428_101304023 | 158 |
| 460 | 3300027907 | Ga0207428_10499329 | Ga0207428_104993292 | 158 |
| 461 | 3300028380 | Ga0268265_11235155 | Ga0268265_112351552 | 158 |
| 462 | 3300028381 | Ga0268264_10019088 | Ga0268264_100190883 | 158 |
| 463 | 3300028381 | Ga0268264_11762337 | Ga0268264_117623371 | 158 |
| 464 | 3300031548 | Ga0307408_100023294 | Ga0307408_1000232945 | 158 |
| 465 | 3300031548 | Ga0307408_100418767 | Ga0307408_1004187672 | 158 |
| 466 | 3300031711 | Ga0265314_10126304 | Ga0265314_101263041 | 158 |
| 467 | 3300031731 | Ga0307405_11020370 | Ga0307405_110203702 | 158 |
| 468 | 3300031995 | Ga0307409_100478148 | Ga0307409_1004781482 | 158 |
| 469 | 3300032002 | Ga0307416_100248585 | Ga0307416_1002485852 | 158 |
| 470 | 3300032004 | Ga0307414_11072669 | Ga0307414_110726692 | 158 |
| 471 | 3300032005 | Ga0307411_10131601 | Ga0307411_101316012 | 158 |
| 472 | 3300034817 | Ga0373948_0007232 | Ga0373948_0007232_1074_1550 | 158 |
| 473 | 3300034819 | Ga0373958_0068265 | Ga0373958_0068265_77_553 | 158 |
| 474 | 3300034820 | Ga0373959_0003425 | Ga0373959_0003425_1939_2415 | 158 |
| 475 | 3300035083 | Ga0373926_0020266 | Ga0373926_0020266_1717_2196 | 158 |
| 476 | 3300035088 | Ga0373940_0010600 | Ga0373940_0010600_1440_1916 | 158 |
| 477 | 3300035088 | Ga0373940_0079348 | Ga0373940_0079348_174_650 | 158 |
| 478 | 3300035088 | Ga0373940_0140518 | Ga0373940_0140518_37_513 | 158 |
| 479 | 3300035090 | Ga0373949_0009104 | Ga0373949_0009104_331_807 | 158 |
| 480 | 3300035091 | Ga0373951_0002550 | Ga0373951_0002550_2648_3124 | 158 |
| 481 | 3300035092 | Ga0373952_0037294 | Ga0373952_0037294_13_489 | 158 |
| 482 | 3300035114 | Ga0373939_0019448 | Ga0373939_0019448_329_805 | 158 |
| 483 | 3300035114 | Ga0373939_0156130 | Ga0373939_0156130_206_682 | 158 |
| 484 | 3300035114 | Ga0373939_0188697 | Ga0373939_0188697_41_517 | 158 |
| 485 | 3300035115 | Ga0373941_0011362 | Ga0373941_0011362_376_852 | 158 |
| 486 | 3300035120 | Ga0373957_0390159 | Ga0373957_0390159_90_566 | 158 |
| 487 | 3300035242 | Ga0373962_0028333 | Ga0373962_0028333_134_610 | 158 |
| 488 | 3300035242 | Ga0373962_0190887 | Ga0373962_0190887_86_562 | 158 |
| 489 | 3300035410 | Ga0373924_0300643 | Ga0373924_0300643_156_632 | 158 |
| 490 | 3300035410 | Ga0373924_0351443 | Ga0373924_0351443_24_500 | 158 |
| 491 | 3300035691 | Ga0373931_0019802 | Ga0373931_0019802_2384_2860 | 158 |
| 492 | 3300035691 | Ga0373931_0033320 | Ga0373931_0033320_2061_2537 | 158 |
| 493 | 3300035691 | Ga0373931_0114603 | Ga0373931_0114603_519_995 | 158 |
| 494 | 3300035691 | Ga0373931_0688463 | Ga0373931_0688463_89_565 | 158 |
| 495 | 3300035695 | Ga0373927_0004542 | Ga0373927_0004542_8437_8916 | 158 |
| 496 | 3300035695 | Ga0373927_0255030 | Ga0373927_0255030_285_761 | 158 |
| 497 | 3300035725 | Ga0373947_0096152 | Ga0373947_0096152_495_974 | 158 |
| 498 | 3300036401 | Ga0373937_0114911 | Ga0373937_0114911_1602_2078 | 158 |
| 499 | 3300037068 | Ga0373925_0068087 | Ga0373925_0068087_1290_1769 | 158 |
| 500 | 3300037418 | Ga0395900_0147762 | Ga0395900_0147762_1504_1980 | 158 |
| 501 | 3300042005 | Ga0439448_0002193 | Ga0439448_0002193_1710_2186 | 158 |
| 502 | 3300042005 | Ga0439448_0005223 | Ga0439448_0005223_139_615 | 158 |
| 503 | 3300042012 | Ga0439455_0006291 | Ga0439455_0006291_772_1248 | 158 |
| 504 | 3300042016 | Ga0439463_020316 | Ga0439463_020316_712_1188 | 158 |
| 505 | 3300042144 | Ga0450889_002862 | Ga0450889_002862_667_1143 | 158 |
| 506 | 3300042157 | Ga0439458_0000918 | Ga0439458_0000918_2391_2867 | 158 |
| 507 | 3300042438 | Ga0439459_0001028 | Ga0439459_0001028_2792_3268 | 158 |
| 508 | 3300042461 | Ga0439460_0001936 | Ga0439460_0001936_3913_4389 | 158 |
| 509 | 3300042461 | Ga0439460_0131809 | Ga0439460_0131809_205_681 | 158 |
| 510 | 3300042876 | Ga0451577_0036946 | Ga0451577_0036946_367_843 | 158 |
| 511 | 3300042876 | Ga0451577_0046597 | Ga0451577_0046597_1041_1517 | 158 |
| 512 | 3300042876 | Ga0451577_0107464 | Ga0451577_0107464_331_807 | 158 |
| 513 | 3300042876 | Ga0451577_0435454 | Ga0451577_0435454_188_664 | 158 |
| 514 | 3300042876 | Ga0451577_0760987 | Ga0451577_0760987_225_701 | 158 |
| 515 | 3300042876 | Ga0451577_1516345 | Ga0451577_1516345_26_508 | 158 |
| 516 | 3300044673 | Ga0453683_0470850 | Ga0453683_0470850_37_513 | 158 |
| 517 | 3300044673 | Ga0453683_0980389 | Ga0453683_0980389_70_546 | 158 |
| 518 | 3300044712 | Ga0453684_0096548 | Ga0453684_0096548_1086_1562 | 158 |
| 519 | 3300044712 | Ga0453684_1671749 | Ga0453684_1671749_136_612 | 158 |
| 520 | 3300045051 | Ga0451576_0022688 | Ga0451576_0022688_2604_3080 | 158 |
| 521 | 3300045051 | Ga0451576_0030647 | Ga0451576_0030647_4579_5055 | 158 |
| 522 | 3300045051 | Ga0451576_0161675 | Ga0451576_0161675_439_915 | 158 |
| 523 | 3300045051 | Ga0451576_0356019 | Ga0451576_0356019_914_1390 | 158 |
| 524 | 3300046455 | Ga0495603_0226791 | Ga0495603_0226791_52_528 | 158 |
| 525 | 3300046472 | Ga0495580_0008477 | Ga0495580_0008477_5881_6357 | 158 |
| 526 | 3300046472 | Ga0495580_0079742 | Ga0495580_0079742_204_680 | 158 |
| 527 | 3300046473 | Ga0495582_0056050 | Ga0495582_0056050_1202_1681 | 158 |
| 528 | 3300046491 | Ga0495584_0290461 | Ga0495584_0290461_113_589 | 158 |
| 529 | 3300046499 | Ga0495594_0239045 | Ga0495594_0239045_337_813 | 158 |
