F487526
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 986 | 373 | 1972 | 282 |
Family's Representative Sequence
| Representative Sequence | 3300025937|Ga0207669_10050150|Ga0207669_100501501 |
| Length | 324 |
| Sequence | MGSNERNPIPTPALPLKGRGITSLLPSFPPSLIQNMQIFDIFLLEAILNGILLGGILALLALGLNLIFGVIDVVWICYAELIMIGMYAIFYLHVSYGWPLWLAFPCAVVVVAMLGLLLHQLVIRPVLAAEPINQLLVTGGVLFFLQGVATLAFGVEFKNLGVNLPPISLGEMQFSSARLVAFLAALGCMIGMYLFLTRTYLGTAIRAISQDRAIMPLMGVNPSRIFLITSALGGGLAGLASCLLVLQYDIHPAIGLSFGPITFLVCVLGGLGNMIGGFIAAFIFAQFISVGGFFLHLEWGYVLAFLFFIGFMFWRPRGLLGGKS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 70 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 71 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 72 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 73 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 118 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 119 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 120 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 121 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 186 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 190 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 191 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 192 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 193 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 195 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 196 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 197 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 198 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 199 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 200 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 201 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 202 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 204 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 205 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 208 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 211 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 213 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 218 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 219 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 220 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 221 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 222 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 223 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 224 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 227 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 228 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 229 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 230 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 231 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 232 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 233 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 234 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 235 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 236 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 237 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 238 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 239 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 240 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 241 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 242 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 243 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 244 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 245 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 246 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 247 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 248 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 249 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 250 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 251 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 294 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 295 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 296 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 297 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 298 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 299 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 302 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 303 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 304 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 305 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 306 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 307 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 308 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 309 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 310 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 311 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 312 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 344 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 345 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 346 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 347 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 348 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 349 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 350 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 360 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 365 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 366 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 367 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 368 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 371 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 372 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 373 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.7 |
| Metatranscriptomes | 0 |
| Isolates | 0.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.14 |
| Nodule | 0 |
| Rhizoplane | 4.06 |
| Rhizosphere | 89.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207669_10050150 | 3300025937 | Bacteria | 2493 |
| 2 | JGI25406J46586_10006501 | 3300003203 | Bacteria | 5377 |
| 3 | JGI25406J46586_10011229 | 3300003203 | Bacteria | 3937 |
| 4 | JGI26129J50193_1002204 | 3300003349 | Bacteria | 1366 |
| 5 | Ga0065712_10030896 | 3300005290 | Bacteria | 1858 |
| 6 | Ga0065715_10124256 | 3300005293 | Bacteria | 2158 |
| 7 | Ga0065715_10157979 | 3300005293 | Bacteria | 1658 |
| 8 | Ga0065707_10096354 | 3300005295 | Bacteria | 3275 |
| 9 | Ga0065707_10119257 | 3300005295 | Bacteria | 2162 |
| 10 | Ga0070676_10034437 | 3300005328 | Bacteria | 2908 |
| 11 | Ga0070690_100067294 | 3300005330 | Bacteria | 2321 |
| 12 | Ga0070690_100162427 | 3300005330 | Bacteria | 1532 |
| 13 | Ga0070670_100356109 | 3300005331 | Bacteria | 1286 |
| 14 | Ga0070677_10022862 | 3300005333 | Bacteria | 2308 |
| 15 | Ga0068869_100002482 | 3300005334 | Bacteria | 11121 |
| 16 | Ga0068869_100006166 | 3300005334 | Bacteria | 7591 |
| 17 | Ga0068869_100015428 | 3300005334 | Bacteria | 5124 |
| 18 | Ga0068869_100187717 | 3300005334 | Bacteria | 1624 |
| 19 | Ga0068869_100349072 | 3300005334 | Bacteria | 1206 |
| 20 | Ga0070680_100176034 | 3300005336 | Bacteria | 1801 |
| 21 | Ga0070680_100259607 | 3300005336 | Bacteria | 1469 |
| 22 | Ga0070682_100001528 | 3300005337 | Bacteria | 12962 |
| 23 | Ga0068868_100002947 | 3300005338 | Bacteria | 11815 |
| 24 | Ga0070689_100002038 | 3300005340 | Bacteria | 13107 |
| 25 | Ga0070689_100156381 | 3300005340 | Bacteria | 1841 |
| 26 | Ga0070691_10016926 | 3300005341 | Bacteria | 3353 |
| 27 | Ga0070691_10017617 | 3300005341 | Bacteria | 3287 |
| 28 | Ga0070691_10021810 | 3300005341 | Bacteria | 2967 |
| 29 | Ga0070691_10028327 | 3300005341 | Bacteria | 2616 |
| 30 | Ga0070691_10076194 | 3300005341 | Bacteria | 1635 |
| 31 | Ga0070687_100000326 | 3300005343 | Bacteria | 16173 |
| 32 | Ga0070687_100056298 | 3300005343 | Bacteria | 2057 |
| 33 | Ga0070692_10008943 | 3300005345 | Bacteria | 4491 |
| 34 | Ga0070692_10010920 | 3300005345 | Bacteria | 4155 |
| 35 | Ga0070692_10070275 | 3300005345 | Bacteria | 1864 |
| 36 | Ga0070692_10157985 | 3300005345 | Bacteria | 1296 |
| 37 | Ga0070668_100027604 | 3300005347 | Bacteria | 4310 |
| 38 | Ga0070668_100337000 | 3300005347 | Bacteria | 1273 |
| 39 | Ga0070668_100359050 | 3300005347 | Bacteria | 1235 |
| 40 | Ga0070669_100002984 | 3300005353 | Bacteria | 12193 |
| 41 | Ga0070669_100382177 | 3300005353 | Bacteria | 1148 |
| 42 | Ga0070669_100388179 | 3300005353 | Bacteria | 1140 |
| 43 | Ga0070675_100179485 | 3300005354 | Bacteria | 1830 |
| 44 | Ga0070675_100270406 | 3300005354 | Bacteria | 1491 |
| 45 | Ga0070671_100204493 | 3300005355 | Bacteria | 1675 |
| 46 | Ga0070671_100282518 | 3300005355 | Bacteria | 1412 |
| 47 | Ga0070674_100028481 | 3300005356 | Bacteria | 3670 |
| 48 | Ga0070674_100103882 | 3300005356 | Bacteria | 2075 |
| 49 | Ga0070659_100096411 | 3300005366 | Bacteria | 2376 |
| 50 | Ga0070709_10193076 | 3300005434 | Bacteria | 1438 |
| 51 | Ga0070714_100050541 | 3300005435 | Bacteria | 3542 |
| 52 | Ga0070714_100066078 | 3300005435 | Bacteria | 3117 |
| 53 | Ga0070714_100526074 | 3300005435 | Bacteria | 1130 |
| 54 | Ga0070713_100035581 | 3300005436 | Bacteria | 4010 |
| 55 | Ga0070701_10005350 | 3300005438 | Bacteria | 5290 |
| 56 | Ga0070701_10010591 | 3300005438 | Bacteria | 4084 |
| 57 | Ga0070705_100000638 | 3300005440 | Bacteria | 20069 |
| 58 | Ga0070705_100000671 | 3300005440 | Bacteria | 19567 |
| 59 | Ga0070705_100016484 | 3300005440 | Bacteria | 3841 |
| 60 | Ga0070705_100029720 | 3300005440 | Bacteria | 3010 |
| 61 | Ga0070705_100152480 | 3300005440 | Bacteria | 1535 |
| 62 | Ga0070705_100177207 | 3300005440 | Bacteria | 1440 |
| 63 | Ga0070705_100193116 | 3300005440 | Bacteria | 1389 |
| 64 | Ga0070705_100235746 | 3300005440 | Bacteria | 1276 |
| 65 | Ga0070700_100000211 | 3300005441 | Bacteria | 32522 |
| 66 | Ga0070700_100003296 | 3300005441 | Bacteria | 8326 |
| 67 | Ga0070700_100011184 | 3300005441 | Bacteria | 4967 |
| 68 | Ga0070700_100031792 | 3300005441 | Bacteria | 3166 |
| 69 | Ga0070700_100205331 | 3300005441 | Bacteria | 1387 |
| 70 | Ga0070694_100002732 | 3300005444 | Bacteria | 10466 |
| 71 | Ga0070694_100003420 | 3300005444 | Bacteria | 9515 |
| 72 | Ga0070694_100003723 | 3300005444 | Bacteria | 9094 |
| 73 | Ga0070694_100003917 | 3300005444 | Bacteria | 8904 |
| 74 | Ga0070694_100041452 | 3300005444 | Bacteria | 3072 |
| 75 | Ga0070694_100051160 | 3300005444 | Bacteria | 2787 |
| 76 | Ga0070694_100052666 | 3300005444 | Bacteria | 2752 |
| 77 | Ga0070694_100114275 | 3300005444 | Bacteria | 1927 |
| 78 | Ga0070694_100147170 | 3300005444 | Bacteria | 1717 |
| 79 | Ga0070694_100174022 | 3300005444 | Bacteria | 1588 |
| 80 | Ga0070708_100006158 | 3300005445 | Bacteria | 9543 |
| 81 | Ga0070708_100026888 | 3300005445 | Bacteria | 4930 |
| 82 | Ga0070708_100083951 | 3300005445 | Bacteria | 2889 |
| 83 | Ga0070708_100238026 | 3300005445 | Bacteria | 1709 |
| 84 | Ga0070708_100303382 | 3300005445 | Bacteria | 1504 |
| 85 | Ga0070663_100256353 | 3300005455 | Bacteria | 1386 |
| 86 | Ga0070678_100061326 | 3300005456 | Bacteria | 2771 |
| 87 | Ga0070678_100254757 | 3300005456 | Bacteria | 1473 |
| 88 | Ga0070662_100094058 | 3300005457 | Bacteria | 2256 |
| 89 | Ga0070662_100201370 | 3300005457 | Bacteria | 1580 |
| 90 | Ga0070681_10010518 | 3300005458 | Bacteria | 9136 |
| 91 | Ga0070681_10021226 | 3300005458 | Bacteria | 6507 |
| 92 | Ga0070681_10078253 | 3300005458 | Bacteria | 3264 |
| 93 | Ga0070681_10108660 | 3300005458 | Bacteria | 2714 |
| 94 | Ga0068867_100001335 | 3300005459 | Bacteria | 17077 |
| 95 | Ga0068867_100003689 | 3300005459 | Bacteria | 10776 |
| 96 | Ga0068867_100134456 | 3300005459 | Bacteria | 1926 |
| 97 | Ga0068867_100165182 | 3300005459 | Bacteria | 1749 |
| 98 | Ga0070706_100073844 | 3300005467 | Bacteria | 3157 |
| 99 | Ga0070706_100078254 | 3300005467 | Bacteria | 3062 |
| 100 | Ga0070707_100018938 | 3300005468 | Bacteria | 6483 |
| 101 | Ga0070707_100037794 | 3300005468 | Bacteria | 4610 |
| 102 | Ga0070707_100274545 | 3300005468 | Bacteria | 1639 |
| 103 | Ga0070707_100317232 | 3300005468 | Bacteria | 1515 |
| 104 | Ga0070698_100005791 | 3300005471 | Bacteria | 13518 |
| 105 | Ga0070698_100137973 | 3300005471 | Bacteria | 2392 |
| 106 | Ga0070699_100003010 | 3300005518 | Bacteria | 14968 |
| 107 | Ga0070699_100006362 | 3300005518 | Bacteria | 10297 |
| 108 | Ga0070699_100006895 | 3300005518 | Bacteria | 9881 |
| 109 | Ga0070699_100042885 | 3300005518 | Bacteria | 3916 |
