F487526

General Info

Members Datasets Scaffolds Average Seq Length
986 373 1972 282

Family's Representative Sequence

Representative Sequence 3300025937|Ga0207669_10050150|Ga0207669_100501501
Length 324
Sequence MGSNERNPIPTPALPLKGRGITSLLPSFPPSLIQNMQIFDIFLLEAILNGILLGGILALLALGLNLIFGVIDVVWICYAELIMIGMYAIFYLHVSYGWPLWLAFPCAVVVVAMLGLLLHQLVIRPVLAAEPINQLLVTGGVLFFLQGVATLAFGVEFKNLGVNLPPISLGEMQFSSARLVAFLAALGCMIGMYLFLTRTYLGTAIRAISQDRAIMPLMGVNPSRIFLITSALGGGLAGLASCLLVLQYDIHPAIGLSFGPITFLVCVLGGLGNMIGGFIAAFIFAQFISVGGFFLHLEWGYVLAFLFFIGFMFWRPRGLLGGKS

Samples

Sample ID Description Type Environment
1 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
118 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
184 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
189 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
190 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
191 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
192 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
193 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
196 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
199 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
200 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
201 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
202 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
203 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
204 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
205 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
207 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
208 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
209 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
210 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
211 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
212 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
213 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
216 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
217 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
218 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
219 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
220 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
221 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
222 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
223 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
224 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
228 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
229 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
230 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
231 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
232 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
233 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
234 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
235 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
236 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
237 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
238 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
239 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
240 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
241 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
242 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
243 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
244 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
245 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
246 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
247 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
248 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
249 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
250 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
251 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
252 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
253 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
254 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
255 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
256 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
257 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
258 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
259 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
260 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
261 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
262 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
263 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
264 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
265 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
266 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
267 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
268 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
269 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
270 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
271 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
272 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
273 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
274 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
275 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
276 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
277 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
278 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
279 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
280 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
281 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
282 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
283 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
284 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
285 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
286 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
287 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
288 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
289 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
290 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
291 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
292 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
293 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
294 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
295 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
296 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
297 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
298 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
299 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
300 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
301 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
302 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
303 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
304 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
305 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
306 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
307 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
308 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
309 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
310 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
311 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
312 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
326 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
327 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
328 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
329 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
330 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
331 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
332 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
333 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
334 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
335 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
336 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
337 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
338 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
339 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
340 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
343 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
344 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
345 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
346 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
347 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
348 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
349 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
350 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
351 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
352 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
353 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
354 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
355 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
356 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
357 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
358 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
359 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
360 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
361 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
362 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
363 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
364 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
365 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
366 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
367 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
368 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
369 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
370 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
371 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
372 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
373 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.14
Nodule 0
Rhizoplane 4.06
Rhizosphere 89.55
Stem 0
Stem Tuber 0
Unclassified 0.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207669_10050150 3300025937 Bacteria 2493
2 JGI25406J46586_10006501 3300003203 Bacteria 5377
3 JGI25406J46586_10011229 3300003203 Bacteria 3937
4 JGI26129J50193_1002204 3300003349 Bacteria 1366