| 530 | 3300046499 | Ga0495594_0371188 | Ga0495594_0371188_133_612 | 158 |
| 531 | 3300046528 | Ga0495642_0051230 | Ga0495642_0051230_685_1161 | 158 |
| 532 | 3300046528 | Ga0495642_0074530 | Ga0495642_0074530_375_851 | 158 |
| 533 | 3300046531 | Ga0495665_0233727 | Ga0495665_0233727_204_683 | 158 |
| 534 | 3300046537 | Ga0495598_0288491 | Ga0495598_0288491_48_524 | 158 |
| 535 | 3300046660 | Ga0495625_0449338 | Ga0495625_0449338_139_618 | 158 |
| 536 | 3300046664 | Ga0495659_0166090 | Ga0495659_0166090_83_559 | 158 |
| 537 | 3300046683 | Ga0495658_0082401 | Ga0495658_0082401_285_764 | 158 |
| 538 | 3300046684 | Ga0495669_0082176 | Ga0495669_0082176_481_957 | 158 |
| 539 | 3300046684 | Ga0495669_0149190 | Ga0495669_0149190_121_597 | 158 |
| 540 | 3300046684 | Ga0495669_0225583 | Ga0495669_0225583_225_701 | 158 |
| 541 | 3300046684 | Ga0495669_0399898 | Ga0495669_0399898_18_494 | 158 |
| 542 | 3300046689 | Ga0495613_0218140 | Ga0495613_0218140_577_1053 | 158 |
| 543 | 3300047315 | Ga0495581_0046596 | Ga0495581_0046596_1877_2356 | 158 |
| 544 | 3300047318 | Ga0495636_0050381 | Ga0495636_0050381_275_751 | 158 |
| 545 | 3300047319 | Ga0495674_0730644 | Ga0495674_0730644_38_514 | 158 |
| 546 | 3300048905 | Ga0496102_0010932 | Ga0496102_0010932_2442_2918 | 158 |
| 547 | 3300048905 | Ga0496102_0066067 | Ga0496102_0066067_2317_2793 | 158 |
| 548 | 3300048905 | Ga0496102_0253381 | Ga0496102_0253381_246_722 | 158 |
| 549 | 3300048906 | Ga0496103_0028264 | Ga0496103_0028264_619_1095 | 158 |
| 550 | 3300048906 | Ga0496103_0554031 | Ga0496103_0554031_76_552 | 158 |
| 551 | 3300048907 | Ga0496104_0842980 | Ga0496104_0842980_329_805 | 158 |
| 552 | 3300048909 | Ga0496106_0244983 | Ga0496106_0244983_695_1171 | 158 |
| 553 | 3300048909 | Ga0496106_0971645 | Ga0496106_0971645_151_627 | 158 |
| 554 | 3300048910 | Ga0496107_0081233 | Ga0496107_0081233_1453_1929 | 158 |
| 555 | 3300048911 | Ga0496108_0147203 | Ga0496108_0147203_1312_1788 | 158 |
| 556 | 3300048911 | Ga0496108_0613880 | Ga0496108_0613880_376_852 | 158 |
| 557 | 3300048912 | Ga0496109_0126929 | Ga0496109_0126929_1663_2139 | 158 |
| 558 | 3300048913 | Ga0496110_0273285 | Ga0496110_0273285_996_1472 | 158 |
| 559 | 3300048913 | Ga0496110_0923881 | Ga0496110_0923881_68_544 | 158 |
| 560 | 3300048915 | Ga0496112_0021044 | Ga0496112_0021044_1163_1639 | 158 |
| 561 | 3300048916 | Ga0496113_0186441 | Ga0496113_0186441_983_1459 | 158 |
| 562 | 3300049568 | Ga0501031_0193378 | Ga0501031_0193378_492_968 | 158 |
| 563 | 3300049568 | Ga0501031_0427335 | Ga0501031_0427335_59_535 | 158 |
| 564 | 3300049569 | Ga0501032_0961727 | Ga0501032_0961727_12_488 | 158 |
| 565 | 3300049570 | Ga0501033_0055942 | Ga0501033_0055942_11_487 | 158 |
| 566 | 3300049570 | Ga0501033_0093909 | Ga0501033_0093909_672_1148 | 158 |
| 567 | 3300049570 | Ga0501033_0359677 | Ga0501033_0359677_363_839 | 158 |
| 568 | 3300049570 | Ga0501033_0391053 | Ga0501033_0391053_360_836 | 158 |
| 569 | 3300049570 | Ga0501033_0445711 | Ga0501033_0445711_37_513 | 158 |
| 570 | 3300049570 | Ga0501033_0652577 | Ga0501033_0652577_108_584 | 158 |
| 571 | 3300049572 | Ga0501036_0005109 | Ga0501036_0005109_6390_6866 | 158 |
| 572 | 3300049572 | Ga0501036_0185009 | Ga0501036_0185009_437_913 | 158 |
| 573 | 3300049572 | Ga0501036_0277380 | Ga0501036_0277380_685_1161 | 158 |
| 574 | 3300049572 | Ga0501036_0426056 | Ga0501036_0426056_71_547 | 158 |
| 575 | 3300049572 | Ga0501036_0617865 | Ga0501036_0617865_409_885 | 158 |
| 576 | 3300049573 | Ga0501037_0211703 | Ga0501037_0211703_328_804 | 158 |
| 577 | 3300049573 | Ga0501037_0370828 | Ga0501037_0370828_343_819 | 158 |
| 578 | 3300049574 | Ga0501038_0048428 | Ga0501038_0048428_2671_3147 | 158 |
| 579 | 3300049574 | Ga0501038_0141276 | Ga0501038_0141276_1071_1547 | 158 |
| 580 | 3300049574 | Ga0501038_0419050 | Ga0501038_0419050_23_499 | 158 |
| 581 | 3300049574 | Ga0501038_0946666 | Ga0501038_0946666_90_566 | 158 |
| 582 | 3300049575 | Ga0501039_0032051 | Ga0501039_0032051_1304_1780 | 158 |
| 583 | 3300049575 | Ga0501039_0032798 | Ga0501039_0032798_1223_1699 | 158 |
| 584 | 3300049575 | Ga0501039_0038255 | Ga0501039_0038255_3100_3576 | 158 |
| 585 | 3300049575 | Ga0501039_0039920 | Ga0501039_0039920_689_1165 | 158 |
| 586 | 3300049576 | Ga0501040_0009563 | Ga0501040_0009563_2303_2779 | 158 |
| 587 | 3300049576 | Ga0501040_0014292 | Ga0501040_0014292_636_1112 | 158 |
| 588 | 3300049576 | Ga0501040_0021542 | Ga0501040_0021542_3694_4170 | 158 |
| 589 | 3300049576 | Ga0501040_0060684 | Ga0501040_0060684_871_1347 | 158 |
| 590 | 3300049576 | Ga0501040_0186798 | Ga0501040_0186798_789_1265 | 158 |
| 591 | 3300049576 | Ga0501040_0360763 | Ga0501040_0360763_172_648 | 158 |
| 592 | 3300049577 | Ga0501041_0027686 | Ga0501041_0027686_441_917 | 158 |
| 593 | 3300049577 | Ga0501041_0033417 | Ga0501041_0033417_1632_2108 | 158 |
| 594 | 3300049577 | Ga0501041_0064102 | Ga0501041_0064102_1232_1708 | 158 |
| 595 | 3300049577 | Ga0501041_0206413 | Ga0501041_0206413_300_779 | 158 |
| 596 | 3300049577 | Ga0501041_0300587 | Ga0501041_0300587_116_592 | 158 |
| 597 | 3300049578 | Ga0501042_0039188 | Ga0501042_0039188_2810_3286 | 158 |
| 598 | 3300049578 | Ga0501042_0042966 | Ga0501042_0042966_2193_2669 | 158 |
| 599 | 3300049578 | Ga0501042_0205447 | Ga0501042_0205447_576_1052 | 158 |