| 110 | Ga0070699_100381209 | 3300005518 | Bacteria | 1273 |
| 111 | Ga0070679_100064153 | 3300005530 | Bacteria | 3661 |
| 112 | Ga0070679_100113499 | 3300005530 | Bacteria | 2695 |
| 113 | Ga0070679_100202722 | 3300005530 | Bacteria | 1949 |
| 114 | Ga0070679_100400224 | 3300005530 | Bacteria | 1319 |
| 115 | Ga0070697_100001293 | 3300005536 | Bacteria | 18848 |
| 116 | Ga0070697_100001434 | 3300005536 | Bacteria | 18124 |
| 117 | Ga0070697_100005785 | 3300005536 | Bacteria | 9535 |
| 118 | Ga0070697_100007886 | 3300005536 | Bacteria | 8297 |
| 119 | Ga0070697_100008411 | 3300005536 | Bacteria | 8051 |
| 120 | Ga0070697_100019057 | 3300005536 | Bacteria | 5415 |
| 121 | Ga0070697_100072868 | 3300005536 | Bacteria | 2819 |
| 122 | Ga0068853_100274211 | 3300005539 | Bacteria | 1554 |
| 123 | Ga0070672_100083906 | 3300005543 | Bacteria | 2558 |
| 124 | Ga0070672_100129583 | 3300005543 | Bacteria | 2072 |
| 125 | Ga0070672_100254777 | 3300005543 | Bacteria | 1479 |
| 126 | Ga0070686_100010234 | 3300005544 | Bacteria | 5280 |
| 127 | Ga0070686_100173058 | 3300005544 | Bacteria | 1529 |
| 128 | Ga0070686_100339895 | 3300005544 | Bacteria | 1125 |
| 129 | Ga0070686_100459993 | 3300005544 | Bacteria | 980 |
| 130 | Ga0070695_100000948 | 3300005545 | Bacteria | 15745 |
| 131 | Ga0070695_100001721 | 3300005545 | Bacteria | 12312 |
| 132 | Ga0070695_100002319 | 3300005545 | Bacteria | 10916 |
| 133 | Ga0070695_100005573 | 3300005545 | Bacteria | 7415 |
| 134 | Ga0070695_100022262 | 3300005545 | Bacteria | 3886 |
| 135 | Ga0070695_100022535 | 3300005545 | Bacteria | 3864 |
| 136 | Ga0070695_100027043 | 3300005545 | Bacteria | 3552 |
| 137 | Ga0070695_100031558 | 3300005545 | Bacteria | 3306 |
| 138 | Ga0070695_100086311 | 3300005545 | Bacteria | 2085 |
| 139 | Ga0070696_100000012 | 3300005546 | Bacteria | 79388 |
| 140 | Ga0070696_100002401 | 3300005546 | Bacteria | 12400 |
| 141 | Ga0070696_100009167 | 3300005546 | Bacteria | 6624 |
| 142 | Ga0070696_100044664 | 3300005546 | Bacteria | 3068 |
| 143 | Ga0070696_100095717 | 3300005546 | Bacteria | 2121 |
| 144 | Ga0070696_100126282 | 3300005546 | Bacteria | 1856 |
| 145 | Ga0070696_100278221 | 3300005546 | Bacteria | 1275 |
| 146 | Ga0070693_100000135 | 3300005547 | Bacteria | 33350 |
| 147 | Ga0070693_100007379 | 3300005547 | Bacteria | 5372 |
| 148 | Ga0070693_100128216 | 3300005547 | Bacteria | 1582 |
| 149 | Ga0070693_100281037 | 3300005547 | Bacteria | 1115 |
| 150 | Ga0070704_100000108 | 3300005549 | Bacteria | 28920 |
| 151 | Ga0070704_100000193 | 3300005549 | Bacteria | 25011 |
| 152 | Ga0070704_100029938 | 3300005549 | Bacteria | 3641 |
| 153 | Ga0070704_100080648 | 3300005549 | Bacteria | 2394 |
| 154 | Ga0070704_100169376 | 3300005549 | Bacteria | 1735 |
| 155 | Ga0070704_100236196 | 3300005549 | Bacteria | 1494 |
| 156 | Ga0070704_100277704 | 3300005549 | Bacteria | 1386 |
| 157 | Ga0070704_100282099 | 3300005549 | Bacteria | 1377 |
| 158 | Ga0070704_100393298 | 3300005549 | Bacteria | 1181 |
| 159 | Ga0070704_100399480 | 3300005549 | Bacteria | 1172 |
| 160 | Ga0068855_100063388 | 3300005563 | Bacteria | 4313 |
| 161 | Ga0068855_100288486 | 3300005563 | Bacteria | 1820 |
| 162 | Ga0070664_100138582 | 3300005564 | Bacteria | 2141 |
| 163 | Ga0068857_100022542 | 3300005577 | Bacteria | 5541 |
| 164 | Ga0068857_100359791 | 3300005577 | Bacteria | 1349 |
| 165 | Ga0068857_100430073 | 3300005577 | Bacteria | 1232 |
| 166 | Ga0068857_100740837 | 3300005577 | Bacteria | 936 |
| 167 | Ga0068854_100001657 | 3300005578 | Bacteria | 13562 |
| 168 | Ga0068854_100407247 | 3300005578 | Bacteria | 1127 |
| 169 | Ga0068856_100332974 | 3300005614 | Bacteria | 1536 |
| 170 | Ga0068859_100003978 | 3300005617 | Bacteria | 15080 |
| 171 | Ga0068859_100006107 | 3300005617 | Bacteria | 12235 |
| 172 | Ga0068859_100007972 | 3300005617 | Bacteria | 10743 |
| 173 | Ga0068859_100021038 | 3300005617 | Bacteria | 6547 |
| 174 | Ga0068859_100099270 | 3300005617 | Bacteria | 2967 |
| 175 | Ga0068859_100383206 | 3300005617 | Bacteria | 1501 |
| 176 | Ga0068859_100432520 | 3300005617 | Bacteria | 1412 |
| 177 | Ga0068864_100149961 | 3300005618 | Bacteria | 2111 |
| 178 | Ga0068864_100381014 | 3300005618 | Bacteria | 1337 |
| 179 | Ga0068866_10009989 | 3300005718 | Bacteria | 4053 |
| 180 | Ga0068861_100000173 | 3300005719 | Bacteria | 34168 |
| 181 | Ga0068861_100019210 | 3300005719 | Bacteria | 4882 |
| 182 | Ga0068861_100113605 | 3300005719 | Bacteria | 2173 |
| 183 | Ga0068861_100131722 | 3300005719 | Bacteria | 2030 |
| 184 | Ga0068861_100424200 | 3300005719 | Bacteria | 1186 |
| 185 | Ga0068863_100126447 | 3300005841 | Bacteria | 2439 |
| 186 | Ga0068858_100001425 | 3300005842 | Bacteria | 24575 |
| 187 | Ga0068858_100136445 | 3300005842 | Bacteria | 2302 |
| 188 | Ga0068858_100161059 | 3300005842 | Bacteria | 2113 |
| 189 | Ga0068858_100228900 | 3300005842 | Bacteria | 1762 |
| 190 | Ga0068860_100001885 | 3300005843 | Bacteria | 22275 |
| 191 | Ga0068860_100060141 | 3300005843 | Bacteria | 3611 |
| 192 | Ga0068860_100554582 | 3300005843 | Bacteria | 1152 |
| 193 | Ga0068862_100000594 | 3300005844 | Bacteria | 37690 |
| 194 | Ga0068862_100004236 | 3300005844 | Bacteria | 12153 |
| 195 | Ga0081455_10000014 | 3300005937 | Bacteria | 193884 |
| 196 | Ga0081455_10007461 | 3300005937 | Bacteria | 11516 |
| 197 | Ga0081455_10017729 | 3300005937 | Bacteria | 6813 |
| 198 | Ga0081538_10027411 | 3300005981 | Bacteria | 3950 |
| 199 | Ga0081538_10048592 | 3300005981 | Bacteria | 2585 |
| 200 | Ga0081540_1000035 | 3300005983 | Bacteria | 141244 |
| 201 | Ga0081540_1000878 | 3300005983 | Bacteria | 27167 |
| 202 | Ga0081539_10000462 | 3300005985 | Bacteria | 86060 |
| 203 | Ga0081539_10001341 | 3300005985 | Bacteria | 42889 |
| 204 | Ga0070717_10424093 | 3300006028 | Bacteria | 1197 |
| 205 | Ga0070717_10463418 | 3300006028 | Bacteria | 1143 |
| 206 | Ga0075365_10011758 | 3300006038 | Bacteria | 5162 |
| 207 | Ga0075368_10003743 | 3300006042 | Bacteria | 5105 |
| 208 | Ga0075368_10012309 | 3300006042 | Bacteria | 3124 |
| 209 | Ga0075363_100030177 | 3300006048 | Bacteria | 2804 |
| 210 | Ga0075363_100052945 | 3300006048 | Bacteria | 2167 |
| 211 | Ga0075432_10041440 | 3300006058 | Bacteria | 1609 |
| 212 | Ga0070715_10083343 | 3300006163 | Bacteria | 1456 |
| 213 | Ga0070716_100078136 | 3300006173 | Bacteria | 1967 |
| 214 | Ga0070716_100231393 | 3300006173 | Bacteria | 1248 |
| 215 | Ga0070712_100006640 | 3300006175 | Bacteria | 7192 |
| 216 | Ga0070712_100057102 | 3300006175 | Bacteria | 2741 |
| 217 | Ga0075362_10078884 | 3300006177 | Bacteria | 1515 |
| 218 | Ga0075367_10028637 | 3300006178 | Bacteria | 3179 |
| 219 | Ga0075367_10040940 | 3300006178 | Bacteria | 2706 |
| 220 | Ga0075367_10208319 | 3300006178 | Bacteria | 1222 |
| 221 | Ga0097621_100000939 | 3300006237 | Bacteria | 20422 |
| 222 | Ga0075370_10033514 | 3300006353 | Bacteria | 2876 |
| 223 | Ga0068871_100000370 | 3300006358 | Bacteria | 31403 |
| 224 | Ga0068871_100080962 | 3300006358 | Bacteria | 2689 |
| 225 | Ga0075428_100000446 | 3300006844 | Bacteria | 41165 |
| 226 | Ga0075428_100001232 | 3300006844 | Bacteria | 27372 |
| 227 | Ga0075428_100009146 | 3300006844 | Bacteria | 10994 |
| 228 | Ga0075428_100018652 | 3300006844 | Bacteria | 7669 |
| 229 | Ga0075428_100019802 | 3300006844 | Bacteria | 7447 |
| 230 | Ga0075428_100022052 | 3300006844 | Bacteria | 7050 |
| 231 | Ga0075428_100044588 | 3300006844 | Bacteria | 4873 |
| 232 | Ga0075428_100223503 | 3300006844 | Bacteria | 2033 |
| 233 | Ga0075428_100535990 | 3300006844 | Bacteria | 1252 |
| 234 | Ga0075428_100653210 | 3300006844 | Bacteria | 1121 |
| 235 | Ga0075430_100006952 | 3300006846 | Bacteria | 9540 |
| 236 | Ga0075430_100010982 | 3300006846 | Bacteria | 7671 |
| 237 | Ga0075430_100048016 | 3300006846 | Bacteria | 3605 |
| 238 | Ga0075430_100307408 | 3300006846 | Bacteria | 1311 |
| 239 | Ga0075430_100349174 | 3300006846 | Bacteria | 1222 |
| 240 | Ga0075431_100000586 | 3300006847 | Bacteria | 30900 |
| 241 | Ga0075431_100002204 | 3300006847 | Bacteria | 18653 |
| 242 | Ga0075431_100006333 | 3300006847 | Bacteria | 11758 |
| 243 | Ga0075431_100023814 | 3300006847 | Bacteria | 6267 |
| 244 | Ga0075431_100100743 | 3300006847 | Bacteria | 2981 |
| 245 | Ga0075431_100150402 | 3300006847 | Bacteria | 2397 |
| 246 | Ga0075431_100155138 | 3300006847 | Bacteria | 2356 |
| 247 | Ga0075431_100204579 | 3300006847 | Bacteria | 2019 |
| 248 | Ga0075433_10001281 | 3300006852 | Bacteria | 18351 |
| 249 | Ga0075433_10006995 | 3300006852 | Bacteria | 8944 |
| 250 | Ga0075433_10033836 | 3300006852 | Bacteria | 4384 |
| 251 | Ga0075433_10119236 | 3300006852 | Bacteria | 2342 |
| 252 | Ga0075434_100001574 | 3300006871 | Bacteria | 19334 |
| 253 | Ga0075434_100002685 | 3300006871 | Bacteria | 15706 |
| 254 | Ga0075434_100053555 | 3300006871 | Bacteria | 4009 |
| 255 | Ga0075434_100082740 | 3300006871 | Bacteria | 3207 |
| 256 | Ga0075434_100093341 | 3300006871 | Bacteria | 3013 |
| 257 | Ga0075434_100104025 | 3300006871 | Bacteria | 2848 |
| 258 | Ga0075434_100577052 | 3300006871 | Bacteria | 1144 |
| 259 | Ga0075429_100000259 | 3300006880 | Bacteria | 36776 |
| 260 | Ga0075429_100000922 | 3300006880 | Bacteria | 23290 |
| 261 | Ga0075429_100002976 | 3300006880 | Bacteria | 14374 |
| 262 | Ga0068865_100007455 | 3300006881 | Bacteria | 6733 |
| 263 | Ga0068865_100017764 | 3300006881 | Bacteria | 4579 |
| 264 | Ga0068865_100020281 | 3300006881 | Bacteria | 4311 |
| 265 | Ga0075436_100001357 | 3300006914 | Bacteria | 16645 |
| 266 | Ga0075436_100006485 | 3300006914 | Bacteria | 8017 |
| 267 | Ga0075436_100142454 | 3300006914 | Bacteria | 1685 |
| 268 | Ga0075436_100204923 | 3300006914 | Bacteria | 1397 |
| 269 | Ga0075436_100210584 | 3300006914 | Bacteria | 1378 |
| 270 | Ga0075436_100284425 | 3300006914 | Bacteria | 1183 |
| 271 | Ga0097620_100003978 | 3300006931 | Bacteria | 15080 |
| 272 | Ga0097620_100006104 | 3300006931 | Bacteria | 12235 |
| 273 | Ga0097620_100007972 | 3300006931 | Bacteria | 10743 |
| 274 | Ga0097620_100021038 | 3300006931 | Bacteria | 6547 |
| 275 | Ga0097620_100099264 | 3300006931 | Bacteria | 2967 |
| 276 | Ga0097620_100383240 | 3300006931 | Bacteria | 1501 |
| 277 | Ga0097620_100432525 | 3300006931 | Bacteria | 1412 |
| 278 | Ga0075435_100000047 | 3300007076 | Bacteria | 60782 |
| 279 | Ga0075435_100017237 | 3300007076 | Bacteria | 5462 |
| 280 | Ga0075435_100256335 | 3300007076 | Bacteria | 1490 |
| 281 | Ga0099794_10059969 | 3300007265 | Bacteria | 1847 |
| 282 | Ga0099794_10158993 | 3300007265 | Bacteria | 1149 |
| 283 | Ga0105240_10394231 | 3300009093 | Bacteria | 1561 |
| 284 | Ga0111539_10003844 | 3300009094 | Bacteria | 19777 |
| 285 | Ga0111539_10011877 | 3300009094 | Bacteria | 10916 |
| 286 | Ga0111539_10031418 | 3300009094 | Bacteria | 6451 |
| 287 | Ga0111539_10034785 | 3300009094 | Bacteria | 6104 |
| 288 | Ga0111539_10086334 | 3300009094 | Bacteria | 3687 |
| 289 | Ga0111539_10291090 | 3300009094 | Bacteria | 1900 |
| 290 | Ga0111539_10354182 | 3300009094 | Bacteria | 1708 |
| 291 | Ga0111539_10405491 | 3300009094 | Bacteria | 1588 |
| 292 | Ga0111539_10663496 | 3300009094 | Bacteria | 1214 |
| 293 | Ga0105245_10007041 | 3300009098 | Bacteria | 9866 |
| 294 | Ga0105245_10012980 | 3300009098 | Bacteria | 7260 |
| 295 | Ga0105245_10075077 | 3300009098 | Bacteria | 3077 |
| 296 | Ga0105247_10112872 | 3300009101 | Bacteria | 1751 |
| 297 | Ga0114129_10000068 | 3300009147 | Bacteria | 93579 |
| 298 | Ga0114129_10000430 | 3300009147 | Bacteria | 49930 |
| 299 | Ga0114129_10000703 | 3300009147 | Bacteria | 42137 |
| 300 | Ga0114129_10002359 | 3300009147 | Bacteria | 26209 |
| 301 | Ga0114129_10020013 | 3300009147 | Bacteria | 9525 |
| 302 | Ga0114129_10020418 | 3300009147 | Bacteria | 9421 |
| 303 | Ga0114129_10074037 | 3300009147 | Bacteria | 4744 |
| 304 | Ga0114129_10164336 | 3300009147 | Bacteria | 3030 |
| 305 | Ga0114129_10915868 | 3300009147 | Bacteria | 1110 |
| 306 | Ga0105243_10000708 | 3300009148 | Bacteria | 32162 |
| 307 | Ga0105243_10043929 | 3300009148 | Bacteria | 3504 |
| 308 | Ga0105243_10444606 | 3300009148 | Bacteria | 1215 |
| 309 | Ga0105241_10092438 | 3300009174 | Bacteria | 2389 |
| 310 | Ga0105241_10122645 | 3300009174 | Bacteria | 2095 |
| 311 | Ga0105242_10041789 | 3300009176 | Bacteria | 3700 |
| 312 | Ga0105242_10258302 | 3300009176 | Bacteria | 1573 |
| 313 | Ga0105248_10114457 | 3300009177 | Bacteria | 3042 |
| 314 | Ga0105248_10368233 | 3300009177 | Bacteria | 1618 |
| 315 | Ga0105237_10029142 | 3300009545 | Bacteria | 5615 |
| 316 | Ga0105237_10037012 | 3300009545 | Bacteria | 4934 |