5 Ga0065712_10030896 3300005290 Bacteria 1858
6 Ga0065715_10124256 3300005293 Bacteria 2158
7 Ga0065715_10157979 3300005293 Bacteria 1658
8 Ga0065707_10096354 3300005295 Bacteria 3275
9 Ga0065707_10119257 3300005295 Bacteria 2162
10 Ga0070676_10034437 3300005328 Bacteria 2908
11 Ga0070690_100067294 3300005330 Bacteria 2321
12 Ga0070690_100162427 3300005330 Bacteria 1532
13 Ga0070670_100356109 3300005331 Bacteria 1286
14 Ga0070677_10022862 3300005333 Bacteria 2308
15 Ga0068869_100002482 3300005334 Bacteria 11121
16 Ga0068869_100006166 3300005334 Bacteria 7591
17 Ga0068869_100015428 3300005334 Bacteria 5124
18 Ga0068869_100187717 3300005334 Bacteria 1624
19 Ga0068869_100349072 3300005334 Bacteria 1206
20 Ga0070680_100176034 3300005336 Bacteria 1801
21 Ga0070680_100259607 3300005336 Bacteria 1469
22 Ga0070682_100001528 3300005337 Bacteria 12962
23 Ga0068868_100002947 3300005338 Bacteria 11815
24 Ga0070689_100002038 3300005340 Bacteria 13107
25 Ga0070689_100156381 3300005340 Bacteria 1841
26 Ga0070691_10016926 3300005341 Bacteria 3353
27 Ga0070691_10017617 3300005341 Bacteria 3287
28 Ga0070691_10021810 3300005341 Bacteria 2967
29 Ga0070691_10028327 3300005341 Bacteria 2616
30 Ga0070691_10076194 3300005341 Bacteria 1635
31 Ga0070687_100000326 3300005343 Bacteria 16173
32 Ga0070687_100056298 3300005343 Bacteria 2057
33 Ga0070692_10008943 3300005345 Bacteria 4491
34 Ga0070692_10010920 3300005345 Bacteria 4155
35 Ga0070692_10070275 3300005345 Bacteria 1864
36 Ga0070692_10157985 3300005345 Bacteria 1296
37 Ga0070668_100027604 3300005347 Bacteria 4310
38 Ga0070668_100337000 3300005347 Bacteria 1273
39 Ga0070668_100359050 3300005347 Bacteria 1235
40 Ga0070669_100002984 3300005353 Bacteria 12193
41 Ga0070669_100382177 3300005353 Bacteria 1148
42 Ga0070669_100388179 3300005353 Bacteria 1140
43 Ga0070675_100179485 3300005354 Bacteria 1830
44 Ga0070675_100270406 3300005354 Bacteria 1491
45 Ga0070671_100204493 3300005355 Bacteria 1675
46 Ga0070671_100282518 3300005355 Bacteria 1412
47 Ga0070674_100028481 3300005356 Bacteria 3670
48 Ga0070674_100103882 3300005356 Bacteria 2075
49 Ga0070659_100096411 3300005366 Bacteria 2376
50 Ga0070709_10193076 3300005434 Bacteria 1438
51 Ga0070714_100050541 3300005435 Bacteria 3542
52 Ga0070714_100066078 3300005435 Bacteria 3117
53 Ga0070714_100526074 3300005435 Bacteria 1130
54 Ga0070713_100035581 3300005436 Bacteria 4010
55 Ga0070701_10005350 3300005438 Bacteria 5290
56 Ga0070701_10010591 3300005438 Bacteria 4084
57 Ga0070705_100000638 3300005440 Bacteria 20069
58 Ga0070705_100000671 3300005440 Bacteria 19567
59 Ga0070705_100016484 3300005440 Bacteria 3841
60 Ga0070705_100029720 3300005440 Bacteria 3010
61 Ga0070705_100152480 3300005440 Bacteria 1535
62 Ga0070705_100177207 3300005440 Bacteria 1440
63 Ga0070705_100193116 3300005440 Bacteria 1389
64 Ga0070705_100235746 3300005440 Bacteria 1276
65 Ga0070700_100000211 3300005441 Bacteria 32522
66 Ga0070700_100003296 3300005441 Bacteria 8326
67 Ga0070700_100011184 3300005441 Bacteria 4967
68 Ga0070700_100031792 3300005441 Bacteria 3166
69 Ga0070700_100205331 3300005441 Bacteria 1387
70 Ga0070694_100002732 3300005444 Bacteria 10466
71 Ga0070694_100003420 3300005444 Bacteria 9515
72 Ga0070694_100003723 3300005444 Bacteria 9094
73 Ga0070694_100003917 3300005444 Bacteria 8904
74 Ga0070694_100041452 3300005444 Bacteria 3072
75 Ga0070694_100051160 3300005444 Bacteria 2787
76 Ga0070694_100052666 3300005444 Bacteria 2752
77 Ga0070694_100114275 3300005444 Bacteria 1927
78 Ga0070694_100147170 3300005444 Bacteria 1717
79 Ga0070694_100174022 3300005444 Bacteria 1588
80 Ga0070708_100006158 3300005445 Bacteria 9543
81 Ga0070708_100026888 3300005445 Bacteria 4930
82 Ga0070708_100083951 3300005445 Bacteria 2889
83 Ga0070708_100238026 3300005445 Bacteria 1709
84 Ga0070708_100303382 3300005445 Bacteria 1504
85 Ga0070663_100256353 3300005455 Bacteria 1386
86 Ga0070678_100061326 3300005456 Bacteria 2771
87 Ga0070678_100254757 3300005456 Bacteria 1473
88 Ga0070662_100094058 3300005457 Bacteria 2256
89 Ga0070662_100201370 3300005457 Bacteria 1580
90 Ga0070681_10010518 3300005458 Bacteria 9136
91 Ga0070681_10021226 3300005458 Bacteria 6507
92 Ga0070681_10078253 3300005458 Bacteria 3264
93 Ga0070681_10108660 3300005458 Bacteria 2714
94 Ga0068867_100001335 3300005459 Bacteria 17077
95 Ga0068867_100003689 3300005459 Bacteria 10776
96 Ga0068867_100134456 3300005459 Bacteria 1926
97 Ga0068867_100165182 3300005459 Bacteria 1749
98 Ga0070706_100073844 3300005467 Bacteria 3157
99 Ga0070706_100078254 3300005467 Bacteria 3062
100 Ga0070707_100018938 3300005468 Bacteria 6483
101 Ga0070707_100037794 3300005468 Bacteria 4610
102 Ga0070707_100274545 3300005468 Bacteria 1639
103 Ga0070707_100317232 3300005468 Bacteria 1515
104 Ga0070698_100005791 3300005471 Bacteria 13518
105 Ga0070698_100137973 3300005471 Bacteria 2392
106 Ga0070699_100003010 3300005518 Bacteria 14968
107 Ga0070699_100006362 3300005518 Bacteria 10297
108 Ga0070699_100006895 3300005518 Bacteria 9881
109 Ga0070699_100042885 3300005518 Bacteria 3916
110 Ga0070699_100381209 3300005518 Bacteria 1273
111 Ga0070679_100064153 3300005530 Bacteria 3661
112 Ga0070679_100113499 3300005530 Bacteria 2695
113 Ga0070679_100202722 3300005530 Bacteria 1949
114 Ga0070679_100400224 3300005530 Bacteria 1319
115 Ga0070697_100001293 3300005536 Bacteria 18848
116 Ga0070697_100001434 3300005536 Bacteria 18124
117 Ga0070697_100005785 3300005536 Bacteria 9535
118 Ga0070697_100007886 3300005536 Bacteria 8297
119 Ga0070697_100008411 3300005536 Bacteria 8051
120 Ga0070697_100019057 3300005536 Bacteria 5415
121 Ga0070697_100072868 3300005536 Bacteria 2819
122 Ga0068853_100274211 3300005539 Bacteria 1554
123 Ga0070672_100083906 3300005543 Bacteria 2558
124 Ga0070672_100129583 3300005543 Bacteria 2072
125 Ga0070672_100254777 3300005543 Bacteria 1479
126 Ga0070686_100010234 3300005544 Bacteria 5280
127 Ga0070686_100173058 3300005544 Bacteria 1529
128 Ga0070686_100339895 3300005544 Bacteria 1125
129 Ga0070686_100459993 3300005544 Bacteria 980
130 Ga0070695_100000948 3300005545 Bacteria 15745
131 Ga0070695_100001721 3300005545 Bacteria 12312
132 Ga0070695_100002319 3300005545 Bacteria 10916
133 Ga0070695_100005573 3300005545 Bacteria 7415
134 Ga0070695_100022262 3300005545 Bacteria 3886
135 Ga0070695_100022535 3300005545 Bacteria 3864
136 Ga0070695_100027043 3300005545 Bacteria 3552
137 Ga0070695_100031558 3300005545 Bacteria 3306
138 Ga0070695_100086311 3300005545 Bacteria 2085
139 Ga0070696_100000012 3300005546 Bacteria 79388
140 Ga0070696_100002401 3300005546 Bacteria 12400
141 Ga0070696_100009167 3300005546 Bacteria 6624
142 Ga0070696_100044664 3300005546 Bacteria 3068
143 Ga0070696_100095717 3300005546 Bacteria 2121
144 Ga0070696_100126282 3300005546 Bacteria 1856
145 Ga0070696_100278221 3300005546 Bacteria 1275
146 Ga0070693_100000135 3300005547 Bacteria 33350
147 Ga0070693_100007379 3300005547 Bacteria 5372
148 Ga0070693_100128216 3300005547 Bacteria 1582
149 Ga0070693_100281037 3300005547 Bacteria 1115
150 Ga0070704_100000108 3300005549 Bacteria 28920
151 Ga0070704_100000193 3300005549 Bacteria 25011
152 Ga0070704_100029938 3300005549 Bacteria 3641
153 Ga0070704_100080648 3300005549 Bacteria 2394
154 Ga0070704_100169376 3300005549 Bacteria 1735
155 Ga0070704_100236196 3300005549 Bacteria 1494
156 Ga0070704_100277704 3300005549 Bacteria 1386
157 Ga0070704_100282099 3300005549 Bacteria 1377
158 Ga0070704_100393298 3300005549 Bacteria 1181
159 Ga0070704_100399480 3300005549 Bacteria 1172
160 Ga0068855_100063388 3300005563 Bacteria 4313
161 Ga0068855_100288486 3300005563 Bacteria 1820
162 Ga0070664_100138582 3300005564 Bacteria 2141
163 Ga0068857_100022542 3300005577 Bacteria 5541
164 Ga0068857_100359791 3300005577 Bacteria 1349
165 Ga0068857_100430073 3300005577 Bacteria 1232
166 Ga0068857_100740837 3300005577 Bacteria 936
167 Ga0068854_100001657 3300005578 Bacteria 13562
168 Ga0068854_100407247 3300005578 Bacteria 1127
169 Ga0068856_100332974 3300005614 Bacteria 1536
170 Ga0068859_100003978 3300005617 Bacteria 15080
171 Ga0068859_100006107 3300005617 Bacteria 12235
172 Ga0068859_100007972 3300005617 Bacteria 10743
173 Ga0068859_100021038 3300005617 Bacteria 6547
174 Ga0068859_100099270 3300005617 Bacteria 2967
175 Ga0068859_100383206 3300005617 Bacteria 1501
176 Ga0068859_100432520 3300005617 Bacteria 1412
177 Ga0068864_100149961 3300005618 Bacteria 2111
178 Ga0068864_100381014 3300005618 Bacteria 1337
179 Ga0068866_10009989 3300005718 Bacteria 4053
180 Ga0068861_100000173 3300005719 Bacteria 34168
181 Ga0068861_100019210 3300005719 Bacteria 4882
182 Ga0068861_100113605 3300005719 Bacteria 2173
183 Ga0068861_100131722 3300005719 Bacteria 2030
184 Ga0068861_100424200 3300005719 Bacteria 1186
185 Ga0068863_100126447 3300005841 Bacteria 2439
186 Ga0068858_100001425 3300005842 Bacteria 24575
187 Ga0068858_100136445 3300005842 Bacteria 2302
188 Ga0068858_100161059 3300005842 Bacteria 2113
189 Ga0068858_100228900 3300005842 Bacteria 1762
190 Ga0068860_100001885 3300005843 Bacteria 22275
191 Ga0068860_100060141 3300005843 Bacteria 3611
192 Ga0068860_100554582 3300005843 Bacteria 1152
193 Ga0068862_100000594 3300005844 Bacteria 37690
194 Ga0068862_100004236 3300005844 Bacteria 12153
195 Ga0081455_10000014 3300005937 Bacteria 193884
196 Ga0081455_10007461 3300005937 Bacteria 11516
197 Ga0081455_10017729 3300005937 Bacteria 6813
198 Ga0081538_10027411 3300005981 Bacteria 3950
199 Ga0081538_10048592 3300005981 Bacteria 2585
200 Ga0081540_1000035 3300005983 Bacteria 141244
201 Ga0081540_1000878 3300005983 Bacteria 27167
202 Ga0081539_10000462 3300005985 Bacteria 86060
203 Ga0081539_10001341 3300005985 Bacteria 42889
204 Ga0070717_10424093 3300006028 Bacteria 1197
205 Ga0070717_10463418 3300006028 Bacteria 1143
206 Ga0075365_10011758 3300006038 Bacteria 5162
207 Ga0075368_10003743 3300006042 Bacteria 5105
208 Ga0075368_10012309 3300006042 Bacteria 3124
209 Ga0075363_100030177 3300006048 Bacteria 2804
210 Ga0075363_100052945 3300006048 Bacteria 2167
211 Ga0075432_10041440 3300006058 Bacteria 1609
212 Ga0070715_10083343 3300006163 Bacteria 1456
213 Ga0070716_100078136 3300006173 Bacteria 1967
214 Ga0070716_100231393 3300006173 Bacteria 1248
215 Ga0070712_100006640 3300006175 Bacteria 7192
216 Ga0070712_100057102 3300006175 Bacteria 2741
217 Ga0075362_10078884 3300006177 Bacteria 1515