| 600 | 3300049578 | Ga0501042_0512930 | Ga0501042_0512930_280_756 | 158 |
| 601 | 3300049578 | Ga0501042_0807046 | Ga0501042_0807046_22_498 | 158 |
| 602 | 3300049579 | Ga0501043_0406446 | Ga0501043_0406446_167_643 | 158 |
| 603 | 3300049580 | Ga0501046_0000240 | Ga0501046_0000240_13670_14146 | 158 |
| 604 | 3300049580 | Ga0501046_0731214 | Ga0501046_0731214_44_520 | 158 |
| 605 | 3300049581 | Ga0501047_0076459 | Ga0501047_0076459_342_818 | 158 |
| 606 | 3300049582 | Ga0501048_0140718 | Ga0501048_0140718_248_724 | 158 |
| 607 | 3300049582 | Ga0501048_0186064 | Ga0501048_0186064_319_795 | 158 |
| 608 | 3300049583 | Ga0501067_0071530 | Ga0501067_0071530_120_596 | 158 |
| 609 | 3300049583 | Ga0501067_0283137 | Ga0501067_0283137_392_868 | 158 |
| 610 | 3300049584 | Ga0501068_0198496 | Ga0501068_0198496_50_526 | 158 |
| 611 | 3300049584 | Ga0501068_0256039 | Ga0501068_0256039_278_754 | 158 |
| 612 | 3300049584 | Ga0501068_1129423 | Ga0501068_1129423_25_501 | 158 |
| 613 | 3300049587 | Ga0501071_0030461 | Ga0501071_0030461_628_1104 | 158 |
| 614 | 3300049587 | Ga0501071_0031512 | Ga0501071_0031512_1395_1871 | 158 |
| 615 | 3300049587 | Ga0501071_0065147 | Ga0501071_0065147_1263_1739 | 158 |
| 616 | 3300049587 | Ga0501071_0239223 | Ga0501071_0239223_400_876 | 158 |
| 617 | 3300049587 | Ga0501071_0246197 | Ga0501071_0246197_409_885 | 158 |
| 618 | 3300049587 | Ga0501071_0333749 | Ga0501071_0333749_460_936 | 158 |
| 619 | 3300049588 | Ga0501072_0007527 | Ga0501072_0007527_3130_3606 | 158 |
| 620 | 3300049588 | Ga0501072_0035907 | Ga0501072_0035907_2230_2706 | 158 |
| 621 | 3300049588 | Ga0501072_0139172 | Ga0501072_0139172_96_572 | 158 |
| 622 | 3300049588 | Ga0501072_0278407 | Ga0501072_0278407_173_649 | 158 |
| 623 | 3300049588 | Ga0501072_0401356 | Ga0501072_0401356_33_509 | 158 |
| 624 | 3300049588 | Ga0501072_0495651 | Ga0501072_0495651_405_881 | 158 |
| 625 | 3300049589 | Ga0501073_0131364 | Ga0501073_0131364_410_886 | 158 |
| 626 | 3300049589 | Ga0501073_0704591 | Ga0501073_0704591_53_529 | 158 |
| 627 | 3300049590 | Ga0501074_0059181 | Ga0501074_0059181_352_828 | 158 |
| 628 | 3300049590 | Ga0501074_0215780 | Ga0501074_0215780_433_909 | 158 |
| 629 | 3300049590 | Ga0501074_0578085 | Ga0501074_0578085_300_776 | 158 |
| 630 | 3300049590 | Ga0501074_0872746 | Ga0501074_0872746_11_487 | 158 |
| 631 | 3300049590 | Ga0501074_0916673 | Ga0501074_0916673_125_601 | 158 |
| 632 | 3300049591 | Ga0501075_0000012 | Ga0501075_0000012_58524_59000 | 158 |
| 633 | 3300049591 | Ga0501075_0011227 | Ga0501075_0011227_4935_5411 | 158 |
| 634 | 3300049591 | Ga0501075_0047705 | Ga0501075_0047705_2085_2561 | 158 |
| 635 | 3300049591 | Ga0501075_0115352 | Ga0501075_0115352_1485_1961 | 158 |
| 636 | 3300049591 | Ga0501075_0242714 | Ga0501075_0242714_244_720 | 158 |
| 637 | 3300049591 | Ga0501075_0487059 | Ga0501075_0487059_430_906 | 158 |
| 638 | 3300049591 | Ga0501075_0603314 | Ga0501075_0603314_238_714 | 158 |
| 639 | 3300049591 | Ga0501075_0670335 | Ga0501075_0670335_148_624 | 158 |
| 640 | 3300049592 | Ga0501076_0000017 | Ga0501076_0000017_35945_36421 | 158 |
| 641 | 3300049592 | Ga0501076_0006954 | Ga0501076_0006954_7402_7878 | 158 |
| 642 | 3300049592 | Ga0501076_0036530 | Ga0501076_0036530_3236_3712 | 158 |
| 643 | 3300049592 | Ga0501076_0067773 | Ga0501076_0067773_1415_1891 | 158 |
| 644 | 3300049592 | Ga0501076_0121955 | Ga0501076_0121955_569_1045 | 158 |
| 645 | 3300049592 | Ga0501076_0147370 | Ga0501076_0147370_468_944 | 158 |
| 646 | 3300049592 | Ga0501076_0287379 | Ga0501076_0287379_480_956 | 158 |
| 647 | 3300049592 | Ga0501076_0377082 | Ga0501076_0377082_497_973 | 158 |
| 648 | 3300049592 | Ga0501076_0601020 | Ga0501076_0601020_47_523 | 158 |
| 649 | 3300049592 | Ga0501076_0709093 | Ga0501076_0709093_97_573 | 158 |
| 650 | 3300049593 | Ga0501077_0060344 | Ga0501077_0060344_1360_1836 | 158 |
| 651 | 3300049593 | Ga0501077_0116589 | Ga0501077_0116589_909_1385 | 158 |
| 652 | 3300049593 | Ga0501077_0180092 | Ga0501077_0180092_755_1231 | 158 |
| 653 | 3300049593 | Ga0501077_0332972 | Ga0501077_0332972_17_493 | 158 |
| 654 | 3300049593 | Ga0501077_0365669 | Ga0501077_0365669_404_880 | 158 |
| 655 | 3300049593 | Ga0501077_0838831 | Ga0501077_0838831_94_570 | 158 |
| 656 | 3300049705 | Ga0501225_0298961 | Ga0501225_0298961_47_523 | 158 |
| 657 | 3300049741 | Ga0501079_0005994 | Ga0501079_0005994_8088_8564 | 158 |
| 658 | 3300049741 | Ga0501079_0006852 | Ga0501079_0006852_3199_3675 | 158 |
| 659 | 3300049741 | Ga0501079_0078458 | Ga0501079_0078458_1911_2387 | 158 |
| 660 | 3300049741 | Ga0501079_0138649 | Ga0501079_0138649_520_996 | 158 |
| 661 | 3300049741 | Ga0501079_0197591 | Ga0501079_0197591_131_607 | 158 |
| 662 | 3300049741 | Ga0501079_0219145 | Ga0501079_0219145_981_1457 | 158 |
| 663 | 3300049741 | Ga0501079_0963387 | Ga0501079_0963387_74_550 | 158 |
| 664 | 3300049741 | Ga0501079_1055914 | Ga0501079_1055914_131_607 | 158 |
| 665 | 3300049742 | Ga0501080_0073623 | Ga0501080_0073623_1683_2159 | 158 |
| 666 | 3300049742 | Ga0501080_0373107 | Ga0501080_0373107_780_1256 | 158 |
| 667 | 3300049742 | Ga0501080_0497738 | Ga0501080_0497738_142_618 | 158 |
| 668 | 3300049742 | Ga0501080_1755328 | Ga0501080_1755328_13_489 | 158 |
| 669 | 3300049743 | Ga0501081_0002066 | Ga0501081_0002066_6962_7438 | 158 |