| 317 | Ga0105238_10341110 | 3300009551 | Bacteria | 1486 |
| 318 | Ga0105249_10000599 | 3300009553 | Bacteria | 32843 |
| 319 | Ga0105249_10002072 | 3300009553 | Bacteria | 17373 |
| 320 | Ga0105249_10131152 | 3300009553 | Bacteria | 2393 |
| 321 | Ga0105249_10603595 | 3300009553 | Bacteria | 1152 |
| 322 | Ga0099796_10028306 | 3300010159 | Bacteria | 1798 |
| 323 | Ga0105239_10036817 | 3300010375 | Bacteria | 5368 |
| 324 | Ga0105239_10242555 | 3300010375 | Bacteria | 2023 |
| 325 | Ga0105246_10136796 | 3300011119 | Bacteria | 1837 |
| 326 | Ga0157369_10217554 | 3300013105 | Bacteria | 2000 |
| 327 | Ga0157378_10006229 | 3300013297 | Bacteria | 10445 |
| 328 | Ga0157378_10422905 | 3300013297 | Bacteria | 1317 |
| 329 | Ga0157378_10491426 | 3300013297 | Bacteria | 1224 |
| 330 | Ga0163162_10018668 | 3300013306 | Bacteria | 6794 |
| 331 | Ga0163162_10333214 | 3300013306 | Bacteria | 1650 |
| 332 | Ga0163162_10436895 | 3300013306 | Bacteria | 1441 |
| 333 | Ga0163162_10494459 | 3300013306 | Bacteria | 1354 |
| 334 | Ga0157372_10202758 | 3300013307 | Bacteria | 2298 |
| 335 | Ga0157375_10444959 | 3300013308 | Bacteria | 1461 |
| 336 | Ga0157375_10516832 | 3300013308 | Bacteria | 1357 |
| 337 | Ga0163163_10001948 | 3300014325 | Bacteria | 17455 |
| 338 | Ga0163163_10609142 | 3300014325 | Bacteria | 1155 |
| 339 | Ga0157380_10270015 | 3300014326 | Bacteria | 1550 |
| 340 | Ga0157380_10305790 | 3300014326 | Bacteria | 1467 |
| 341 | Ga0157380_10463956 | 3300014326 | Bacteria | 1220 |
| 342 | Ga0157377_10101288 | 3300014745 | Bacteria | 1717 |
| 343 | Ga0157379_10441317 | 3300014968 | Bacteria | 1200 |
| 344 | Ga0157376_10011568 | 3300014969 | Bacteria | 6512 |
| 345 | Ga0157376_10059518 | 3300014969 | Bacteria | 3203 |
| 346 | Ga0213873_10024658 | 3300021358 | Bacteria | 1445 |
| 347 | Ga0213874_10011204 | 3300021377 | Bacteria | 2265 |
| 348 | Ga0213876_10000816 | 3300021384 | Bacteria | 21075 |
| 349 | Ga0213876_10000944 | 3300021384 | Bacteria | 19157 |
| 350 | Ga0213876_10084059 | 3300021384 | Bacteria | 1684 |
| 351 | Ga0213875_10000003 | 3300021388 | Bacteria | 719367 |
| 352 | Ga0213875_10001075 | 3300021388 | Bacteria | 19135 |
| 353 | Ga0213875_10012486 | 3300021388 | Bacteria | 4193 |
| 354 | Ga0213875_10016470 | 3300021388 | Bacteria | 3583 |
| 355 | Ga0213875_10034599 | 3300021388 | Bacteria | 2386 |
| 356 | Ga0207653_10001145 | 3300025885 | Bacteria | 8692 |
| 357 | Ga0207682_10002103 | 3300025893 | Bacteria | 9019 |
| 358 | Ga0207692_10195460 | 3300025898 | Bacteria | 1186 |
| 359 | Ga0207642_10005920 | 3300025899 | Bacteria | 4029 |
| 360 | Ga0207642_10018611 | 3300025899 | Bacteria | 2670 |
| 361 | Ga0207710_10024128 | 3300025900 | Bacteria | 2617 |
| 362 | Ga0207688_10016496 | 3300025901 | Bacteria | 4006 |
| 363 | Ga0207645_10045314 | 3300025907 | Bacteria | 2811 |
| 364 | Ga0207684_10004520 | 3300025910 | Bacteria | 13068 |
| 365 | Ga0207654_10035292 | 3300025911 | Bacteria | 2785 |
| 366 | Ga0207654_10089196 | 3300025911 | Bacteria | 1875 |
| 367 | Ga0207707_10001852 | 3300025912 | Bacteria | 19339 |
| 368 | Ga0207707_10010205 | 3300025912 | Bacteria | 8153 |
| 369 | Ga0207707_10064689 | 3300025912 | Bacteria | 3184 |
| 370 | Ga0207671_10030628 | 3300025914 | Bacteria | 4011 |
| 371 | Ga0207693_10003608 | 3300025915 | Bacteria | 13212 |
| 372 | Ga0207693_10013129 | 3300025915 | Bacteria | 6682 |
| 373 | Ga0207693_10052856 | 3300025915 | Bacteria | 3187 |
| 374 | Ga0207662_10000639 | 3300025918 | Bacteria | 15770 |
| 375 | Ga0207662_10010145 | 3300025918 | Bacteria | 5193 |
| 376 | Ga0207662_10044570 | 3300025918 | Bacteria | 2619 |
| 377 | Ga0207652_10159637 | 3300025921 | Bacteria | 2021 |
| 378 | Ga0207652_10180287 | 3300025921 | Bacteria | 1898 |
| 379 | Ga0207652_10187492 | 3300025921 | Bacteria | 1860 |
| 380 | Ga0207646_10003037 | 3300025922 | Bacteria | 19308 |
| 381 | Ga0207646_10065719 | 3300025922 | Bacteria | 3238 |
| 382 | Ga0207646_10176822 | 3300025922 | Bacteria | 1928 |
| 383 | Ga0207681_10002455 | 3300025923 | Bacteria | 11755 |
| 384 | Ga0207681_10404072 | 3300025923 | Bacteria | 1104 |
| 385 | Ga0207694_10237511 | 3300025924 | Bacteria | 1489 |
| 386 | Ga0207650_10246261 | 3300025925 | Bacteria | 1446 |
| 387 | Ga0207659_10189264 | 3300025926 | Bacteria | 1637 |
| 388 | Ga0207687_10003950 | 3300025927 | Bacteria | 9932 |
| 389 | Ga0207687_10016484 | 3300025927 | Bacteria | 4853 |
| 390 | Ga0207687_10184012 | 3300025927 | Bacteria | 1620 |
| 391 | Ga0207664_10331786 | 3300025929 | Bacteria | 1344 |
| 392 | Ga0207644_10072069 | 3300025931 | Bacteria | 2529 |
| 393 | Ga0207706_10040460 | 3300025933 | Bacteria | 4131 |
| 394 | Ga0207706_10080777 | 3300025933 | Bacteria | 2858 |
| 395 | Ga0207706_10149150 | 3300025933 | Bacteria | 2057 |
| 396 | Ga0207686_10006692 | 3300025934 | Bacteria | 6211 |
| 397 | Ga0207686_10064621 | 3300025934 | Bacteria | 2331 |
| 398 | Ga0207709_10036753 | 3300025935 | Bacteria | 2904 |
| 399 | Ga0207709_10049360 | 3300025935 | Bacteria | 2568 |
| 400 | Ga0207709_10225211 | 3300025935 | Bacteria | 1355 |
| 401 | Ga0207709_10234795 | 3300025935 | Bacteria | 1330 |
| 402 | Ga0207670_10185603 | 3300025936 | Bacteria | 1569 |
| 403 | Ga0207669_10043433 | 3300025937 | Bacteria | 2632 |
| 404 | Ga0207704_10007060 | 3300025938 | Bacteria | 5280 |
| 405 | Ga0207704_10460629 | 3300025938 | Bacteria | 1017 |
| 406 | Ga0207665_10136272 | 3300025939 | Bacteria | 1747 |
| 407 | Ga0207691_10059780 | 3300025940 | Bacteria | 3464 |
| 408 | Ga0207691_10081129 | 3300025940 | Bacteria | 2916 |
| 409 | Ga0207691_10119619 | 3300025940 | Bacteria | 2336 |
| 410 | Ga0207711_10097521 | 3300025941 | Bacteria | 2595 |
| 411 | Ga0207711_10411394 | 3300025941 | Bacteria | 1257 |
| 412 | Ga0207689_10007163 | 3300025942 | Bacteria | 9806 |
| 413 | Ga0207689_10036449 | 3300025942 | Bacteria | 4083 |
| 414 | Ga0207689_10097726 | 3300025942 | Bacteria | 2412 |
| 415 | Ga0207661_10219910 | 3300025944 | Bacteria | 1678 |
| 416 | Ga0207679_10016081 | 3300025945 | Bacteria | 4961 |
| 417 | Ga0207667_10033944 | 3300025949 | Bacteria | 5481 |
| 418 | Ga0207667_10054565 | 3300025949 | Bacteria | 4203 |
| 419 | Ga0207651_10195438 | 3300025960 | Bacteria | 1617 |
| 420 | Ga0207712_10003113 | 3300025961 | Bacteria | 10584 |
| 421 | Ga0207712_10003418 | 3300025961 | Bacteria | 10034 |
| 422 | Ga0207712_10217206 | 3300025961 | Bacteria | 1526 |
| 423 | Ga0207712_10244082 | 3300025961 | Bacteria | 1448 |
| 424 | Ga0207668_10087785 | 3300025972 | Bacteria | 2276 |
| 425 | Ga0207640_10014585 | 3300025981 | Bacteria | 4528 |
| 426 | Ga0207640_10287323 | 3300025981 | Bacteria | 1295 |
| 427 | Ga0207658_10106231 | 3300025986 | Bacteria | 2210 |
| 428 | Ga0207677_10029879 | 3300026023 | Bacteria | 3470 |
| 429 | Ga0207703_10013352 | 3300026035 | Bacteria | 6400 |
| 430 | Ga0207703_10055811 | 3300026035 | Bacteria | 3214 |
| 431 | Ga0207703_10084896 | 3300026035 | Bacteria | 2649 |
| 432 | Ga0207703_10136321 | 3300026035 | Bacteria | 2125 |
| 433 | Ga0207703_10278628 | 3300026035 | Bacteria | 1518 |
| 434 | Ga0207703_10680861 | 3300026035 | Bacteria | 977 |
| 435 | Ga0207639_10004290 | 3300026041 | Bacteria | 9612 |
| 436 | Ga0207639_10569432 | 3300026041 | Bacteria | 1042 |
| 437 | Ga0207678_10003276 | 3300026067 | Bacteria | 14615 |
| 438 | Ga0207708_10000142 | 3300026075 | Bacteria | 56900 |
| 439 | Ga0207708_10000153 | 3300026075 | Bacteria | 54987 |
| 440 | Ga0207708_10001509 | 3300026075 | Bacteria | 17351 |
| 441 | Ga0207708_10026481 | 3300026075 | Bacteria | 4389 |
| 442 | Ga0207708_10050676 | 3300026075 | Bacteria | 3160 |
| 443 | Ga0207708_10070975 | 3300026075 | Bacteria | 2667 |
| 444 | Ga0207708_10296444 | 3300026075 | Bacteria | 1314 |
| 445 | Ga0207708_10345084 | 3300026075 | Bacteria | 1220 |
| 446 | Ga0207702_10192198 | 3300026078 | Bacteria | 1887 |
| 447 | Ga0207641_10075539 | 3300026088 | Bacteria | 2910 |
| 448 | Ga0207641_10720362 | 3300026088 | Bacteria | 983 |
| 449 | Ga0207648_10000130 | 3300026089 | Bacteria | 74342 |
| 450 | Ga0207648_10003264 | 3300026089 | Bacteria | 17048 |
| 451 | Ga0207648_10081281 | 3300026089 | Bacteria | 2826 |
| 452 | Ga0207676_10008709 | 3300026095 | Bacteria | 7216 |
| 453 | Ga0207676_10203923 | 3300026095 | Bacteria | 1749 |
| 454 | Ga0207674_10008447 | 3300026116 | Bacteria | 11892 |
| 455 | Ga0207674_10014574 | 3300026116 | Bacteria | 8676 |
| 456 | Ga0207674_10147265 | 3300026116 | Bacteria | 2313 |
| 457 | Ga0207675_100000253 | 3300026118 | Bacteria | 51284 |
| 458 | Ga0207675_100000648 | 3300026118 | Bacteria | 34256 |
| 459 | Ga0207675_100105017 | 3300026118 | Bacteria | 2662 |
| 460 | Ga0207675_100151459 | 3300026118 | Bacteria | 2207 |
| 461 | Ga0207675_100185079 | 3300026118 | Bacteria | 1996 |
| 462 | Ga0207683_10023791 | 3300026121 | Bacteria | 5270 |
| 463 | Ga0209969_1002469 | 3300027360 | Bacteria | 2557 |
| 464 | Ga0209981_1012871 | 3300027378 | Bacteria | 1161 |
| 465 | Ga0209996_1000475 | 3300027395 | Bacteria | 4824 |
| 466 | Ga0209996_1004059 | 3300027395 | Bacteria | 1855 |
| 467 | Ga0209996_1008521 | 3300027395 | Bacteria | 1344 |
| 468 | Ga0210000_1001307 | 3300027462 | Bacteria | 3509 |
| 469 | Ga0210000_1001320 | 3300027462 | Bacteria | 3499 |
| 470 | Ga0209995_1005928 | 3300027471 | Bacteria | 1967 |
| 471 | Ga0209968_1001005 | 3300027526 | Bacteria | 4335 |
| 472 | Ga0209968_1005706 | 3300027526 | Bacteria | 1870 |
| 473 | Ga0209968_1015897 | 3300027526 | Bacteria | 1193 |
| 474 | Ga0209999_1008492 | 3300027543 | Bacteria | 1853 |
| 475 | Ga0209983_1000380 | 3300027665 | Bacteria | 9453 |
| 476 | Ga0209971_1000228 | 3300027682 | Bacteria | 16409 |
| 477 | Ga0209971_1006441 | 3300027682 | Bacteria | 2775 |
| 478 | Ga0209966_1000098 | 3300027695 | Bacteria | 38805 |
| 479 | Ga0209998_10000125 | 3300027717 | Bacteria | 29964 |
| 480 | Ga0209813_10006973 | 3300027866 | Bacteria | 2804 |
| 481 | Ga0209813_10035293 | 3300027866 | Bacteria | 1497 |
| 482 | Ga0209974_10004008 | 3300027876 | Bacteria | 5265 |
| 483 | Ga0207428_10000721 | 3300027907 | Bacteria | 38142 |
| 484 | Ga0207428_10012105 | 3300027907 | Bacteria | 7591 |
| 485 | Ga0207428_10209626 | 3300027907 | Bacteria | 1464 |
| 486 | Ga0268265_10000627 | 3300028380 | Bacteria | 35202 |
| 487 | Ga0268265_10000885 | 3300028380 | Bacteria | 28020 |
| 488 | Ga0268265_10000939 | 3300028380 | Bacteria | 26819 |
| 489 | Ga0268265_10006592 | 3300028380 | Bacteria | 7858 |
| 490 | Ga0268265_10012099 | 3300028380 | Bacteria | 5843 |
| 491 | Ga0268265_10200165 | 3300028380 | Bacteria | 1732 |
| 492 | Ga0268264_10001246 | 3300028381 | Bacteria | 24277 |
| 493 | Ga0268264_10047794 | 3300028381 | Bacteria | 3558 |
| 494 | Ga0268264_10245600 | 3300028381 | Bacteria | 1660 |
| 495 | Ga0268264_10249517 | 3300028381 | Bacteria | 1648 |
| 496 | Ga0265338_10288882 | 3300028800 | Bacteria | 1196 |
| 497 | Ga0265330_10032768 | 3300031235 | Bacteria | 2327 |
| 498 | Ga0265320_10038673 | 3300031240 | Bacteria | 2391 |
| 499 | Ga0265329_10038528 | 3300031242 | Bacteria | 1537 |
| 500 | Ga0265339_10041981 | 3300031249 | Bacteria | 2534 |
| 501 | Ga0265316_10019986 | 3300031344 | Bacteria | 5712 |
| 502 | Ga0265316_10045361 | 3300031344 | Bacteria | 3490 |
| 503 | Ga0307408_100070265 | 3300031548 | Bacteria | 2585 |
| 504 | Ga0316575_10014633 | 3300031665 | Bacteria | 2949 |
| 505 | Ga0316575_10020135 | 3300031665 | Bacteria | 2558 |
| 506 | Ga0265342_10025824 | 3300031712 | Bacteria | 3687 |
| 507 | Ga0265342_10027031 | 3300031712 | Bacteria | 3592 |
| 508 | Ga0307416_100047257 | 3300032002 | Bacteria | 3405 |
| 509 | Ga0307414_10360773 | 3300032004 | Bacteria | 1250 |
| 510 | Ga0373950_0015439 | 3300034818 | Bacteria | 1295 |
| 511 | Ga0373938_0009918 | 3300034957 | Bacteria | 1736 |
| 512 | Ga0373926_0000320 | 3300035083 | Bacteria | 11963 |
| 513 | Ga0373926_0002880 | 3300035083 | Bacteria | 5512 |
| 514 | Ga0373940_0008635 | 3300035088 | Bacteria | 2345 |
| 515 | Ga0373944_0007777 | 3300035089 | Bacteria | 2881 |
| 516 | Ga0373952_0008135 | 3300035092 | Bacteria | 1983 |
| 517 | Ga0373923_0015997 | 3300035111 | Bacteria | 2841 |
| 518 | Ga0373932_0019320 | 3300035112 | Bacteria | 1775 |
| 519 | Ga0373936_0013035 | 3300035113 | Bacteria | 3170 |
| 520 | Ga0373936_0037929 | 3300035113 | Bacteria | 1926 |
| 521 | Ga0373941_0009738 | 3300035115 | Bacteria | 2428 |
| 522 | Ga0373945_0002043 | 3300035116 | Bacteria | 6277 |
| 523 | Ga0373945_0012081 | 3300035116 | Bacteria | 2863 |
| 524 | Ga0373954_0032281 | 3300035118 | Bacteria | 2420 |
| 525 | Ga0373956_0032314 | 3300035119 | Bacteria | 2296 |
| 526 | Ga0373957_0068681 | 3300035120 | Bacteria | 1383 |