218 Ga0075367_10028637 3300006178 Bacteria 3179
219 Ga0075367_10040940 3300006178 Bacteria 2706
220 Ga0075367_10208319 3300006178 Bacteria 1222
221 Ga0097621_100000939 3300006237 Bacteria 20422
222 Ga0075370_10033514 3300006353 Bacteria 2876
223 Ga0068871_100000370 3300006358 Bacteria 31403
224 Ga0068871_100080962 3300006358 Bacteria 2689
225 Ga0075428_100000446 3300006844 Bacteria 41165
226 Ga0075428_100001232 3300006844 Bacteria 27372
227 Ga0075428_100009146 3300006844 Bacteria 10994
228 Ga0075428_100018652 3300006844 Bacteria 7669
229 Ga0075428_100019802 3300006844 Bacteria 7447
230 Ga0075428_100022052 3300006844 Bacteria 7050
231 Ga0075428_100044588 3300006844 Bacteria 4873
232 Ga0075428_100223503 3300006844 Bacteria 2033
233 Ga0075428_100535990 3300006844 Bacteria 1252
234 Ga0075428_100653210 3300006844 Bacteria 1121
235 Ga0075430_100006952 3300006846 Bacteria 9540
236 Ga0075430_100010982 3300006846 Bacteria 7671
237 Ga0075430_100048016 3300006846 Bacteria 3605
238 Ga0075430_100307408 3300006846 Bacteria 1311
239 Ga0075430_100349174 3300006846 Bacteria 1222
240 Ga0075431_100000586 3300006847 Bacteria 30900
241 Ga0075431_100002204 3300006847 Bacteria 18653
242 Ga0075431_100006333 3300006847 Bacteria 11758
243 Ga0075431_100023814 3300006847 Bacteria 6267
244 Ga0075431_100100743 3300006847 Bacteria 2981
245 Ga0075431_100150402 3300006847 Bacteria 2397
246 Ga0075431_100155138 3300006847 Bacteria 2356
247 Ga0075431_100204579 3300006847 Bacteria 2019
248 Ga0075433_10001281 3300006852 Bacteria 18351
249 Ga0075433_10006995 3300006852 Bacteria 8944
250 Ga0075433_10033836 3300006852 Bacteria 4384
251 Ga0075433_10119236 3300006852 Bacteria 2342
252 Ga0075434_100001574 3300006871 Bacteria 19334
253 Ga0075434_100002685 3300006871 Bacteria 15706
254 Ga0075434_100053555 3300006871 Bacteria 4009
255 Ga0075434_100082740 3300006871 Bacteria 3207
256 Ga0075434_100093341 3300006871 Bacteria 3013
257 Ga0075434_100104025 3300006871 Bacteria 2848
258 Ga0075434_100577052 3300006871 Bacteria 1144
259 Ga0075429_100000259 3300006880 Bacteria 36776
260 Ga0075429_100000922 3300006880 Bacteria 23290
261 Ga0075429_100002976 3300006880 Bacteria 14374
262 Ga0068865_100007455 3300006881 Bacteria 6733
263 Ga0068865_100017764 3300006881 Bacteria 4579
264 Ga0068865_100020281 3300006881 Bacteria 4311
265 Ga0075436_100001357 3300006914 Bacteria 16645
266 Ga0075436_100006485 3300006914 Bacteria 8017
267 Ga0075436_100142454 3300006914 Bacteria 1685
268 Ga0075436_100204923 3300006914 Bacteria 1397
269 Ga0075436_100210584 3300006914 Bacteria 1378
270 Ga0075436_100284425 3300006914 Bacteria 1183
271 Ga0097620_100003978 3300006931 Bacteria 15080
272 Ga0097620_100006104 3300006931 Bacteria 12235
273 Ga0097620_100007972 3300006931 Bacteria 10743
274 Ga0097620_100021038 3300006931 Bacteria 6547
275 Ga0097620_100099264 3300006931 Bacteria 2967
276 Ga0097620_100383240 3300006931 Bacteria 1501
277 Ga0097620_100432525 3300006931 Bacteria 1412
278 Ga0075435_100000047 3300007076 Bacteria 60782
279 Ga0075435_100017237 3300007076 Bacteria 5462
280 Ga0075435_100256335 3300007076 Bacteria 1490
281 Ga0099794_10059969 3300007265 Bacteria 1847
282 Ga0099794_10158993 3300007265 Bacteria 1149
283 Ga0105240_10394231 3300009093 Bacteria 1561
284 Ga0111539_10003844 3300009094 Bacteria 19777
285 Ga0111539_10011877 3300009094 Bacteria 10916
286 Ga0111539_10031418 3300009094 Bacteria 6451
287 Ga0111539_10034785 3300009094 Bacteria 6104
288 Ga0111539_10086334 3300009094 Bacteria 3687
289 Ga0111539_10291090 3300009094 Bacteria 1900
290 Ga0111539_10354182 3300009094 Bacteria 1708
291 Ga0111539_10405491 3300009094 Bacteria 1588
292 Ga0111539_10663496 3300009094 Bacteria 1214
293 Ga0105245_10007041 3300009098 Bacteria 9866
294 Ga0105245_10012980 3300009098 Bacteria 7260
295 Ga0105245_10075077 3300009098 Bacteria 3077
296 Ga0105247_10112872 3300009101 Bacteria 1751
297 Ga0114129_10000068 3300009147 Bacteria 93579
298 Ga0114129_10000430 3300009147 Bacteria 49930
299 Ga0114129_10000703 3300009147 Bacteria 42137
300 Ga0114129_10002359 3300009147 Bacteria 26209
301 Ga0114129_10020013 3300009147 Bacteria 9525
302 Ga0114129_10020418 3300009147 Bacteria 9421
303 Ga0114129_10074037 3300009147 Bacteria 4744
304 Ga0114129_10164336 3300009147 Bacteria 3030
305 Ga0114129_10915868 3300009147 Bacteria 1110
306 Ga0105243_10000708 3300009148 Bacteria 32162
307 Ga0105243_10043929 3300009148 Bacteria 3504
308 Ga0105243_10444606 3300009148 Bacteria 1215
309 Ga0105241_10092438 3300009174 Bacteria 2389
310 Ga0105241_10122645 3300009174 Bacteria 2095
311 Ga0105242_10041789 3300009176 Bacteria 3700
312 Ga0105242_10258302 3300009176 Bacteria 1573
313 Ga0105248_10114457 3300009177 Bacteria 3042
314 Ga0105248_10368233 3300009177 Bacteria 1618
315 Ga0105237_10029142 3300009545 Bacteria 5615
316 Ga0105237_10037012 3300009545 Bacteria 4934
317 Ga0105238_10341110 3300009551 Bacteria 1486
318 Ga0105249_10000599 3300009553 Bacteria 32843
319 Ga0105249_10002072 3300009553 Bacteria 17373
320 Ga0105249_10131152 3300009553 Bacteria 2393
321 Ga0105249_10603595 3300009553 Bacteria 1152
322 Ga0099796_10028306 3300010159 Bacteria 1798
323 Ga0105239_10036817 3300010375 Bacteria 5368
324 Ga0105239_10242555 3300010375 Bacteria 2023
325 Ga0105246_10136796 3300011119 Bacteria 1837
326 Ga0157369_10217554 3300013105 Bacteria 2000
327 Ga0157378_10006229 3300013297 Bacteria 10445
328 Ga0157378_10422905 3300013297 Bacteria 1317
329 Ga0157378_10491426 3300013297 Bacteria 1224
330 Ga0163162_10018668 3300013306 Bacteria 6794
331 Ga0163162_10333214 3300013306 Bacteria 1650
332 Ga0163162_10436895 3300013306 Bacteria 1441
333 Ga0163162_10494459 3300013306 Bacteria 1354
334 Ga0157372_10202758 3300013307 Bacteria 2298
335 Ga0157375_10444959 3300013308 Bacteria 1461
336 Ga0157375_10516832 3300013308 Bacteria 1357
337 Ga0163163_10001948 3300014325 Bacteria 17455
338 Ga0163163_10609142 3300014325 Bacteria 1155
339 Ga0157380_10270015 3300014326 Bacteria 1550
340 Ga0157380_10305790 3300014326 Bacteria 1467
341 Ga0157380_10463956 3300014326 Bacteria 1220
342 Ga0157377_10101288 3300014745 Bacteria 1717
343 Ga0157379_10441317 3300014968 Bacteria 1200
344 Ga0157376_10011568 3300014969 Bacteria 6512
345 Ga0157376_10059518 3300014969 Bacteria 3203
346 Ga0213873_10024658 3300021358 Bacteria 1445
347 Ga0213874_10011204 3300021377 Bacteria 2265
348 Ga0213876_10000816 3300021384 Bacteria 21075
349 Ga0213876_10000944 3300021384 Bacteria 19157
350 Ga0213876_10084059 3300021384 Bacteria 1684
351 Ga0213875_10000003 3300021388 Bacteria 719367
352 Ga0213875_10001075 3300021388 Bacteria 19135
353 Ga0213875_10012486 3300021388 Bacteria 4193
354 Ga0213875_10016470 3300021388 Bacteria 3583
355 Ga0213875_10034599 3300021388 Bacteria 2386
356 Ga0207653_10001145 3300025885 Bacteria 8692
357 Ga0207682_10002103 3300025893 Bacteria 9019
358 Ga0207692_10195460 3300025898 Bacteria 1186
359 Ga0207642_10005920 3300025899 Bacteria 4029
360 Ga0207642_10018611 3300025899 Bacteria 2670
361 Ga0207710_10024128 3300025900 Bacteria 2617
362 Ga0207688_10016496 3300025901 Bacteria 4006
363 Ga0207645_10045314 3300025907 Bacteria 2811
364 Ga0207684_10004520 3300025910 Bacteria 13068
365 Ga0207654_10035292 3300025911 Bacteria 2785
366 Ga0207654_10089196 3300025911 Bacteria 1875
367 Ga0207707_10001852 3300025912 Bacteria 19339
368 Ga0207707_10010205 3300025912 Bacteria 8153
369 Ga0207707_10064689 3300025912 Bacteria 3184
370 Ga0207671_10030628 3300025914 Bacteria 4011
371 Ga0207693_10003608 3300025915 Bacteria 13212
372 Ga0207693_10013129 3300025915 Bacteria 6682
373 Ga0207693_10052856 3300025915 Bacteria 3187
374 Ga0207662_10000639 3300025918 Bacteria 15770
375 Ga0207662_10010145 3300025918 Bacteria 5193
376 Ga0207662_10044570 3300025918 Bacteria 2619
377 Ga0207652_10159637 3300025921 Bacteria 2021
378 Ga0207652_10180287 3300025921 Bacteria 1898
379 Ga0207652_10187492 3300025921 Bacteria 1860
380 Ga0207646_10003037 3300025922 Bacteria 19308
381 Ga0207646_10065719 3300025922 Bacteria 3238
382 Ga0207646_10176822 3300025922 Bacteria 1928
383 Ga0207681_10002455 3300025923 Bacteria 11755
384 Ga0207681_10404072 3300025923 Bacteria 1104
385 Ga0207694_10237511 3300025924 Bacteria 1489
386 Ga0207650_10246261 3300025925 Bacteria 1446
387 Ga0207659_10189264 3300025926 Bacteria 1637
388 Ga0207687_10003950 3300025927 Bacteria 9932
389 Ga0207687_10016484 3300025927 Bacteria 4853
390 Ga0207687_10184012 3300025927 Bacteria 1620
391 Ga0207664_10331786 3300025929 Bacteria 1344
392 Ga0207644_10072069 3300025931 Bacteria 2529
393 Ga0207706_10040460 3300025933 Bacteria 4131
394 Ga0207706_10080777 3300025933 Bacteria 2858
395 Ga0207706_10149150 3300025933 Bacteria 2057
396 Ga0207686_10006692 3300025934 Bacteria 6211
397 Ga0207686_10064621 3300025934 Bacteria 2331
398 Ga0207709_10036753 3300025935 Bacteria 2904
399 Ga0207709_10049360 3300025935 Bacteria 2568
400 Ga0207709_10225211 3300025935 Bacteria 1355
401 Ga0207709_10234795 3300025935 Bacteria 1330
402 Ga0207670_10185603 3300025936 Bacteria 1569
403 Ga0207669_10043433 3300025937 Bacteria 2632
404 Ga0207704_10007060 3300025938 Bacteria 5280
405 Ga0207704_10460629 3300025938 Bacteria 1017
406 Ga0207665_10136272 3300025939 Bacteria 1747
407 Ga0207691_10059780 3300025940 Bacteria 3464
408 Ga0207691_10081129 3300025940 Bacteria 2916
409 Ga0207691_10119619 3300025940 Bacteria 2336
410 Ga0207711_10097521 3300025941 Bacteria 2595
411 Ga0207711_10411394 3300025941 Bacteria 1257
412 Ga0207689_10007163 3300025942 Bacteria 9806
413 Ga0207689_10036449 3300025942 Bacteria 4083
414 Ga0207689_10097726 3300025942 Bacteria 2412
415 Ga0207661_10219910 3300025944 Bacteria 1678
416 Ga0207679_10016081 3300025945 Bacteria 4961
417 Ga0207667_10033944 3300025949 Bacteria 5481
418 Ga0207667_10054565 3300025949 Bacteria 4203
419 Ga0207651_10195438 3300025960 Bacteria 1617
420 Ga0207712_10003113 3300025961 Bacteria 10584
421 Ga0207712_10003418 3300025961 Bacteria 10034
422 Ga0207712_10217206 3300025961 Bacteria 1526
423 Ga0207712_10244082 3300025961 Bacteria 1448
424 Ga0207668_10087785 3300025972 Bacteria 2276
425 Ga0207640_10014585 3300025981 Bacteria 4528
426 Ga0207640_10287323 3300025981 Bacteria 1295
427 Ga0207658_10106231 3300025986 Bacteria 2210
428 Ga0207677_10029879 3300026023 Bacteria 3470
429 Ga0207703_10013352 3300026035 Bacteria 6400
430 Ga0207703_10055811 3300026035 Bacteria 3214
431 Ga0207703_10084896 3300026035 Bacteria 2649
432 Ga0207703_10136321 3300026035 Bacteria 2125
433 Ga0207703_10278628 3300026035 Bacteria 1518
434 Ga0207703_10680861 3300026035 Bacteria 977
435 Ga0207639_10004290 3300026041 Bacteria 9612
436 Ga0207639_10569432 3300026041 Bacteria 1042
437 Ga0207678_10003276 3300026067 Bacteria 14615
438 Ga0207708_10000142 3300026075 Bacteria 56900
439 Ga0207708_10000153 3300026075 Bacteria 54987
440 Ga0207708_10001509 3300026075 Bacteria 17351
441 Ga0207708_10026481 3300026075 Bacteria 4389
442 Ga0207708_10050676 3300026075 Bacteria 3160
443 Ga0207708_10070975 3300026075 Bacteria 2667
444 Ga0207708_10296444 3300026075 Bacteria 1314
445 Ga0207708_10345084 3300026075 Bacteria 1220
446 Ga0207702_10192198 3300026078 Bacteria 1887
447 Ga0207641_10075539 3300026088 Bacteria 2910
448 Ga0207641_10720362 3300026088 Bacteria 983
449 Ga0207648_10000130 3300026089 Bacteria 74342
450 Ga0207648_10003264 3300026089 Bacteria 17048
451 Ga0207648_10081281 3300026089 Bacteria 2826
452 Ga0207676_10008709 3300026095 Bacteria 7216
453 Ga0207676_10203923 3300026095 Bacteria 1749
454 Ga0207674_10008447 3300026116 Bacteria 11892
455 Ga0207674_10014574 3300026116 Bacteria 8676
456 Ga0207674_10147265 3300026116 Bacteria 2313
457 Ga0207675_100000253 3300026118 Bacteria 51284
458 Ga0207675_100000648 3300026118 Bacteria 34256
459 Ga0207675_100105017 3300026118 Bacteria 2662
460 Ga0207675_100151459 3300026118 Bacteria 2207
461 Ga0207675_100185079 3300026118 Bacteria 1996
462 Ga0207683_10023791 3300026121 Bacteria 5270
463 Ga0209969_1002469 3300027360 Bacteria 2557
464 Ga0209981_1012871 3300027378 Bacteria 1161
465 Ga0209996_1000475 3300027395 Bacteria 4824
466 Ga0209996_1004059 3300027395 Bacteria 1855
467 Ga0209996_1008521 3300027395 Bacteria 1344
468 Ga0210000_1001307 3300027462 Bacteria 3509
469 Ga0210000_1001320 3300027462 Bacteria 3499
470 Ga0209995_1005928 3300027471 Bacteria 1967
471 Ga0209968_1001005 3300027526 Bacteria 4335
472 Ga0209968_1005706 3300027526 Bacteria 1870
473 Ga0209968_1015897 3300027526 Bacteria 1193
474 Ga0209999_1008492 3300027543 Bacteria 1853
475 Ga0209983_1000380 3300027665 Bacteria 9453
476 Ga0209971_1000228 3300027682 Bacteria 16409
477 Ga0209971_1006441 3300027682 Bacteria 2775
478 Ga0209966_1000098 3300027695 Bacteria 38805
479 Ga0209998_10000125 3300027717 Bacteria 29964
480 Ga0209813_10006973 3300027866 Bacteria 2804
481 Ga0209813_10035293 3300027866 Bacteria 1497
482 Ga0209974_10004008 3300027876 Bacteria 5265
483 Ga0207428_10000721 3300027907 Bacteria 38142
484 Ga0207428_10012105 3300027907 Bacteria 7591
485 Ga0207428_10209626 3300027907 Bacteria 1464
486 Ga0268265_10000627 3300028380 Bacteria 35202
487 Ga0268265_10000885 3300028380 Bacteria 28020
488 Ga0268265_10000939 3300028380 Bacteria 26819
489 Ga0268265_10006592 3300028380 Bacteria 7858
490 Ga0268265_10012099 3300028380 Bacteria 5843
491 Ga0268265_10200165 3300028380 Bacteria 1732
492 Ga0268264_10001246 3300028381 Bacteria 24277
493 Ga0268264_10047794 3300028381 Bacteria 3558
494 Ga0268264_10245600 3300028381 Bacteria 1660
495 Ga0268264_10249517 3300028381 Bacteria 1648
496 Ga0265338_10288882 3300028800 Bacteria 1196
497 Ga0265330_10032768 3300031235 Bacteria 2327
498 Ga0265320_10038673 3300031240 Bacteria 2391
499 Ga0265329_10038528 3300031242 Bacteria 1537
500 Ga0265339_10041981 3300031249 Bacteria 2534
501 Ga0265316_10019986 3300031344 Bacteria 5712
502 Ga0265316_10045361 3300031344 Bacteria 3490
503 Ga0307408_100070265 3300031548 Bacteria 2585
504 Ga0316575_10014633 3300031665 Bacteria 2949
505 Ga0316575_10020135 3300031665 Bacteria 2558
506 Ga0265342_10025824 3300031712 Bacteria 3687
507 Ga0265342_10027031 3300031712 Bacteria 3592
508 Ga0307416_100047257 3300032002 Bacteria 3405
509 Ga0307414_10360773 3300032004 Bacteria 1250
510 Ga0373950_0015439 3300034818 Bacteria 1295
511 Ga0373938_0009918 3300034957 Bacteria 1736
512 Ga0373926_0000320 3300035083 Bacteria 11963
513 Ga0373926_0002880 3300035083 Bacteria 5512
514 Ga0373940_0008635 3300035088 Bacteria 2345
515 Ga0373944_0007777 3300035089 Bacteria 2881
516 Ga0373952_0008135 3300035092 Bacteria 1983
517 Ga0373923_0015997 3300035111 Bacteria 2841
518 Ga0373932_0019320 3300035112 Bacteria 1775
519 Ga0373936_0013035 3300035113 Bacteria 3170
520 Ga0373936_0037929 3300035113 Bacteria 1926
521 Ga0373941_0009738 3300035115 Bacteria 2428
522 Ga0373945_0002043 3300035116 Bacteria 6277
523 Ga0373945_0012081 3300035116 Bacteria 2863
524 Ga0373954_0032281 3300035118 Bacteria 2420
525 Ga0373956_0032314 3300035119 Bacteria 2296
526 Ga0373957_0068681 3300035120 Bacteria 1383
527 Ga0373960_0010649 3300035121 Bacteria 2250
528 Ga0373943_0000424 3300035170 Bacteria 17836
529 Ga0373943_0006382 3300035170 Bacteria 5298
530 Ga0373943_0028636 3300035170 Bacteria 2626
531 Ga0373946_0003275 3300035171 Bacteria 5751
532 Ga0373946_0006545 3300035171 Bacteria 4227
533 Ga0373946_0020065 3300035171 Bacteria 2580
534 Ga0373955_0039290 3300035172 Bacteria 2525
535 Ga0373955_0310029 3300035172 Bacteria 953
536 Ga0373962_0048074 3300035242 Bacteria 1222
537 Ga0316574_0004412 3300035398 Bacteria 7366
538 Ga0373931_0000207 3300035691 Bacteria 25079
539 Ga0373931_0002172 3300035691 Bacteria 8643
540 Ga0373931_0027600 3300035691 Bacteria 2899
541 Ga0373931_0094053 3300035691 Bacteria 1675
542 Ga0373931_0096222 3300035691 Bacteria 1658
543 Ga0373931_0152554 3300035691 Bacteria 1348
544 Ga0373931_0273544 3300035691 Bacteria 1035
545 Ga0373935_0000882 3300035692 Bacteria 16207
546 Ga0373935_0002678 3300035692 Bacteria 10245
547 Ga0373935_0006454 3300035692 Bacteria 7002
548 Ga0373935_0009918 3300035692 Bacteria 5707
549 Ga0373927_0000414 3300035695 Bacteria 32784
550 Ga0373927_0006828 3300035695 Bacteria 7767
551 Ga0373927_0025829 3300035695 Bacteria 3839
552 Ga0373927_0098409 3300035695 Bacteria 1902
553 Ga0373927_0149233 3300035695 Bacteria 1531
554 Ga0373933_0008780 3300035724 Bacteria 5510
555 Ga0373933_0123375 3300035724 Bacteria 1624
556 Ga0373947_0000275 3300035725 Bacteria 29242
557 Ga0373947_0007039 3300035725 Bacteria 6519
558 Ga0373947_0017419 3300035725 Bacteria 4132
559 Ga0373947_0066277 3300035725 Bacteria 2204
560 Ga0373937_0108121 3300036401 Bacteria 2586
561 Ga0373937_0134761 3300036401 Bacteria 2308
562 Ga0373937_0394453 3300036401 Bacteria 1313
563 Ga0373925_0002725 3300037068 Bacteria 13982
564 Ga0373925_0014839 3300037068 Bacteria 5630
565 Ga0373925_0087640 3300037068 Bacteria 2376
566 Ga0373925_0109429 3300037068 Bacteria 2133
567 Ga0395905_0537467 3300037471 Bacteria 1070
568 Ga0316581_0006661 3300037588 Bacteria 3068
569 Ga0436364_0147453 3300037853 Bacteria 11701
570 Ga0436364_0162358 3300037853 Bacteria 4611
571 Ga0436364_0676530 3300037853 Bacteria 1157
572 Ga0436364_0685371 3300037853 Bacteria 68284
573 Ga0436364_0700611 3300037853 Bacteria 2954
574 Ga0436364_0705174 3300037853 Bacteria 16891
575 Ga0436364_0760962 3300037853 Bacteria 28778
576 Ga0436364_1082407 3300037853 Bacteria 7015
577 Ga0436364_1114716 3300037853 Bacteria 3092
578 Ga0436365_0159339 3300039437 Bacteria 58353
579 Ga0436365_0736793 3300039437 Bacteria 96466
580 Ga0436365_1308054 3300039437 Bacteria 2450
581 Ga0436365_1837194 3300039437 Bacteria 2771
582 Ga0436365_1892164 3300039437 Bacteria 4736
583 Ga0436360_0404169 3300039438 Bacteria 1139
584 Ga0436360_0886479 3300039438 Bacteria 1593
585 Ga0436361_0847532 3300039447 Bacteria 980
586 Ga0436363_0313348 3300039450 Bacteria 32729
587 Ga0436363_1475436 3300039450 Bacteria 11441
588 Ga0436362_1056133 3300039453 Bacteria 1577
589 Ga0436362_1066130 3300039453 Bacteria 5116
590 Ga0436362_1124287 3300039453 Bacteria 1131
591 Ga0439461_0030608 3300041410 Bacteria 1120
592 Ga0439441_001670 3300042001 Bacteria 2973
593 Ga0439441_002598 3300042001 Bacteria 2561
594 Ga0439443_002737 3300042003 Bacteria 2144
595 Ga0439450_012023 3300042008 Bacteria 1709
596 Ga0439446_0004940 3300042156 Bacteria 3408
597 Ga0439434_0003115 3300042435 Bacteria 4874
598 Ga0439434_0038426 3300042435 Bacteria 1467
599 Ga0439434_0056815 3300042435 Bacteria 1219
600 Ga0439435_0004837 3300042436 Bacteria 2925
601 Ga0439444_0001275 3300042437 Bacteria 3213
602 Ga0439459_0008227 3300042438 Bacteria 1778
603 Ga0439464_0020595 3300042439 Bacteria 1806
604 Ga0439464_0056003 3300042439 Bacteria 1148
605 Ga0439460_0001552 3300042461 Bacteria 5415
606 Ga0439460_0018435 3300042461 Bacteria 1880
607 Ga0451577_0204639 3300042876 Bacteria 1782
608 Ga0451577_0300010 3300042876 Bacteria 1456
609 Ga0451577_0343975 3300042876 Bacteria 1353
610 Ga0439440_0013406 3300042993 Bacteria 1758
611 Ga0453683_0025310 3300044673 Bacteria 3772
612 Ga0453684_0024772 3300044712 Bacteria 8747
613 Ga0451576_0030558 3300045051 Bacteria 5756
614 Ga0451576_0031269 3300045051 Bacteria 5678
615 Ga0451576_0034448 3300045051 Bacteria 5378
616 Ga0451576_0035065 3300045051 Bacteria 5324
617 Ga0451576_0253503 3300045051 Bacteria 1839
618 Ga0451576_0536241 3300045051 Bacteria 1229
619 Ga0466967_0251474 3300045976 Bacteria 1688
620 Ga0495603_0028409 3300046455 Bacteria 3373
621 Ga0495603_0244401 3300046455 Bacteria 1034
622 Ga0495629_0170376 3300046459 Bacteria 1511
623 Ga0495653_0057546 3300046463 Bacteria 2958
624 Ga0495653_0058032 3300046463 Bacteria 2943
625 Ga0495653_0233476 3300046463 Bacteria 1230
626 Ga0495580_0001270 3300046472 Bacteria 22269
627 Ga0495580_0058049 3300046472 Bacteria 2723
628 Ga0495662_0000261 3300046476 Bacteria 22323
629 Ga0495662_0016950 3300046476 Bacteria 3525
630 Ga0495662_0034302 3300046476 Bacteria 2450
631 Ga0495664_0000736 3300046477 Bacteria 16729
632 Ga0495608_0019659 3300046511 Bacteria 4646
633 Ga0495608_0128988 3300046511 Bacteria 1619
634 Ga0495618_0160733 3300046514 Bacteria 1432
635 Ga0495628_0202423 3300046516 Bacteria 1495
636 Ga0495630_0002218 3300046517 Bacteria 13534
637 Ga0495663_0030658 3300046525 Bacteria 1595
638 Ga0495666_0057274 3300046526 Bacteria 1866
639 Ga0495666_0166937 3300046526 Bacteria 1019
640 Ga0495652_0199677 3300046529 Bacteria 1519
641 Ga0495665_0024212 3300046531 Bacteria 3261
642 Ga0495640_0002964 3300046533 Bacteria 13677
643 Ga0495640_0013343 3300046533 Bacteria 6244
644 Ga0495640_0217321 3300046533 Bacteria 1206
645 Ga0495586_0001814 3300046535 Bacteria 11645
646 Ga0495586_0048291 3300046535 Bacteria 2299
647 Ga0495621_0019212 3300046539 Bacteria 2229
648 Ga0495621_0039933 3300046539 Bacteria 1643
649 Ga0495645_0002109 3300046543 Bacteria 13497
650 Ga0495667_0048970 3300046559 Bacteria 2790
651 Ga0495656_0044546 3300046615 Bacteria 1869
652 Ga0495634_0006321 3300046642 Bacteria 9017
653 Ga0495634_0017261 3300046642 Bacteria 5153
654 Ga0495634_0039498 3300046642 Bacteria 3213
655 Ga0495634_0223442 3300046642 Bacteria 1161
656 Ga0495625_0049301 3300046660 Bacteria 3028
657 Ga0495635_0000438 3300046663 Bacteria 26330
658 Ga0495588_0010367 3300046674 Bacteria 4334
659 Ga0495646_0022684 3300046680 Bacteria 3957
660 Ga0495647_0016640 3300046681 Bacteria 2591
661 Ga0495658_0005364 3300046683 Bacteria 6306
662 Ga0495658_0134032 3300046683 Bacteria 1510
663 Ga0495669_0005523 3300046684 Bacteria 5277
664 Ga0495613_0027628 3300046689 Bacteria 4223
665 Ga0495613_0122418 3300046689 Bacteria 1867
666 Ga0495613_0245809 3300046689 Bacteria 1250
667 Ga0495613_0307480 3300046689 Bacteria 1096
668 Ga0495624_0001570 3300046690 Bacteria 17622
669 Ga0495624_0064570 3300046690 Bacteria 2288
670 Ga0495600_0028225 3300046809 Bacteria 3630
671 Ga0495581_0025033 3300047315 Bacteria 3459
672 Ga0495604_0346453 3300047317 Bacteria 988
673 Ga0495674_0000209 3300047319 Bacteria 48240
674 Ga0495674_0024470 3300047319 Bacteria 5548
675 Ga0495674_0314268 3300047319 Bacteria 1278
676 Ga0495676_0033822 3300047321 Bacteria 4297
677 Ga0495676_0047447 3300047321 Bacteria 3473
678 Ga0495676_0085983 3300047321 Bacteria 2368
679 Ga0495680_0386936 3300047322 Bacteria 968
680 Ga0495684_0001766 3300047471 Bacteria 17346
681 Ga0495684_0003044 3300047471 Bacteria 13189
682 Ga0495684_0049314 3300047471 Bacteria 3217
683 Ga0495593_0007179 3300047673 Bacteria 6532
684 Ga0495602_0080662 3300048088 Bacteria 2740
685 Ga0495602_0454798 3300048088 Bacteria 903
686 Ga0495615_0012423 3300048090 Bacteria 1755
687 Ga0496100_0134321 3300048903 Bacteria 1746
688 Ga0496100_0207228 3300048903 Bacteria 1432
689 Ga0496100_0332254 3300048903 Bacteria 1144
690 Ga0496101_0424249 3300048904 Bacteria 1048
691 Ga0496102_0010995 3300048905 Bacteria 7800
692 Ga0496102_0176348 3300048905 Bacteria 2013
693 Ga0496103_0030761 3300048906 Bacteria 3268
694 Ga0496104_0006466 3300048907 Bacteria 10301
695 Ga0496104_0011676 3300048907 Bacteria 7875
696 Ga0496104_0035653 3300048907 Bacteria 4645
697 Ga0496104_0040885 3300048907 Bacteria 4347
698 Ga0496105_0000783 3300048908 Bacteria 21486
699 Ga0496105_0006116 3300048908 Bacteria 9216
700 Ga0496105_0017779 3300048908 Bacteria 5703
701 Ga0496105_0037299 3300048908 Bacteria 4003
702 Ga0496106_0002235 3300048909 Bacteria 14435
703 Ga0496106_0094236 3300048909 Bacteria 2315
704 Ga0496106_0108221 3300048909 Bacteria 2162
705 Ga0496106_0209392 3300048909 Bacteria 1553
706 Ga0496107_0005679 3300048910 Bacteria 8536
707 Ga0496108_0000783 3300048911 Bacteria 24833
708 Ga0496108_0005523 3300048911 Bacteria 10227
709 Ga0496109_0002516 3300048912 Bacteria 15368
710 Ga0496109_0044666 3300048912 Bacteria 4020
711 Ga0496110_0023893 3300048913 Bacteria 5204
712 Ga0496110_0039288 3300048913 Bacteria 4120
713 Ga0496110_0163933 3300048913 Bacteria 2015
714 Ga0496110_0192729 3300048913 Bacteria 1851
715 Ga0496110_0227850 3300048913 Bacteria 1695
716 Ga0496110_0444194 3300048913 Bacteria 1182
717 Ga0496111_0000495 3300048914 Bacteria 20302
718 Ga0496111_0012998 3300048914 Bacteria 5651
719 Ga0496112_0003524 3300048915 Bacteria 12978
720 Ga0496112_0008371 3300048915 Bacteria 9263
721 Ga0496113_0000529 3300048916 Bacteria 18858
722 Ga0496114_0109194 3300048917 Bacteria 2369
723 Ga0496114_0167669 3300048917 Bacteria 1912
724 Ga0496115_0004616 3300048918 Bacteria 9972
725 Ga0496115_0156652 3300048918 Bacteria 1882
726 Ga0496115_0376978 3300048918 Bacteria 1154
727 Ga0496117_0032979 3300048920 Bacteria 3923
728 Ga0496120_0106075 3300048923 Bacteria 1476
729 Ga0496122_0017063 3300048925 Bacteria 6814
730 Ga0496124_0012283 3300048927 Bacteria 8461
731 Ga0496124_0087643 3300048927 Bacteria 2546
732 Ga0496125_0002695 3300048928 Bacteria 22608
733 Ga0501033_0083116 3300049570 Bacteria 2347
734 Ga0501033_0201346 3300049570 Bacteria 1422
735 Ga0501034_0019935 3300049571 Bacteria 6848
736 Ga0501034_0273000 3300049571 Bacteria 1631
737 Ga0501036_0001382 3300049572 Bacteria 18652
738 Ga0501036_0020963 3300049572 Bacteria 5489
739 Ga0501036_0103560 3300049572 Bacteria 2407
740 Ga0501036_0111786 3300049572 Bacteria 2308
741 Ga0501036_0190621 3300049572 Bacteria 1725
742 Ga0501037_0003480 3300049573 Bacteria 11423
743 Ga0501037_0154252 3300049573 Bacteria 1640
744 Ga0501038_0000646 3300049574 Bacteria 30992
745 Ga0501038_0012439 3300049574 Bacteria 7776
746 Ga0501038_0073051 3300049574 Bacteria 2905
747 Ga0501038_0191459 3300049574 Bacteria 1645
748 Ga0501038_0342704 3300049574 Bacteria 1165
749 Ga0501038_0378757 3300049574 Bacteria 1098
750 Ga0501039_0001534 3300049575 Bacteria 16970
751 Ga0501039_0112756 3300049575 Bacteria 2126
752 Ga0501039_0137082 3300049575 Bacteria 1922
753 Ga0501039_0157905 3300049575 Bacteria 1782
754 Ga0501039_0175265 3300049575 Bacteria 1686
755 Ga0501039_0280225 3300049575 Bacteria 1310
756 Ga0501040_0000087 3300049576 Bacteria 46070
757 Ga0501040_0017509 3300049576 Bacteria 4756
758 Ga0501041_0002380 3300049577 Bacteria 10639
759 Ga0501041_0007945 3300049577 Bacteria 6239
760 Ga0501041_0021655 3300049577 Bacteria 3851
761 Ga0501041_0074019 3300049577 Bacteria 2093
762 Ga0501041_0132095 3300049577 Bacteria 1555
763 Ga0501041_0137561 3300049577 Bacteria 1522
764 Ga0501041_0195047 3300049577 Bacteria 1269
765 Ga0501041_0214942 3300049577 Bacteria 1206
766 Ga0501042_0000957 3300049578 Bacteria 16263
767 Ga0501042_0002829 3300049578 Bacteria 10750
768 Ga0501042_0038500 3300049578 Bacteria 3396
769 Ga0501042_0040685 3300049578 Bacteria 3304
770 Ga0501043_0008327 3300049579 Bacteria 8164
771 Ga0501043_0008730 3300049579 Bacteria 7975
772 Ga0501043_0240942 3300049579 Bacteria 1395
773 Ga0501043_0254530 3300049579 Bacteria 1352
774 Ga0501043_0286800 3300049579 Bacteria 1261
775 Ga0501046_0000364 3300049580 Bacteria 45712
776 Ga0501046_0022776 3300049580 Bacteria 5158
777 Ga0501046_0036174 3300049580 Bacteria 3975
778 Ga0501046_0042825 3300049580 Bacteria 3608
779 Ga0501046_0068487 3300049580 Bacteria 2762
780 Ga0501046_0112204 3300049580 Bacteria 2082
781 Ga0501047_0028382 3300049581 Bacteria 5394
782 Ga0501048_0001228 3300049582 Bacteria 19413
783 Ga0501048_0017702 3300049582 Bacteria 5245
784 Ga0501048_0024555 3300049582 Bacteria 4399
785 Ga0501048_0026590 3300049582 Bacteria 4212
786 Ga0501048_0152336 3300049582 Bacteria 1636
787 Ga0501048_0249039 3300049582 Bacteria 1261
788 Ga0501067_0037054 3300049583 Bacteria 2709
789 Ga0501068_0011606 3300049584 Bacteria 4976
790 Ga0501068_0040132 3300049584 Bacteria 2809
791 Ga0501068_0054258 3300049584 Bacteria 2428
792 Ga0501068_0064794 3300049584 Bacteria 2224
793 Ga0501069_0026341 3300049585 Bacteria 3183
794 Ga0501069_0103036 3300049585 Bacteria 1621
795 Ga0501069_0260763 3300049585 Unclassified 1012
796 Ga0501070_0373034 3300049586 Bacteria 1156
797 Ga0501071_0000156 3300049587 Bacteria 28990
798 Ga0501071_0001439 3300049587 Bacteria 13746
799 Ga0501071_0045592 3300049587 Bacteria 3148
800 Ga0501071_0055335 3300049587 Bacteria 2864
801 Ga0501071_0146449 3300049587 Bacteria 1760
802 Ga0501072_0000252 3300049588 Bacteria 39255
803 Ga0501072_0002340 3300049588 Bacteria 14217
804 Ga0501072_0011074 3300049588 Bacteria 6882
805 Ga0501072_0014152 3300049588 Bacteria 6112
806 Ga0501072_0015235 3300049588 Bacteria 5894
807 Ga0501072_0084821 3300049588 Bacteria 2512
808 Ga0501072_0108041 3300049588 Bacteria 2213
809 Ga0501072_0142384 3300049588 Bacteria 1912
810 Ga0501072_0191446 3300049588 Bacteria 1631
811 Ga0501072_0251166 3300049588 Bacteria 1408
812 Ga0501072_0262130 3300049588 Bacteria 1376
813 Ga0501073_0085182 3300049589 Bacteria 2199
814 Ga0501073_0237298 3300049589 Bacteria 1259
815 Ga0501074_0001338 3300049590 Bacteria 16345
816 Ga0501074_0035939 3300049590 Bacteria 3589
817 Ga0501074_0075577 3300049590 Bacteria 2418
818 Ga0501074_0220011 3300049590 Bacteria 1352
819 Ga0501074_0251630 3300049590 Bacteria 1256
820 Ga0501075_0000004 3300049591 Bacteria 148813
821 Ga0501075_0000058 3300049591 Bacteria 46963
822 Ga0501075_0045061 3300049591 Bacteria 3310
823 Ga0501075_0074851 3300049591 Bacteria 2561
824 Ga0501075_0287979 3300049591 Bacteria 1252
825 Ga0501076_0000729 3300049592 Bacteria 21290
826 Ga0501076_0000774 3300049592 Bacteria 20666
827 Ga0501076_0005575 3300049592 Bacteria 9066
828 Ga0501076_0006035 3300049592 Bacteria 8762
829 Ga0501076_0008073 3300049592 Bacteria 7693
830 Ga0501076_0015076 3300049592 Bacteria 5836
831 Ga0501076_0104111 3300049592 Bacteria 2289
832 Ga0501077_0000178 3300049593 Bacteria 36417
833 Ga0501077_0022957 3300049593 Bacteria 3955
834 Ga0501077_0106072 3300049593 Bacteria 1781
835 Ga0501077_0171686 3300049593 Bacteria 1377
836 Ga0501077_0204832 3300049593 Bacteria 1253
837 Ga0501079_0000022 3300049741 Bacteria 63662
838 Ga0501079_0005648 3300049741 Bacteria 9338
839 Ga0501079_0032205 3300049741 Bacteria 4030
840 Ga0501079_0051015 3300049741 Bacteria 3193
841 Ga0501079_0068313 3300049741 Bacteria 2743
842 Ga0501079_0074885 3300049741 Bacteria 2617
843 Ga0501079_0096889 3300049741 Bacteria 2287
844 Ga0501079_0165351 3300049741 Bacteria 1725
845 Ga0501079_0215556 3300049741 Bacteria 1499
846 Ga0501080_0001368 3300049742 Bacteria 20407
847 Ga0501080_0007494 3300049742 Bacteria 9853
848 Ga0501080_0011566 3300049742 Bacteria 8083
849 Ga0501080_0013259 3300049742 Bacteria 7572
850 Ga0501080_0014988 3300049742 Bacteria 7138
851 Ga0501080_0091352 3300049742 Bacteria 2828
852 Ga0501080_0163888 3300049742 Bacteria 2052
853 Ga0501080_0263607 3300049742 Bacteria 1569
854 Ga0501080_0322145 3300049742 Bacteria 1399
855 Ga0501081_0000774 3300049743 Bacteria 18730
856 Ga0501081_0005054 3300049743 Bacteria 8490
857 Ga0501081_0043796 3300049743 Bacteria 3071
858 Ga0501081_0090558 3300049743 Bacteria 2150
859 Ga0501081_0110500 3300049743 Bacteria 1950
860 Ga0501081_0259297 3300049743 Bacteria 1270
861 Ga0501083_0009935 3300049744 Bacteria 6718
862 Ga0501083_0066623 3300049744 Bacteria 2397
863 Ga0501083_0084820 3300049744 Bacteria 2096
864 Ga0501083_0100994 3300049744 Bacteria 1902
865 Ga0501083_0170035 3300049744 Bacteria 1425
866 Ga0501083_0212132 3300049744 Bacteria 1262
867 Ga0501035_0001252 3300049822 Bacteria 26379
868 Ga0501035_0031108 3300049822 Bacteria 4861
869 Ga0501035_0216312 3300049822 Bacteria 1638
870 Ga0501044_0097643 3300049823 Bacteria 2958
871 Ga0501045_0001164 3300049824 Bacteria 17428
872 Ga0501045_0005395 3300049824 Bacteria 8854
873 Ga0501045_0038943 3300049824 Bacteria 3459
874 Ga0501045_0039692 3300049824 Bacteria 3425
875 Ga0501045_0050317 3300049824 Bacteria 3040
876 Ga0501045_0053256 3300049824 Bacteria 2957
877 Ga0501045_0067775 3300049824 Bacteria 2621
878 Ga0501045_0345062 3300049824 Bacteria 1108
879 nmdc:mga03n38_70088_c1 3300050490 Bacteria 1621
880 nmdc:mga00v17_42716_c1 3300050491 Bacteria 2728
881 nmdc:mga00v17_663_c1 3300050491 Bacteria 18944
882 nmdc:mga0yw44_125726_c1 3300050492 Bacteria 1656
883 nmdc:mga0yw44_241100_c1 3300050492 Bacteria 1202
884 nmdc:mga0yw44_6134_c1 3300050492 Bacteria 5773
885 nmdc:mga0k408_144836_c1 3300050493 Bacteria 1414
886 nmdc:mga0k408_21840_c1 3300050493 Bacteria 3600
887 nmdc:mga06z11_1221_c1 3300050494 Bacteria 9490
888 nmdc:mga06z11_14795_c1 3300050494 Bacteria 3465
889 nmdc:mga06z11_4849_c1 3300050494 Bacteria 5328
890 nmdc:mga04h51_18663_c1 3300050495 Bacteria 2046
891 nmdc:mga04h51_5277_c1 3300050495 Bacteria 3283
892 nmdc:mga07m45_140965_c1 3300050496 Bacteria 1396
893 nmdc:mga05p37_11593_c1 3300050507 Bacteria 10504
894 nmdc:mga05p37_286168_c1 3300050507 Bacteria 1964
895 nmdc:mga05p37_3149_c1 3300050507 Bacteria 19194
896 nmdc:mga05p37_3283_c1 3300050507 Bacteria 18860
897 nmdc:mga05p37_53751_c1 3300050507 Bacteria 4954
898 nmdc:mga05p37_591813_c1 3300050507 Bacteria 1254
899 nmdc:mga05p37_710_c2 3300050507 Bacteria 23500
900 nmdc:mga09592_126_c1 3300050508 Bacteria 35358
901 nmdc:mga09592_1332_c1 3300050508 Bacteria 19780
902 nmdc:mga09592_3063_c1 3300050508 Bacteria 13561
903 nmdc:mga09592_4616_c1 3300050508 Bacteria 11157
904 nmdc:mga09592_51499_c1 3300050508 Bacteria 3474
905 nmdc:mga09592_77287_c1 3300050508 Bacteria 2832
906 nmdc:mga0qj67_132673_c1 3300050509 Bacteria 2017
907 nmdc:mga0qj67_2393_c1 3300050509 Bacteria 13371
908 nmdc:mga06r32_100774_c1 3300050510 Bacteria 2833
909 nmdc:mga06r32_178409_c1 3300050510 Bacteria 2109
910 nmdc:mga06r32_2441_c1 3300050510 Bacteria 16629
911 nmdc:mga06r32_256198_c1 3300050510 Bacteria 1737
912 nmdc:mga06r32_343670_c1 3300050510 Bacteria 1477
913 nmdc:mga06r32_4_c1 3300050510 Bacteria 144637
914 nmdc:mga06r32_6022_c1 3300050510 Bacteria 10911
915 nmdc:mga06r32_61903_c1 3300050510 Bacteria 3604
916 nmdc:mga06r32_63545_c1 3300050510 Bacteria 3559
917 nmdc:mga06r32_7414_c1 3300050510 Bacteria 9867
918 nmdc:mga08y16_1078_c1 3300050511 Bacteria 26854
919 nmdc:mga08y16_156104_c1 3300050511 Bacteria 2371
920 nmdc:mga08y16_16843_c1 3300050511 Bacteria 7694
921 nmdc:mga08y16_182193_c1 3300050511 Bacteria 2181
922 nmdc:mga08y16_39253_c1 3300050511 Bacteria 4968
923 nmdc:mga08y16_399621_c1 3300050511 Bacteria 1407
924 nmdc:mga08y16_4436_c1 3300050511 Bacteria 14668
925 nmdc:mga0n895_110942_c1 3300050512 Bacteria 2759
926 nmdc:mga0n895_1570_c1 3300050512 Bacteria 17182
927 nmdc:mga0n895_3956_c1 3300050512 Bacteria 12046
928 nmdc:mga0n895_401522_c1 3300050512 Bacteria 1386
929 nmdc:mga0n895_42634_c1 3300050512 Bacteria 4416
930 nmdc:mga0n895_50020_c1 3300050512 Bacteria 4097
931 nmdc:mga0rr50_18250_c1 3300050513 Bacteria 4707
932 nmdc:mga0rr50_315148_c1 3300050513 Bacteria 1311
933 nmdc:mga0rr50_359_c1 3300050513 Bacteria 24852
934 nmdc:mga0rr50_55745_c1 3300050513 Bacteria 2950
935 nmdc:mga08x19_120397_c1 3300050514 Bacteria 1759
936 nmdc:mga08x19_12690_c1 3300050514 Bacteria 5080
937 nmdc:mga08x19_20446_c1 3300050514 Bacteria 4075
938 nmdc:mga08x19_245588_c1 3300050514 Bacteria 1235
939 nmdc:mga08x19_47006_c1 3300050514 Bacteria 2762
940 nmdc:mga0a205_1075_c1 3300050515 Bacteria 22701
941 nmdc:mga0a205_16420_c1 3300050515 Bacteria 6934
942 nmdc:mga0a205_297825_c1 3300050515 Bacteria 1486
943 nmdc:mga0a205_311895_c1 3300050515 Bacteria 1445
944 nmdc:mga0a205_34387_c1 3300050515 Bacteria 4862
945 nmdc:mga0a205_93_c2 3300050515 Bacteria 37118
946 nmdc:mga0sz30_68952_c1 3300050516 Bacteria 1520
947 Ga0495601_0001471 3300053077 Bacteria 12982
948 Ga0495601_0035335 3300053077 Bacteria 3119
949 Ga0495601_0310879 3300053077 Bacteria 1026
950 Ga0495612_0000353 3300053078 Bacteria 18580
951 Ga0495595_0036616 3300053084 Bacteria 2228
952 Ga0495619_0001077 3300053085 Bacteria 17905
953 Ga0495619_0084025 3300053085 Bacteria 2148
954 Ga0500658_0085078 3300053134 Bacteria 1359
955 Ga0500568_0002596 3300053139 Bacteria 10496
956 Ga0500577_0029867 3300053142 Bacteria 1892
957 Ga0500616_0095822 3300053153 Bacteria 1460
958 Ga0501084_0000157 3300054114 Bacteria 52388
959 Ga0501084_0002367 3300054114 Bacteria 15172
960 Ga0501084_0039329 3300054114 Bacteria 3956
961 Ga0501084_0053208 3300054114 Bacteria 3386
962 Ga0501084_0113461 3300054114 Bacteria 2278
963 Ga0501084_0225774 3300054114 Bacteria 1580
964 Ga0501084_0250867 3300054114 Bacteria 1494
965 Ga0501084_0410885 3300054114 Bacteria 1144
966 Ga0501082_0000050 3300060353 Bacteria 83978
967 Ga0501082_0000341 3300060353 Bacteria 41171
968 Ga0501082_0001651 3300060353 Bacteria 19655
969 Ga0501082_0063226 3300060353 Bacteria 3187
970 Ga0501082_0100457 3300060353 Bacteria 2502
971 Ga0501082_0152329 3300060353 Bacteria 2009
972 Ga0501082_0160913 3300060353 Bacteria 1951
973 Ga0501082_0199196 3300060353 Bacteria 1742
974 Ga0530510_0000084 3300061734 Bacteria 49991
975 Ga0530510_0000222 3300061734 Bacteria 35471
976 Ga0530510_0002069 3300061734 Bacteria 13788
977 Ga0530510_0002542 3300061734 Bacteria 12535
978 Ga0530510_0003261 3300061734 Bacteria 11152
979 Ga0530510_0004269 3300061734 Bacteria 9891
980 Ga0530510_0010377 3300061734 Bacteria 6531
981 Ga0530510_0039127 3300061734 Bacteria 3423
982 Ga0530510_0115418 3300061734 Bacteria 1968
983 Ga0530510_0298034 3300061734 Bacteria 1206
984 2776910825 2775507049 Bacteria 6284736
985 2883581241 2883577096 Bacteria 4709178
986 2894773134 2894772417 Bacteria 5305674
987 Ga0207669_10050150
988 JGI25406J46586_10006501
989 JGI25406J46586_10011229
990 JGI26129J50193_1002204
991 Ga0065712_10030896
992 Ga0065715_10124256
993 Ga0065715_10157979
994 Ga0065707_10096354
995 Ga0065707_10119257
996 Ga0070676_10034437
997 Ga0070690_100067294
998 Ga0070690_100162427
999 Ga0070670_100356109
1000 Ga0070677_10022862
1001 Ga0068869_100002482
1002 Ga0068869_100006166
1003 Ga0068869_100015428
1004 Ga0068869_100187717
1005 Ga0068869_100349072
1006 Ga0070680_100176034
1007 Ga0070680_100259607
1008 Ga0070682_100001528
1009 Ga0068868_100002947
1010 Ga0070689_100002038
1011 Ga0070689_100156381
1012 Ga0070691_10016926
1013 Ga0070691_10017617
1014 Ga0070691_10021810
1015 Ga0070691_10028327
1016 Ga0070691_10076194
1017 Ga0070687_100000326
1018 Ga0070687_100056298
1019 Ga0070692_10008943
1020 Ga0070692_10010920
1021 Ga0070692_10070275
1022 Ga0070692_10157985
1023 Ga0070668_100027604
1024 Ga0070668_100337000
1025 Ga0070668_100359050
1026 Ga0070669_100002984
1027 Ga0070669_100382177
1028 Ga0070669_100388179
1029 Ga0070675_100179485
1030 Ga0070675_100270406
1031 Ga0070671_100204493
1032 Ga0070671_100282518
1033 Ga0070674_100028481
1034 Ga0070674_100103882
1035 Ga0070659_100096411
1036 Ga0070709_10193076
1037 Ga0070714_100050541
1038 Ga0070714_100066078
1039 Ga0070714_100526074
1040 Ga0070713_100035581
1041 Ga0070701_10005350
1042 Ga0070701_10010591
1043 Ga0070705_100000638
1044 Ga0070705_100000671
1045 Ga0070705_100016484
1046 Ga0070705_100029720
1047 Ga0070705_100152480
1048 Ga0070705_100177207
1049 Ga0070705_100193116
1050 Ga0070705_100235746
1051 Ga0070700_100000211
1052 Ga0070700_100003296
1053 Ga0070700_100011184
1054 Ga0070700_100031792
1055 Ga0070700_100205331
1056 Ga0070694_100002732
1057 Ga0070694_100003420
1058 Ga0070694_100003723
1059 Ga0070694_100003917
1060 Ga0070694_100041452
1061 Ga0070694_100051160
1062 Ga0070694_100052666
1063 Ga0070694_100114275
1064 Ga0070694_100147170
1065 Ga0070694_100174022
1066 Ga0070708_100006158
1067 Ga0070708_100026888
1068 Ga0070708_100083951
1069 Ga0070708_100238026
1070 Ga0070708_100303382
1071 Ga0070663_100256353
1072 Ga0070678_100061326
1073 Ga0070678_100254757
1074 Ga0070662_100094058
1075 Ga0070662_100201370
1076 Ga0070681_10010518
1077 Ga0070681_10021226
1078 Ga0070681_10078253
1079 Ga0070681_10108660
1080 Ga0068867_100001335
1081 Ga0068867_100003689
1082 Ga0068867_100134456
1083 Ga0068867_100165182
1084 Ga0070706_100073844
1085 Ga0070706_100078254
1086 Ga0070707_100018938
1087 Ga0070707_100037794
1088 Ga0070707_100274545
1089 Ga0070707_100317232
1090 Ga0070698_100005791
1091 Ga0070698_100137973
1092 Ga0070699_100003010
1093 Ga0070699_100006362
1094 Ga0070699_100006895
1095 Ga0070699_100042885
1096 Ga0070699_100381209
1097 Ga0070679_100064153
1098 Ga0070679_100113499
1099 Ga0070679_100202722
1100 Ga0070679_100400224
1101 Ga0070697_100001293
1102 Ga0070697_100001434
1103 Ga0070697_100005785
1104 Ga0070697_100007886
1105 Ga0070697_100008411
1106 Ga0070697_100019057
1107 Ga0070697_100072868
1108 Ga0068853_100274211
1109 Ga0070672_100083906
1110 Ga0070672_100129583
1111 Ga0070672_100254777
1112 Ga0070686_100010234
1113 Ga0070686_100173058
1114 Ga0070686_100339895
1115 Ga0070686_100459993
1116 Ga0070695_100000948
1117 Ga0070695_100001721
1118 Ga0070695_100002319
1119 Ga0070695_100005573
1120 Ga0070695_100022262
1121 Ga0070695_100022535
1122 Ga0070695_100027043
1123 Ga0070695_100031558
1124 Ga0070695_100086311
1125 Ga0070696_100000012
1126 Ga0070696_100002401
1127 Ga0070696_100009167
1128 Ga0070696_100044664
1129 Ga0070696_100095717
1130 Ga0070696_100126282
1131 Ga0070696_100278221
1132 Ga0070693_100000135
1133 Ga0070693_100007379
1134 Ga0070693_100128216
1135 Ga0070693_100281037
1136 Ga0070704_100000108
1137 Ga0070704_100000193
1138 Ga0070704_100029938
1139 Ga0070704_100080648
1140 Ga0070704_100169376
1141 Ga0070704_100236196
1142 Ga0070704_100277704
1143 Ga0070704_100282099
1144 Ga0070704_100393298
1145 Ga0070704_100399480
1146 Ga0068855_100063388
1147 Ga0068855_100288486
1148 Ga0070664_100138582
1149 Ga0068857_100022542
1150 Ga0068857_100359791
1151 Ga0068857_100430073
1152 Ga0068857_100740837
1153 Ga0068854_100001657
1154 Ga0068854_100407247
1155 Ga0068856_100332974
1156 Ga0068859_100003978
1157 Ga0068859_100006107
1158 Ga0068859_100007972
1159 Ga0068859_100021038
1160 Ga0068859_100099270
1161 Ga0068859_100383206
1162 Ga0068859_100432520
1163 Ga0068864_100149961
1164 Ga0068864_100381014
1165 Ga0068866_10009989
1166 Ga0068861_100000173
1167 Ga0068861_100019210
1168 Ga0068861_100113605
1169 Ga0068861_100131722
1170 Ga0068861_100424200
1171 Ga0068863_100126447
1172 Ga0068858_100001425
1173 Ga0068858_100136445
1174 Ga0068858_100161059
1175 Ga0068858_100228900
1176 Ga0068860_100001885
1177 Ga0068860_100060141
1178 Ga0068860_100554582
1179 Ga0068862_100000594
1180 Ga0068862_100004236
1181 Ga0081455_10000014
1182 Ga0081455_10007461
1183 Ga0081455_10017729
1184 Ga0081538_10027411
1185 Ga0081538_10048592
1186 Ga0081540_1000035
1187 Ga0081540_1000878
1188 Ga0081539_10000462
1189 Ga0081539_10001341
1190 Ga0070717_10424093
1191 Ga0070717_10463418
1192 Ga0075365_10011758
1193 Ga0075368_10003743
1194 Ga0075368_10012309
1195 Ga0075363_100030177
1196 Ga0075363_100052945
1197 Ga0075432_10041440
1198 Ga0070715_10083343
1199 Ga0070716_100078136
1200 Ga0070716_100231393
1201 Ga0070712_100006640
1202 Ga0070712_100057102
1203 Ga0075362_10078884
1204 Ga0075367_10028637
1205 Ga0075367_10040940
1206 Ga0075367_10208319
1207 Ga0097621_100000939
1208 Ga0075370_10033514
1209 Ga0068871_100000370
1210 Ga0068871_100080962
1211 Ga0075428_100000446
1212 Ga0075428_100001232
1213 Ga0075428_100009146
1214 Ga0075428_100018652
1215 Ga0075428_100019802
1216 Ga0075428_100022052
1217 Ga0075428_100044588
1218 Ga0075428_100223503
1219 Ga0075428_100535990
1220 Ga0075428_100653210
1221 Ga0075430_100006952
1222 Ga0075430_100010982
1223 Ga0075430_100048016
1224 Ga0075430_100307408
1225 Ga0075430_100349174
1226 Ga0075431_100000586
1227 Ga0075431_100002204
1228 Ga0075431_100006333
1229 Ga0075431_100023814
1230 Ga0075431_100100743
1231 Ga0075431_100150402
1232 Ga0075431_100155138
1233 Ga0075431_100204579
1234 Ga0075433_10001281
1235 Ga0075433_10006995
1236 Ga0075433_10033836
1237 Ga0075433_10119236
1238 Ga0075434_100001574
1239 Ga0075434_100002685
1240 Ga0075434_100053555
1241 Ga0075434_100082740
1242 Ga0075434_100093341
1243 Ga0075434_100104025
1244 Ga0075434_100577052
1245 Ga0075429_100000259
1246 Ga0075429_100000922
1247 Ga0075429_100002976
1248 Ga0068865_100007455
1249 Ga0068865_100017764
1250 Ga0068865_100020281
1251 Ga0075436_100001357
1252 Ga0075436_100006485
1253 Ga0075436_100142454
1254 Ga0075436_100204923
1255 Ga0075436_100210584
1256 Ga0075436_100284425
1257 Ga0097620_100003978
1258 Ga0097620_100006104
1259 Ga0097620_100007972
1260 Ga0097620_100021038
1261 Ga0097620_100099264
1262 Ga0097620_100383240
1263 Ga0097620_100432525
1264 Ga0075435_100000047
1265 Ga0075435_100017237
1266 Ga0075435_100256335
1267 Ga0099794_10059969
1268 Ga0099794_10158993
1269 Ga0105240_10394231
1270 Ga0111539_10003844
1271 Ga0111539_10011877
1272 Ga0111539_10031418
1273 Ga0111539_10034785
1274 Ga0111539_10086334
1275 Ga0111539_10291090
1276 Ga0111539_10354182
1277 Ga0111539_10405491
1278 Ga0111539_10663496
1279 Ga0105245_10007041
1280 Ga0105245_10012980
1281 Ga0105245_10075077
1282 Ga0105247_10112872
1283 Ga0114129_10000068
1284 Ga0114129_10000430
1285 Ga0114129_10000703
1286 Ga0114129_10002359
1287 Ga0114129_10020013
1288 Ga0114129_10020418
1289 Ga0114129_10074037
1290 Ga0114129_10164336
1291 Ga0114129_10915868
1292 Ga0105243_10000708
1293 Ga0105243_10043929
1294 Ga0105243_10444606
1295 Ga0105241_10092438
1296 Ga0105241_10122645
1297 Ga0105242_10041789
1298 Ga0105242_10258302
1299 Ga0105248_10114457
1300 Ga0105248_10368233
1301 Ga0105237_10029142
1302 Ga0105237_10037012
1303 Ga0105238_10341110
1304 Ga0105249_10000599
1305 Ga0105249_10002072
1306 Ga0105249_10131152
1307 Ga0105249_10603595
1308 Ga0099796_10028306
1309 Ga0105239_10036817
1310 Ga0105239_10242555
1311 Ga0105246_10136796
1312 Ga0157369_10217554
1313 Ga0157378_10006229
1314 Ga0157378_10422905
1315 Ga0157378_10491426
1316 Ga0163162_10018668
1317 Ga0163162_10333214
1318 Ga0163162_10436895
1319 Ga0163162_10494459
1320 Ga0157372_10202758
1321 Ga0157375_10444959
1322 Ga0157375_10516832
1323 Ga0163163_10001948
1324 Ga0163163_10609142
1325 Ga0157380_10270015
1326 Ga0157380_10305790
1327 Ga0157380_10463956
1328 Ga0157377_10101288
1329 Ga0157379_10441317
1330 Ga0157376_10011568
1331 Ga0157376_10059518
1332 Ga0213873_10024658
1333 Ga0213874_10011204
1334 Ga0213876_10000816
1335 Ga0213876_10000944
1336 Ga0213876_10084059
1337 Ga0213875_10000003
1338 Ga0213875_10001075
1339 Ga0213875_10012486
1340 Ga0213875_10016470
1341 Ga0213875_10034599
1342 Ga0207653_10001145
1343 Ga0207682_10002103
1344 Ga0207692_10195460
1345 Ga0207642_10005920
1346 Ga0207642_10018611
1347 Ga0207710_10024128
1348 Ga0207688_10016496
1349 Ga0207645_10045314
1350 Ga0207684_10004520
1351 Ga0207654_10035292
1352 Ga0207654_10089196
1353 Ga0207707_10001852
1354 Ga0207707_10010205
1355 Ga0207707_10064689
1356 Ga0207671_10030628
1357 Ga0207693_10003608
1358 Ga0207693_10013129
1359 Ga0207693_10052856
1360 Ga0207662_10000639
1361 Ga0207662_10010145
1362 Ga0207662_10044570
1363 Ga0207652_10159637
1364 Ga0207652_10180287
1365 Ga0207652_10187492
1366 Ga0207646_10003037
1367 Ga0207646_10065719
1368 Ga0207646_10176822
1369 Ga0207681_10002455
1370 Ga0207681_10404072
1371 Ga0207694_10237511
1372 Ga0207650_10246261
1373 Ga0207659_10189264
1374 Ga0207687_10003950
1375 Ga0207687_10016484
1376 Ga0207687_10184012
1377 Ga0207664_10331786
1378 Ga0207644_10072069
1379 Ga0207706_10040460
1380 Ga0207706_10080777
1381 Ga0207706_10149150
1382 Ga0207686_10006692
1383 Ga0207686_10064621
1384 Ga0207709_10036753
1385 Ga0207709_10049360
1386 Ga0207709_10225211
1387 Ga0207709_10234795
1388 Ga0207670_10185603
1389 Ga0207669_10043433
1390 Ga0207704_10007060
1391 Ga0207704_10460629
1392 Ga0207665_10136272
1393 Ga0207691_10059780
1394 Ga0207691_10081129
1395 Ga0207691_10119619
1396 Ga0207711_10097521
1397 Ga0207711_10411394
1398 Ga0207689_10007163
1399 Ga0207689_10036449
1400 Ga0207689_10097726
1401 Ga0207661_10219910
1402 Ga0207679_10016081
1403 Ga0207667_10033944
1404 Ga0207667_10054565
1405 Ga0207651_10195438
1406 Ga0207712_10003113
1407 Ga0207712_10003418
1408 Ga0207712_10217206
1409 Ga0207712_10244082
1410 Ga0207668_10087785
1411 Ga0207640_10014585
1412 Ga0207640_10287323
1413 Ga0207658_10106231
1414 Ga0207677_10029879
1415 Ga0207703_10013352
1416 Ga0207703_10055811
1417 Ga0207703_10084896
1418 Ga0207703_10136321
1419 Ga0207703_10278628
1420 Ga0207703_10680861
1421 Ga0207639_10004290
1422 Ga0207639_10569432
1423 Ga0207678_10003276
1424 Ga0207708_10000142
1425 Ga0207708_10000153
1426 Ga0207708_10001509
1427 Ga0207708_10026481
1428 Ga0207708_10050676
1429 Ga0207708_10070975
1430 Ga0207708_10296444
1431 Ga0207708_10345084
1432 Ga0207702_10192198
1433 Ga0207641_10075539
1434 Ga0207641_10720362
1435 Ga0207648_10000130
1436 Ga0207648_10003264
1437 Ga0207648_10081281
1438 Ga0207676_10008709
1439 Ga0207676_10203923
1440 Ga0207674_10008447
1441 Ga0207674_10014574
1442 Ga0207674_10147265
1443 Ga0207675_100000253
1444 Ga0207675_100000648
1445 Ga0207675_100105017
1446 Ga0207675_100151459
1447 Ga0207675_100185079
1448 Ga0207683_10023791
1449 Ga0209969_1002469
1450 Ga0209981_1012871
1451 Ga0209996_1000475
1452 Ga0209996_1004059
1453 Ga0209996_1008521
1454 Ga0210000_1001307
1455 Ga0210000_1001320
1456 Ga0209995_1005928
1457 Ga0209968_1001005
1458 Ga0209968_1005706
1459 Ga0209968_1015897
1460 Ga0209999_1008492
1461 Ga0209983_1000380
1462 Ga0209971_1000228
1463 Ga0209971_1006441
1464 Ga0209966_1000098
1465 Ga0209998_10000125
1466 Ga0209813_10006973
1467 Ga0209813_10035293
1468 Ga0209974_10004008
1469 Ga0207428_10000721
1470 Ga0207428_10012105
1471 Ga0207428_10209626
1472 Ga0268265_10000627
1473 Ga0268265_10000885
1474 Ga0268265_10000939
1475 Ga0268265_10006592
1476 Ga0268265_10012099
1477 Ga0268265_10200165
1478 Ga0268264_10001246
1479 Ga0268264_10047794
1480 Ga0268264_10245600
1481 Ga0268264_10249517
1482 Ga0265338_10288882
1483 Ga0265330_10032768
1484 Ga0265320_10038673
1485 Ga0265329_10038528
1486 Ga0265339_10041981
1487 Ga0265316_10019986
1488 Ga0265316_10045361
1489 Ga0307408_100070265
1490 Ga0316575_10014633
1491 Ga0316575_10020135
1492 Ga0265342_10025824
1493 Ga0265342_10027031
1494 Ga0307416_100047257
1495 Ga0307414_10360773
1496 Ga0373950_0015439
1497 Ga0373938_0009918
1498 Ga0373926_0000320
1499 Ga0373926_0002880
1500 Ga0373940_0008635
1501 Ga0373944_0007777
1502 Ga0373952_0008135
1503 Ga0373923_0015997
1504 Ga0373932_0019320
1505 Ga0373936_0013035
1506 Ga0373936_0037929
1507 Ga0373941_0009738
1508 Ga0373945_0002043
1509 Ga0373945_0012081
1510 Ga0373954_0032281
1511 Ga0373956_0032314
1512 Ga0373957_0068681
1513 Ga0373960_0010649
1514 Ga0373943_0000424
1515 Ga0373943_0006382
1516 Ga0373943_0028636
1517 Ga0373946_0003275
1518 Ga0373946_0006545
1519 Ga0373946_0020065
1520 Ga0373955_0039290
1521 Ga0373955_0310029
1522 Ga0373962_0048074
1523 Ga0316574_0004412
1524 Ga0373931_0000207
1525 Ga0373931_0002172
1526 Ga0373931_0027600
1527 Ga0373931_0094053
1528 Ga0373931_0096222
1529 Ga0373931_0152554
1530 Ga0373931_0273544
1531 Ga0373935_0000882
1532 Ga0373935_0002678
1533 Ga0373935_0006454
1534 Ga0373935_0009918
1535 Ga0373927_0000414
1536 Ga0373927_0006828
1537 Ga0373927_0025829
1538 Ga0373927_0098409
1539 Ga0373927_0149233
1540 Ga0373933_0008780
1541 Ga0373933_0123375
1542 Ga0373947_0000275
1543 Ga0373947_0007039
1544 Ga0373947_0017419
1545 Ga0373947_0066277
1546 Ga0373937_0108121
1547 Ga0373937_0134761
1548 Ga0373937_0394453
1549 Ga0373925_0002725
1550 Ga0373925_0014839
1551 Ga0373925_0087640
1552 Ga0373925_0109429
1553 Ga0395905_0537467
1554 Ga0316581_0006661
1555 Ga0436364_0147453
1556 Ga0436364_0162358
1557 Ga0436364_0676530
1558 Ga0436364_0685371
1559 Ga0436364_0700611
1560 Ga0436364_0705174
1561 Ga0436364_0760962
1562 Ga0436364_1082407
1563 Ga0436364_1114716
1564 Ga0436365_0159339
1565 Ga0436365_0736793
1566 Ga0436365_1308054
1567 Ga0436365_1837194
1568 Ga0436365_1892164
1569 Ga0436360_0404169
1570 Ga0436360_0886479
1571 Ga0436361_0847532
1572 Ga0436363_0313348
1573 Ga0436363_1475436
1574 Ga0436362_1056133
1575 Ga0436362_1066130
1576 Ga0436362_1124287
1577 Ga0439461_0030608
1578 Ga0439441_001670
1579 Ga0439441_002598
1580 Ga0439443_002737
1581 Ga0439450_012023
1582 Ga0439446_0004940
1583 Ga0439434_0003115
1584 Ga0439434_0038426
1585 Ga0439434_0056815
1586 Ga0439435_0004837
1587 Ga0439444_0001275
1588 Ga0439459_0008227
1589 Ga0439464_0020595
1590 Ga0439464_0056003
1591 Ga0439460_0001552
1592 Ga0439460_0018435
1593 Ga0451577_0204639
1594 Ga0451577_0300010
1595 Ga0451577_0343975
1596 Ga0439440_0013406
1597 Ga0453683_0025310
1598 Ga0453684_0024772
1599 Ga0451576_0030558
1600 Ga0451576_0031269
1601 Ga0451576_0034448
1602 Ga0451576_0035065
1603 Ga0451576_0253503
1604 Ga0451576_0536241
1605 Ga0466967_0251474
1606 Ga0495603_0028409
1607 Ga0495603_0244401
1608 Ga0495629_0170376
1609 Ga0495653_0057546
1610 Ga0495653_0058032
1611 Ga0495653_0233476
1612 Ga0495580_0001270
1613 Ga0495580_0058049
1614 Ga0495662_0000261
1615 Ga0495662_0016950
1616 Ga0495662_0034302
1617 Ga0495664_0000736
1618 Ga0495608_0019659
1619 Ga0495608_0128988
1620 Ga0495618_0160733
1621 Ga0495628_0202423
1622 Ga0495630_0002218
1623 Ga0495663_0030658
1624 Ga0495666_0057274
1625 Ga0495666_0166937
1626 Ga0495652_0199677
1627 Ga0495665_0024212
1628 Ga0495640_0002964
1629 Ga0495640_0013343
1630 Ga0495640_0217321
1631 Ga0495586_0001814
1632 Ga0495586_0048291
1633 Ga0495621_0019212
1634 Ga0495621_0039933
1635 Ga0495645_0002109
1636 Ga0495667_0048970
1637 Ga0495656_0044546
1638 Ga0495634_0006321
1639 Ga0495634_0017261
1640 Ga0495634_0039498
1641 Ga0495634_0223442
1642 Ga0495625_0049301
1643 Ga0495635_0000438
1644 Ga0495588_0010367
1645 Ga0495646_0022684
1646 Ga0495647_0016640
1647 Ga0495658_0005364
1648 Ga0495658_0134032
1649 Ga0495669_0005523
1650 Ga0495613_0027628
1651 Ga0495613_0122418
1652 Ga0495613_0245809
1653 Ga0495613_0307480
1654 Ga0495624_0001570
1655 Ga0495624_0064570
1656 Ga0495600_0028225
1657 Ga0495581_0025033
1658 Ga0495604_0346453
1659 Ga0495674_0000209
1660 Ga0495674_0024470
1661 Ga0495674_0314268
1662 Ga0495676_0033822
1663 Ga0495676_0047447
1664 Ga0495676_0085983
1665 Ga0495680_0386936
1666 Ga0495684_0001766
1667 Ga0495684_0003044
1668 Ga0495684_0049314
1669 Ga0495593_0007179
1670 Ga0495602_0080662
1671 Ga0495602_0454798
1672 Ga0495615_0012423
1673 Ga0496100_0134321
1674 Ga0496100_0207228
1675 Ga0496100_0332254
1676 Ga0496101_0424249
1677 Ga0496102_0010995
1678 Ga0496102_0176348
1679 Ga0496103_0030761
1680 Ga0496104_0006466
1681 Ga0496104_0011676
1682 Ga0496104_0035653
1683 Ga0496104_0040885
1684 Ga0496105_0000783
1685 Ga0496105_0006116
1686 Ga0496105_0017779
1687 Ga0496105_0037299
1688 Ga0496106_0002235
1689 Ga0496106_0094236
1690 Ga0496106_0108221
1691 Ga0496106_0209392
1692 Ga0496107_0005679
1693 Ga0496108_0000783
1694 Ga0496108_0005523
1695 Ga0496109_0002516
1696 Ga0496109_0044666
1697 Ga0496110_0023893
1698 Ga0496110_0039288
1699 Ga0496110_0163933
1700 Ga0496110_0192729
1701 Ga0496110_0227850
1702 Ga0496110_0444194
1703 Ga0496111_0000495
1704 Ga0496111_0012998
1705 Ga0496112_0003524
1706 Ga0496112_0008371
1707 Ga0496113_0000529
1708 Ga0496114_0109194
1709 Ga0496114_0167669
1710 Ga0496115_0004616
1711 Ga0496115_0156652
1712 Ga0496115_0376978
1713 Ga0496117_0032979
1714 Ga0496120_0106075
1715 Ga0496122_0017063
1716 Ga0496124_0012283
1717 Ga0496124_0087643
1718 Ga0496125_0002695
1719 Ga0501033_0083116
1720 Ga0501033_0201346
1721 Ga0501034_0019935
1722 Ga0501034_0273000
1723 Ga0501036_0001382
1724 Ga0501036_0020963
1725 Ga0501036_0103560
1726 Ga0501036_0111786
1727 Ga0501036_0190621
1728 Ga0501037_0003480
1729 Ga0501037_0154252
1730 Ga0501038_0000646
1731 Ga0501038_0012439
1732 Ga0501038_0073051
1733 Ga0501038_0191459
1734 Ga0501038_0342704
1735 Ga0501038_0378757
1736 Ga0501039_0001534
1737 Ga0501039_0112756
1738 Ga0501039_0137082
1739 Ga0501039_0157905
1740 Ga0501039_0175265
1741 Ga0501039_0280225
1742 Ga0501040_0000087
1743 Ga0501040_0017509
1744 Ga0501041_0002380
1745 Ga0501041_0007945
1746 Ga0501041_0021655
1747 Ga0501041_0074019
1748 Ga0501041_0132095
1749 Ga0501041_0137561
1750 Ga0501041_0195047
1751 Ga0501041_0214942
1752 Ga0501042_0000957
1753 Ga0501042_0002829
1754 Ga0501042_0038500
1755 Ga0501042_0040685
1756 Ga0501043_0008327
1757 Ga0501043_0008730
1758 Ga0501043_0240942
1759 Ga0501043_0254530
1760 Ga0501043_0286800
1761 Ga0501046_0000364
1762 Ga0501046_0022776
1763 Ga0501046_0036174
1764 Ga0501046_0042825
1765 Ga0501046_0068487
1766 Ga0501046_0112204
1767 Ga0501047_0028382
1768 Ga0501048_0001228
1769 Ga0501048_0017702
1770 Ga0501048_0024555
1771 Ga0501048_0026590
1772 Ga0501048_0152336
1773 Ga0501048_0249039
1774 Ga0501067_0037054
1775 Ga0501068_0011606
1776 Ga0501068_0040132
1777 Ga0501068_0054258
1778 Ga0501068_0064794
1779 Ga0501069_0026341
1780 Ga0501069_0103036
1781 Ga0501069_0260763
1782 Ga0501070_0373034
1783 Ga0501071_0000156
1784 Ga0501071_0001439
1785 Ga0501071_0045592
1786 Ga0501071_0055335
1787 Ga0501071_0146449
1788 Ga0501072_0000252
1789 Ga0501072_0002340
1790 Ga0501072_0011074
1791 Ga0501072_0014152
1792 Ga0501072_0015235
1793 Ga0501072_0084821
1794 Ga0501072_0108041
1795 Ga0501072_0142384
1796 Ga0501072_0191446
1797 Ga0501072_0251166
1798 Ga0501072_0262130
1799 Ga0501073_0085182
1800 Ga0501073_0237298
1801 Ga0501074_0001338
1802 Ga0501074_0035939
1803 Ga0501074_0075577
1804 Ga0501074_0220011
1805 Ga0501074_0251630
1806 Ga0501075_0000004
1807 Ga0501075_0000058
1808 Ga0501075_0045061
1809 Ga0501075_0074851
1810 Ga0501075_0287979
1811 Ga0501076_0000729
1812 Ga0501076_0000774
1813 Ga0501076_0005575
1814 Ga0501076_0006035
1815 Ga0501076_0008073
1816 Ga0501076_0015076
1817 Ga0501076_0104111
1818 Ga0501077_0000178
1819 Ga0501077_0022957
1820 Ga0501077_0106072
1821 Ga0501077_0171686
1822 Ga0501077_0204832
1823 Ga0501079_0000022
1824 Ga0501079_0005648
1825 Ga0501079_0032205
1826 Ga0501079_0051015
1827 Ga0501079_0068313
1828 Ga0501079_0074885
1829 Ga0501079_0096889
1830 Ga0501079_0165351
1831 Ga0501079_0215556
1832 Ga0501080_0001368
1833 Ga0501080_0007494
1834 Ga0501080_0011566
1835 Ga0501080_0013259
1836 Ga0501080_0014988
1837 Ga0501080_0091352
1838 Ga0501080_0163888
1839 Ga0501080_0263607
1840 Ga0501080_0322145
1841 Ga0501081_0000774
1842 Ga0501081_0005054
1843 Ga0501081_0043796
1844 Ga0501081_0090558
1845 Ga0501081_0110500
1846 Ga0501081_0259297
1847 Ga0501083_0009935
1848 Ga0501083_0066623
1849 Ga0501083_0084820
1850 Ga0501083_0100994
1851 Ga0501083_0170035
1852 Ga0501083_0212132
1853 Ga0501035_0001252
1854 Ga0501035_0031108
1855 Ga0501035_0216312
1856 Ga0501044_0097643
1857 Ga0501045_0001164
1858 Ga0501045_0005395
1859 Ga0501045_0038943
1860 Ga0501045_0039692
1861 Ga0501045_0050317
1862 Ga0501045_0053256
1863 Ga0501045_0067775
1864 Ga0501045_0345062
1865 nmdc:mga03n38_70088_c1
1866 nmdc:mga00v17_42716_c1
1867 nmdc:mga00v17_663_c1
1868 nmdc:mga0yw44_125726_c1
1869 nmdc:mga0yw44_241100_c1
1870 nmdc:mga0yw44_6134_c1
1871 nmdc:mga0k408_144836_c1
1872 nmdc:mga0k408_21840_c1
1873 nmdc:mga06z11_1221_c1
1874 nmdc:mga06z11_14795_c1
1875 nmdc:mga06z11_4849_c1
1876 nmdc:mga04h51_18663_c1
1877 nmdc:mga04h51_5277_c1
1878 nmdc:mga07m45_140965_c1
1879 nmdc:mga05p37_11593_c1
1880 nmdc:mga05p37_286168_c1
1881 nmdc:mga05p37_3149_c1
1882 nmdc:mga05p37_3283_c1
1883 nmdc:mga05p37_53751_c1
1884 nmdc:mga05p37_591813_c1
1885 nmdc:mga05p37_710_c2
1886 nmdc:mga09592_126_c1
1887 nmdc:mga09592_1332_c1
1888 nmdc:mga09592_3063_c1
1889 nmdc:mga09592_4616_c1
1890 nmdc:mga09592_51499_c1
1891 nmdc:mga09592_77287_c1
1892 nmdc:mga0qj67_132673_c1
1893 nmdc:mga0qj67_2393_c1
1894 nmdc:mga06r32_100774_c1
1895 nmdc:mga06r32_178409_c1
1896 nmdc:mga06r32_2441_c1
1897 nmdc:mga06r32_256198_c1
1898 nmdc:mga06r32_343670_c1
1899 nmdc:mga06r32_4_c1
1900 nmdc:mga06r32_6022_c1
1901 nmdc:mga06r32_61903_c1
1902 nmdc:mga06r32_63545_c1
1903 nmdc:mga06r32_7414_c1
1904 nmdc:mga08y16_1078_c1
1905 nmdc:mga08y16_156104_c1
1906 nmdc:mga08y16_16843_c1
1907 nmdc:mga08y16_182193_c1
1908 nmdc:mga08y16_39253_c1
1909 nmdc:mga08y16_399621_c1
1910 nmdc:mga08y16_4436_c1
1911 nmdc:mga0n895_110942_c1
1912 nmdc:mga0n895_1570_c1
1913 nmdc:mga0n895_3956_c1
1914 nmdc:mga0n895_401522_c1
1915 nmdc:mga0n895_42634_c1
1916 nmdc:mga0n895_50020_c1
1917 nmdc:mga0rr50_18250_c1
1918 nmdc:mga0rr50_315148_c1
1919 nmdc:mga0rr50_359_c1
1920 nmdc:mga0rr50_55745_c1
1921 nmdc:mga08x19_120397_c1
1922 nmdc:mga08x19_12690_c1
1923 nmdc:mga08x19_20446_c1
1924 nmdc:mga08x19_245588_c1
1925 nmdc:mga08x19_47006_c1
1926 nmdc:mga0a205_1075_c1
1927 nmdc:mga0a205_16420_c1
1928 nmdc:mga0a205_297825_c1
1929 nmdc:mga0a205_311895_c1
1930 nmdc:mga0a205_34387_c1
1931 nmdc:mga0a205_93_c2
1932 nmdc:mga0sz30_68952_c1
1933 Ga0495601_0001471
1934 Ga0495601_0035335
1935 Ga0495601_0310879
1936 Ga0495612_0000353
1937 Ga0495595_0036616
1938 Ga0495619_0001077
1939 Ga0495619_0084025
1940 Ga0500658_0085078
1941 Ga0500568_0002596
1942 Ga0500577_0029867
1943 Ga0500616_0095822
1944 Ga0501084_0000157
1945 Ga0501084_0002367
1946 Ga0501084_0039329
1947 Ga0501084_0053208
1948 Ga0501084_0113461
1949 Ga0501084_0225774
1950 Ga0501084_0250867
1951 Ga0501084_0410885
1952 Ga0501082_0000050
1953 Ga0501082_0000341
1954 Ga0501082_0001651
1955 Ga0501082_0063226
1956 Ga0501082_0100457
1957 Ga0501082_0152329
1958 Ga0501082_0160913
1959 Ga0501082_0199196
1960 Ga0530510_0000084
1961 Ga0530510_0000222
1962 Ga0530510_0002069
1963 Ga0530510_0002542
1964 Ga0530510_0003261
1965 Ga0530510_0004269
1966 Ga0530510_0010377
1967 Ga0530510_0039127
1968 Ga0530510_0115418
1969 Ga0530510_0298034
1970 2776910825
1971 2883581241
1972 2894773134

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

46

312

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g1u-assembly1.cif.gz_B x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis 0.5677 5 276
1l7v-assembly1.cif.gz_B bacterial abc transporter involved in b12 uptake 0.5571 8 274
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5423 6 281
4g1u-assembly1.cif.gz_B x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis 0.5422 5 276
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.5396 13 281
ID Description Score Start End Superfamily
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8987 11 275 1.10.3470.10
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8448 11 275 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8221 9 277 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7848 9 277 1.10.3470.10
af_P77672_36_301_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7785 8 275 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A2V7A8I3-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9693 2 288 GO:0005886
GO:0006865
GO:0022857
AF-A0A2V7A8I3-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.966 2 288 GO:0005886
GO:0006865
GO:0022857
AF-A0A2V6Z4S1-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9626 48 288 GO:0005886
GO:0006865
GO:0022857
AF-A0A147K391-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9606 1 288 GO:0005886
GO:0006865
GO:0022857
AF-A0A1W9U1L0-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9589 7 287 GO:0005886
GO:0006865
GO:0022857

Map