| 670 | 3300049743 | Ga0501081_0013261 | Ga0501081_0013261_4612_5088 | 158 |
| 671 | 3300049743 | Ga0501081_0038292 | Ga0501081_0038292_1872_2348 | 158 |
| 672 | 3300049743 | Ga0501081_0188420 | Ga0501081_0188420_306_782 | 158 |
| 673 | 3300049743 | Ga0501081_0205179 | Ga0501081_0205179_758_1234 | 158 |
| 674 | 3300049743 | Ga0501081_0265212 | Ga0501081_0265212_392_868 | 158 |
| 675 | 3300049743 | Ga0501081_0405481 | Ga0501081_0405481_379_855 | 158 |
| 676 | 3300049743 | Ga0501081_0859186 | Ga0501081_0859186_61_537 | 158 |
| 677 | 3300049744 | Ga0501083_0031126 | Ga0501083_0031126_1040_1516 | 158 |
| 678 | 3300049744 | Ga0501083_0130108 | Ga0501083_0130108_141_617 | 158 |
| 679 | 3300049744 | Ga0501083_0311386 | Ga0501083_0311386_444_920 | 158 |
| 680 | 3300049744 | Ga0501083_0419515 | Ga0501083_0419515_243_719 | 158 |
| 681 | 3300049822 | Ga0501035_0050571 | Ga0501035_0050571_2911_3387 | 158 |
| 682 | 3300049822 | Ga0501035_0163390 | Ga0501035_0163390_630_1112 | 158 |
| 683 | 3300049823 | Ga0501044_0619678 | Ga0501044_0619678_488_964 | 158 |
| 684 | 3300049824 | Ga0501045_0001958 | Ga0501045_0001958_13312_13788 | 158 |
| 685 | 3300049824 | Ga0501045_0029292 | Ga0501045_0029292_627_1103 | 158 |
| 686 | 3300049824 | Ga0501045_0065298 | Ga0501045_0065298_594_1070 | 158 |
| 687 | 3300049824 | Ga0501045_0099188 | Ga0501045_0099188_598_1074 | 158 |
| 688 | 3300049824 | Ga0501045_0107916 | Ga0501045_0107916_335_811 | 158 |
| 689 | 3300049824 | Ga0501045_0323108 | Ga0501045_0323108_406_882 | 158 |
| 690 | 3300049824 | Ga0501045_0339243 | Ga0501045_0339243_97_573 | 158 |
| 691 | 3300050492 | nmdc:mga0yw44_606325_c1 | nmdc:mga0yw44_606325_c1_81_560 | 158 |
| 692 | 3300050507 | nmdc:mga05p37_10_c2 | nmdc:mga05p37_10_c2_24589_25065 | 158 |
| 693 | 3300050507 | nmdc:mga05p37_110323_c1 | nmdc:mga05p37_110323_c1_2353_2829 | 158 |
| 694 | 3300050507 | nmdc:mga05p37_11108_c1 | nmdc:mga05p37_11108_c1_5888_6364 | 158 |
| 695 | 3300050507 | nmdc:mga05p37_1150835_c1 | nmdc:mga05p37_1150835_c1_131_607 | 158 |
| 696 | 3300050507 | nmdc:mga05p37_1304217_c1 | nmdc:mga05p37_1304217_c1_131_607 | 158 |
| 697 | 3300050507 | nmdc:mga05p37_215431_c2 | nmdc:mga05p37_215431_c2_918_1394 | 158 |
| 698 | 3300050507 | nmdc:mga05p37_22110_c1 | nmdc:mga05p37_22110_c1_6309_6785 | 158 |
| 699 | 3300050507 | nmdc:mga05p37_225285_c1 | nmdc:mga05p37_225285_c1_1669_2145 | 158 |
| 700 | 3300050507 | nmdc:mga05p37_24187_c1 | nmdc:mga05p37_24187_c1_2985_3461 | 158 |
| 701 | 3300050507 | nmdc:mga05p37_3081_c1 | nmdc:mga05p37_3081_c1_2979_3455 | 158 |
| 702 | 3300050507 | nmdc:mga05p37_343254_c1 | nmdc:mga05p37_343254_c1_64_540 | 158 |
| 703 | 3300050507 | nmdc:mga05p37_420359_c1 | nmdc:mga05p37_420359_c1_756_1232 | 158 |
| 704 | 3300050507 | nmdc:mga05p37_502038_c1 | nmdc:mga05p37_502038_c1_535_1011 | 158 |
| 705 | 3300050507 | nmdc:mga05p37_58104_c1 | nmdc:mga05p37_58104_c1_4232_4708 | 158 |
| 706 | 3300050508 | nmdc:mga09592_124044_c1 | nmdc:mga09592_124044_c1_1219_1695 | 158 |
| 707 | 3300050508 | nmdc:mga09592_139739_c1 | nmdc:mga09592_139739_c1_1126_1602 | 158 |
| 708 | 3300050508 | nmdc:mga09592_24319_c1 | nmdc:mga09592_24319_c1_4441_4917 | 158 |
| 709 | 3300050508 | nmdc:mga09592_298723_c1 | nmdc:mga09592_298723_c1_815_1291 | 158 |
| 710 | 3300050508 | nmdc:mga09592_64762_c1 | nmdc:mga09592_64762_c1_1124_1600 | 158 |
| 711 | 3300050508 | nmdc:mga09592_68297_c1 | nmdc:mga09592_68297_c1_725_1201 | 158 |
| 712 | 3300050509 | nmdc:mga0qj67_20_c1 | nmdc:mga0qj67_20_c1_22181_22660 | 158 |
| 713 | 3300050509 | nmdc:mga0qj67_405627_c1 | nmdc:mga0qj67_405627_c1_490_966 | 158 |
| 714 | 3300050509 | nmdc:mga0qj67_4979_c1 | nmdc:mga0qj67_4979_c1_3654_4130 | 158 |
| 715 | 3300050509 | nmdc:mga0qj67_946007_c1 | nmdc:mga0qj67_946007_c1_108_584 | 158 |
| 716 | 3300050510 | nmdc:mga06r32_117248_c1 | nmdc:mga06r32_117248_c1_279_755 | 158 |
| 717 | 3300050510 | nmdc:mga06r32_117406_c1 | nmdc:mga06r32_117406_c1_967_1443 | 158 |
| 718 | 3300050510 | nmdc:mga06r32_124811_c1 | nmdc:mga06r32_124811_c1_662_1138 | 158 |
| 719 | 3300050510 | nmdc:mga06r32_1358803_c1 | nmdc:mga06r32_1358803_c1_15_491 | 158 |
| 720 | 3300050510 | nmdc:mga06r32_386083_c1 | nmdc:mga06r32_386083_c1_891_1367 | 158 |
| 721 | 3300050510 | nmdc:mga06r32_41821_c1 | nmdc:mga06r32_41821_c1_3567_4043 | 158 |
| 722 | 3300050510 | nmdc:mga06r32_498246_c1 | nmdc:mga06r32_498246_c1_352_828 | 158 |
| 723 | 3300050510 | nmdc:mga06r32_974080_c1 | nmdc:mga06r32_974080_c1_38_514 | 158 |
| 724 | 3300050511 | nmdc:mga08y16_118635_c1 | nmdc:mga08y16_118635_c1_322_798 | 158 |
| 725 | 3300050511 | nmdc:mga08y16_20946_c1 | nmdc:mga08y16_20946_c1_3962_4438 | 158 |
| 726 | 3300050511 | nmdc:mga08y16_3030_c1 | nmdc:mga08y16_3030_c1_11733_12209 | 158 |
| 727 | 3300050511 | nmdc:mga08y16_435170_c1 | nmdc:mga08y16_435170_c1_250_726 | 158 |
| 728 | 3300050511 | nmdc:mga08y16_833728_c1 | nmdc:mga08y16_833728_c1_116_592 | 158 |
| 729 | 3300050512 | nmdc:mga0n895_104305_c1 | nmdc:mga0n895_104305_c1_522_998 | 158 |
| 730 | 3300050512 | nmdc:mga0n895_1693793_c1 | nmdc:mga0n895_1693793_c1_71_547 | 158 |
| 731 | 3300050512 | nmdc:mga0n895_19189_c1 | nmdc:mga0n895_19189_c1_3848_4324 | 158 |
| 732 | 3300050512 | nmdc:mga0n895_210855_c1 | nmdc:mga0n895_210855_c1_263_739 | 158 |