| 527 | Ga0373960_0010649 | 3300035121 | Bacteria | 2250 |
| 528 | Ga0373943_0000424 | 3300035170 | Bacteria | 17836 |
| 529 | Ga0373943_0006382 | 3300035170 | Bacteria | 5298 |
| 530 | Ga0373943_0028636 | 3300035170 | Bacteria | 2626 |
| 531 | Ga0373946_0003275 | 3300035171 | Bacteria | 5751 |
| 532 | Ga0373946_0006545 | 3300035171 | Bacteria | 4227 |
| 533 | Ga0373946_0020065 | 3300035171 | Bacteria | 2580 |
| 534 | Ga0373955_0039290 | 3300035172 | Bacteria | 2525 |
| 535 | Ga0373955_0310029 | 3300035172 | Bacteria | 953 |
| 536 | Ga0373962_0048074 | 3300035242 | Bacteria | 1222 |
| 537 | Ga0316574_0004412 | 3300035398 | Bacteria | 7366 |
| 538 | Ga0373931_0000207 | 3300035691 | Bacteria | 25079 |
| 539 | Ga0373931_0002172 | 3300035691 | Bacteria | 8643 |
| 540 | Ga0373931_0027600 | 3300035691 | Bacteria | 2899 |
| 541 | Ga0373931_0094053 | 3300035691 | Bacteria | 1675 |
| 542 | Ga0373931_0096222 | 3300035691 | Bacteria | 1658 |
| 543 | Ga0373931_0152554 | 3300035691 | Bacteria | 1348 |
| 544 | Ga0373931_0273544 | 3300035691 | Bacteria | 1035 |
| 545 | Ga0373935_0000882 | 3300035692 | Bacteria | 16207 |
| 546 | Ga0373935_0002678 | 3300035692 | Bacteria | 10245 |
| 547 | Ga0373935_0006454 | 3300035692 | Bacteria | 7002 |
| 548 | Ga0373935_0009918 | 3300035692 | Bacteria | 5707 |
| 549 | Ga0373927_0000414 | 3300035695 | Bacteria | 32784 |
| 550 | Ga0373927_0006828 | 3300035695 | Bacteria | 7767 |
| 551 | Ga0373927_0025829 | 3300035695 | Bacteria | 3839 |
| 552 | Ga0373927_0098409 | 3300035695 | Bacteria | 1902 |
| 553 | Ga0373927_0149233 | 3300035695 | Bacteria | 1531 |
| 554 | Ga0373933_0008780 | 3300035724 | Bacteria | 5510 |
| 555 | Ga0373933_0123375 | 3300035724 | Bacteria | 1624 |
| 556 | Ga0373947_0000275 | 3300035725 | Bacteria | 29242 |
| 557 | Ga0373947_0007039 | 3300035725 | Bacteria | 6519 |
| 558 | Ga0373947_0017419 | 3300035725 | Bacteria | 4132 |
| 559 | Ga0373947_0066277 | 3300035725 | Bacteria | 2204 |
| 560 | Ga0373937_0108121 | 3300036401 | Bacteria | 2586 |
| 561 | Ga0373937_0134761 | 3300036401 | Bacteria | 2308 |
| 562 | Ga0373937_0394453 | 3300036401 | Bacteria | 1313 |
| 563 | Ga0373925_0002725 | 3300037068 | Bacteria | 13982 |
| 564 | Ga0373925_0014839 | 3300037068 | Bacteria | 5630 |
| 565 | Ga0373925_0087640 | 3300037068 | Bacteria | 2376 |
| 566 | Ga0373925_0109429 | 3300037068 | Bacteria | 2133 |
| 567 | Ga0395905_0537467 | 3300037471 | Bacteria | 1070 |
| 568 | Ga0316581_0006661 | 3300037588 | Bacteria | 3068 |
| 569 | Ga0436364_0147453 | 3300037853 | Bacteria | 11701 |
| 570 | Ga0436364_0162358 | 3300037853 | Bacteria | 4611 |
| 571 | Ga0436364_0676530 | 3300037853 | Bacteria | 1157 |
| 572 | Ga0436364_0685371 | 3300037853 | Bacteria | 68284 |
| 573 | Ga0436364_0700611 | 3300037853 | Bacteria | 2954 |
| 574 | Ga0436364_0705174 | 3300037853 | Bacteria | 16891 |
| 575 | Ga0436364_0760962 | 3300037853 | Bacteria | 28778 |
| 576 | Ga0436364_1082407 | 3300037853 | Bacteria | 7015 |
| 577 | Ga0436364_1114716 | 3300037853 | Bacteria | 3092 |
| 578 | Ga0436365_0159339 | 3300039437 | Bacteria | 58353 |
| 579 | Ga0436365_0736793 | 3300039437 | Bacteria | 96466 |
| 580 | Ga0436365_1308054 | 3300039437 | Bacteria | 2450 |
| 581 | Ga0436365_1837194 | 3300039437 | Bacteria | 2771 |
| 582 | Ga0436365_1892164 | 3300039437 | Bacteria | 4736 |
| 583 | Ga0436360_0404169 | 3300039438 | Bacteria | 1139 |
| 584 | Ga0436360_0886479 | 3300039438 | Bacteria | 1593 |
| 585 | Ga0436361_0847532 | 3300039447 | Bacteria | 980 |
| 586 | Ga0436363_0313348 | 3300039450 | Bacteria | 32729 |
| 587 | Ga0436363_1475436 | 3300039450 | Bacteria | 11441 |
| 588 | Ga0436362_1056133 | 3300039453 | Bacteria | 1577 |
| 589 | Ga0436362_1066130 | 3300039453 | Bacteria | 5116 |
| 590 | Ga0436362_1124287 | 3300039453 | Bacteria | 1131 |
| 591 | Ga0439461_0030608 | 3300041410 | Bacteria | 1120 |
| 592 | Ga0439441_001670 | 3300042001 | Bacteria | 2973 |
| 593 | Ga0439441_002598 | 3300042001 | Bacteria | 2561 |
| 594 | Ga0439443_002737 | 3300042003 | Bacteria | 2144 |
| 595 | Ga0439450_012023 | 3300042008 | Bacteria | 1709 |
| 596 | Ga0439446_0004940 | 3300042156 | Bacteria | 3408 |
| 597 | Ga0439434_0003115 | 3300042435 | Bacteria | 4874 |
| 598 | Ga0439434_0038426 | 3300042435 | Bacteria | 1467 |
| 599 | Ga0439434_0056815 | 3300042435 | Bacteria | 1219 |
| 600 | Ga0439435_0004837 | 3300042436 | Bacteria | 2925 |
| 601 | Ga0439444_0001275 | 3300042437 | Bacteria | 3213 |
| 602 | Ga0439459_0008227 | 3300042438 | Bacteria | 1778 |
| 603 | Ga0439464_0020595 | 3300042439 | Bacteria | 1806 |
| 604 | Ga0439464_0056003 | 3300042439 | Bacteria | 1148 |
| 605 | Ga0439460_0001552 | 3300042461 | Bacteria | 5415 |
| 606 | Ga0439460_0018435 | 3300042461 | Bacteria | 1880 |
| 607 | Ga0451577_0204639 | 3300042876 | Bacteria | 1782 |
| 608 | Ga0451577_0300010 | 3300042876 | Bacteria | 1456 |
| 609 | Ga0451577_0343975 | 3300042876 | Bacteria | 1353 |
| 610 | Ga0439440_0013406 | 3300042993 | Bacteria | 1758 |
| 611 | Ga0453683_0025310 | 3300044673 | Bacteria | 3772 |
| 612 | Ga0453684_0024772 | 3300044712 | Bacteria | 8747 |
| 613 | Ga0451576_0030558 | 3300045051 | Bacteria | 5756 |
| 614 | Ga0451576_0031269 | 3300045051 | Bacteria | 5678 |
| 615 | Ga0451576_0034448 | 3300045051 | Bacteria | 5378 |
| 616 | Ga0451576_0035065 | 3300045051 | Bacteria | 5324 |
| 617 | Ga0451576_0253503 | 3300045051 | Bacteria | 1839 |
| 618 | Ga0451576_0536241 | 3300045051 | Bacteria | 1229 |
| 619 | Ga0466967_0251474 | 3300045976 | Bacteria | 1688 |
| 620 | Ga0495603_0028409 | 3300046455 | Bacteria | 3373 |
| 621 | Ga0495603_0244401 | 3300046455 | Bacteria | 1034 |
| 622 | Ga0495629_0170376 | 3300046459 | Bacteria | 1511 |
| 623 | Ga0495653_0057546 | 3300046463 | Bacteria | 2958 |
| 624 | Ga0495653_0058032 | 3300046463 | Bacteria | 2943 |
| 625 | Ga0495653_0233476 | 3300046463 | Bacteria | 1230 |
| 626 | Ga0495580_0001270 | 3300046472 | Bacteria | 22269 |
| 627 | Ga0495580_0058049 | 3300046472 | Bacteria | 2723 |
| 628 | Ga0495662_0000261 | 3300046476 | Bacteria | 22323 |
| 629 | Ga0495662_0016950 | 3300046476 | Bacteria | 3525 |
| 630 | Ga0495662_0034302 | 3300046476 | Bacteria | 2450 |
| 631 | Ga0495664_0000736 | 3300046477 | Bacteria | 16729 |
| 632 | Ga0495608_0019659 | 3300046511 | Bacteria | 4646 |
| 633 | Ga0495608_0128988 | 3300046511 | Bacteria | 1619 |
| 634 | Ga0495618_0160733 | 3300046514 | Bacteria | 1432 |
| 635 | Ga0495628_0202423 | 3300046516 | Bacteria | 1495 |
| 636 | Ga0495630_0002218 | 3300046517 | Bacteria | 13534 |
| 637 | Ga0495663_0030658 | 3300046525 | Bacteria | 1595 |
| 638 | Ga0495666_0057274 | 3300046526 | Bacteria | 1866 |
| 639 | Ga0495666_0166937 | 3300046526 | Bacteria | 1019 |
| 640 | Ga0495652_0199677 | 3300046529 | Bacteria | 1519 |
| 641 | Ga0495665_0024212 | 3300046531 | Bacteria | 3261 |
| 642 | Ga0495640_0002964 | 3300046533 | Bacteria | 13677 |
| 643 | Ga0495640_0013343 | 3300046533 | Bacteria | 6244 |
| 644 | Ga0495640_0217321 | 3300046533 | Bacteria | 1206 |
| 645 | Ga0495586_0001814 | 3300046535 | Bacteria | 11645 |
| 646 | Ga0495586_0048291 | 3300046535 | Bacteria | 2299 |
| 647 | Ga0495621_0019212 | 3300046539 | Bacteria | 2229 |
| 648 | Ga0495621_0039933 | 3300046539 | Bacteria | 1643 |
| 649 | Ga0495645_0002109 | 3300046543 | Bacteria | 13497 |
| 650 | Ga0495667_0048970 | 3300046559 | Bacteria | 2790 |
| 651 | Ga0495656_0044546 | 3300046615 | Bacteria | 1869 |
| 652 | Ga0495634_0006321 | 3300046642 | Bacteria | 9017 |
| 653 | Ga0495634_0017261 | 3300046642 | Bacteria | 5153 |
| 654 | Ga0495634_0039498 | 3300046642 | Bacteria | 3213 |
| 655 | Ga0495634_0223442 | 3300046642 | Bacteria | 1161 |
| 656 | Ga0495625_0049301 | 3300046660 | Bacteria | 3028 |
| 657 | Ga0495635_0000438 | 3300046663 | Bacteria | 26330 |
| 658 | Ga0495588_0010367 | 3300046674 | Bacteria | 4334 |
| 659 | Ga0495646_0022684 | 3300046680 | Bacteria | 3957 |
| 660 | Ga0495647_0016640 | 3300046681 | Bacteria | 2591 |
| 661 | Ga0495658_0005364 | 3300046683 | Bacteria | 6306 |
| 662 | Ga0495658_0134032 | 3300046683 | Bacteria | 1510 |
| 663 | Ga0495669_0005523 | 3300046684 | Bacteria | 5277 |
| 664 | Ga0495613_0027628 | 3300046689 | Bacteria | 4223 |
| 665 | Ga0495613_0122418 | 3300046689 | Bacteria | 1867 |
| 666 | Ga0495613_0245809 | 3300046689 | Bacteria | 1250 |
| 667 | Ga0495613_0307480 | 3300046689 | Bacteria | 1096 |
| 668 | Ga0495624_0001570 | 3300046690 | Bacteria | 17622 |
| 669 | Ga0495624_0064570 | 3300046690 | Bacteria | 2288 |
| 670 | Ga0495600_0028225 | 3300046809 | Bacteria | 3630 |
| 671 | Ga0495581_0025033 | 3300047315 | Bacteria | 3459 |
| 672 | Ga0495604_0346453 | 3300047317 | Bacteria | 988 |
| 673 | Ga0495674_0000209 | 3300047319 | Bacteria | 48240 |
| 674 | Ga0495674_0024470 | 3300047319 | Bacteria | 5548 |
| 675 | Ga0495674_0314268 | 3300047319 | Bacteria | 1278 |
| 676 | Ga0495676_0033822 | 3300047321 | Bacteria | 4297 |
| 677 | Ga0495676_0047447 | 3300047321 | Bacteria | 3473 |
| 678 | Ga0495676_0085983 | 3300047321 | Bacteria | 2368 |
| 679 | Ga0495680_0386936 | 3300047322 | Bacteria | 968 |
| 680 | Ga0495684_0001766 | 3300047471 | Bacteria | 17346 |
| 681 | Ga0495684_0003044 | 3300047471 | Bacteria | 13189 |
| 682 | Ga0495684_0049314 | 3300047471 | Bacteria | 3217 |
| 683 | Ga0495593_0007179 | 3300047673 | Bacteria | 6532 |
| 684 | Ga0495602_0080662 | 3300048088 | Bacteria | 2740 |
| 685 | Ga0495602_0454798 | 3300048088 | Bacteria | 903 |
| 686 | Ga0495615_0012423 | 3300048090 | Bacteria | 1755 |
| 687 | Ga0496100_0134321 | 3300048903 | Bacteria | 1746 |
| 688 | Ga0496100_0207228 | 3300048903 | Bacteria | 1432 |
| 689 | Ga0496100_0332254 | 3300048903 | Bacteria | 1144 |
| 690 | Ga0496101_0424249 | 3300048904 | Bacteria | 1048 |
| 691 | Ga0496102_0010995 | 3300048905 | Bacteria | 7800 |
| 692 | Ga0496102_0176348 | 3300048905 | Bacteria | 2013 |
| 693 | Ga0496103_0030761 | 3300048906 | Bacteria | 3268 |
| 694 | Ga0496104_0006466 | 3300048907 | Bacteria | 10301 |
| 695 | Ga0496104_0011676 | 3300048907 | Bacteria | 7875 |
| 696 | Ga0496104_0035653 | 3300048907 | Bacteria | 4645 |
| 697 | Ga0496104_0040885 | 3300048907 | Bacteria | 4347 |
| 698 | Ga0496105_0000783 | 3300048908 | Bacteria | 21486 |
| 699 | Ga0496105_0006116 | 3300048908 | Bacteria | 9216 |
| 700 | Ga0496105_0017779 | 3300048908 | Bacteria | 5703 |
| 701 | Ga0496105_0037299 | 3300048908 | Bacteria | 4003 |
| 702 | Ga0496106_0002235 | 3300048909 | Bacteria | 14435 |
| 703 | Ga0496106_0094236 | 3300048909 | Bacteria | 2315 |
| 704 | Ga0496106_0108221 | 3300048909 | Bacteria | 2162 |
| 705 | Ga0496106_0209392 | 3300048909 | Bacteria | 1553 |
| 706 | Ga0496107_0005679 | 3300048910 | Bacteria | 8536 |
| 707 | Ga0496108_0000783 | 3300048911 | Bacteria | 24833 |
| 708 | Ga0496108_0005523 | 3300048911 | Bacteria | 10227 |
| 709 | Ga0496109_0002516 | 3300048912 | Bacteria | 15368 |
| 710 | Ga0496109_0044666 | 3300048912 | Bacteria | 4020 |
| 711 | Ga0496110_0023893 | 3300048913 | Bacteria | 5204 |
| 712 | Ga0496110_0039288 | 3300048913 | Bacteria | 4120 |
| 713 | Ga0496110_0163933 | 3300048913 | Bacteria | 2015 |
| 714 | Ga0496110_0192729 | 3300048913 | Bacteria | 1851 |
| 715 | Ga0496110_0227850 | 3300048913 | Bacteria | 1695 |
| 716 | Ga0496110_0444194 | 3300048913 | Bacteria | 1182 |
| 717 | Ga0496111_0000495 | 3300048914 | Bacteria | 20302 |
| 718 | Ga0496111_0012998 | 3300048914 | Bacteria | 5651 |
| 719 | Ga0496112_0003524 | 3300048915 | Bacteria | 12978 |
| 720 | Ga0496112_0008371 | 3300048915 | Bacteria | 9263 |
| 721 | Ga0496113_0000529 | 3300048916 | Bacteria | 18858 |
| 722 | Ga0496114_0109194 | 3300048917 | Bacteria | 2369 |
| 723 | Ga0496114_0167669 | 3300048917 | Bacteria | 1912 |
| 724 | Ga0496115_0004616 | 3300048918 | Bacteria | 9972 |
| 725 | Ga0496115_0156652 | 3300048918 | Bacteria | 1882 |
| 726 | Ga0496115_0376978 | 3300048918 | Bacteria | 1154 |
| 727 | Ga0496117_0032979 | 3300048920 | Bacteria | 3923 |
| 728 | Ga0496120_0106075 | 3300048923 | Bacteria | 1476 |
| 729 | Ga0496122_0017063 | 3300048925 | Bacteria | 6814 |
| 730 | Ga0496124_0012283 | 3300048927 | Bacteria | 8461 |
| 731 | Ga0496124_0087643 | 3300048927 | Bacteria | 2546 |
| 732 | Ga0496125_0002695 | 3300048928 | Bacteria | 22608 |
| 733 | Ga0501033_0083116 | 3300049570 | Bacteria | 2347 |
| 734 | Ga0501033_0201346 | 3300049570 | Bacteria | 1422 |
| 735 | Ga0501034_0019935 | 3300049571 | Bacteria | 6848 |
| 736 | Ga0501034_0273000 | 3300049571 | Bacteria | 1631 |
| 737 | Ga0501036_0001382 | 3300049572 | Bacteria | 18652 |
| 738 | Ga0501036_0020963 | 3300049572 | Bacteria | 5489 |
| 739 | Ga0501036_0103560 | 3300049572 | Bacteria | 2407 |