| 733 | 3300050512 | nmdc:mga0n895_2139228_c1 | nmdc:mga0n895_2139228_c1_28_504 | 158 |
| 734 | 3300050512 | nmdc:mga0n895_227210_c1 | nmdc:mga0n895_227210_c1_601_1077 | 158 |
| 735 | 3300050512 | nmdc:mga0n895_305864_c1 | nmdc:mga0n895_305864_c1_344_820 | 158 |
| 736 | 3300050512 | nmdc:mga0n895_450950_c1 | nmdc:mga0n895_450950_c1_211_687 | 158 |
| 737 | 3300050512 | nmdc:mga0n895_59105_c1 | nmdc:mga0n895_59105_c1_2114_2590 | 158 |
| 738 | 3300050512 | nmdc:mga0n895_848231_c1 | nmdc:mga0n895_848231_c1_192_668 | 158 |
| 739 | 3300050513 | nmdc:mga0rr50_13073_c1 | nmdc:mga0rr50_13073_c1_676_1152 | 158 |
| 740 | 3300050513 | nmdc:mga0rr50_136396_c1 | nmdc:mga0rr50_136396_c1_171_647 | 158 |
| 741 | 3300050513 | nmdc:mga0rr50_136723_c1 | nmdc:mga0rr50_136723_c1_436_912 | 158 |
| 742 | 3300050513 | nmdc:mga0rr50_183023_c1 | nmdc:mga0rr50_183023_c1_638_1114 | 158 |
| 743 | 3300050513 | nmdc:mga0rr50_192906_c1 | nmdc:mga0rr50_192906_c1_522_998 | 158 |
| 744 | 3300050513 | nmdc:mga0rr50_234065_c1 | nmdc:mga0rr50_234065_c1_27_503 | 158 |
| 745 | 3300050513 | nmdc:mga0rr50_234522_c1 | nmdc:mga0rr50_234522_c1_722_1198 | 158 |
| 746 | 3300050513 | nmdc:mga0rr50_24525_c1 | nmdc:mga0rr50_24525_c1_1539_2015 | 158 |
| 747 | 3300050513 | nmdc:mga0rr50_35290_c1 | nmdc:mga0rr50_35290_c1_269_745 | 158 |
| 748 | 3300050513 | nmdc:mga0rr50_670860_c1 | nmdc:mga0rr50_670860_c1_243_719 | 158 |
| 749 | 3300050513 | nmdc:mga0rr50_714941_c1 | nmdc:mga0rr50_714941_c1_191_667 | 158 |
| 750 | 3300050514 | nmdc:mga08x19_475200_c1 | nmdc:mga08x19_475200_c1_281_757 | 158 |
| 751 | 3300050514 | nmdc:mga08x19_5200_c1 | nmdc:mga08x19_5200_c1_6698_7174 | 158 |
| 752 | 3300050514 | nmdc:mga08x19_7608_c2 | nmdc:mga08x19_7608_c2_3012_3488 | 158 |
| 753 | 3300050514 | nmdc:mga08x19_77092_c1 | nmdc:mga08x19_77092_c1_598_1074 | 158 |
| 754 | 3300050515 | nmdc:mga0a205_107897_c1 | nmdc:mga0a205_107897_c1_2087_2563 | 158 |
| 755 | 3300050515 | nmdc:mga0a205_108965_c1 | nmdc:mga0a205_108965_c1_2065_2541 | 158 |
| 756 | 3300050515 | nmdc:mga0a205_1419263_c1 | nmdc:mga0a205_1419263_c1_45_521 | 158 |
| 757 | 3300050515 | nmdc:mga0a205_257705_c1 | nmdc:mga0a205_257705_c1_794_1270 | 158 |
| 758 | 3300050515 | nmdc:mga0a205_280858_c1 | nmdc:mga0a205_280858_c1_750_1226 | 158 |
| 759 | 3300050515 | nmdc:mga0a205_339970_c1 | nmdc:mga0a205_339970_c1_603_1079 | 158 |
| 760 | 3300050515 | nmdc:mga0a205_418275_c1 | nmdc:mga0a205_418275_c1_29_505 | 158 |
| 761 | 3300050515 | nmdc:mga0a205_44592_c1 | nmdc:mga0a205_44592_c1_1108_1584 | 158 |
| 762 | 3300050515 | nmdc:mga0a205_689510_c1 | nmdc:mga0a205_689510_c1_244_720 | 158 |
| 763 | 3300050515 | nmdc:mga0a205_898_c1 | nmdc:mga0a205_898_c1_7494_7970 | 158 |
| 764 | 3300050515 | nmdc:mga0a205_89972_c1 | nmdc:mga0a205_89972_c1_201_677 | 158 |
| 765 | 3300050515 | nmdc:mga0a205_99806_c1 | nmdc:mga0a205_99806_c1_2118_2594 | 158 |
| 766 | 3300053083 | Ga0495655_0077900 | Ga0495655_0077900_55_534 | 158 |
| 767 | 3300053083 | Ga0495655_0229258 | Ga0495655_0229258_130_606 | 158 |
| 768 | 3300054114 | Ga0501084_0001662 | Ga0501084_0001662_14208_14684 | 158 |
| 769 | 3300054114 | Ga0501084_0002436 | Ga0501084_0002436_1348_1824 | 158 |
| 770 | 3300054114 | Ga0501084_0027116 | Ga0501084_0027116_3225_3701 | 158 |
| 771 | 3300054114 | Ga0501084_0029997 | Ga0501084_0029997_920_1396 | 158 |
| 772 | 3300054114 | Ga0501084_0112610 | Ga0501084_0112610_31_507 | 158 |
| 773 | 3300054114 | Ga0501084_0241711 | Ga0501084_0241711_116_592 | 158 |
| 774 | 3300054114 | Ga0501084_0629801 | Ga0501084_0629801_336_812 | 158 |
| 775 | 3300054114 | Ga0501084_0636977 | Ga0501084_0636977_344_820 | 158 |
| 776 | 3300054114 | Ga0501084_1051042 | Ga0501084_1051042_59_535 | 158 |
| 777 | 3300054114 | Ga0501084_1481991 | Ga0501084_1481991_48_524 | 158 |
| 778 | 3300060353 | Ga0501082_0000567 | Ga0501082_0000567_392_868 | 158 |
| 779 | 3300060353 | Ga0501082_0002744 | Ga0501082_0002744_7383_7859 | 158 |
| 780 | 3300060353 | Ga0501082_0070395 | Ga0501082_0070395_14_490 | 158 |
| 781 | 3300060353 | Ga0501082_0114863 | Ga0501082_0114863_195_671 | 158 |
| 782 | 3300060353 | Ga0501082_0517397 | Ga0501082_0517397_175_651 | 158 |
| 783 | 3300060353 | Ga0501082_0548297 | Ga0501082_0548297_487_963 | 158 |
| 784 | 3300061734 | Ga0530510_0000004 | Ga0530510_0000004_115652_116128 | 158 |
| 785 | 3300061734 | Ga0530510_0008337 | Ga0530510_0008337_3778_4254 | 158 |
| 786 | 3300061734 | Ga0530510_0013854 | Ga0530510_0013854_4525_5001 | 158 |
| 787 | 3300061734 | Ga0530510_0072726 | Ga0530510_0072726_481_957 | 158 |
| 788 | 3300061734 | Ga0530510_0122308 | Ga0530510_0122308_1338_1814 | 158 |
| 789 | 3300061734 | Ga0530510_0146636 | Ga0530510_0146636_543_1019 | 158 |
| 790 | 3300061734 | Ga0530510_0985166 | Ga0530510_0985166_152_628 | 158 |
| 791 | 3300005340 | Ga0070689_101315779 | Ga0070689_1013157791 | 159 |
| 792 | 3300005434 | Ga0070709_10017798 | Ga0070709_100177983 | 159 |
| 793 | 3300005440 | Ga0070705_100261927 | Ga0070705_1002619272 | 159 |
| 794 | 3300005458 | Ga0070681_10318356 | Ga0070681_103183561 | 159 |
| 795 | 3300005467 | Ga0070706_100200412 | Ga0070706_1002004122 | 159 |
| 796 | 3300005471 | Ga0070698_100183878 | Ga0070698_1001838782 | 159 |
| 797 | 3300005545 | Ga0070695_100086829 | Ga0070695_1000868292 | 159 |
| 798 | 3300005546 | Ga0070696_100101177 | Ga0070696_1001011772 | 159 |
| 799 | 3300005548 | Ga0070665_100721117 | Ga0070665_1007211172 | 159 |
| 800 | 3300005549 | Ga0070704_100222115 | Ga0070704_1002221152 | 159 |
| 801 | 3300005617 | Ga0068859_101868518 | Ga0068859_1018685181 | 159 |
| 802 | 3300005843 | Ga0068860_101272601 | Ga0068860_1012726012 | 159 |
| 803 | 3300006358 | Ga0068871_100893510 | Ga0068871_1008935102 | 159 |
| 804 | 3300006871 | Ga0075434_100220229 | Ga0075434_1002202292 | 159 |
| 805 | 3300006871 | Ga0075434_100227961 | Ga0075434_1002279612 | 159 |
| 806 | 3300006931 | Ga0097620_101869201 | Ga0097620_1018692012 | 159 |
| 807 | 3300009094 | Ga0111539_10044400 | Ga0111539_100444002 | 159 |
| 808 | 3300009147 | Ga0114129_10798473 | Ga0114129_107984732 | 159 |
| 809 | 3300009147 | Ga0114129_11742557 | Ga0114129_117425572 | 159 |
| 810 | 3300009176 | Ga0105242_10138777 | Ga0105242_101387772 | 159 |
| 811 | 3300009551 | Ga0105238_10069382 | Ga0105238_100693823 | 159 |
| 812 | 3300013105 | Ga0157369_10217059 | Ga0157369_102170592 | 159 |
| 813 | 3300013297 | Ga0157378_11982502 | Ga0157378_119825022 | 159 |
| 814 | 3300014325 | Ga0163163_10506302 | Ga0163163_105063022 | 159 |
| 815 | 3300025905 | Ga0207685_10105949 | Ga0207685_101059492 | 159 |
| 816 | 3300025910 | Ga0207684_10013814 | Ga0207684_100138146 | 159 |
| 817 | 3300025912 | Ga0207707_10535647 | Ga0207707_105356472 | 159 |
| 818 | 3300025915 | Ga0207693_10400419 | Ga0207693_104004192 | 159 |
| 819 | 3300025924 | Ga0207694_10044685 | Ga0207694_100446853 | 159 |
| 820 | 3300025934 | Ga0207686_10159058 | Ga0207686_101590582 | 159 |
| 821 | 3300026041 | Ga0207639_10305816 | Ga0207639_103058161 | 159 |
| 822 | 3300026142 | Ga0207698_11662362 | Ga0207698_116623621 | 159 |
| 823 | 3300028379 | Ga0268266_11003625 | Ga0268266_110036252 | 159 |
| 824 | 3300031239 | Ga0265328_10057182 | Ga0265328_100571822 | 159 |
| 825 | 3300031240 | Ga0265320_10361190 | Ga0265320_103611901 | 159 |
| 826 | 3300031241 | Ga0265325_10069363 | Ga0265325_100693632 | 159 |
| 827 | 3300031249 | Ga0265339_10019242 | Ga0265339_100192423 | 159 |
| 828 | 3300031250 | Ga0265331_10001750 | Ga0265331_100017509 | 159 |
| 829 | 3300031595 | Ga0265313_10000827 | Ga0265313_1000082726 | 159 |
| 830 | 3300031712 | Ga0265342_10023073 | Ga0265342_100230733 | 159 |
| 831 | 3300035088 | Ga0373940_0119209 | Ga0373940_0119209_67_552 | 159 |
| 832 | 3300035113 | Ga0373936_0245159 | Ga0373936_0245159_81_560 | 159 |
| 833 | 3300035116 | Ga0373945_0084629 | Ga0373945_0084629_690_1169 | 159 |
| 834 | 3300035725 | Ga0373947_0670133 | Ga0373947_0670133_41_520 | 159 |
| 835 | 3300036401 | Ga0373937_0412708 | Ga0373937_0412708_702_1181 | 159 |
| 836 | 3300037068 | Ga0373925_0179456 | Ga0373925_0179456_372_851 | 159 |
| 837 | 3300042438 | Ga0439459_0146234 | Ga0439459_0146234_84_566 | 159 |
| 838 | 3300046491 | Ga0495584_0258842 | Ga0495584_0258842_150_635 | 159 |
| 839 | 3300046683 | Ga0495658_0336575 | Ga0495658_0336575_207_686 | 159 |
| 840 | 3300048903 | Ga0496100_0401498 | Ga0496100_0401498_151_636 | 159 |
| 841 | 3300048904 | Ga0496101_1111565 | Ga0496101_1111565_58_543 | 159 |
| 842 | 3300048909 | Ga0496106_0424802 | Ga0496106_0424802_517_999 | 159 |
| 843 | 3300049575 | Ga0501039_0963490 | Ga0501039_0963490_172_651 | 159 |
| 844 | 3300050507 | nmdc:mga05p37_1376606_c1 | nmdc:mga05p37_1376606_c1_53_538 | 159 |
| 845 | 3300050507 | nmdc:mga05p37_165504_c1 | nmdc:mga05p37_165504_c1_697_1182 | 159 |
| 846 | 3300050511 | nmdc:mga08y16_100544_c1 | nmdc:mga08y16_100544_c1_1715_2200 | 159 |
| 847 | 3300050512 | nmdc:mga0n895_163863_c1 | nmdc:mga0n895_163863_c1_947_1432 | 159 |
| 848 | 3300050512 | nmdc:mga0n895_54227_c1 | nmdc:mga0n895_54227_c1_3097_3582 | 159 |
| 849 | 3300050513 | nmdc:mga0rr50_122342_c1 | nmdc:mga0rr50_122342_c1_1410_1895 | 159 |
| 850 | 3300050515 | nmdc:mga0a205_865812_c1 | nmdc:mga0a205_865812_c1_212_697 | 159 |
| 851 | 3300005344 | Ga0070661_100951606 | Ga0070661_1009516061 | 160 |
| 852 | 3300005445 | Ga0070708_100059696 | Ga0070708_1000596964 | 160 |
| 853 | 3300005468 | Ga0070707_100062823 | Ga0070707_1000628234 | 160 |
| 854 | 3300005471 | Ga0070698_100009575 | Ga0070698_1000095752 | 160 |
| 855 | 3300005518 | Ga0070699_100027897 | Ga0070699_1000278974 | 160 |
| 856 | 3300005549 | Ga0070704_100099673 | Ga0070704_1000996732 | 160 |
| 857 | 3300006175 | Ga0070712_100367805 | Ga0070712_1003678052 | 160 |
| 858 | 3300006844 | Ga0075428_100261471 | Ga0075428_1002614713 | 160 |
| 859 | 3300006846 | Ga0075430_100006077 | Ga0075430_10000607710 | 160 |
| 860 | 3300006847 | Ga0075431_100006036 | Ga0075431_10000603612 | 160 |
| 861 | 3300006847 | Ga0075431_100046375 | Ga0075431_1000463753 | 160 |
| 862 | 3300006852 | Ga0075433_10481153 | Ga0075433_104811532 | 160 |
| 863 | 3300006852 | Ga0075433_10592320 | Ga0075433_105923202 | 160 |
| 864 | 3300006871 | Ga0075434_100244650 | Ga0075434_1002446502 | 160 |
| 865 | 3300006871 | Ga0075434_100275006 | Ga0075434_1002750062 | 160 |
| 866 | 3300006880 | Ga0075429_100000231 | Ga0075429_1000002317 | 160 |
| 867 | 3300006914 | Ga0075436_100019659 | Ga0075436_1000196595 | 160 |
| 868 | 3300007076 | Ga0075435_100593860 | Ga0075435_1005938602 | 160 |
| 869 | 3300009094 | Ga0111539_11845588 | Ga0111539_118455881 | 160 |