| 740 | Ga0501036_0111786 | 3300049572 | Bacteria | 2308 |
| 741 | Ga0501036_0190621 | 3300049572 | Bacteria | 1725 |
| 742 | Ga0501037_0003480 | 3300049573 | Bacteria | 11423 |
| 743 | Ga0501037_0154252 | 3300049573 | Bacteria | 1640 |
| 744 | Ga0501038_0000646 | 3300049574 | Bacteria | 30992 |
| 745 | Ga0501038_0012439 | 3300049574 | Bacteria | 7776 |
| 746 | Ga0501038_0073051 | 3300049574 | Bacteria | 2905 |
| 747 | Ga0501038_0191459 | 3300049574 | Bacteria | 1645 |
| 748 | Ga0501038_0342704 | 3300049574 | Bacteria | 1165 |
| 749 | Ga0501038_0378757 | 3300049574 | Bacteria | 1098 |
| 750 | Ga0501039_0001534 | 3300049575 | Bacteria | 16970 |
| 751 | Ga0501039_0112756 | 3300049575 | Bacteria | 2126 |
| 752 | Ga0501039_0137082 | 3300049575 | Bacteria | 1922 |
| 753 | Ga0501039_0157905 | 3300049575 | Bacteria | 1782 |
| 754 | Ga0501039_0175265 | 3300049575 | Bacteria | 1686 |
| 755 | Ga0501039_0280225 | 3300049575 | Bacteria | 1310 |
| 756 | Ga0501040_0000087 | 3300049576 | Bacteria | 46070 |
| 757 | Ga0501040_0017509 | 3300049576 | Bacteria | 4756 |
| 758 | Ga0501041_0002380 | 3300049577 | Bacteria | 10639 |
| 759 | Ga0501041_0007945 | 3300049577 | Bacteria | 6239 |
| 760 | Ga0501041_0021655 | 3300049577 | Bacteria | 3851 |
| 761 | Ga0501041_0074019 | 3300049577 | Bacteria | 2093 |
| 762 | Ga0501041_0132095 | 3300049577 | Bacteria | 1555 |
| 763 | Ga0501041_0137561 | 3300049577 | Bacteria | 1522 |
| 764 | Ga0501041_0195047 | 3300049577 | Bacteria | 1269 |
| 765 | Ga0501041_0214942 | 3300049577 | Bacteria | 1206 |
| 766 | Ga0501042_0000957 | 3300049578 | Bacteria | 16263 |
| 767 | Ga0501042_0002829 | 3300049578 | Bacteria | 10750 |
| 768 | Ga0501042_0038500 | 3300049578 | Bacteria | 3396 |
| 769 | Ga0501042_0040685 | 3300049578 | Bacteria | 3304 |
| 770 | Ga0501043_0008327 | 3300049579 | Bacteria | 8164 |
| 771 | Ga0501043_0008730 | 3300049579 | Bacteria | 7975 |
| 772 | Ga0501043_0240942 | 3300049579 | Bacteria | 1395 |
| 773 | Ga0501043_0254530 | 3300049579 | Bacteria | 1352 |
| 774 | Ga0501043_0286800 | 3300049579 | Bacteria | 1261 |
| 775 | Ga0501046_0000364 | 3300049580 | Bacteria | 45712 |
| 776 | Ga0501046_0022776 | 3300049580 | Bacteria | 5158 |
| 777 | Ga0501046_0036174 | 3300049580 | Bacteria | 3975 |
| 778 | Ga0501046_0042825 | 3300049580 | Bacteria | 3608 |
| 779 | Ga0501046_0068487 | 3300049580 | Bacteria | 2762 |
| 780 | Ga0501046_0112204 | 3300049580 | Bacteria | 2082 |
| 781 | Ga0501047_0028382 | 3300049581 | Bacteria | 5394 |
| 782 | Ga0501048_0001228 | 3300049582 | Bacteria | 19413 |
| 783 | Ga0501048_0017702 | 3300049582 | Bacteria | 5245 |
| 784 | Ga0501048_0024555 | 3300049582 | Bacteria | 4399 |
| 785 | Ga0501048_0026590 | 3300049582 | Bacteria | 4212 |
| 786 | Ga0501048_0152336 | 3300049582 | Bacteria | 1636 |
| 787 | Ga0501048_0249039 | 3300049582 | Bacteria | 1261 |
| 788 | Ga0501067_0037054 | 3300049583 | Bacteria | 2709 |
| 789 | Ga0501068_0011606 | 3300049584 | Bacteria | 4976 |
| 790 | Ga0501068_0040132 | 3300049584 | Bacteria | 2809 |
| 791 | Ga0501068_0054258 | 3300049584 | Bacteria | 2428 |
| 792 | Ga0501068_0064794 | 3300049584 | Bacteria | 2224 |
| 793 | Ga0501069_0026341 | 3300049585 | Bacteria | 3183 |
| 794 | Ga0501069_0103036 | 3300049585 | Bacteria | 1621 |
| 795 | Ga0501069_0260763 | 3300049585 | Unclassified | 1012 |
| 796 | Ga0501070_0373034 | 3300049586 | Bacteria | 1156 |
| 797 | Ga0501071_0000156 | 3300049587 | Bacteria | 28990 |
| 798 | Ga0501071_0001439 | 3300049587 | Bacteria | 13746 |
| 799 | Ga0501071_0045592 | 3300049587 | Bacteria | 3148 |
| 800 | Ga0501071_0055335 | 3300049587 | Bacteria | 2864 |
| 801 | Ga0501071_0146449 | 3300049587 | Bacteria | 1760 |
| 802 | Ga0501072_0000252 | 3300049588 | Bacteria | 39255 |
| 803 | Ga0501072_0002340 | 3300049588 | Bacteria | 14217 |
| 804 | Ga0501072_0011074 | 3300049588 | Bacteria | 6882 |
| 805 | Ga0501072_0014152 | 3300049588 | Bacteria | 6112 |
| 806 | Ga0501072_0015235 | 3300049588 | Bacteria | 5894 |
| 807 | Ga0501072_0084821 | 3300049588 | Bacteria | 2512 |
| 808 | Ga0501072_0108041 | 3300049588 | Bacteria | 2213 |
| 809 | Ga0501072_0142384 | 3300049588 | Bacteria | 1912 |
| 810 | Ga0501072_0191446 | 3300049588 | Bacteria | 1631 |
| 811 | Ga0501072_0251166 | 3300049588 | Bacteria | 1408 |
| 812 | Ga0501072_0262130 | 3300049588 | Bacteria | 1376 |
| 813 | Ga0501073_0085182 | 3300049589 | Bacteria | 2199 |
| 814 | Ga0501073_0237298 | 3300049589 | Bacteria | 1259 |
| 815 | Ga0501074_0001338 | 3300049590 | Bacteria | 16345 |
| 816 | Ga0501074_0035939 | 3300049590 | Bacteria | 3589 |
| 817 | Ga0501074_0075577 | 3300049590 | Bacteria | 2418 |
| 818 | Ga0501074_0220011 | 3300049590 | Bacteria | 1352 |
| 819 | Ga0501074_0251630 | 3300049590 | Bacteria | 1256 |
| 820 | Ga0501075_0000004 | 3300049591 | Bacteria | 148813 |
| 821 | Ga0501075_0000058 | 3300049591 | Bacteria | 46963 |
| 822 | Ga0501075_0045061 | 3300049591 | Bacteria | 3310 |
| 823 | Ga0501075_0074851 | 3300049591 | Bacteria | 2561 |
| 824 | Ga0501075_0287979 | 3300049591 | Bacteria | 1252 |
| 825 | Ga0501076_0000729 | 3300049592 | Bacteria | 21290 |
| 826 | Ga0501076_0000774 | 3300049592 | Bacteria | 20666 |
| 827 | Ga0501076_0005575 | 3300049592 | Bacteria | 9066 |
| 828 | Ga0501076_0006035 | 3300049592 | Bacteria | 8762 |
| 829 | Ga0501076_0008073 | 3300049592 | Bacteria | 7693 |
| 830 | Ga0501076_0015076 | 3300049592 | Bacteria | 5836 |
| 831 | Ga0501076_0104111 | 3300049592 | Bacteria | 2289 |
| 832 | Ga0501077_0000178 | 3300049593 | Bacteria | 36417 |
| 833 | Ga0501077_0022957 | 3300049593 | Bacteria | 3955 |
| 834 | Ga0501077_0106072 | 3300049593 | Bacteria | 1781 |
| 835 | Ga0501077_0171686 | 3300049593 | Bacteria | 1377 |
| 836 | Ga0501077_0204832 | 3300049593 | Bacteria | 1253 |
| 837 | Ga0501079_0000022 | 3300049741 | Bacteria | 63662 |
| 838 | Ga0501079_0005648 | 3300049741 | Bacteria | 9338 |
| 839 | Ga0501079_0032205 | 3300049741 | Bacteria | 4030 |
| 840 | Ga0501079_0051015 | 3300049741 | Bacteria | 3193 |
| 841 | Ga0501079_0068313 | 3300049741 | Bacteria | 2743 |
| 842 | Ga0501079_0074885 | 3300049741 | Bacteria | 2617 |
| 843 | Ga0501079_0096889 | 3300049741 | Bacteria | 2287 |
| 844 | Ga0501079_0165351 | 3300049741 | Bacteria | 1725 |
| 845 | Ga0501079_0215556 | 3300049741 | Bacteria | 1499 |
| 846 | Ga0501080_0001368 | 3300049742 | Bacteria | 20407 |
| 847 | Ga0501080_0007494 | 3300049742 | Bacteria | 9853 |
| 848 | Ga0501080_0011566 | 3300049742 | Bacteria | 8083 |
| 849 | Ga0501080_0013259 | 3300049742 | Bacteria | 7572 |
| 850 | Ga0501080_0014988 | 3300049742 | Bacteria | 7138 |
| 851 | Ga0501080_0091352 | 3300049742 | Bacteria | 2828 |
| 852 | Ga0501080_0163888 | 3300049742 | Bacteria | 2052 |
| 853 | Ga0501080_0263607 | 3300049742 | Bacteria | 1569 |
| 854 | Ga0501080_0322145 | 3300049742 | Bacteria | 1399 |
| 855 | Ga0501081_0000774 | 3300049743 | Bacteria | 18730 |
| 856 | Ga0501081_0005054 | 3300049743 | Bacteria | 8490 |
| 857 | Ga0501081_0043796 | 3300049743 | Bacteria | 3071 |
| 858 | Ga0501081_0090558 | 3300049743 | Bacteria | 2150 |
| 859 | Ga0501081_0110500 | 3300049743 | Bacteria | 1950 |
| 860 | Ga0501081_0259297 | 3300049743 | Bacteria | 1270 |
| 861 | Ga0501083_0009935 | 3300049744 | Bacteria | 6718 |
| 862 | Ga0501083_0066623 | 3300049744 | Bacteria | 2397 |
| 863 | Ga0501083_0084820 | 3300049744 | Bacteria | 2096 |
| 864 | Ga0501083_0100994 | 3300049744 | Bacteria | 1902 |
| 865 | Ga0501083_0170035 | 3300049744 | Bacteria | 1425 |
| 866 | Ga0501083_0212132 | 3300049744 | Bacteria | 1262 |
| 867 | Ga0501035_0001252 | 3300049822 | Bacteria | 26379 |
| 868 | Ga0501035_0031108 | 3300049822 | Bacteria | 4861 |
| 869 | Ga0501035_0216312 | 3300049822 | Bacteria | 1638 |
| 870 | Ga0501044_0097643 | 3300049823 | Bacteria | 2958 |
| 871 | Ga0501045_0001164 | 3300049824 | Bacteria | 17428 |
| 872 | Ga0501045_0005395 | 3300049824 | Bacteria | 8854 |
| 873 | Ga0501045_0038943 | 3300049824 | Bacteria | 3459 |
| 874 | Ga0501045_0039692 | 3300049824 | Bacteria | 3425 |
| 875 | Ga0501045_0050317 | 3300049824 | Bacteria | 3040 |
| 876 | Ga0501045_0053256 | 3300049824 | Bacteria | 2957 |
| 877 | Ga0501045_0067775 | 3300049824 | Bacteria | 2621 |
| 878 | Ga0501045_0345062 | 3300049824 | Bacteria | 1108 |
| 879 | nmdc:mga03n38_70088_c1 | 3300050490 | Bacteria | 1621 |
| 880 | nmdc:mga00v17_42716_c1 | 3300050491 | Bacteria | 2728 |
| 881 | nmdc:mga00v17_663_c1 | 3300050491 | Bacteria | 18944 |
| 882 | nmdc:mga0yw44_125726_c1 | 3300050492 | Bacteria | 1656 |
| 883 | nmdc:mga0yw44_241100_c1 | 3300050492 | Bacteria | 1202 |
| 884 | nmdc:mga0yw44_6134_c1 | 3300050492 | Bacteria | 5773 |
| 885 | nmdc:mga0k408_144836_c1 | 3300050493 | Bacteria | 1414 |
| 886 | nmdc:mga0k408_21840_c1 | 3300050493 | Bacteria | 3600 |
| 887 | nmdc:mga06z11_1221_c1 | 3300050494 | Bacteria | 9490 |
| 888 | nmdc:mga06z11_14795_c1 | 3300050494 | Bacteria | 3465 |
| 889 | nmdc:mga06z11_4849_c1 | 3300050494 | Bacteria | 5328 |
| 890 | nmdc:mga04h51_18663_c1 | 3300050495 | Bacteria | 2046 |
| 891 | nmdc:mga04h51_5277_c1 | 3300050495 | Bacteria | 3283 |
| 892 | nmdc:mga07m45_140965_c1 | 3300050496 | Bacteria | 1396 |
| 893 | nmdc:mga05p37_11593_c1 | 3300050507 | Bacteria | 10504 |
| 894 | nmdc:mga05p37_286168_c1 | 3300050507 | Bacteria | 1964 |
| 895 | nmdc:mga05p37_3149_c1 | 3300050507 | Bacteria | 19194 |
| 896 | nmdc:mga05p37_3283_c1 | 3300050507 | Bacteria | 18860 |
| 897 | nmdc:mga05p37_53751_c1 | 3300050507 | Bacteria | 4954 |
| 898 | nmdc:mga05p37_591813_c1 | 3300050507 | Bacteria | 1254 |
| 899 | nmdc:mga05p37_710_c2 | 3300050507 | Bacteria | 23500 |
| 900 | nmdc:mga09592_126_c1 | 3300050508 | Bacteria | 35358 |
| 901 | nmdc:mga09592_1332_c1 | 3300050508 | Bacteria | 19780 |
| 902 | nmdc:mga09592_3063_c1 | 3300050508 | Bacteria | 13561 |
| 903 | nmdc:mga09592_4616_c1 | 3300050508 | Bacteria | 11157 |
| 904 | nmdc:mga09592_51499_c1 | 3300050508 | Bacteria | 3474 |
| 905 | nmdc:mga09592_77287_c1 | 3300050508 | Bacteria | 2832 |
| 906 | nmdc:mga0qj67_132673_c1 | 3300050509 | Bacteria | 2017 |
| 907 | nmdc:mga0qj67_2393_c1 | 3300050509 | Bacteria | 13371 |
| 908 | nmdc:mga06r32_100774_c1 | 3300050510 | Bacteria | 2833 |
| 909 | nmdc:mga06r32_178409_c1 | 3300050510 | Bacteria | 2109 |
| 910 | nmdc:mga06r32_2441_c1 | 3300050510 | Bacteria | 16629 |
| 911 | nmdc:mga06r32_256198_c1 | 3300050510 | Bacteria | 1737 |
| 912 | nmdc:mga06r32_343670_c1 | 3300050510 | Bacteria | 1477 |
| 913 | nmdc:mga06r32_4_c1 | 3300050510 | Bacteria | 144637 |
| 914 | nmdc:mga06r32_6022_c1 | 3300050510 | Bacteria | 10911 |
| 915 | nmdc:mga06r32_61903_c1 | 3300050510 | Bacteria | 3604 |
| 916 | nmdc:mga06r32_63545_c1 | 3300050510 | Bacteria | 3559 |
| 917 | nmdc:mga06r32_7414_c1 | 3300050510 | Bacteria | 9867 |
| 918 | nmdc:mga08y16_1078_c1 | 3300050511 | Bacteria | 26854 |
| 919 | nmdc:mga08y16_156104_c1 | 3300050511 | Bacteria | 2371 |
| 920 | nmdc:mga08y16_16843_c1 | 3300050511 | Bacteria | 7694 |
| 921 | nmdc:mga08y16_182193_c1 | 3300050511 | Bacteria | 2181 |
| 922 | nmdc:mga08y16_39253_c1 | 3300050511 | Bacteria | 4968 |
| 923 | nmdc:mga08y16_399621_c1 | 3300050511 | Bacteria | 1407 |
| 924 | nmdc:mga08y16_4436_c1 | 3300050511 | Bacteria | 14668 |
| 925 | nmdc:mga0n895_110942_c1 | 3300050512 | Bacteria | 2759 |
| 926 | nmdc:mga0n895_1570_c1 | 3300050512 | Bacteria | 17182 |
| 927 | nmdc:mga0n895_3956_c1 | 3300050512 | Bacteria | 12046 |
| 928 | nmdc:mga0n895_401522_c1 | 3300050512 | Bacteria | 1386 |
| 929 | nmdc:mga0n895_42634_c1 | 3300050512 | Bacteria | 4416 |
| 930 | nmdc:mga0n895_50020_c1 | 3300050512 | Bacteria | 4097 |
| 931 | nmdc:mga0rr50_18250_c1 | 3300050513 | Bacteria | 4707 |
| 932 | nmdc:mga0rr50_315148_c1 | 3300050513 | Bacteria | 1311 |
| 933 | nmdc:mga0rr50_359_c1 | 3300050513 | Bacteria | 24852 |
| 934 | nmdc:mga0rr50_55745_c1 | 3300050513 | Bacteria | 2950 |
| 935 | nmdc:mga08x19_120397_c1 | 3300050514 | Bacteria | 1759 |
| 936 | nmdc:mga08x19_12690_c1 | 3300050514 | Bacteria | 5080 |
| 937 | nmdc:mga08x19_20446_c1 | 3300050514 | Bacteria | 4075 |
| 938 | nmdc:mga08x19_245588_c1 | 3300050514 | Bacteria | 1235 |
| 939 | nmdc:mga08x19_47006_c1 | 3300050514 | Bacteria | 2762 |
| 940 | nmdc:mga0a205_1075_c1 | 3300050515 | Bacteria | 22701 |
| 941 | nmdc:mga0a205_16420_c1 | 3300050515 | Bacteria | 6934 |
| 942 | nmdc:mga0a205_297825_c1 | 3300050515 | Bacteria | 1486 |
| 943 | nmdc:mga0a205_311895_c1 | 3300050515 | Bacteria | 1445 |
| 944 | nmdc:mga0a205_34387_c1 | 3300050515 | Bacteria | 4862 |
| 945 | nmdc:mga0a205_93_c2 | 3300050515 | Bacteria | 37118 |
| 946 | nmdc:mga0sz30_68952_c1 | 3300050516 | Bacteria | 1520 |
| 947 | Ga0495601_0001471 | 3300053077 | Bacteria | 12982 |
| 948 | Ga0495601_0035335 | 3300053077 | Bacteria | 3119 |
| 949 | Ga0495601_0310879 | 3300053077 | Bacteria | 1026 |
| 950 | Ga0495612_0000353 | 3300053078 | Bacteria | 18580 |
| 951 | Ga0495595_0036616 | 3300053084 | Bacteria | 2228 |
| 952 | Ga0495619_0001077 | 3300053085 | Bacteria | 17905 |
| 953 | Ga0495619_0084025 | 3300053085 | Bacteria | 2148 |
| 954 | Ga0500658_0085078 | 3300053134 | Bacteria | 1359 |
| 955 | Ga0500568_0002596 | 3300053139 | Bacteria | 10496 |
| 956 | Ga0500577_0029867 | 3300053142 | Bacteria | 1892 |
| 957 | Ga0500616_0095822 | 3300053153 | Bacteria | 1460 |
| 958 | Ga0501084_0000157 | 3300054114 | Bacteria | 52388 |
| 959 | Ga0501084_0002367 | 3300054114 | Bacteria | 15172 |
| 960 | Ga0501084_0039329 | 3300054114 | Bacteria | 3956 |
| 961 | Ga0501084_0053208 | 3300054114 | Bacteria | 3386 |
| 962 | Ga0501084_0113461 | 3300054114 | Bacteria | 2278 |
| 963 | Ga0501084_0225774 | 3300054114 | Bacteria | 1580 |
| 964 | Ga0501084_0250867 | 3300054114 | Bacteria | 1494 |
| 965 | Ga0501084_0410885 | 3300054114 | Bacteria | 1144 |
| 966 | Ga0501082_0000050 | 3300060353 | Bacteria | 83978 |
| 967 | Ga0501082_0000341 | 3300060353 | Bacteria | 41171 |
| 968 | Ga0501082_0001651 | 3300060353 | Bacteria | 19655 |
| 969 | Ga0501082_0063226 | 3300060353 | Bacteria | 3187 |
| 970 | Ga0501082_0100457 | 3300060353 | Bacteria | 2502 |
| 971 | Ga0501082_0152329 | 3300060353 | Bacteria | 2009 |
| 972 | Ga0501082_0160913 | 3300060353 | Bacteria | 1951 |
| 973 | Ga0501082_0199196 | 3300060353 | Bacteria | 1742 |
| 974 | Ga0530510_0000084 | 3300061734 | Bacteria | 49991 |
| 975 | Ga0530510_0000222 | 3300061734 | Bacteria | 35471 |
| 976 | Ga0530510_0002069 | 3300061734 | Bacteria | 13788 |
| 977 | Ga0530510_0002542 | 3300061734 | Bacteria | 12535 |
| 978 | Ga0530510_0003261 | 3300061734 | Bacteria | 11152 |
| 979 | Ga0530510_0004269 | 3300061734 | Bacteria | 9891 |
| 980 | Ga0530510_0010377 | 3300061734 | Bacteria | 6531 |
| 981 | Ga0530510_0039127 | 3300061734 | Bacteria | 3423 |
| 982 | Ga0530510_0115418 | 3300061734 | Bacteria | 1968 |
| 983 | Ga0530510_0298034 | 3300061734 | Bacteria | 1206 |
| 984 | 2776910825 | 2775507049 | Bacteria | 6284736 |
| 985 | 2883581241 | 2883577096 | Bacteria | 4709178 |
| 986 | 2894773134 | 2894772417 | Bacteria | 5305674 |
| 987 | Ga0207669_10050150 | |||
| 988 | JGI25406J46586_10006501 | |||
| 989 | JGI25406J46586_10011229 | |||
| 990 | JGI26129J50193_1002204 | |||
| 991 | Ga0065712_10030896 | |||
| 992 | Ga0065715_10124256 | |||
| 993 | Ga0065715_10157979 | |||
| 994 | Ga0065707_10096354 | |||
| 995 | Ga0065707_10119257 | |||
| 996 | Ga0070676_10034437 | |||
| 997 | Ga0070690_100067294 | |||
| 998 | Ga0070690_100162427 | |||
| 999 | Ga0070670_100356109 | |||
| 1000 | Ga0070677_10022862 | |||
| 1001 | Ga0068869_100002482 | |||
| 1002 | Ga0068869_100006166 | |||
| 1003 | Ga0068869_100015428 | |||
| 1004 | Ga0068869_100187717 | |||
| 1005 | Ga0068869_100349072 | |||
| 1006 | Ga0070680_100176034 | |||
| 1007 | Ga0070680_100259607 | |||
| 1008 | Ga0070682_100001528 | |||
| 1009 | Ga0068868_100002947 | |||
| 1010 | Ga0070689_100002038 | |||
| 1011 | Ga0070689_100156381 | |||
| 1012 | Ga0070691_10016926 | |||
| 1013 | Ga0070691_10017617 | |||
| 1014 | Ga0070691_10021810 | |||
| 1015 | Ga0070691_10028327 | |||
| 1016 | Ga0070691_10076194 | |||
| 1017 | Ga0070687_100000326 | |||
| 1018 | Ga0070687_100056298 | |||
| 1019 | Ga0070692_10008943 | |||
| 1020 | Ga0070692_10010920 | |||
| 1021 | Ga0070692_10070275 | |||
| 1022 | Ga0070692_10157985 | |||
| 1023 | Ga0070668_100027604 | |||
| 1024 | Ga0070668_100337000 | |||
| 1025 | Ga0070668_100359050 | |||
| 1026 | Ga0070669_100002984 | |||
| 1027 | Ga0070669_100382177 | |||
| 1028 | Ga0070669_100388179 | |||
| 1029 | Ga0070675_100179485 | |||
| 1030 | Ga0070675_100270406 | |||
| 1031 | Ga0070671_100204493 | |||
| 1032 | Ga0070671_100282518 | |||
| 1033 | Ga0070674_100028481 | |||
| 1034 | Ga0070674_100103882 | |||
| 1035 | Ga0070659_100096411 | |||
| 1036 | Ga0070709_10193076 | |||
| 1037 | Ga0070714_100050541 | |||
| 1038 | Ga0070714_100066078 | |||
| 1039 | Ga0070714_100526074 | |||
| 1040 | Ga0070713_100035581 | |||
| 1041 | Ga0070701_10005350 | |||
| 1042 | Ga0070701_10010591 | |||
| 1043 | Ga0070705_100000638 | |||
| 1044 | Ga0070705_100000671 | |||
| 1045 | Ga0070705_100016484 | |||
| 1046 | Ga0070705_100029720 | |||
| 1047 | Ga0070705_100152480 | |||
| 1048 | Ga0070705_100177207 | |||
| 1049 | Ga0070705_100193116 | |||
| 1050 | Ga0070705_100235746 | |||
| 1051 | Ga0070700_100000211 | |||
| 1052 | Ga0070700_100003296 | |||
| 1053 | Ga0070700_100011184 | |||
| 1054 | Ga0070700_100031792 | |||
| 1055 | Ga0070700_100205331 | |||
| 1056 | Ga0070694_100002732 | |||
| 1057 | Ga0070694_100003420 | |||
| 1058 | Ga0070694_100003723 | |||
| 1059 | Ga0070694_100003917 | |||
| 1060 | Ga0070694_100041452 | |||
| 1061 | Ga0070694_100051160 | |||
| 1062 | Ga0070694_100052666 | |||
| 1063 | Ga0070694_100114275 | |||
| 1064 | Ga0070694_100147170 | |||
| 1065 | Ga0070694_100174022 | |||
| 1066 | Ga0070708_100006158 | |||
| 1067 | Ga0070708_100026888 | |||
| 1068 | Ga0070708_100083951 | |||
| 1069 | Ga0070708_100238026 | |||
| 1070 | Ga0070708_100303382 | |||
| 1071 | Ga0070663_100256353 | |||
| 1072 | Ga0070678_100061326 | |||
| 1073 | Ga0070678_100254757 | |||
| 1074 | Ga0070662_100094058 | |||
| 1075 | Ga0070662_100201370 | |||
| 1076 | Ga0070681_10010518 | |||
| 1077 | Ga0070681_10021226 | |||
| 1078 | Ga0070681_10078253 | |||
| 1079 | Ga0070681_10108660 | |||
| 1080 | Ga0068867_100001335 | |||
| 1081 | Ga0068867_100003689 | |||
| 1082 | Ga0068867_100134456 | |||
| 1083 | Ga0068867_100165182 | |||
| 1084 | Ga0070706_100073844 | |||
| 1085 | Ga0070706_100078254 | |||
| 1086 | Ga0070707_100018938 | |||
| 1087 | Ga0070707_100037794 | |||
| 1088 | Ga0070707_100274545 | |||
| 1089 | Ga0070707_100317232 | |||
| 1090 | Ga0070698_100005791 | |||
| 1091 | Ga0070698_100137973 | |||
| 1092 | Ga0070699_100003010 | |||
| 1093 | Ga0070699_100006362 | |||
| 1094 | Ga0070699_100006895 | |||
| 1095 | Ga0070699_100042885 | |||
| 1096 | Ga0070699_100381209 | |||
| 1097 | Ga0070679_100064153 | |||
| 1098 | Ga0070679_100113499 | |||
| 1099 | Ga0070679_100202722 | |||
| 1100 | Ga0070679_100400224 | |||
| 1101 | Ga0070697_100001293 | |||
| 1102 | Ga0070697_100001434 | |||
| 1103 | Ga0070697_100005785 | |||
| 1104 | Ga0070697_100007886 | |||
| 1105 | Ga0070697_100008411 | |||
| 1106 | Ga0070697_100019057 | |||
| 1107 | Ga0070697_100072868 | |||
| 1108 | Ga0068853_100274211 | |||
| 1109 | Ga0070672_100083906 | |||
| 1110 | Ga0070672_100129583 | |||
| 1111 | Ga0070672_100254777 | |||
| 1112 | Ga0070686_100010234 | |||
| 1113 | Ga0070686_100173058 | |||
| 1114 | Ga0070686_100339895 | |||
| 1115 | Ga0070686_100459993 | |||
| 1116 | Ga0070695_100000948 | |||
| 1117 | Ga0070695_100001721 | |||
| 1118 | Ga0070695_100002319 | |||
| 1119 | Ga0070695_100005573 | |||
| 1120 | Ga0070695_100022262 | |||
| 1121 | Ga0070695_100022535 | |||
| 1122 | Ga0070695_100027043 | |||
| 1123 | Ga0070695_100031558 | |||
| 1124 | Ga0070695_100086311 | |||
| 1125 | Ga0070696_100000012 | |||
| 1126 | Ga0070696_100002401 | |||
| 1127 | Ga0070696_100009167 | |||
| 1128 | Ga0070696_100044664 | |||
| 1129 | Ga0070696_100095717 | |||
| 1130 | Ga0070696_100126282 | |||
| 1131 | Ga0070696_100278221 | |||
| 1132 | Ga0070693_100000135 | |||
| 1133 | Ga0070693_100007379 | |||
| 1134 | Ga0070693_100128216 | |||
| 1135 | Ga0070693_100281037 | |||
| 1136 | Ga0070704_100000108 | |||
| 1137 | Ga0070704_100000193 | |||
| 1138 | Ga0070704_100029938 | |||
| 1139 | Ga0070704_100080648 | |||
| 1140 | Ga0070704_100169376 | |||
| 1141 | Ga0070704_100236196 | |||
| 1142 | Ga0070704_100277704 | |||
| 1143 | Ga0070704_100282099 | |||
| 1144 | Ga0070704_100393298 | |||
| 1145 | Ga0070704_100399480 | |||
| 1146 | Ga0068855_100063388 | |||
| 1147 | Ga0068855_100288486 | |||
| 1148 | Ga0070664_100138582 | |||
| 1149 | Ga0068857_100022542 | |||
| 1150 | Ga0068857_100359791 | |||
| 1151 | Ga0068857_100430073 | |||
| 1152 | Ga0068857_100740837 | |||
| 1153 | Ga0068854_100001657 | |||
| 1154 | Ga0068854_100407247 | |||
| 1155 | Ga0068856_100332974 | |||
| 1156 | Ga0068859_100003978 | |||
| 1157 | Ga0068859_100006107 | |||
| 1158 | Ga0068859_100007972 | |||
| 1159 | Ga0068859_100021038 | |||
| 1160 | Ga0068859_100099270 | |||
| 1161 | Ga0068859_100383206 | |||
| 1162 | Ga0068859_100432520 | |||
| 1163 | Ga0068864_100149961 | |||
| 1164 | Ga0068864_100381014 | |||
| 1165 | Ga0068866_10009989 | |||
| 1166 | Ga0068861_100000173 | |||
| 1167 | Ga0068861_100019210 | |||
| 1168 | Ga0068861_100113605 | |||
| 1169 | Ga0068861_100131722 | |||
| 1170 | Ga0068861_100424200 | |||
| 1171 | Ga0068863_100126447 | |||
| 1172 | Ga0068858_100001425 | |||
| 1173 | Ga0068858_100136445 | |||
| 1174 | Ga0068858_100161059 | |||
| 1175 | Ga0068858_100228900 | |||
| 1176 | Ga0068860_100001885 | |||
| 1177 | Ga0068860_100060141 | |||
| 1178 | Ga0068860_100554582 | |||
| 1179 | Ga0068862_100000594 | |||
| 1180 | Ga0068862_100004236 | |||
| 1181 | Ga0081455_10000014 | |||
| 1182 | Ga0081455_10007461 | |||
| 1183 | Ga0081455_10017729 | |||
| 1184 | Ga0081538_10027411 | |||
| 1185 | Ga0081538_10048592 | |||
| 1186 | Ga0081540_1000035 | |||
| 1187 | Ga0081540_1000878 | |||
| 1188 | Ga0081539_10000462 | |||
| 1189 | Ga0081539_10001341 | |||
| 1190 | Ga0070717_10424093 | |||
| 1191 | Ga0070717_10463418 | |||
| 1192 | Ga0075365_10011758 | |||
| 1193 | Ga0075368_10003743 | |||
| 1194 | Ga0075368_10012309 | |||
| 1195 | Ga0075363_100030177 | |||
| 1196 | Ga0075363_100052945 | |||
| 1197 | Ga0075432_10041440 | |||
| 1198 | Ga0070715_10083343 | |||
| 1199 | Ga0070716_100078136 | |||
| 1200 | Ga0070716_100231393 | |||
| 1201 | Ga0070712_100006640 | |||
| 1202 | Ga0070712_100057102 | |||
| 1203 | Ga0075362_10078884 | |||
| 1204 | Ga0075367_10028637 | |||
| 1205 | Ga0075367_10040940 | |||
| 1206 | Ga0075367_10208319 | |||
| 1207 | Ga0097621_100000939 | |||
| 1208 | Ga0075370_10033514 | |||
| 1209 | Ga0068871_100000370 | |||
| 1210 | Ga0068871_100080962 | |||
| 1211 | Ga0075428_100000446 | |||
| 1212 | Ga0075428_100001232 | |||
| 1213 | Ga0075428_100009146 | |||
| 1214 | Ga0075428_100018652 | |||
| 1215 | Ga0075428_100019802 | |||
| 1216 | Ga0075428_100022052 | |||
| 1217 | Ga0075428_100044588 | |||
| 1218 | Ga0075428_100223503 | |||
| 1219 | Ga0075428_100535990 | |||
| 1220 | Ga0075428_100653210 | |||
| 1221 | Ga0075430_100006952 | |||
| 1222 | Ga0075430_100010982 | |||
| 1223 | Ga0075430_100048016 | |||
| 1224 | Ga0075430_100307408 | |||
| 1225 | Ga0075430_100349174 | |||
| 1226 | Ga0075431_100000586 | |||
| 1227 | Ga0075431_100002204 | |||
| 1228 | Ga0075431_100006333 | |||
| 1229 | Ga0075431_100023814 | |||
| 1230 | Ga0075431_100100743 | |||
| 1231 | Ga0075431_100150402 | |||
| 1232 | Ga0075431_100155138 | |||
| 1233 | Ga0075431_100204579 | |||
| 1234 | Ga0075433_10001281 | |||
| 1235 | Ga0075433_10006995 | |||
| 1236 | Ga0075433_10033836 | |||
| 1237 | Ga0075433_10119236 | |||
| 1238 | Ga0075434_100001574 | |||
| 1239 | Ga0075434_100002685 | |||
| 1240 | Ga0075434_100053555 | |||
| 1241 | Ga0075434_100082740 | |||
| 1242 | Ga0075434_100093341 | |||
| 1243 | Ga0075434_100104025 | |||
| 1244 | Ga0075434_100577052 | |||
| 1245 | Ga0075429_100000259 | |||
| 1246 | Ga0075429_100000922 | |||
| 1247 | Ga0075429_100002976 | |||
| 1248 | Ga0068865_100007455 | |||
| 1249 | Ga0068865_100017764 | |||
| 1250 | Ga0068865_100020281 | |||
| 1251 | Ga0075436_100001357 | |||
| 1252 | Ga0075436_100006485 | |||
| 1253 | Ga0075436_100142454 | |||
| 1254 | Ga0075436_100204923 | |||
| 1255 | Ga0075436_100210584 | |||
| 1256 | Ga0075436_100284425 | |||
| 1257 | Ga0097620_100003978 | |||
| 1258 | Ga0097620_100006104 | |||
| 1259 | Ga0097620_100007972 | |||
| 1260 | Ga0097620_100021038 | |||
| 1261 | Ga0097620_100099264 | |||
| 1262 | Ga0097620_100383240 | |||
| 1263 | Ga0097620_100432525 | |||
| 1264 | Ga0075435_100000047 | |||
| 1265 | Ga0075435_100017237 | |||
| 1266 | Ga0075435_100256335 | |||
| 1267 | Ga0099794_10059969 | |||
| 1268 | Ga0099794_10158993 | |||
| 1269 | Ga0105240_10394231 | |||
| 1270 | Ga0111539_10003844 | |||
| 1271 | Ga0111539_10011877 | |||
| 1272 | Ga0111539_10031418 | |||
| 1273 | Ga0111539_10034785 | |||
| 1274 | Ga0111539_10086334 | |||
| 1275 | Ga0111539_10291090 | |||
| 1276 | Ga0111539_10354182 | |||
| 1277 | Ga0111539_10405491 | |||
| 1278 | Ga0111539_10663496 | |||
| 1279 | Ga0105245_10007041 | |||
| 1280 | Ga0105245_10012980 | |||
| 1281 | Ga0105245_10075077 | |||
| 1282 | Ga0105247_10112872 | |||
| 1283 | Ga0114129_10000068 | |||
| 1284 | Ga0114129_10000430 | |||
| 1285 | Ga0114129_10000703 | |||
| 1286 | Ga0114129_10002359 | |||
| 1287 | Ga0114129_10020013 | |||
| 1288 | Ga0114129_10020418 | |||
| 1289 | Ga0114129_10074037 | |||
| 1290 | Ga0114129_10164336 | |||
| 1291 | Ga0114129_10915868 | |||
| 1292 | Ga0105243_10000708 | |||
| 1293 | Ga0105243_10043929 | |||
| 1294 | Ga0105243_10444606 | |||
| 1295 | Ga0105241_10092438 | |||
| 1296 | Ga0105241_10122645 | |||
| 1297 | Ga0105242_10041789 | |||
| 1298 | Ga0105242_10258302 | |||
| 1299 | Ga0105248_10114457 | |||
| 1300 | Ga0105248_10368233 | |||
| 1301 | Ga0105237_10029142 | |||
| 1302 | Ga0105237_10037012 | |||
| 1303 | Ga0105238_10341110 | |||
| 1304 | Ga0105249_10000599 | |||
| 1305 | Ga0105249_10002072 | |||
| 1306 | Ga0105249_10131152 | |||
| 1307 | Ga0105249_10603595 | |||
| 1308 | Ga0099796_10028306 | |||
| 1309 | Ga0105239_10036817 | |||
| 1310 | Ga0105239_10242555 | |||
| 1311 | Ga0105246_10136796 | |||
| 1312 | Ga0157369_10217554 | |||
| 1313 | Ga0157378_10006229 | |||
| 1314 | Ga0157378_10422905 | |||
| 1315 | Ga0157378_10491426 | |||
| 1316 | Ga0163162_10018668 | |||
| 1317 | Ga0163162_10333214 | |||
| 1318 | Ga0163162_10436895 | |||
| 1319 | Ga0163162_10494459 | |||
| 1320 | Ga0157372_10202758 | |||
| 1321 | Ga0157375_10444959 | |||
| 1322 | Ga0157375_10516832 | |||
| 1323 | Ga0163163_10001948 | |||
| 1324 | Ga0163163_10609142 | |||
| 1325 | Ga0157380_10270015 | |||
| 1326 | Ga0157380_10305790 | |||
| 1327 | Ga0157380_10463956 | |||
| 1328 | Ga0157377_10101288 | |||
| 1329 | Ga0157379_10441317 | |||
| 1330 | Ga0157376_10011568 | |||
| 1331 | Ga0157376_10059518 | |||
| 1332 | Ga0213873_10024658 | |||
| 1333 | Ga0213874_10011204 | |||
| 1334 | Ga0213876_10000816 | |||
| 1335 | Ga0213876_10000944 | |||
| 1336 | Ga0213876_10084059 | |||
| 1337 | Ga0213875_10000003 | |||
| 1338 | Ga0213875_10001075 | |||
| 1339 | Ga0213875_10012486 | |||
| 1340 | Ga0213875_10016470 | |||
| 1341 | Ga0213875_10034599 | |||
| 1342 | Ga0207653_10001145 | |||
| 1343 | Ga0207682_10002103 | |||
| 1344 | Ga0207692_10195460 | |||
| 1345 | Ga0207642_10005920 | |||
| 1346 | Ga0207642_10018611 | |||
| 1347 | Ga0207710_10024128 | |||
| 1348 | Ga0207688_10016496 | |||
| 1349 | Ga0207645_10045314 | |||
| 1350 | Ga0207684_10004520 | |||
| 1351 | Ga0207654_10035292 | |||
| 1352 | Ga0207654_10089196 | |||
| 1353 | Ga0207707_10001852 | |||
| 1354 | Ga0207707_10010205 | |||
| 1355 | Ga0207707_10064689 | |||
| 1356 | Ga0207671_10030628 | |||
| 1357 | Ga0207693_10003608 | |||
| 1358 | Ga0207693_10013129 | |||
| 1359 | Ga0207693_10052856 | |||
| 1360 | Ga0207662_10000639 | |||
| 1361 | Ga0207662_10010145 | |||
| 1362 | Ga0207662_10044570 | |||
| 1363 | Ga0207652_10159637 | |||
| 1364 | Ga0207652_10180287 | |||
| 1365 | Ga0207652_10187492 | |||
| 1366 | Ga0207646_10003037 | |||
| 1367 | Ga0207646_10065719 | |||
| 1368 | Ga0207646_10176822 | |||
| 1369 | Ga0207681_10002455 | |||
| 1370 | Ga0207681_10404072 | |||
| 1371 | Ga0207694_10237511 | |||
| 1372 | Ga0207650_10246261 | |||
| 1373 | Ga0207659_10189264 | |||
| 1374 | Ga0207687_10003950 | |||
| 1375 | Ga0207687_10016484 | |||
| 1376 | Ga0207687_10184012 | |||
| 1377 | Ga0207664_10331786 | |||
| 1378 | Ga0207644_10072069 | |||
| 1379 | Ga0207706_10040460 | |||
| 1380 | Ga0207706_10080777 | |||
| 1381 | Ga0207706_10149150 | |||
| 1382 | Ga0207686_10006692 | |||
| 1383 | Ga0207686_10064621 | |||
| 1384 | Ga0207709_10036753 | |||
| 1385 | Ga0207709_10049360 | |||
| 1386 | Ga0207709_10225211 | |||
| 1387 | Ga0207709_10234795 | |||
| 1388 | Ga0207670_10185603 | |||
| 1389 | Ga0207669_10043433 | |||
| 1390 | Ga0207704_10007060 | |||
| 1391 | Ga0207704_10460629 | |||
| 1392 | Ga0207665_10136272 | |||
| 1393 | Ga0207691_10059780 | |||
| 1394 | Ga0207691_10081129 | |||
| 1395 | Ga0207691_10119619 | |||
| 1396 | Ga0207711_10097521 | |||
| 1397 | Ga0207711_10411394 | |||
| 1398 | Ga0207689_10007163 | |||
| 1399 | Ga0207689_10036449 | |||
| 1400 | Ga0207689_10097726 | |||
| 1401 | Ga0207661_10219910 | |||
| 1402 | Ga0207679_10016081 | |||
| 1403 | Ga0207667_10033944 | |||
| 1404 | Ga0207667_10054565 | |||
| 1405 | Ga0207651_10195438 | |||
| 1406 | Ga0207712_10003113 | |||
| 1407 | Ga0207712_10003418 | |||
| 1408 | Ga0207712_10217206 | |||
| 1409 | Ga0207712_10244082 | |||
| 1410 | Ga0207668_10087785 | |||
| 1411 | Ga0207640_10014585 | |||
| 1412 | Ga0207640_10287323 | |||
| 1413 | Ga0207658_10106231 | |||
| 1414 | Ga0207677_10029879 | |||
| 1415 | Ga0207703_10013352 | |||
| 1416 | Ga0207703_10055811 | |||
| 1417 | Ga0207703_10084896 | |||
| 1418 | Ga0207703_10136321 | |||
| 1419 | Ga0207703_10278628 | |||
| 1420 | Ga0207703_10680861 | |||
| 1421 | Ga0207639_10004290 | |||
| 1422 | Ga0207639_10569432 | |||
| 1423 | Ga0207678_10003276 | |||
| 1424 | Ga0207708_10000142 | |||
| 1425 | Ga0207708_10000153 | |||
| 1426 | Ga0207708_10001509 | |||
| 1427 | Ga0207708_10026481 | |||
| 1428 | Ga0207708_10050676 | |||
| 1429 | Ga0207708_10070975 | |||
| 1430 | Ga0207708_10296444 | |||
| 1431 | Ga0207708_10345084 | |||
| 1432 | Ga0207702_10192198 | |||
| 1433 | Ga0207641_10075539 | |||
| 1434 | Ga0207641_10720362 | |||
| 1435 | Ga0207648_10000130 | |||
| 1436 | Ga0207648_10003264 | |||
| 1437 | Ga0207648_10081281 | |||
| 1438 | Ga0207676_10008709 | |||
| 1439 | Ga0207676_10203923 | |||
| 1440 | Ga0207674_10008447 | |||
| 1441 | Ga0207674_10014574 | |||
| 1442 | Ga0207674_10147265 | |||
| 1443 | Ga0207675_100000253 | |||
| 1444 | Ga0207675_100000648 | |||
| 1445 | Ga0207675_100105017 | |||
| 1446 | Ga0207675_100151459 | |||
| 1447 | Ga0207675_100185079 | |||
| 1448 | Ga0207683_10023791 | |||
| 1449 | Ga0209969_1002469 | |||
| 1450 | Ga0209981_1012871 | |||
| 1451 | Ga0209996_1000475 | |||
| 1452 | Ga0209996_1004059 | |||
| 1453 | Ga0209996_1008521 | |||
| 1454 | Ga0210000_1001307 | |||
| 1455 | Ga0210000_1001320 | |||
| 1456 | Ga0209995_1005928 | |||
| 1457 | Ga0209968_1001005 | |||
| 1458 | Ga0209968_1005706 | |||
| 1459 | Ga0209968_1015897 | |||
| 1460 | Ga0209999_1008492 | |||
| 1461 | Ga0209983_1000380 | |||
| 1462 | Ga0209971_1000228 | |||
| 1463 | Ga0209971_1006441 | |||
| 1464 | Ga0209966_1000098 | |||
| 1465 | Ga0209998_10000125 | |||
| 1466 | Ga0209813_10006973 | |||
| 1467 | Ga0209813_10035293 | |||
| 1468 | Ga0209974_10004008 | |||
| 1469 | Ga0207428_10000721 | |||
| 1470 | Ga0207428_10012105 | |||
| 1471 | Ga0207428_10209626 | |||
| 1472 | Ga0268265_10000627 | |||
| 1473 | Ga0268265_10000885 | |||
| 1474 | Ga0268265_10000939 | |||
| 1475 | Ga0268265_10006592 | |||
| 1476 | Ga0268265_10012099 | |||
| 1477 | Ga0268265_10200165 | |||
| 1478 | Ga0268264_10001246 | |||
| 1479 | Ga0268264_10047794 | |||
| 1480 | Ga0268264_10245600 | |||
| 1481 | Ga0268264_10249517 | |||
| 1482 | Ga0265338_10288882 | |||
| 1483 | Ga0265330_10032768 | |||
| 1484 | Ga0265320_10038673 | |||
| 1485 | Ga0265329_10038528 | |||
| 1486 | Ga0265339_10041981 | |||
| 1487 | Ga0265316_10019986 | |||
| 1488 | Ga0265316_10045361 | |||
| 1489 | Ga0307408_100070265 | |||
| 1490 | Ga0316575_10014633 | |||
| 1491 | Ga0316575_10020135 | |||
| 1492 | Ga0265342_10025824 | |||
| 1493 | Ga0265342_10027031 | |||
| 1494 | Ga0307416_100047257 | |||
| 1495 | Ga0307414_10360773 | |||
| 1496 | Ga0373950_0015439 | |||
| 1497 | Ga0373938_0009918 | |||
| 1498 | Ga0373926_0000320 | |||
| 1499 | Ga0373926_0002880 | |||
| 1500 | Ga0373940_0008635 | |||
| 1501 | Ga0373944_0007777 | |||
| 1502 | Ga0373952_0008135 | |||
| 1503 | Ga0373923_0015997 | |||
| 1504 | Ga0373932_0019320 | |||
| 1505 | Ga0373936_0013035 | |||
| 1506 | Ga0373936_0037929 | |||
| 1507 | Ga0373941_0009738 | |||
| 1508 | Ga0373945_0002043 | |||
| 1509 | Ga0373945_0012081 | |||
| 1510 | Ga0373954_0032281 | |||
| 1511 | Ga0373956_0032314 | |||
| 1512 | Ga0373957_0068681 | |||
| 1513 | Ga0373960_0010649 | |||
| 1514 | Ga0373943_0000424 | |||
| 1515 | Ga0373943_0006382 | |||
| 1516 | Ga0373943_0028636 | |||
| 1517 | Ga0373946_0003275 | |||
| 1518 | Ga0373946_0006545 | |||
| 1519 | Ga0373946_0020065 | |||
| 1520 | Ga0373955_0039290 | |||
| 1521 | Ga0373955_0310029 | |||
| 1522 | Ga0373962_0048074 | |||
| 1523 | Ga0316574_0004412 | |||
| 1524 | Ga0373931_0000207 | |||
| 1525 | Ga0373931_0002172 | |||
| 1526 | Ga0373931_0027600 | |||
| 1527 | Ga0373931_0094053 | |||
| 1528 | Ga0373931_0096222 | |||
| 1529 | Ga0373931_0152554 | |||
| 1530 | Ga0373931_0273544 | |||
| 1531 | Ga0373935_0000882 | |||
| 1532 | Ga0373935_0002678 | |||
| 1533 | Ga0373935_0006454 | |||
| 1534 | Ga0373935_0009918 | |||
| 1535 | Ga0373927_0000414 | |||
| 1536 | Ga0373927_0006828 | |||
| 1537 | Ga0373927_0025829 | |||
| 1538 | Ga0373927_0098409 | |||
| 1539 | Ga0373927_0149233 | |||
| 1540 | Ga0373933_0008780 | |||
| 1541 | Ga0373933_0123375 | |||
| 1542 | Ga0373947_0000275 | |||
| 1543 | Ga0373947_0007039 | |||
| 1544 | Ga0373947_0017419 | |||
| 1545 | Ga0373947_0066277 | |||
| 1546 | Ga0373937_0108121 | |||
| 1547 | Ga0373937_0134761 | |||
| 1548 | Ga0373937_0394453 | |||
| 1549 | Ga0373925_0002725 | |||
| 1550 | Ga0373925_0014839 | |||
| 1551 | Ga0373925_0087640 | |||
| 1552 | Ga0373925_0109429 | |||
| 1553 | Ga0395905_0537467 | |||
| 1554 | Ga0316581_0006661 | |||
| 1555 | Ga0436364_0147453 | |||
| 1556 | Ga0436364_0162358 | |||
| 1557 | Ga0436364_0676530 | |||
| 1558 | Ga0436364_0685371 | |||
| 1559 | Ga0436364_0700611 | |||
| 1560 | Ga0436364_0705174 | |||
| 1561 | Ga0436364_0760962 | |||
| 1562 | Ga0436364_1082407 | |||
| 1563 | Ga0436364_1114716 | |||
| 1564 | Ga0436365_0159339 | |||
| 1565 | Ga0436365_0736793 | |||
| 1566 | Ga0436365_1308054 | |||
| 1567 | Ga0436365_1837194 | |||
| 1568 | Ga0436365_1892164 | |||
| 1569 | Ga0436360_0404169 | |||
| 1570 | Ga0436360_0886479 | |||
| 1571 | Ga0436361_0847532 | |||
| 1572 | Ga0436363_0313348 | |||
| 1573 | Ga0436363_1475436 | |||
| 1574 | Ga0436362_1056133 | |||
| 1575 | Ga0436362_1066130 | |||
| 1576 | Ga0436362_1124287 | |||
| 1577 | Ga0439461_0030608 | |||
| 1578 | Ga0439441_001670 | |||
| 1579 | Ga0439441_002598 | |||
| 1580 | Ga0439443_002737 | |||
| 1581 | Ga0439450_012023 | |||
| 1582 | Ga0439446_0004940 | |||
| 1583 | Ga0439434_0003115 | |||
| 1584 | Ga0439434_0038426 | |||
| 1585 | Ga0439434_0056815 | |||
| 1586 | Ga0439435_0004837 | |||
| 1587 | Ga0439444_0001275 | |||
| 1588 | Ga0439459_0008227 | |||
| 1589 | Ga0439464_0020595 | |||
| 1590 | Ga0439464_0056003 | |||
| 1591 | Ga0439460_0001552 | |||
| 1592 | Ga0439460_0018435 | |||
| 1593 | Ga0451577_0204639 | |||
| 1594 | Ga0451577_0300010 | |||
| 1595 | Ga0451577_0343975 | |||
| 1596 | Ga0439440_0013406 | |||
| 1597 | Ga0453683_0025310 | |||
| 1598 | Ga0453684_0024772 | |||
| 1599 | Ga0451576_0030558 | |||
| 1600 | Ga0451576_0031269 | |||
| 1601 | Ga0451576_0034448 | |||
| 1602 | Ga0451576_0035065 | |||
| 1603 | Ga0451576_0253503 | |||
| 1604 | Ga0451576_0536241 | |||
| 1605 | Ga0466967_0251474 | |||
| 1606 | Ga0495603_0028409 | |||
| 1607 | Ga0495603_0244401 | |||
| 1608 | Ga0495629_0170376 | |||
| 1609 | Ga0495653_0057546 | |||
| 1610 | Ga0495653_0058032 | |||
| 1611 | Ga0495653_0233476 | |||
| 1612 | Ga0495580_0001270 | |||
| 1613 | Ga0495580_0058049 | |||
| 1614 | Ga0495662_0000261 | |||
| 1615 | Ga0495662_0016950 | |||
| 1616 | Ga0495662_0034302 | |||
| 1617 | Ga0495664_0000736 | |||
| 1618 | Ga0495608_0019659 | |||
| 1619 | Ga0495608_0128988 | |||
| 1620 | Ga0495618_0160733 | |||
| 1621 | Ga0495628_0202423 | |||
| 1622 | Ga0495630_0002218 | |||
| 1623 | Ga0495663_0030658 | |||
| 1624 | Ga0495666_0057274 | |||
| 1625 | Ga0495666_0166937 | |||
| 1626 | Ga0495652_0199677 | |||
| 1627 | Ga0495665_0024212 | |||
| 1628 | Ga0495640_0002964 | |||
| 1629 | Ga0495640_0013343 | |||
| 1630 | Ga0495640_0217321 | |||
| 1631 | Ga0495586_0001814 | |||
| 1632 | Ga0495586_0048291 | |||
| 1633 | Ga0495621_0019212 | |||
| 1634 | Ga0495621_0039933 | |||
| 1635 | Ga0495645_0002109 | |||
| 1636 | Ga0495667_0048970 | |||
| 1637 | Ga0495656_0044546 | |||
| 1638 | Ga0495634_0006321 | |||
| 1639 | Ga0495634_0017261 | |||
| 1640 | Ga0495634_0039498 | |||
| 1641 | Ga0495634_0223442 | |||
| 1642 | Ga0495625_0049301 | |||
| 1643 | Ga0495635_0000438 | |||
| 1644 | Ga0495588_0010367 | |||
| 1645 | Ga0495646_0022684 | |||
| 1646 | Ga0495647_0016640 | |||
| 1647 | Ga0495658_0005364 | |||
| 1648 | Ga0495658_0134032 | |||
| 1649 | Ga0495669_0005523 | |||
| 1650 | Ga0495613_0027628 | |||
| 1651 | Ga0495613_0122418 | |||
| 1652 | Ga0495613_0245809 | |||
| 1653 | Ga0495613_0307480 | |||
| 1654 | Ga0495624_0001570 | |||
| 1655 | Ga0495624_0064570 | |||
| 1656 | Ga0495600_0028225 | |||
| 1657 | Ga0495581_0025033 | |||
| 1658 | Ga0495604_0346453 | |||
| 1659 | Ga0495674_0000209 | |||
| 1660 | Ga0495674_0024470 | |||
| 1661 | Ga0495674_0314268 | |||
| 1662 | Ga0495676_0033822 | |||
| 1663 | Ga0495676_0047447 | |||
| 1664 | Ga0495676_0085983 | |||
| 1665 | Ga0495680_0386936 | |||
| 1666 | Ga0495684_0001766 | |||
| 1667 | Ga0495684_0003044 | |||
| 1668 | Ga0495684_0049314 | |||
| 1669 | Ga0495593_0007179 | |||
| 1670 | Ga0495602_0080662 | |||
| 1671 | Ga0495602_0454798 | |||
| 1672 | Ga0495615_0012423 | |||
| 1673 | Ga0496100_0134321 | |||
| 1674 | Ga0496100_0207228 | |||
| 1675 | Ga0496100_0332254 | |||
| 1676 | Ga0496101_0424249 | |||
| 1677 | Ga0496102_0010995 | |||
| 1678 | Ga0496102_0176348 | |||
| 1679 | Ga0496103_0030761 | |||
| 1680 | Ga0496104_0006466 | |||
| 1681 | Ga0496104_0011676 | |||
| 1682 | Ga0496104_0035653 | |||
| 1683 | Ga0496104_0040885 | |||
| 1684 | Ga0496105_0000783 | |||
| 1685 | Ga0496105_0006116 | |||
| 1686 | Ga0496105_0017779 | |||
| 1687 | Ga0496105_0037299 | |||
| 1688 | Ga0496106_0002235 | |||
| 1689 | Ga0496106_0094236 | |||
| 1690 | Ga0496106_0108221 | |||
| 1691 | Ga0496106_0209392 | |||
| 1692 | Ga0496107_0005679 | |||
| 1693 | Ga0496108_0000783 | |||
| 1694 | Ga0496108_0005523 | |||
| 1695 | Ga0496109_0002516 | |||
| 1696 | Ga0496109_0044666 | |||
| 1697 | Ga0496110_0023893 | |||
| 1698 | Ga0496110_0039288 | |||
| 1699 | Ga0496110_0163933 | |||
| 1700 | Ga0496110_0192729 | |||
| 1701 | Ga0496110_0227850 | |||
| 1702 | Ga0496110_0444194 | |||
| 1703 | Ga0496111_0000495 | |||
| 1704 | Ga0496111_0012998 | |||
| 1705 | Ga0496112_0003524 | |||
| 1706 | Ga0496112_0008371 | |||
| 1707 | Ga0496113_0000529 | |||
| 1708 | Ga0496114_0109194 | |||
| 1709 | Ga0496114_0167669 | |||
| 1710 | Ga0496115_0004616 | |||
| 1711 | Ga0496115_0156652 | |||
| 1712 | Ga0496115_0376978 | |||
| 1713 | Ga0496117_0032979 | |||
| 1714 | Ga0496120_0106075 | |||
| 1715 | Ga0496122_0017063 | |||
| 1716 | Ga0496124_0012283 | |||
| 1717 | Ga0496124_0087643 | |||
| 1718 | Ga0496125_0002695 | |||
| 1719 | Ga0501033_0083116 | |||
| 1720 | Ga0501033_0201346 | |||
| 1721 | Ga0501034_0019935 | |||
| 1722 | Ga0501034_0273000 | |||
| 1723 | Ga0501036_0001382 | |||
| 1724 | Ga0501036_0020963 | |||
| 1725 | Ga0501036_0103560 | |||
| 1726 | Ga0501036_0111786 | |||
| 1727 | Ga0501036_0190621 | |||
| 1728 | Ga0501037_0003480 | |||
| 1729 | Ga0501037_0154252 | |||
| 1730 | Ga0501038_0000646 | |||
| 1731 | Ga0501038_0012439 | |||
| 1732 | Ga0501038_0073051 | |||
| 1733 | Ga0501038_0191459 | |||
| 1734 | Ga0501038_0342704 | |||
| 1735 | Ga0501038_0378757 | |||
| 1736 | Ga0501039_0001534 | |||
| 1737 | Ga0501039_0112756 | |||
| 1738 | Ga0501039_0137082 | |||
| 1739 | Ga0501039_0157905 | |||
| 1740 | Ga0501039_0175265 | |||
| 1741 | Ga0501039_0280225 | |||
| 1742 | Ga0501040_0000087 | |||
| 1743 | Ga0501040_0017509 | |||
| 1744 | Ga0501041_0002380 | |||
| 1745 | Ga0501041_0007945 | |||
| 1746 | Ga0501041_0021655 | |||
| 1747 | Ga0501041_0074019 | |||
| 1748 | Ga0501041_0132095 | |||
| 1749 | Ga0501041_0137561 | |||
| 1750 | Ga0501041_0195047 | |||
| 1751 | Ga0501041_0214942 | |||
| 1752 | Ga0501042_0000957 | |||
| 1753 | Ga0501042_0002829 | |||
| 1754 | Ga0501042_0038500 | |||
| 1755 | Ga0501042_0040685 | |||
| 1756 | Ga0501043_0008327 | |||
| 1757 | Ga0501043_0008730 | |||
| 1758 | Ga0501043_0240942 | |||
| 1759 | Ga0501043_0254530 | |||
| 1760 | Ga0501043_0286800 | |||
| 1761 | Ga0501046_0000364 | |||
| 1762 | Ga0501046_0022776 | |||
| 1763 | Ga0501046_0036174 | |||
| 1764 | Ga0501046_0042825 | |||
| 1765 | Ga0501046_0068487 | |||
| 1766 | Ga0501046_0112204 | |||
| 1767 | Ga0501047_0028382 | |||
| 1768 | Ga0501048_0001228 | |||
| 1769 | Ga0501048_0017702 | |||
| 1770 | Ga0501048_0024555 | |||
| 1771 | Ga0501048_0026590 | |||
| 1772 | Ga0501048_0152336 | |||
| 1773 | Ga0501048_0249039 | |||
| 1774 | Ga0501067_0037054 | |||
| 1775 | Ga0501068_0011606 | |||
| 1776 | Ga0501068_0040132 | |||
| 1777 | Ga0501068_0054258 | |||
| 1778 | Ga0501068_0064794 | |||
| 1779 | Ga0501069_0026341 | |||
| 1780 | Ga0501069_0103036 | |||
| 1781 | Ga0501069_0260763 | |||
| 1782 | Ga0501070_0373034 | |||
| 1783 | Ga0501071_0000156 | |||
| 1784 | Ga0501071_0001439 | |||
| 1785 | Ga0501071_0045592 | |||
| 1786 | Ga0501071_0055335 | |||
| 1787 | Ga0501071_0146449 | |||
| 1788 | Ga0501072_0000252 | |||
| 1789 | Ga0501072_0002340 | |||
| 1790 | Ga0501072_0011074 | |||
| 1791 | Ga0501072_0014152 | |||
| 1792 | Ga0501072_0015235 | |||
| 1793 | Ga0501072_0084821 | |||
| 1794 | Ga0501072_0108041 | |||
| 1795 | Ga0501072_0142384 | |||
| 1796 | Ga0501072_0191446 | |||
| 1797 | Ga0501072_0251166 | |||
| 1798 | Ga0501072_0262130 | |||
| 1799 | Ga0501073_0085182 | |||
| 1800 | Ga0501073_0237298 | |||
| 1801 | Ga0501074_0001338 | |||
| 1802 | Ga0501074_0035939 | |||
| 1803 | Ga0501074_0075577 | |||
| 1804 | Ga0501074_0220011 | |||
| 1805 | Ga0501074_0251630 | |||
| 1806 | Ga0501075_0000004 | |||
| 1807 | Ga0501075_0000058 | |||
| 1808 | Ga0501075_0045061 | |||
| 1809 | Ga0501075_0074851 | |||
| 1810 | Ga0501075_0287979 | |||
| 1811 | Ga0501076_0000729 | |||
| 1812 | Ga0501076_0000774 | |||
| 1813 | Ga0501076_0005575 | |||
| 1814 | Ga0501076_0006035 | |||
| 1815 | Ga0501076_0008073 | |||
| 1816 | Ga0501076_0015076 | |||
| 1817 | Ga0501076_0104111 | |||
| 1818 | Ga0501077_0000178 | |||
| 1819 | Ga0501077_0022957 | |||
| 1820 | Ga0501077_0106072 | |||
| 1821 | Ga0501077_0171686 | |||
| 1822 | Ga0501077_0204832 | |||
| 1823 | Ga0501079_0000022 | |||
| 1824 | Ga0501079_0005648 | |||
| 1825 | Ga0501079_0032205 | |||
| 1826 | Ga0501079_0051015 | |||
| 1827 | Ga0501079_0068313 | |||
| 1828 | Ga0501079_0074885 | |||
| 1829 | Ga0501079_0096889 | |||
| 1830 | Ga0501079_0165351 | |||
| 1831 | Ga0501079_0215556 | |||
| 1832 | Ga0501080_0001368 | |||
| 1833 | Ga0501080_0007494 | |||
| 1834 | Ga0501080_0011566 | |||
| 1835 | Ga0501080_0013259 | |||
| 1836 | Ga0501080_0014988 | |||
| 1837 | Ga0501080_0091352 | |||
| 1838 | Ga0501080_0163888 | |||
| 1839 | Ga0501080_0263607 | |||
| 1840 | Ga0501080_0322145 | |||
| 1841 | Ga0501081_0000774 | |||
| 1842 | Ga0501081_0005054 | |||
| 1843 | Ga0501081_0043796 | |||
| 1844 | Ga0501081_0090558 | |||
| 1845 | Ga0501081_0110500 | |||
| 1846 | Ga0501081_0259297 | |||
| 1847 | Ga0501083_0009935 | |||
| 1848 | Ga0501083_0066623 | |||
| 1849 | Ga0501083_0084820 | |||
| 1850 | Ga0501083_0100994 | |||
| 1851 | Ga0501083_0170035 | |||
| 1852 | Ga0501083_0212132 | |||
| 1853 | Ga0501035_0001252 | |||
| 1854 | Ga0501035_0031108 | |||
| 1855 | Ga0501035_0216312 | |||
| 1856 | Ga0501044_0097643 | |||
| 1857 | Ga0501045_0001164 | |||
| 1858 | Ga0501045_0005395 | |||
| 1859 | Ga0501045_0038943 | |||
| 1860 | Ga0501045_0039692 | |||
| 1861 | Ga0501045_0050317 | |||
| 1862 | Ga0501045_0053256 | |||
| 1863 | Ga0501045_0067775 | |||
| 1864 | Ga0501045_0345062 | |||
| 1865 | nmdc:mga03n38_70088_c1 | |||
| 1866 | nmdc:mga00v17_42716_c1 | |||
| 1867 | nmdc:mga00v17_663_c1 | |||
| 1868 | nmdc:mga0yw44_125726_c1 | |||
| 1869 | nmdc:mga0yw44_241100_c1 | |||
| 1870 | nmdc:mga0yw44_6134_c1 | |||
| 1871 | nmdc:mga0k408_144836_c1 | |||
| 1872 | nmdc:mga0k408_21840_c1 | |||
| 1873 | nmdc:mga06z11_1221_c1 | |||
| 1874 | nmdc:mga06z11_14795_c1 | |||
| 1875 | nmdc:mga06z11_4849_c1 | |||
| 1876 | nmdc:mga04h51_18663_c1 | |||
| 1877 | nmdc:mga04h51_5277_c1 | |||
| 1878 | nmdc:mga07m45_140965_c1 | |||
| 1879 | nmdc:mga05p37_11593_c1 | |||
| 1880 | nmdc:mga05p37_286168_c1 | |||
| 1881 | nmdc:mga05p37_3149_c1 | |||
| 1882 | nmdc:mga05p37_3283_c1 | |||
| 1883 | nmdc:mga05p37_53751_c1 | |||
| 1884 | nmdc:mga05p37_591813_c1 | |||
| 1885 | nmdc:mga05p37_710_c2 | |||
| 1886 | nmdc:mga09592_126_c1 | |||
| 1887 | nmdc:mga09592_1332_c1 | |||
| 1888 | nmdc:mga09592_3063_c1 | |||
| 1889 | nmdc:mga09592_4616_c1 | |||
| 1890 | nmdc:mga09592_51499_c1 | |||
| 1891 | nmdc:mga09592_77287_c1 | |||
| 1892 | nmdc:mga0qj67_132673_c1 | |||
| 1893 | nmdc:mga0qj67_2393_c1 | |||
| 1894 | nmdc:mga06r32_100774_c1 | |||
| 1895 | nmdc:mga06r32_178409_c1 | |||
| 1896 | nmdc:mga06r32_2441_c1 | |||
| 1897 | nmdc:mga06r32_256198_c1 | |||
| 1898 | nmdc:mga06r32_343670_c1 | |||
| 1899 | nmdc:mga06r32_4_c1 | |||
| 1900 | nmdc:mga06r32_6022_c1 | |||
| 1901 | nmdc:mga06r32_61903_c1 | |||
| 1902 | nmdc:mga06r32_63545_c1 | |||
| 1903 | nmdc:mga06r32_7414_c1 | |||
| 1904 | nmdc:mga08y16_1078_c1 | |||
| 1905 | nmdc:mga08y16_156104_c1 | |||
| 1906 | nmdc:mga08y16_16843_c1 | |||
| 1907 | nmdc:mga08y16_182193_c1 | |||
| 1908 | nmdc:mga08y16_39253_c1 | |||
| 1909 | nmdc:mga08y16_399621_c1 | |||
| 1910 | nmdc:mga08y16_4436_c1 | |||
| 1911 | nmdc:mga0n895_110942_c1 | |||
| 1912 | nmdc:mga0n895_1570_c1 | |||
| 1913 | nmdc:mga0n895_3956_c1 | |||
| 1914 | nmdc:mga0n895_401522_c1 | |||
| 1915 | nmdc:mga0n895_42634_c1 | |||
| 1916 | nmdc:mga0n895_50020_c1 | |||
| 1917 | nmdc:mga0rr50_18250_c1 | |||
| 1918 | nmdc:mga0rr50_315148_c1 | |||
| 1919 | nmdc:mga0rr50_359_c1 | |||
| 1920 | nmdc:mga0rr50_55745_c1 | |||
| 1921 | nmdc:mga08x19_120397_c1 | |||
| 1922 | nmdc:mga08x19_12690_c1 | |||
| 1923 | nmdc:mga08x19_20446_c1 | |||
| 1924 | nmdc:mga08x19_245588_c1 | |||
| 1925 | nmdc:mga08x19_47006_c1 | |||
| 1926 | nmdc:mga0a205_1075_c1 | |||
| 1927 | nmdc:mga0a205_16420_c1 | |||
| 1928 | nmdc:mga0a205_297825_c1 | |||
| 1929 | nmdc:mga0a205_311895_c1 | |||
| 1930 | nmdc:mga0a205_34387_c1 | |||
| 1931 | nmdc:mga0a205_93_c2 | |||
| 1932 | nmdc:mga0sz30_68952_c1 | |||
| 1933 | Ga0495601_0001471 | |||
| 1934 | Ga0495601_0035335 | |||
| 1935 | Ga0495601_0310879 | |||
| 1936 | Ga0495612_0000353 | |||
| 1937 | Ga0495595_0036616 | |||
| 1938 | Ga0495619_0001077 | |||
| 1939 | Ga0495619_0084025 | |||
| 1940 | Ga0500658_0085078 | |||
| 1941 | Ga0500568_0002596 | |||
| 1942 | Ga0500577_0029867 | |||
| 1943 | Ga0500616_0095822 | |||
| 1944 | Ga0501084_0000157 | |||
| 1945 | Ga0501084_0002367 | |||
| 1946 | Ga0501084_0039329 | |||
| 1947 | Ga0501084_0053208 | |||
| 1948 | Ga0501084_0113461 | |||
| 1949 | Ga0501084_0225774 | |||
| 1950 | Ga0501084_0250867 | |||
| 1951 | Ga0501084_0410885 | |||
| 1952 | Ga0501082_0000050 | |||
| 1953 | Ga0501082_0000341 | |||
| 1954 | Ga0501082_0001651 | |||
| 1955 | Ga0501082_0063226 | |||
| 1956 | Ga0501082_0100457 | |||
| 1957 | Ga0501082_0152329 | |||
| 1958 | Ga0501082_0160913 | |||
| 1959 | Ga0501082_0199196 | |||
| 1960 | Ga0530510_0000084 | |||
| 1961 | Ga0530510_0000222 | |||
| 1962 | Ga0530510_0002069 | |||
| 1963 | Ga0530510_0002542 | |||
| 1964 | Ga0530510_0003261 | |||
| 1965 | Ga0530510_0004269 | |||
| 1966 | Ga0530510_0010377 | |||
| 1967 | Ga0530510_0039127 | |||
| 1968 | Ga0530510_0115418 | |||
| 1969 | Ga0530510_0298034 | |||
| 1970 | 2776910825 | |||
| 1971 | 2883581241 | |||
| 1972 | 2894773134 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4g1u-assembly1.cif.gz_B | x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis | 0.5677 | 5 | 276 |
| 1l7v-assembly1.cif.gz_B | bacterial abc transporter involved in b12 uptake | 0.5571 | 8 | 274 |
| 7kyo-assembly1.cif.gz_C-2 | psabc from streptococcus pneumoniae in complex with fab | 0.5423 | 6 | 281 |
| 4g1u-assembly1.cif.gz_B | x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis | 0.5422 | 5 | 276 |
| 7kyp-assembly4.cif.gz_N | psabc from streptococcus pneumoniae in complex with fab | 0.5396 | 13 | 281 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AEX7_11_292_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8987 | 11 | 275 | 1.10.3470.10 |
| af_P0AEX7_11_292_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8448 | 11 | 275 | 1.10.3470.10 |
| af_Q58665_14_295_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8221 | 9 | 277 | 1.10.3470.10 |
| af_Q58665_14_295_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7848 | 9 | 277 | 1.10.3470.10 |
| af_P77672_36_301_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7785 | 8 | 275 | 1.10.3470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7A8I3-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9693 | 2 | 288 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A2V7A8I3-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.966 | 2 | 288 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A2V6Z4S1-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9626 | 48 | 288 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A147K391-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9606 | 1 | 288 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A1W9U1L0-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9589 | 7 | 287 |
GO:0005886
GO:0006865 GO:0022857 |