| 870 | 3300009147 | Ga0114129_10045389 | Ga0114129_100453892 | 160 |
| 871 | 3300009147 | Ga0114129_10108103 | Ga0114129_101081034 | 160 |
| 872 | 3300025906 | Ga0207699_10699993 | Ga0207699_106999931 | 160 |
| 873 | 3300025910 | Ga0207684_10009460 | Ga0207684_1000946010 | 160 |
| 874 | 3300025915 | Ga0207693_10440230 | Ga0207693_104402302 | 160 |
| 875 | 3300025916 | Ga0207663_10490803 | Ga0207663_104908032 | 160 |
| 876 | 3300025922 | Ga0207646_10003701 | Ga0207646_1000370112 | 160 |
| 877 | 3300025928 | Ga0207700_10101633 | Ga0207700_101016332 | 160 |
| 878 | 3300025929 | Ga0207664_10179129 | Ga0207664_101791292 | 160 |
| 879 | 3300031595 | Ga0265313_10185659 | Ga0265313_101856592 | 160 |
| 880 | 3300037312 | Ga0395899_0153428 | Ga0395899_0153428_1023_1508 | 160 |
| 881 | 3300037418 | Ga0395900_0006737 | Ga0395900_0006737_4822_5307 | 160 |
| 882 | 3300037466 | Ga0395898_0010133 | Ga0395898_0010133_9333_9818 | 160 |
| 883 | 3300038443 | Ga0395901_0006192 | Ga0395901_0006192_11610_12095 | 160 |
| 884 | 3300041411 | Ga0439466_0048642 | Ga0439466_0048642_626_1108 | 160 |
| 885 | 3300049161 | Ga0501305_085992 | Ga0501305_085992_24_527 | 160 |
| 886 | 3300049572 | Ga0501036_0071970 | Ga0501036_0071970_1386_1868 | 160 |
| 887 | 3300049574 | Ga0501038_0105155 | Ga0501038_0105155_899_1381 | 160 |
| 888 | 3300049577 | Ga0501041_0024142 | Ga0501041_0024142_1729_2211 | 160 |
| 889 | 3300049577 | Ga0501041_0694717 | Ga0501041_0694717_133_618 | 160 |
| 890 | 3300049578 | Ga0501042_0104521 | Ga0501042_0104521_115_600 | 160 |
| 891 | 3300049580 | Ga0501046_0046249 | Ga0501046_0046249_2014_2496 | 160 |
| 892 | 3300049582 | Ga0501048_0037582 | Ga0501048_0037582_981_1463 | 160 |
| 893 | 3300049582 | Ga0501048_0432600 | Ga0501048_0432600_69_554 | 160 |
| 894 | 3300049582 | Ga0501048_0523030 | Ga0501048_0523030_320_805 | 160 |
| 895 | 3300049584 | Ga0501068_0054654 | Ga0501068_0054654_525_1007 | 160 |
| 896 | 3300049584 | Ga0501068_0336008 | Ga0501068_0336008_174_659 | 160 |
| 897 | 3300049584 | Ga0501068_0723670 | Ga0501068_0723670_34_519 | 160 |
| 898 | 3300049587 | Ga0501071_0189012 | Ga0501071_0189012_12_494 | 160 |
| 899 | 3300049589 | Ga0501073_0116445 | Ga0501073_0116445_1135_1617 | 160 |
| 900 | 3300049591 | Ga0501075_0060858 | Ga0501075_0060858_1079_1561 | 160 |
| 901 | 3300049591 | Ga0501075_0133558 | Ga0501075_0133558_1082_1567 | 160 |
| 902 | 3300049591 | Ga0501075_0272937 | Ga0501075_0272937_52_537 | 160 |
| 903 | 3300049591 | Ga0501075_0323388 | Ga0501075_0323388_379_864 | 160 |
| 904 | 3300049593 | Ga0501077_0058521 | Ga0501077_0058521_381_863 | 160 |
| 905 | 3300049593 | Ga0501077_0196427 | Ga0501077_0196427_514_999 | 160 |
| 906 | 3300049741 | Ga0501079_0058831 | Ga0501079_0058831_1547_2029 | 160 |
| 907 | 3300049742 | Ga0501080_0066821 | Ga0501080_0066821_1393_1875 | 160 |
| 908 | 3300049743 | Ga0501081_0003442 | Ga0501081_0003442_1533_2015 | 160 |
| 909 | 3300049824 | Ga0501045_0081861 | Ga0501045_0081861_309_791 | 160 |
| 910 | 3300050507 | nmdc:mga05p37_176241_c1 | nmdc:mga05p37_176241_c1_894_1379 | 160 |
| 911 | 3300050507 | nmdc:mga05p37_33814_c1 | nmdc:mga05p37_33814_c1_673_1158 | 160 |
| 912 | 3300050507 | nmdc:mga05p37_72842_c1 | nmdc:mga05p37_72842_c1_3571_4056 | 160 |
| 913 | 3300050508 | nmdc:mga09592_679155_c1 | nmdc:mga09592_679155_c1_201_695 | 160 |
| 914 | 3300050508 | nmdc:mga09592_691_c1 | nmdc:mga09592_691_c1_6341_6826 | 160 |
| 915 | 3300050509 | nmdc:mga0qj67_213_c1 | nmdc:mga0qj67_213_c1_30043_30528 | 160 |
| 916 | 3300050510 | nmdc:mga06r32_230362_c1 | nmdc:mga06r32_230362_c1_389_874 | 160 |
| 917 | 3300050512 | nmdc:mga0n895_192746_c1 | nmdc:mga0n895_192746_c1_515_1000 | 160 |
| 918 | 3300050515 | nmdc:mga0a205_317158_c1 | nmdc:mga0a205_317158_c1_32_517 | 160 |
| 919 | 3300050515 | nmdc:mga0a205_434535_c1 | nmdc:mga0a205_434535_c1_289_774 | 160 |
| 920 | 3300054114 | Ga0501084_0078448 | Ga0501084_0078448_119_604 | 160 |
| 921 | 3300054114 | Ga0501084_0174967 | Ga0501084_0174967_395_877 | 160 |
| 922 | 3300054114 | Ga0501084_0469717 | Ga0501084_0469717_541_1026 | 160 |
| 923 | 3300060353 | Ga0501082_0063843 | Ga0501082_0063843_972_1454 | 160 |
| 924 | 3300060353 | Ga0501082_0232715 | Ga0501082_0232715_396_881 | 160 |
| 925 | 3300060353 | Ga0501082_1820701 | Ga0501082_1820701_21_503 | 160 |
| 926 | 3300061734 | Ga0530510_0029094 | Ga0530510_0029094_1415_1897 | 160 |
| 927 | 3300003163 | Ga0006759J45824_1047994 | Ga0006759J45824_10479941 | 161 |
| 928 | 3300003308 | Ga0006777J48905_1043548 | Ga0006777J48905_10435482 | 161 |
| 929 | 3300003574 | Ga0007410J51695_1025380 | Ga0007410J51695_10253801 | 161 |
| 930 | 3300003579 | Ga0007429J51699_1036292 | Ga0007429J51699_10362922 | 161 |
| 931 | 3300004803 | Ga0058862_12435877 | Ga0058862_124358772 | 161 |
| 932 | 3300005339 | Ga0070660_100275412 | Ga0070660_1002754121 | 161 |
| 933 | 3300005345 | Ga0070692_10376336 | Ga0070692_103763362 | 161 |
| 934 | 3300005355 | Ga0070671_100518997 | Ga0070671_1005189971 | 161 |
| 935 | 3300005530 | Ga0070679_100344590 | Ga0070679_1003445901 | 161 |
| 936 | 3300005535 | Ga0070684_100242059 | Ga0070684_1002420592 | 161 |
| 937 | 3300005547 | Ga0070693_100878737 | Ga0070693_1008787371 | 161 |
| 938 | 3300005549 | Ga0070704_100046832 | Ga0070704_1000468322 | 161 |
| 939 | 3300005564 | Ga0070664_100436268 | Ga0070664_1004362682 | 161 |
| 940 | 3300005578 | Ga0068854_100284689 | Ga0068854_1002846892 | 161 |
| 941 | 3300005614 | Ga0068856_101116104 | Ga0068856_1011161041 | 161 |
| 942 | 3300005615 | Ga0070702_100248406 | Ga0070702_1002484062 | 161 |
| 943 | 3300006847 | Ga0075431_101294668 | Ga0075431_1012946682 | 161 |
| 944 | 3300006852 | Ga0075433_10308921 | Ga0075433_103089212 | 161 |
| 945 | 3300009093 | Ga0105240_10217423 | Ga0105240_102174232 | 161 |
| 946 | 3300009147 | Ga0114129_10177825 | Ga0114129_101778252 | 161 |
| 947 | 3300014325 | Ga0163163_10440381 | Ga0163163_104403812 | 161 |
| 948 | 3300020070 | Ga0206356_11296602 | Ga0206356_112966021 | 161 |
| 949 | 3300020078 | Ga0206352_10551387 | Ga0206352_105513871 | 161 |
| 950 | 3300020078 | Ga0206352_10961566 | Ga0206352_109615662 | 161 |
| 951 | 3300020080 | Ga0206350_10918364 | Ga0206350_109183641 | 161 |
| 952 | 3300021358 | Ga0213873_10031999 | Ga0213873_100319992 | 161 |
| 953 | 3300021377 | Ga0213874_10116250 | Ga0213874_101162502 | 161 |
| 954 | 3300021384 | Ga0213876_10073124 | Ga0213876_100731242 | 161 |
| 955 | 3300021388 | Ga0213875_10027992 | Ga0213875_100279923 | 161 |
| 956 | 3300022467 | Ga0224712_10276785 | Ga0224712_102767852 | 161 |
| 957 | 3300025913 | Ga0207695_10308224 | Ga0207695_103082242 | 161 |
| 958 | 3300025921 | Ga0207652_10108409 | Ga0207652_101084094 | 161 |
| 959 | 3300025945 | Ga0207679_10607726 | Ga0207679_106077262 | 161 |
| 960 | 3300031241 | Ga0265325_10021553 | Ga0265325_100215531 | 161 |
| 961 | 3300038443 | Ga0395901_0520337 | Ga0395901_0520337_458_943 | 161 |
| 962 | 3300039437 | Ga0436365_0527275 | Ga0436365_0527275_731_1216 | 161 |
| 963 | 3300039438 | Ga0436360_0096378 | Ga0436360_0096378_1608_2093 | 161 |
| 964 | 3300039450 | Ga0436363_0015138 | Ga0436363_0015138_161_646 | 161 |
| 965 | 3300039453 | Ga0436362_1242246 | Ga0436362_1242246_427_912 | 161 |
| 966 | 3300048904 | Ga0496101_0254165 | Ga0496101_0254165_470_958 | 161 |
| 967 | 3300048905 | Ga0496102_0497306 | Ga0496102_0497306_471_959 | 161 |
| 968 | 3300048909 | Ga0496106_0136730 | Ga0496106_0136730_1409_1897 | 161 |
| 969 | 3300048911 | Ga0496108_0456019 | Ga0496108_0456019_337_825 | 161 |
| 970 | 3300048915 | Ga0496112_0062304 | Ga0496112_0062304_1683_2171 | 161 |
| 971 | 3300049581 | Ga0501047_1280446 | Ga0501047_1280446_25_510 | 161 |
| 972 | 3300049586 | Ga0501070_0869376 | Ga0501070_0869376_109_594 | 161 |
| 973 | 3300050512 | nmdc:mga0n895_111044_c1 | nmdc:mga0n895_111044_c1_2087_2575 | 161 |
| 974 | 3300050515 | nmdc:mga0a205_155793_c1 | nmdc:mga0a205_155793_c1_205_693 | 161 |
| 975 | 3300050515 | nmdc:mga0a205_155980_c1 | nmdc:mga0a205_155980_c1_945_1433 | 161 |
| 976 | 3300053077 | Ga0495601_0157641 | Ga0495601_0157641_151_636 | 161 |
| 977 | 3300059492 | Ga0587073_0018764 | Ga0587073_0018764_572_1057 | 161 |
| 978 | 3300059506 | Ga0587085_047909 | Ga0587085_047909_105_590 | 161 |
| 979 | 3300059513 | Ga0587094_016200 | Ga0587094_016200_356_841 | 161 |
| 980 | 3300059607 | Ga0587125_037493 | Ga0587125_037493_128_625 | 161 |
| 981 | 3300059639 | Ga0587062_060626 | Ga0587062_060626_39_542 | 161 |
| 982 | 3300059642 | Ga0587069_052092 | Ga0587069_052092_234_719 | 161 |
| 983 | 3300059645 | Ga0587076_065070 | Ga0587076_065070_56_553 | 161 |
| 984 | 3300059647 | Ga0587079_017136 | Ga0587079_017136_194_679 | 161 |
| 985 | 3300059658 | Ga0587119_031195 | Ga0587119_031195_188_691 | 161 |
| 986 | 3300060344 | Ga0587071_019649 | Ga0587071_019649_178_663 | 161 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1n5w-assembly1.cif.gz_D | crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form | 0.9288 | 3 | 157 |
| 1rm6-assembly1.cif.gz_C | structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica | 0.9285 | 2 | 156 |
| 1ffv-assembly1.cif.gz_A | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava | 0.9274 | 3 | 156 |
| 4zoh-assembly1.cif.gz_C-2 | crystal structure of glyceraldehyde oxidoreductase | 0.9217 | 3 | 155 |
| 3hrd-assembly1.cif.gz_H | crystal structure of nicotinate dehydrogenase | 0.9193 | 1 | 156 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1sb3C02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9458 | 81 | 155 | 1.10.150.120 |
| 4zohC02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9419 | 81 | 155 | 1.10.150.120 |
| 1ffuD02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9394 | 81 | 155 | 1.10.150.120 |
| 1n60A02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.939 | 81 | 157 | 1.10.150.120 |
| 3hrdH02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9382 | 80 | 156 | 1.10.150.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A177QCX2-F1-model_v4 | Ferredoxin | 0.946 | 1 | 155 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A3E0P8F5-F1-model_v4 | (2Fe-2S)-binding protein | 0.9457 | 2 | 160 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A1F6C3A9-F1-model_v4 | 2Fe-2S ferredoxin-type domain-containing protein | 0.9455 | 2 | 160 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A2S8FBI0-F1-model_v4 | Ferredoxin | 0.9445 | 2 | 161 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A523P1N6-F1-model_v4 | (2Fe-2S)-binding protein | 0.9441 | 1 | 157 |
GO:0016491
GO:0046872 GO:0051537 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar