F487530
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 986 | 573 | 1972 | 280 |
Family's Representative Sequence
| Representative Sequence | 3300046455|Ga0495603_0031784|Ga0495603_0031784_378_1382 |
| Length | 334 |
| Sequence | MIFCAKKCAISGLFTFALRGEGASIAQSIAVLRFFMIAIRGVTVGAAHSRIVVMNSFTIRTMRPDEISLAVDWAAAEGWNPGLADDACFASVDPEGFFIAELDGKPVATVSCVNYDARFAFLGFYMVRADLRGKGFGLRIWDAAIAHAGARVIGLDGVVAQQENYKKSGFQLAYANVRYGGTVVAAPAAPRTDIMALSDIPFAAVEADDATVFPAPRSAFLRAWIGARGHIGCALMRDGRLAGWGVIRPCRKGFKIGPLVADDRASAEVVLSALLARVGGGEIFLDVPGINREAIALAQDFGLAPVFETARMYTGAIPPLRMQRVFGVTSFELG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 9 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 76 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 77 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 87 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 88 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 89 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 92 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 119 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 120 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 121 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 122 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 123 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 191 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 192 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 193 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 194 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 197 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 201 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 202 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 204 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 205 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 206 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 207 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 209 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 210 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 211 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 212 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 213 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 214 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 215 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 216 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 217 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 218 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 219 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 220 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 221 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 222 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 224 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 225 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 228 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 229 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 231 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 234 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 237 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 238 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 239 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 242 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 243 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 244 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 245 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 246 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 247 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 248 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 249 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 250 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 251 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 252 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 253 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 254 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 255 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 256 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 321 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 322 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 323 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 324 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 325 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 326 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 329 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 330 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 331 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 332 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 333 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 334 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 335 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 336 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 337 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 338 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 339 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 340 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 341 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 342 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 348 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 349 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 350 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 351 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 352 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 353 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 354 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 363 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 366 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 367 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 368 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 369 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 370 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 371 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 372 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 373 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 374 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 375 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 376 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 377 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 378 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 379 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 380 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 381 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 383 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 384 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 385 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 386 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 387 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 388 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 389 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 390 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 391 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 392 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 393 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 394 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 395 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 396 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 397 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 398 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 399 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 400 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 401 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 402 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 403 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 404 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 405 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 406 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 407 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 408 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 409 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 410 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 411 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 412 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 413 | 2791355199 | |||
| 414 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 415 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 416 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 417 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 418 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 419 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 420 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 421 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 422 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 423 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 424 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 425 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 426 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 427 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 428 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 429 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 430 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 431 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 432 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 433 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 434 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 435 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 436 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 437 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 438 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 439 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 440 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 441 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 442 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 443 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 444 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 445 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 446 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 447 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 448 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 449 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 450 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 451 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 452 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 453 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 454 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 455 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 456 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 457 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 458 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 459 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 460 | 2904699407 | |||
| 461 | 2906610324 | |||
| 462 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 463 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 464 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 465 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 466 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 467 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 468 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 469 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 470 | 2922368715 | |||
| 471 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 472 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 473 | 2922425934 | |||
| 474 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 475 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 476 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 477 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 478 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 479 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 480 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 481 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 482 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 483 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 484 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 485 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 486 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 487 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 488 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 489 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 490 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 491 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 492 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 493 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 494 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 495 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 496 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 497 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 498 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 499 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 500 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 501 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 502 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 503 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 504 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 505 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 506 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 507 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 508 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 509 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 510 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 511 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 512 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 513 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 514 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 515 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 516 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 517 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 518 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 519 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 520 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 521 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 522 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 523 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 524 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 525 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 526 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 527 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 528 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 529 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 530 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 531 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 532 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 533 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 534 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 535 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 536 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 537 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 538 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 539 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 540 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 541 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 542 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 543 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 544 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 545 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 546 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 547 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 548 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 549 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 550 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 551 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 552 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 553 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 554 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 555 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 556 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 557 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 558 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 559 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 560 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 561 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 562 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 563 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 564 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 565 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 566 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 567 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 568 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 569 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 570 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 571 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 572 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 573 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.14 |
| Metatranscriptomes | 0 |
| Isolates | 18.86 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.51 |
| Nodule | 16.53 |
| Rhizoplane | 6.49 |
| Rhizosphere | 60.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495603_0031784 | 3300046455 | Bacteria | 3178 |
| 2 | JGI25153J46596_10001348 | 3300003215 | Bacteria | 14698 |
| 3 | JGI25153J46596_10005113 | 3300003215 | Bacteria | 6921 |
| 4 | rootH2_10194050 | 3300003320 | Bacteria | 1150 |
| 5 | rootH1_10218802 | 3300003323 | Bacteria | 1221 |
| 6 | JGI25404J52841_10002324 | 3300003659 | Bacteria | 3580 |
| 7 | JGI25404J52841_10011848 | 3300003659 | Bacteria | 1884 |
| 8 | Ga0055542_1007676 | 3300003762 | Bacteria | 2168 |
| 9 | Ga0055531_10017327 | 3300003794 | Bacteria | 3049 |
| 10 | JGI25405J52794_10022700 | 3300003911 | Bacteria | 1274 |
| 11 | Ga0055543_1015382 | 3300004625 | Bacteria | 1474 |
| 12 | Ga0070658_10035994 | 3300005327 | Bacteria | 3989 |
| 13 | Ga0070658_10092501 | 3300005327 | Bacteria | 2493 |
| 14 | Ga0070658_10282547 | 3300005327 | Bacteria | 1413 |
| 15 | Ga0070676_10026600 | 3300005328 | Bacteria | 3276 |
| 16 | Ga0070683_100247212 | 3300005329 | Bacteria | 1696 |
| 17 | Ga0070690_100028466 | 3300005330 | Bacteria | 3461 |
| 18 | Ga0070670_100240832 | 3300005331 | Bacteria | 1575 |
| 19 | Ga0068869_100011695 | 3300005334 | Bacteria | 5767 |
| 20 | Ga0070666_10058884 | 3300005335 | Bacteria | 2598 |
| 21 | Ga0068868_100025028 | 3300005338 | Bacteria | 4534 |
| 22 | Ga0068868_100077386 | 3300005338 | Bacteria | 2661 |
| 23 | Ga0068868_100080433 | 3300005338 | Bacteria | 2612 |
| 24 | Ga0070689_100360228 | 3300005340 | Bacteria | 1222 |
| 25 | Ga0070661_100018105 | 3300005344 | Bacteria | 5005 |
| 26 | Ga0070668_100034971 | 3300005347 | Bacteria | 3829 |
| 27 | Ga0070668_100041085 | 3300005347 | Bacteria | 3543 |
| 28 | Ga0070668_100050372 | 3300005347 | Bacteria | 3206 |
| 29 | Ga0070668_100093700 | 3300005347 | Bacteria | 2370 |
| 30 | Ga0070668_100123454 | 3300005347 | Bacteria | 2072 |
| 31 | Ga0070668_100472798 | 3300005347 | Bacteria | 1081 |
| 32 | Ga0070668_100512617 | 3300005347 | Bacteria | 1040 |
| 33 | Ga0070669_100096764 | 3300005353 | Bacteria | 2221 |
| 34 | Ga0070669_100270370 | 3300005353 | Bacteria | 1359 |
| 35 | Ga0070675_100015290 | 3300005354 | Bacteria | 6064 |
| 36 | Ga0070675_100139137 | 3300005354 | Bacteria | 2074 |
| 37 | Ga0070675_100144007 | 3300005354 | Bacteria | 2039 |
| 38 | Ga0070675_100172639 | 3300005354 | Bacteria | 1865 |
| 39 | Ga0070675_100260914 | 3300005354 | Bacteria | 1518 |
| 40 | Ga0070671_100084323 | 3300005355 | Bacteria | 2657 |
| 41 | Ga0070671_100467827 | 3300005355 | Bacteria | 1082 |
| 42 | Ga0070671_100569626 | 3300005355 | Bacteria | 977 |
| 43 | Ga0070674_100005849 | 3300005356 | Bacteria | 7151 |
| 44 | Ga0070674_100286185 | 3300005356 | Bacteria | 1308 |
| 45 | Ga0070674_100380114 | 3300005356 | Bacteria | 1149 |
| 46 | Ga0070673_100049195 | 3300005364 | Bacteria | 3291 |
| 47 | Ga0070673_100083303 | 3300005364 | Bacteria | 2598 |
| 48 | Ga0070673_100116694 | 3300005364 | Bacteria | 2221 |
| 49 | Ga0070673_100497786 | 3300005364 | Bacteria | 1102 |
| 50 | Ga0070688_100188968 | 3300005365 | Bacteria | 1434 |
| 51 | Ga0070688_100247229 | 3300005365 | Bacteria | 1269 |
| 52 | Ga0070659_100085056 | 3300005366 | Unclassified | 2530 |
| 53 | Ga0070667_100058981 | 3300005367 | Bacteria | 3246 |
| 54 | Ga0070667_100234682 | 3300005367 | Bacteria | 1636 |
| 55 | Ga0070667_100390250 | 3300005367 | Bacteria | 1266 |
| 56 | Ga0070709_10007981 | 3300005434 | Bacteria | 5816 |
| 57 | Ga0070709_10010010 | 3300005434 | Bacteria | 5240 |
| 58 | Ga0070713_100018061 | 3300005436 | Bacteria | 5356 |
| 59 | Ga0070713_100078575 | 3300005436 | Bacteria | 2809 |
| 60 | Ga0070711_100017786 | 3300005439 | Bacteria | 4529 |
| 61 | Ga0070711_100217823 | 3300005439 | Bacteria | 1482 |
| 62 | Ga0070700_100059967 | 3300005441 | Bacteria | 2397 |
| 63 | Ga0070700_100207291 | 3300005441 | Bacteria | 1381 |
| 64 | Ga0070700_100245844 | 3300005441 | Bacteria | 1281 |
| 65 | Ga0070708_100032898 | 3300005445 | Bacteria | 4501 |
| 66 | Ga0070663_100015862 | 3300005455 | Bacteria | 4876 |
| 67 | Ga0070663_100028129 | 3300005455 | Bacteria | 3823 |
| 68 | Ga0070663_100031284 | 3300005455 | Bacteria | 3656 |
| 69 | Ga0070663_100047543 | 3300005455 | Bacteria | 3039 |
| 70 | Ga0070663_100129979 | 3300005455 | Bacteria | 1911 |
| 71 | Ga0070663_100153088 | 3300005455 | Bacteria | 1770 |
| 72 | Ga0070663_100179236 | 3300005455 | Bacteria | 1642 |
| 73 | Ga0070663_100396955 | 3300005455 | Bacteria | 1126 |
| 74 | Ga0070678_100017583 | 3300005456 | Bacteria | 4611 |
| 75 | Ga0070678_100025842 | 3300005456 | Bacteria | 3959 |
| 76 | Ga0070678_100040466 | 3300005456 | Bacteria | 3298 |
| 77 | Ga0070678_100043604 | 3300005456 | Bacteria | 3196 |
| 78 | Ga0070662_100128561 | 3300005457 | Bacteria | 1950 |
| 79 | Ga0070662_100145515 | 3300005457 | Bacteria | 1841 |
| 80 | Ga0070681_10020209 | 3300005458 | Bacteria | 6675 |
| 81 | Ga0068867_100134850 | 3300005459 | Bacteria | 1923 |
| 82 | Ga0070685_10015586 | 3300005466 | Bacteria | 4039 |
| 83 | Ga0070706_100288427 | 3300005467 | Bacteria | 1532 |
| 84 | Ga0070707_100179894 | 3300005468 | Bacteria | 2061 |
| 85 | Ga0070699_100027008 | 3300005518 | Bacteria | 4951 |
| 86 | Ga0070679_100142014 | 3300005530 | Unclassified | 2380 |
| 87 | Ga0070684_100132544 | 3300005535 | Bacteria | 2248 |
| 88 | Ga0070697_100191014 | 3300005536 | Bacteria | 1738 |
| 89 | Ga0068853_100053977 | 3300005539 | Bacteria | 3462 |
| 90 | Ga0068853_100115324 | 3300005539 | Bacteria | 2390 |
| 91 | Ga0068853_100151042 | 3300005539 | Bacteria | 2091 |
| 92 | Ga0068853_100268674 | 3300005539 | Bacteria | 1570 |
| 93 | Ga0070672_100108422 | 3300005543 | Bacteria | 2261 |
| 94 | Ga0070672_100163889 | 3300005543 | Bacteria | 1846 |
| 95 | Ga0070695_100000851 | 3300005545 | Bacteria | 16425 |
| 96 | Ga0070665_100003924 | 3300005548 | Bacteria | 15697 |
| 97 | Ga0070665_100011644 | 3300005548 | Bacteria | 8889 |
| 98 | Ga0070665_100015331 | 3300005548 | Bacteria | 7695 |
| 99 | Ga0070665_100039788 | 3300005548 | Bacteria | 4726 |
| 100 | Ga0070665_100064243 | 3300005548 | Bacteria | 3680 |
| 101 | Ga0070665_100093475 | 3300005548 | Bacteria | 3012 |
| 102 | Ga0070665_100278819 | 3300005548 | Bacteria | 1673 |
| 103 | Ga0070704_100152049 | 3300005549 | Bacteria | 1821 |
| 104 | Ga0070704_100603643 | 3300005549 | Bacteria | 965 |
| 105 | Ga0068855_100139627 | 3300005563 | Bacteria | 2763 |
| 106 | Ga0068855_100140841 | 3300005563 | Bacteria | 2749 |
| 107 | Ga0068855_100352618 | 3300005563 | Bacteria | 1621 |
| 108 | Ga0070664_100074858 | 3300005564 | Bacteria | 2907 |
| 109 | Ga0070664_100114539 | 3300005564 | Bacteria | 2356 |
| 110 | Ga0068857_100768090 | 3300005577 | Bacteria | 919 |
| 111 | Ga0068854_100180415 | 3300005578 | Bacteria | 1649 |
| 112 | Ga0070702_100009600 | 3300005615 | Bacteria | 4744 |
| 113 | Ga0068859_100116234 | 3300005617 | Bacteria | 2739 |
| 114 | Ga0068859_100334823 | 3300005617 | Bacteria | 1608 |
| 115 | Ga0068864_100083414 | 3300005618 | Bacteria | 2806 |
| 116 | Ga0068866_10049442 | 3300005718 | Bacteria | 2131 |
| 117 | Ga0068861_100094526 | 3300005719 | Bacteria | 2365 |
| 118 | Ga0068861_100109378 | 3300005719 | Bacteria | 2212 |
| 119 | Ga0068861_100209411 | 3300005719 | Bacteria | 1641 |
| 120 | Ga0068861_100235133 | 3300005719 | Bacteria | 1556 |
| 121 | Ga0068863_100120646 | 3300005841 | Bacteria | 2500 |
| 122 | Ga0068863_100153799 | 3300005841 | Bacteria | 2202 |
| 123 | Ga0068863_100186494 | 3300005841 | Bacteria | 1992 |
| 124 | Ga0068863_100426709 | 3300005841 | Bacteria | 1299 |
| 125 | Ga0068858_100034300 | 3300005842 | Bacteria | 4707 |
| 126 | Ga0068858_100049819 | 3300005842 | Bacteria | 3878 |
| 127 | Ga0068858_100088988 | 3300005842 | Bacteria | 2873 |
| 128 | Ga0068858_100191614 | 3300005842 | Bacteria | 1932 |
| 129 | Ga0068858_100335497 | 3300005842 | Bacteria | 1446 |
| 130 | Ga0068860_100009962 | 3300005843 | Bacteria | 9418 |
| 131 | Ga0068860_100017045 | 3300005843 | Bacteria | 7081 |
| 132 | Ga0068862_100018832 | 3300005844 | Bacteria | 5753 |
| 133 | Ga0068862_100049355 | 3300005844 | Bacteria | 3594 |
| 134 | Ga0068862_100155323 | 3300005844 | Bacteria | 2039 |
| 135 | Ga0068862_100440358 | 3300005844 | Bacteria | 1226 |
| 136 | Ga0068862_100468346 | 3300005844 | Bacteria | 1190 |
| 137 | Ga0081455_10001207 | 3300005937 | Bacteria | 32353 |
| 138 | Ga0081455_10002021 | 3300005937 | Bacteria | 24257 |
| 139 | Ga0081455_10005151 | 3300005937 | Bacteria | 14395 |
| 140 | Ga0081455_10012489 | 3300005937 | Bacteria | 8475 |
| 141 | Ga0081455_10026629 | 3300005937 | Bacteria | 5312 |
| 142 | Ga0081455_10045635 | 3300005937 | Bacteria | 3811 |
| 143 | Ga0081455_10140027 | 3300005937 | Bacteria | 1880 |
| 144 | Ga0081538_10010297 | 3300005981 | Bacteria | 7676 |
| 145 | Ga0081540_1000075 | 3300005983 | Bacteria | 106804 |
| 146 | Ga0081540_1000199 | 3300005983 | Bacteria | 62482 |
| 147 | Ga0081540_1000373 | 3300005983 | Bacteria | 44890 |
| 148 | Ga0081540_1000904 | 3300005983 | Bacteria | 26798 |
| 149 | Ga0081540_1002468 | 3300005983 | Bacteria | 15067 |
| 150 | Ga0081540_1007774 | 3300005983 | Bacteria | 7587 |
| 151 | Ga0081540_1010461 | 3300005983 | Bacteria | 6278 |
| 152 | Ga0081540_1012806 | 3300005983 | Bacteria | 5488 |
| 153 | Ga0081540_1019596 | 3300005983 | Bacteria | 4104 |
| 154 | Ga0081540_1021716 | 3300005983 | Bacteria | 3812 |
| 155 | Ga0081540_1024507 | 3300005983 | Bacteria | 3500 |
| 156 | Ga0081539_10015306 | 3300005985 | Bacteria | 5585 |
| 157 | Ga0075365_10009759 | 3300006038 | Bacteria | 5546 |
| 158 | Ga0075365_10019345 | 3300006038 | Bacteria | 4202 |
| 159 | Ga0075365_10037162 | 3300006038 | Bacteria | 3160 |
| 160 | Ga0075365_10079261 | 3300006038 | Bacteria | 2222 |
| 161 | Ga0075365_10123565 | 3300006038 | Bacteria | 1787 |
| 162 | Ga0075368_10057946 | 3300006042 | Bacteria | 1547 |
| 163 | Ga0075368_10065280 | 3300006042 | Bacteria | 1462 |
| 164 | Ga0075368_10098526 | 3300006042 | Bacteria | 1199 |
| 165 | Ga0075368_10141845 | 3300006042 | Bacteria | 1001 |
| 166 | Ga0075364_10081732 | 3300006051 | Bacteria | 2136 |
| 167 | Ga0070716_100134796 | 3300006173 | Bacteria | 1566 |
| 168 | Ga0070712_100082567 | 3300006175 | Bacteria | 2331 |
| 169 | Ga0070712_100158897 | 3300006175 | Bacteria | 1744 |
| 170 | Ga0075362_10059855 | 3300006177 | Bacteria | 1720 |
| 171 | Ga0075367_10070460 | 3300006178 | Bacteria | 2102 |
| 172 | Ga0075427_10001634 | 3300006194 | Bacteria | 2906 |
| 173 | Ga0075366_10055853 | 3300006195 | Bacteria | 2345 |
| 174 | Ga0075366_10078980 | 3300006195 | Bacteria | 1964 |
| 175 | Ga0075370_10008406 | 3300006353 | Bacteria | 5313 |
| 176 | Ga0075370_10024237 | 3300006353 | Bacteria | 3350 |
| 177 | Ga0075370_10051867 | 3300006353 | Bacteria | 2326 |
| 178 | Ga0075370_10076862 | 3300006353 | Bacteria | 1915 |
| 179 | Ga0075370_10252653 | 3300006353 | Bacteria | 1045 |
| 180 | Ga0075428_100060636 | 3300006844 | Bacteria | 4143 |
| 181 | Ga0075428_100082182 | 3300006844 | Bacteria | 3515 |
| 182 | Ga0075428_100108421 | 3300006844 | Bacteria | 3027 |
| 183 | Ga0075428_100154086 | 3300006844 | Bacteria | 2496 |
| 184 | Ga0075430_100002329 | 3300006846 | Bacteria | 15774 |
| 185 | Ga0075430_100089238 | 3300006846 | Bacteria | 2580 |
| 186 | Ga0075430_100119211 | 3300006846 | Bacteria | 2200 |
| 187 | Ga0075430_100155852 | 3300006846 | Bacteria | 1902 |
| 188 | Ga0075430_100330088 | 3300006846 | Bacteria | 1260 |
| 189 | Ga0075431_100082967 | 3300006847 | Bacteria | 3309 |
| 190 | Ga0075431_100097653 | 3300006847 | Bacteria | 3033 |
| 191 | Ga0075431_100498710 | 3300006847 | Bacteria | 1209 |
| 192 | Ga0075433_10002467 | 3300006852 | Bacteria | 14080 |
| 193 | Ga0075433_10024444 | 3300006852 | Bacteria | 5099 |
| 194 | Ga0075433_10032543 | 3300006852 | Bacteria | 4466 |
| 195 | Ga0075434_100031382 | 3300006871 | Bacteria | 5238 |
| 196 | Ga0075434_100137186 | 3300006871 | Bacteria | 2465 |
| 197 | Ga0075434_100219154 | 3300006871 | Bacteria | 1922 |
| 198 | Ga0075429_100040222 | 3300006880 | Bacteria | 4069 |
| 199 | Ga0075429_100074856 | 3300006880 | Bacteria | 2949 |
| 200 | Ga0068865_100059781 | 3300006881 | Bacteria | 2666 |
| 201 | Ga0068865_100122289 | 3300006881 | Bacteria | 1937 |
| 202 | Ga0097620_100116231 | 3300006931 | Bacteria | 2739 |
| 203 | Ga0097620_100334836 | 3300006931 | Bacteria | 1608 |
| 204 | Ga0099825_1024499 | 3300006941 | Bacteria | 3511 |
| 205 | Ga0099825_1039920 | 3300006941 | Bacteria | 1417 |
| 206 | Ga0099824_1016075 | 3300006942 | Bacteria | 6889 |
| 207 | Ga0099824_1022540 | 3300006942 | Bacteria | 4128 |
| 208 | Ga0099822_1005361 | 3300006943 | Bacteria | 16734 |
| 209 | Ga0099822_1033954 | 3300006943 | Bacteria | 3458 |
| 210 | Ga0099823_1038759 | 3300006944 | Bacteria | 3538 |
| 211 | Ga0075435_100026199 | 3300007076 | Bacteria | 4546 |
| 212 | Ga0075435_100029267 | 3300007076 | Bacteria | 4322 |
| 213 | Ga0075435_100121623 | 3300007076 | Bacteria | 2179 |
| 214 | Ga0075435_100137889 | 3300007076 | Bacteria | 2045 |
| 215 | Ga0075435_100221112 | 3300007076 | Bacteria | 1608 |
| 216 | Ga0075435_100247987 | 3300007076 | Bacteria | 1515 |
| 217 | Ga0099794_10001910 | 3300007265 | Bacteria | 7481 |
| 218 | Ga0099795_10007092 | 3300007788 | Bacteria | 3103 |
| 219 | Ga0105240_10133696 | 3300009093 | Bacteria | 2972 |
| 220 | Ga0105240_10481126 | 3300009093 | Bacteria | 1384 |
| 221 | Ga0111539_10004711 | 3300009094 | Bacteria | 17824 |
| 222 | Ga0111539_10113788 | 3300009094 | Bacteria | 3173 |
| 223 | Ga0111539_10188582 | 3300009094 | Bacteria | 2407 |
| 224 | Ga0105245_10028707 | 3300009098 | Bacteria | 4909 |
| 225 | Ga0105245_10071874 | 3300009098 | Bacteria | 3142 |
| 226 | Ga0105245_10551295 | 3300009098 | Bacteria | 1175 |
| 227 | Ga0105245_10854204 | 3300009098 | Bacteria | 950 |
| 228 | Ga0105247_10137399 | 3300009101 | Bacteria | 1598 |
| 229 | Ga0114129_10065176 | 3300009147 | Bacteria | 5085 |
| 230 | Ga0114129_10097158 | 3300009147 | Bacteria | 4077 |
| 231 | Ga0114129_10103217 | 3300009147 | Bacteria | 3942 |
| 232 | Ga0114129_10122946 | 3300009147 | Bacteria | 3570 |
| 233 | Ga0114129_10174002 | 3300009147 | Bacteria | 2933 |
| 234 | Ga0114129_10174153 | 3300009147 | Bacteria | 2931 |
| 235 | Ga0114129_10219830 | 3300009147 | Bacteria | 2563 |
| 236 | Ga0114129_11014398 | 3300009147 | Bacteria | 1044 |
| 237 | Ga0105243_10023886 | 3300009148 | Bacteria | 4659 |
| 238 | Ga0105243_10170425 | 3300009148 | Bacteria | 1885 |
| 239 | Ga0105241_10009784 | 3300009174 | Bacteria | 7046 |
| 240 | Ga0105241_10022328 | 3300009174 | Bacteria | 4687 |
| 241 | Ga0105241_10075397 | 3300009174 | Bacteria | 2628 |
| 242 | Ga0105242_10275223 | 3300009176 | Bacteria | 1527 |
| 243 | Ga0105248_10025654 | 3300009177 | Bacteria | 6554 |
| 244 | Ga0105248_10239373 | 3300009177 | Bacteria | 2043 |
| 245 | Ga0105248_10504104 | 3300009177 | Bacteria | 1365 |
| 246 | Ga0105248_10600592 | 3300009177 | Bacteria | 1242 |
| 247 | Ga0105248_10721903 | 3300009177 | Bacteria | 1124 |
| 248 | Ga0105237_10001286 | 3300009545 | Bacteria | 33400 |
| 249 | Ga0105237_10019561 | 3300009545 | Bacteria | 6994 |
| 250 | Ga0105237_10070713 | 3300009545 | Bacteria | 3485 |
| 251 | Ga0105237_10121414 | 3300009545 | Bacteria | 2607 |
| 252 | Ga0105237_10250574 | 3300009545 | Bacteria | 1773 |
| 253 | Ga0105237_10308261 | 3300009545 | Bacteria | 1586 |
| 254 | Ga0105238_10035583 | 3300009551 | Bacteria | 5061 |
| 255 | Ga0105238_10092006 | 3300009551 | Bacteria | 3020 |
| 256 | Ga0105249_10282304 | 3300009553 | Bacteria | 1659 |
| 257 | Ga0105249_10517955 | 3300009553 | Bacteria | 1240 |
| 258 | Ga0105239_10031496 | 3300010375 | Bacteria | 5831 |
| 259 | Ga0105239_10045785 | 3300010375 | Bacteria | 4794 |
| 260 | Ga0105239_10126790 | 3300010375 | Bacteria | 2837 |
| 261 | Ga0105239_10202408 | 3300010375 | Bacteria | 2224 |
| 262 | Ga0105239_10237552 | 3300010375 | Bacteria | 2045 |
| 263 | Ga0105239_10613861 | 3300010375 | Bacteria | 1241 |
| 264 | Ga0105239_11156499 | 3300010375 | Bacteria | 891 |
| 265 | Ga0105246_10012957 | 3300011119 | Bacteria | 5217 |
| 266 | Ga0105246_10022531 | 3300011119 | Bacteria | 4064 |
| 267 | Ga0105246_10061885 | 3300011119 | Bacteria | 2606 |
| 268 | Ga0105246_10085648 | 3300011119 | Bacteria | 2257 |
| 269 | Ga0157374_10302787 | 3300013296 | Bacteria | 1582 |
| 270 | Ga0157374_10440798 | 3300013296 | Bacteria | 1303 |
| 271 | Ga0157374_10441597 | 3300013296 | Bacteria | 1302 |
| 272 | Ga0157378_10018279 | 3300013297 | Bacteria | 6154 |
| 273 | Ga0157378_10140137 | 3300013297 | Bacteria | 2245 |
| 274 | Ga0163162_10043512 | 3300013306 | Bacteria | 4497 |
| 275 | Ga0163162_10233446 | 3300013306 | Bacteria | 1970 |
| 276 | Ga0157372_10116018 | 3300013307 | Unclassified | 3070 |
| 277 | Ga0157375_10038184 | 3300013308 | Bacteria | 4609 |
| 278 | Ga0157375_10047706 | 3300013308 | Bacteria | 4185 |
| 279 | Ga0157375_10056271 | 3300013308 | Bacteria | 3882 |
| 280 | Ga0157375_10312170 | 3300013308 | Bacteria | 1737 |
| 281 | Ga0157375_10364778 | 3300013308 | Bacteria | 1611 |
| 282 | Ga0163163_10041823 | 3300014325 | Bacteria | 4484 |
| 283 | Ga0163163_10078765 | 3300014325 | Bacteria | 3293 |
| 284 | Ga0163163_10450467 | 3300014325 | Bacteria | 1347 |
| 285 | Ga0163163_10541768 | 3300014325 | Bacteria | 1226 |
| 286 | Ga0157380_10051724 | 3300014326 | Bacteria | 3250 |
| 287 | Ga0157380_10079993 | 3300014326 | Bacteria | 2670 |
| 288 | Ga0157380_10301187 | 3300014326 | Bacteria | 1477 |
| 289 | Ga0182008_10020362 | 3300014497 | Bacteria | 3418 |
| 290 | Ga0157379_10017256 | 3300014968 | Bacteria | 6359 |
| 291 | Ga0157379_10187769 | 3300014968 | Bacteria | 1868 |
| 292 | Ga0157379_10198000 | 3300014968 | Bacteria | 1816 |
| 293 | Ga0157379_10200872 | 3300014968 | Bacteria | 1803 |
| 294 | Ga0157376_10411975 | 3300014969 | Bacteria | 1309 |
| 295 | Ga0163161_10022999 | 3300017792 | Bacteria | 4392 |
| 296 | Ga0163161_10076433 | 3300017792 | Bacteria | 2458 |
| 297 | Ga0163161_10240794 | 3300017792 | Bacteria | 1407 |
| 298 | Ga0214544_1000006 | 3300021320 | Bacteria | 380728 |
| 299 | Ga0214542_1000002 | 3300021321 | Bacteria | 720798 |
| 300 | Ga0214545_1000002 | 3300021324 | Bacteria | 727485 |
| 301 | Ga0214543_1000017 | 3300021327 | Bacteria | 290109 |
| 302 | Ga0213872_10030867 | 3300021361 | Bacteria | 2456 |
| 303 | Ga0209563_100471 | 3300025230 | Bacteria | 13811 |
| 304 | Ga0209677_100757 | 3300025253 | Bacteria | 16368 |
| 305 | Ga0209677_108436 | 3300025253 | Bacteria | 2000 |
| 306 | Ga0209233_1010533 | 3300025261 | Bacteria | 2765 |
| 307 | Ga0209455_1005175 | 3300025272 | Bacteria | 4090 |
| 308 | Ga0209675_1004035 | 3300025291 | Bacteria | 6691 |
| 309 | Ga0209758_1000216 | 3300025297 | Bacteria | 125352 |
| 310 | Ga0209758_1005195 | 3300025297 | Bacteria | 10227 |
| 311 | Ga0209256_1003991 | 3300025299 | Bacteria | 9675 |
| 312 | Ga0207426_1002409 | 3300025302 | Bacteria | 12033 |
| 313 | Ga0207426_1006600 | 3300025302 | Bacteria | 5002 |
| 314 | Ga0207426_1034113 | 3300025302 | Bacteria | 1635 |
| 315 | Ga0209257_1001462 | 3300025304 | Bacteria | 27887 |
| 316 | Ga0207697_10053457 | 3300025315 | Bacteria | 1672 |
| 317 | Ga0207653_10014263 | 3300025885 | Bacteria | 2492 |
| 318 | Ga0207692_10001933 | 3300025898 | Bacteria | 7899 |
| 319 | Ga0207642_10156537 | 3300025899 | Bacteria | 1219 |
| 320 | Ga0207710_10020192 | 3300025900 | Bacteria | 2847 |
| 321 | Ga0207710_10123374 | 3300025900 | Bacteria | 1239 |
| 322 | Ga0207688_10000077 | 3300025901 | Bacteria | 37350 |
| 323 | Ga0207688_10027476 | 3300025901 | Bacteria | 3130 |
| 324 | Ga0207680_10018688 | 3300025903 | Bacteria | 3691 |
| 325 | Ga0207680_10287248 | 3300025903 | Bacteria | 1144 |
| 326 | Ga0207647_10081907 | 3300025904 | Bacteria | 1933 |
| 327 | Ga0207645_10059755 | 3300025907 | Bacteria | 2435 |
| 328 | Ga0207643_10036633 | 3300025908 | Bacteria | 2751 |
| 329 | Ga0207705_10025430 | 3300025909 | Bacteria | 4227 |
| 330 | Ga0207684_10387193 | 3300025910 | Bacteria | 1202 |
| 331 | Ga0207654_10065552 | 3300025911 | Bacteria | 2139 |
| 332 | Ga0207707_10057329 | 3300025912 | Bacteria | 3390 |
| 333 | Ga0207695_10000342 | 3300025913 | Bacteria | 108393 |
| 334 | Ga0207671_10003865 | 3300025914 | Bacteria | 14649 |
| 335 | Ga0207671_10048284 | 3300025914 | Bacteria | 3151 |
| 336 | Ga0207671_10276970 | 3300025914 | Bacteria | 1322 |
| 337 | Ga0207671_10380243 | 3300025914 | Bacteria | 1122 |
| 338 | Ga0207693_10007359 | 3300025915 | Bacteria | 9056 |
| 339 | Ga0207663_10010822 | 3300025916 | Bacteria | 4871 |
| 340 | Ga0207663_10012418 | 3300025916 | Bacteria | 4605 |
| 341 | Ga0207660_10469289 | 3300025917 | Bacteria | 1019 |
| 342 | Ga0207662_10122803 | 3300025918 | Bacteria | 1630 |
| 343 | Ga0207657_10199814 | 3300025919 | Bacteria | 1609 |
| 344 | Ga0207649_10010842 | 3300025920 | Bacteria | 5010 |
| 345 | Ga0207652_10170220 | 3300025921 | Unclassified | 1954 |
| 346 | Ga0207646_10431598 | 3300025922 | Bacteria | 1189 |
| 347 | Ga0207681_10141929 | 3300025923 | Bacteria | 1790 |
| 348 | Ga0207681_10294011 | 3300025923 | Bacteria | 1283 |
| 349 | Ga0207681_10533665 | 3300025923 | Bacteria | 964 |
| 350 | Ga0207694_10136289 | 3300025924 | Bacteria | 1972 |
| 351 | Ga0207694_10172060 | 3300025924 | Bacteria | 1754 |
| 352 | Ga0207650_10125013 | 3300025925 | Bacteria | 2007 |
| 353 | Ga0207659_10168954 | 3300025926 | Bacteria | 1724 |
| 354 | Ga0207687_10081618 | 3300025927 | Bacteria | 2337 |
| 355 | Ga0207664_10012334 | 3300025929 | Bacteria | 6106 |
| 356 | Ga0207644_10302496 | 3300025931 | Bacteria | 1289 |
| 357 | Ga0207690_10062447 | 3300025932 | Unclassified | 2536 |
| 358 | Ga0207706_10001566 | 3300025933 | Bacteria | 22667 |
| 359 | Ga0207706_10024495 | 3300025933 | Bacteria | 5410 |
| 360 | Ga0207706_10045202 | 3300025933 | Bacteria | 3902 |
| 361 | Ga0207706_10121570 | 3300025933 | Bacteria | 2296 |
| 362 | Ga0207686_10121522 | 3300025934 | Bacteria | 1778 |
| 363 | Ga0207709_10015580 | 3300025935 | Bacteria | 4216 |
| 364 | Ga0207670_10113344 | 3300025936 | Bacteria | 1958 |
| 365 | Ga0207670_10386086 | 3300025936 | Bacteria | 1116 |
| 366 | Ga0207670_10390743 | 3300025936 | Bacteria | 1110 |
| 367 | Ga0207669_10082312 | 3300025937 | Bacteria | 2066 |
| 368 | Ga0207665_10014843 | 3300025939 | Bacteria | 5121 |
| 369 | Ga0207665_10055607 | 3300025939 | Bacteria | 2671 |
| 370 | Ga0207691_10116641 | 3300025940 | Bacteria | 2370 |
| 371 | Ga0207691_10133599 | 3300025940 | Bacteria | 2190 |
| 372 | Ga0207711_10014612 | 3300025941 | Bacteria | 6525 |
| 373 | Ga0207711_10072116 | 3300025941 | Bacteria | 2999 |
| 374 | Ga0207711_10307545 | 3300025941 | Bacteria | 1463 |
| 375 | Ga0207711_10457356 | 3300025941 | Bacteria | 1188 |
| 376 | Ga0207689_10002811 | 3300025942 | Bacteria | 16084 |
| 377 | Ga0207689_10056696 | 3300025942 | Bacteria | 3224 |
| 378 | Ga0207689_10078711 | 3300025942 | Bacteria | 2709 |
| 379 | Ga0207661_10432011 | 3300025944 | Bacteria | 1197 |
| 380 | Ga0207651_10027057 | 3300025960 | Bacteria | 3596 |
| 381 | Ga0207651_10182020 | 3300025960 | Bacteria | 1668 |
| 382 | Ga0207651_10504668 | 3300025960 | Bacteria | 1046 |
| 383 | Ga0207712_10114698 | 3300025961 | Bacteria | 2027 |
| 384 | Ga0207712_10157922 | 3300025961 | Bacteria | 1759 |
| 385 | Ga0207712_10347826 | 3300025961 | Bacteria | 1231 |
| 386 | Ga0207712_10367331 | 3300025961 | Bacteria | 1200 |
| 387 | Ga0207668_10014121 | 3300025972 | Bacteria | 4938 |
| 388 | Ga0207668_10100003 | 3300025972 | Bacteria | 2152 |
| 389 | Ga0207668_10175145 | 3300025972 | Bacteria | 1686 |
| 390 | Ga0207668_10189653 | 3300025972 | Bacteria | 1628 |
| 391 | Ga0207668_10190269 | 3300025972 | Bacteria | 1626 |
| 392 | Ga0207668_10203020 | 3300025972 | Bacteria | 1580 |
| 393 | Ga0207668_10391802 | 3300025972 | Bacteria | 1172 |
| 394 | Ga0207668_10414000 | 3300025972 | Bacteria | 1142 |
| 395 | Ga0207640_10028836 | 3300025981 | Bacteria | 3399 |
| 396 | Ga0207640_10087828 | 3300025981 | Bacteria | 2145 |
| 397 | Ga0207658_10029667 | 3300025986 | Bacteria | 3866 |
| 398 | Ga0207677_10089401 | 3300026023 | Bacteria | 2236 |
| 399 | Ga0207677_10110273 | 3300026023 | Bacteria | 2048 |
| 400 | Ga0207703_10041818 | 3300026035 | Bacteria | 3674 |
| 401 | Ga0207703_10132767 | 3300026035 | Bacteria | 2152 |
| 402 | Ga0207703_10168877 | 3300026035 | Bacteria | 1922 |
| 403 | Ga0207678_10016327 | 3300026067 | Bacteria | 6518 |
| 404 | Ga0207678_10019801 | 3300026067 | Bacteria | 5918 |
| 405 | Ga0207678_10023742 | 3300026067 | Bacteria | 5362 |
| 406 | Ga0207678_10044292 | 3300026067 | Bacteria | 3849 |
| 407 | Ga0207678_10054649 | 3300026067 | Bacteria | 3439 |
| 408 | Ga0207678_10054664 | 3300026067 | Bacteria | 3439 |
| 409 | Ga0207678_10070409 | 3300026067 | Bacteria | 2999 |
| 410 | Ga0207708_10062016 | 3300026075 | Bacteria | 2856 |
| 411 | Ga0207708_10068790 | 3300026075 | Bacteria | 2710 |
| 412 | Ga0207641_10094128 | 3300026088 | Bacteria | 2627 |
| 413 | Ga0207641_10273835 | 3300026088 | Bacteria | 1585 |
| 414 | Ga0207641_10298532 | 3300026088 | Bacteria | 1521 |
| 415 | Ga0207648_10001800 | 3300026089 | Bacteria | 23485 |
| 416 | Ga0207648_10198539 | 3300026089 | Bacteria | 1779 |
| 417 | Ga0207648_10540914 | 3300026089 | Bacteria | 1069 |
| 418 | Ga0207676_10072722 | 3300026095 | Bacteria | 2765 |
| 419 | Ga0207676_10143852 | 3300026095 | Bacteria | 2045 |
| 420 | Ga0207674_10071136 | 3300026116 | Bacteria | 3495 |
| 421 | Ga0207675_100008275 | 3300026118 | Bacteria | 9797 |
| 422 | Ga0207675_100024973 | 3300026118 | Bacteria | 5560 |
| 423 | Ga0207675_100081999 | 3300026118 | Bacteria | 3024 |
| 424 | Ga0207675_100244883 | 3300026118 | Bacteria | 1733 |
| 425 | Ga0207683_10018799 | 3300026121 | Bacteria | 5895 |
| 426 | Ga0207683_10021283 | 3300026121 | Bacteria | 5549 |
| 427 | Ga0207683_10033761 | 3300026121 | Bacteria | 4446 |
| 428 | Ga0207683_10036754 | 3300026121 | Bacteria | 4265 |
| 429 | Ga0207698_10815684 | 3300026142 | Bacteria | 936 |
| 430 | Ga0209389_1000196 | 3300027296 | Bacteria | 43831 |
| 431 | Ga0209389_1000284 | 3300027296 | Bacteria | 31998 |
| 432 | Ga0209589_1000006 | 3300027357 | Bacteria | 436292 |
| 433 | Ga0209589_1001029 | 3300027357 | Bacteria | 43810 |
| 434 | Ga0209489_100007 | 3300027361 | Bacteria | 436292 |
| 435 | Ga0209489_101824 | 3300027361 | Bacteria | 43831 |
| 436 | Ga0209489_117016 | 3300027361 | Bacteria | 3539 |
| 437 | Ga0209700_100008 | 3300027363 | Bacteria | 436292 |
| 438 | Ga0209700_103273 | 3300027363 | Bacteria | 31313 |
| 439 | Ga0209588_1030098 | 3300027671 | Bacteria | 1733 |
| 440 | Ga0209588_1035751 | 3300027671 | Bacteria | 1597 |
| 441 | Ga0209813_10019693 | 3300027866 | Bacteria | 1879 |
| 442 | Ga0209813_10034302 | 3300027866 | Bacteria | 1514 |
| 443 | Ga0209813_10042184 | 3300027866 | Bacteria | 1393 |
| 444 | Ga0207428_10003095 | 3300027907 | Bacteria | 16361 |
| 445 | Ga0268266_10000544 | 3300028379 | Bacteria | 52629 |
| 446 | Ga0268266_10001633 | 3300028379 | Bacteria | 26087 |
| 447 | Ga0268266_10027900 | 3300028379 | Bacteria | 4801 |
| 448 | Ga0268266_10079594 | 3300028379 | Bacteria | 2853 |
| 449 | Ga0268266_10213358 | 3300028379 | Bacteria | 1771 |
| 450 | Ga0268266_10269456 | 3300028379 | Bacteria | 1580 |
| 451 | Ga0268265_10048073 | 3300028380 | Bacteria | 3200 |
| 452 | Ga0268265_10051918 | 3300028380 | Bacteria | 3098 |
| 453 | Ga0268265_10383668 | 3300028380 | Bacteria | 1293 |
| 454 | Ga0268264_10037322 | 3300028381 | Bacteria | 4006 |
| 455 | Ga0265337_1007475 | 3300028556 | Bacteria | 4086 |
| 456 | Ga0265319_1002882 | 3300028563 | Bacteria | 9186 |
| 457 | Ga0265334_10009925 | 3300028573 | Bacteria | 4025 |
| 458 | Ga0265318_10013021 | 3300028577 | Bacteria | 3525 |
| 459 | Ga0265336_10001981 | 3300028666 | Bacteria | 8764 |
| 460 | Ga0307517_10228684 | 3300028786 | Bacteria | 1120 |
| 461 | Ga0307515_10059588 | 3300028794 | Bacteria | 5467 |
| 462 | Ga0265338_10000013 | 3300028800 | Bacteria | 379065 |
| 463 | Ga0265324_10003322 | 3300029957 | Bacteria | 7721 |
| 464 | Ga0307509_10274011 | 3300031507 | Bacteria | 1453 |
| 465 | Ga0307408_100485484 | 3300031548 | Bacteria | 1079 |
| 466 | Ga0307516_10006378 | 3300031730 | Bacteria | 13828 |
| 467 | Ga0307516_10144193 | 3300031730 | Bacteria | 2148 |
| 468 | Ga0307516_10204159 | 3300031730 | Bacteria | 1694 |
| 469 | Ga0307413_10038382 | 3300031824 | Bacteria | 2775 |
| 470 | Ga0307409_100187443 | 3300031995 | Bacteria | 1838 |
| 471 | Ga0307415_100034576 | 3300032126 | Bacteria | 3292 |
| 472 | Ga0307510_10004428 | 3300033180 | Bacteria | 16533 |
| 473 | Ga0307510_10017480 | 3300033180 | Bacteria | 8455 |
| 474 | Ga0315911_1000010 | 3300033442 | Bacteria | 322197 |
| 475 | Ga0373926_0065719 | 3300035083 | Bacteria | 1327 |
| 476 | Ga0373928_0021744 | 3300035084 | Bacteria | 1355 |
| 477 | Ga0373929_0023510 | 3300035085 | Bacteria | 1267 |
| 478 | Ga0373952_0019731 | 3300035092 | Bacteria | 1407 |
| 479 | Ga0373923_0126224 | 3300035111 | Bacteria | 1147 |
| 480 | Ga0373932_0017972 | 3300035112 | Bacteria | 1824 |
| 481 | Ga0373932_0047206 | 3300035112 | Bacteria | 1265 |
| 482 | Ga0373932_0062846 | 3300035112 | Bacteria | 1133 |
| 483 | Ga0373936_0053244 | 3300035113 | Bacteria | 1641 |
| 484 | Ga0373939_0005708 | 3300035114 | Bacteria | 2967 |
| 485 | Ga0373939_0138478 | 3300035114 | Bacteria | 875 |
| 486 | Ga0373941_0053037 | 3300035115 | Bacteria | 1295 |
| 487 | Ga0373945_0061371 | 3300035116 | Bacteria | 1404 |
| 488 | Ga0373960_0030197 | 3300035121 | Bacteria | 1508 |
| 489 | Ga0373960_0078200 | 3300035121 | Bacteria | 1036 |
| 490 | Ga0373943_0012834 | 3300035170 | Bacteria | 3776 |
| 491 | Ga0373943_0071923 | 3300035170 | Bacteria | 1753 |
| 492 | Ga0373943_0114119 | 3300035170 | Bacteria | 1428 |
| 493 | Ga0373946_0006617 | 3300035171 | Bacteria | 4208 |
| 494 | Ga0373955_0152426 | 3300035172 | Bacteria | 1361 |
| 495 | Ga0373942_0010929 | 3300035207 | Bacteria | 2143 |
| 496 | Ga0373961_0012173 | 3300035241 | Bacteria | 2149 |
| 497 | Ga0373962_0012362 | 3300035242 | Bacteria | 2150 |
| 498 | Ga0373962_0028315 | 3300035242 | Bacteria | 1519 |
| 499 | Ga0373931_0000589 | 3300035691 | Bacteria | 14992 |
| 500 | Ga0373931_0013520 | 3300035691 | Bacteria | 3976 |
| 501 | Ga0373935_0052593 | 3300035692 | Bacteria | 2589 |
| 502 | Ga0373935_0056830 | 3300035692 | Bacteria | 2496 |
| 503 | Ga0373935_0080948 | 3300035692 | Bacteria | 2110 |
| 504 | Ga0373927_0007128 | 3300035695 | Bacteria | 7587 |
| 505 | Ga0373927_0041681 | 3300035695 | Bacteria | 2977 |
| 506 | Ga0373927_0048146 | 3300035695 | Bacteria | 2757 |
| 507 | Ga0373927_0071342 | 3300035695 | Bacteria | 2248 |
| 508 | Ga0373927_0156791 | 3300035695 | Bacteria | 1491 |
| 509 | Ga0373933_0038204 | 3300035724 | Bacteria | 2821 |
| 510 | Ga0373947_0001699 | 3300035725 | Bacteria | 13502 |
| 511 | Ga0373947_0007402 | 3300035725 | Bacteria | 6356 |
| 512 | Ga0373947_0055264 | 3300035725 | Unclassified | 2397 |
| 513 | Ga0373947_0069905 | 3300035725 | Bacteria | 2150 |
| 514 | Ga0373937_0009747 | 3300036401 | Bacteria | 8373 |
| 515 | Ga0373937_0376498 | 3300036401 | Bacteria | 1346 |
| 516 | Ga0373925_0022773 | 3300037068 | Bacteria | 4572 |
| 517 | Ga0373925_0067599 | 3300037068 | Bacteria | 2696 |
| 518 | Ga0373925_0089875 | 3300037068 | Bacteria | 2347 |
| 519 | Ga0373925_0116895 | 3300037068 | Bacteria | 2066 |
| 520 | Ga0395905_0124921 | 3300037471 | Bacteria | 2420 |
| 521 | Ga0395905_0160393 | 3300037471 | Bacteria | 2114 |
| 522 | Ga0395901_0404554 | 3300038443 | Bacteria | 1402 |
| 523 | Ga0436365_1610361 | 3300039437 | Bacteria | 1154 |
| 524 | Ga0436360_0737618 | 3300039438 | Bacteria | 2741 |
| 525 | Ga0436361_0102531 | 3300039447 | Bacteria | 4162 |
| 526 | Ga0436361_0496474 | 3300039447 | Bacteria | 7367 |
| 527 | Ga0436361_0857818 | 3300039447 | Bacteria | 13715 |
| 528 | Ga0436363_0112888 | 3300039450 | Bacteria | 1089 |
| 529 | Ga0436362_1154959 | 3300039453 | Bacteria | 3540 |
| 530 | Ga0439465_0017091 | 3300041413 | Bacteria | 2264 |
| 531 | Ga0439465_0078545 | 3300041413 | Bacteria | 1116 |
| 532 | Ga0451807_2471553 | 3300041486 | Bacteria | 909 |
| 533 | Ga0450897_009266 | 3300042128 | Bacteria | 929 |
| 534 | Ga0439446_0037075 | 3300042156 | Bacteria | 1427 |
| 535 | Ga0466972_0068802 | 3300044658 | Bacteria | 1691 |
| 536 | Ga0466972_0114728 | 3300044658 | Bacteria | 1272 |
| 537 | Ga0466961_0271468 | 3300044693 | Bacteria | 1039 |
| 538 | Ga0466959_0246904 | 3300045049 | Bacteria | 1232 |
| 539 | Ga0466967_0013831 | 3300045976 | Bacteria | 6257 |
| 540 | Ga0495617_004300 | 3300046452 | Bacteria | 5193 |
| 541 | Ga0495617_056880 | 3300046452 | Bacteria | 1297 |
| 542 | Ga0495592_0027994 | 3300046454 | Bacteria | 4269 |
| 543 | Ga0495603_0002549 | 3300046455 | Bacteria | 10732 |
| 544 | Ga0495603_0007037 | 3300046455 | Bacteria | 6750 |
| 545 | Ga0495603_0045565 | 3300046455 | Bacteria | 2615 |
| 546 | Ga0495603_0166349 | 3300046455 | Bacteria | 1278 |
| 547 | Ga0495629_0004300 | 3300046459 | Bacteria | 10676 |
| 548 | Ga0495629_0005021 | 3300046459 | Bacteria | 9917 |
| 549 | Ga0495638_0035509 | 3300046460 | Bacteria | 3177 |
| 550 | Ga0495638_0037407 | 3300046460 | Bacteria | 3087 |
| 551 | Ga0495580_0041029 | 3300046472 | Bacteria | 3302 |
| 552 | Ga0495582_0114352 | 3300046473 | Bacteria | 1517 |
| 553 | Ga0495605_0072932 | 3300046474 | Bacteria | 1618 |
| 554 | Ga0495639_0004473 | 3300046475 | Bacteria | 5988 |
| 555 | Ga0495639_0095316 | 3300046475 | Bacteria | 1400 |
| 556 | Ga0495639_0176879 | 3300046475 | Bacteria | 1038 |
| 557 | Ga0495662_0012054 | 3300046476 | Bacteria | 4225 |
| 558 | Ga0495664_0009734 | 3300046477 | Bacteria | 5386 |
| 559 | Ga0495664_0132492 | 3300046477 | Bacteria | 1510 |
| 560 | Ga0495585_0079024 | 3300046492 | Bacteria | 1784 |
| 561 | Ga0495585_0155111 | 3300046492 | Bacteria | 1192 |
| 562 | Ga0495585_0175457 | 3300046492 | Bacteria | 1104 |
| 563 | Ga0495594_0010444 | 3300046499 | Bacteria | 4816 |
| 564 | Ga0495594_0023889 | 3300046499 | Bacteria | 3279 |
| 565 | Ga0495596_0118653 | 3300046500 | Bacteria | 1027 |
| 566 | Ga0495607_0149066 | 3300046501 | Bacteria | 1199 |
| 567 | Ga0495606_0038752 | 3300046507 | Bacteria | 3220 |
| 568 | Ga0495616_0144378 | 3300046513 | Bacteria | 1081 |
| 569 | Ga0495618_0025545 | 3300046514 | Bacteria | 3667 |
| 570 | Ga0495628_0091771 | 3300046516 | Bacteria | 2350 |
| 571 | Ga0495628_0137156 | 3300046516 | Bacteria | 1869 |
| 572 | Ga0495631_0131545 | 3300046518 | Bacteria | 1075 |
| 573 | Ga0495643_0081618 | 3300046522 | Bacteria | 1681 |
| 574 | Ga0495644_0024670 | 3300046523 | Bacteria | 2287 |
| 575 | Ga0495644_0157517 | 3300046523 | Bacteria | 870 |
| 576 | Ga0495663_0068741 | 3300046525 | Bacteria | 1125 |
| 577 | Ga0495666_0043604 | 3300046526 | Bacteria | 2167 |
| 578 | Ga0495642_0062807 | 3300046528 | Bacteria | 1543 |
| 579 | Ga0495665_0026950 | 3300046531 | Bacteria | 3085 |
| 580 | Ga0495640_0023620 | 3300046533 | Bacteria | 4475 |
| 581 | Ga0495640_0040831 | 3300046533 | Bacteria | 3246 |
| 582 | Ga0495598_0013894 | 3300046537 | Bacteria | 2005 |
| 583 | Ga0495609_0152860 | 3300046538 | Bacteria | 981 |
| 584 | Ga0495621_0050282 | 3300046539 | Bacteria | 1489 |
| 585 | Ga0495597_0025896 | 3300046542 | Bacteria | 2698 |
| 586 | Ga0495667_0035623 | 3300046559 | Bacteria | 3325 |
| 587 | Ga0495656_0002595 | 3300046615 | Bacteria | 6028 |
| 588 | Ga0495656_0189933 | 3300046615 | Bacteria | 1014 |
| 589 | Ga0495668_0069745 | 3300046616 | Bacteria | 1933 |
| 590 | Ga0495634_0012735 | 3300046642 | Bacteria | 6088 |
| 591 | Ga0495611_0150360 | 3300046648 | Bacteria | 1087 |
| 592 | Ga0495625_0009575 | 3300046660 | Bacteria | 8094 |
| 593 | Ga0495625_0048587 | 3300046660 | Bacteria | 3054 |
| 594 | Ga0495625_0121291 | 3300046660 | Bacteria | 1779 |
| 595 | Ga0495625_0317169 | 3300046660 | Bacteria | 993 |
| 596 | Ga0495635_0005943 | 3300046663 | Bacteria | 8515 |
| 597 | Ga0495635_0085160 | 3300046663 | Bacteria | 2162 |
| 598 | Ga0495659_0008078 | 3300046664 | Bacteria | 3343 |
| 599 | Ga0495661_0218414 | 3300046665 | Bacteria | 989 |
| 600 | Ga0495588_0025133 | 3300046674 | Bacteria | 2965 |
| 601 | Ga0495588_0103725 | 3300046674 | Bacteria | 1495 |
| 602 | Ga0495588_0154253 | 3300046674 | Bacteria | 1214 |
| 603 | Ga0495657_0041743 | 3300046675 | Bacteria | 3137 |
| 604 | Ga0495646_0139351 | 3300046680 | Bacteria | 1358 |
| 605 | Ga0495647_0003332 | 3300046681 | Bacteria | 5149 |
| 606 | Ga0495647_0047611 | 3300046681 | Bacteria | 1655 |
| 607 | Ga0495658_0017021 | 3300046683 | Bacteria | 3748 |
| 608 | Ga0495658_0091052 | 3300046683 | Bacteria | 1806 |
| 609 | Ga0495658_0135977 | 3300046683 | Bacteria | 1499 |
| 610 | Ga0495669_0001655 | 3300046684 | Bacteria | 9153 |
| 611 | Ga0495613_0060267 | 3300046689 | Bacteria | 2780 |
| 612 | Ga0495613_0098560 | 3300046689 | Bacteria | 2112 |
| 613 | Ga0495624_0003239 | 3300046690 | Bacteria | 12139 |
| 614 | Ga0495624_0148702 | 3300046690 | Bacteria | 1433 |
| 615 | Ga0495649_0004412 | 3300046694 | Bacteria | 9195 |
| 616 | Ga0495589_0061947 | 3300046794 | Bacteria | 1835 |
| 617 | Ga0495600_0029114 | 3300046809 | Bacteria | 3575 |
| 618 | Ga0495581_0002498 | 3300047315 | Bacteria | 10427 |
| 619 | Ga0495581_0097956 | 3300047315 | Bacteria | 1703 |
| 620 | Ga0495604_0102779 | 3300047317 | Bacteria | 2097 |
| 621 | Ga0495636_0056022 | 3300047318 | Bacteria | 1659 |
| 622 | Ga0495674_0031540 | 3300047319 | Bacteria | 4814 |
| 623 | Ga0495672_0058508 | 3300047320 | Bacteria | 2234 |
| 624 | Ga0495676_0015378 | 3300047321 | Bacteria | 6815 |
| 625 | Ga0495683_0109795 | 3300047323 | Bacteria | 1318 |
| 626 | Ga0495683_0134017 | 3300047323 | Bacteria | 1166 |
| 627 | Ga0495673_0042343 | 3300047469 | Bacteria | 2045 |
| 628 | Ga0495686_0047811 | 3300047472 | Bacteria | 2700 |
| 629 | Ga0495686_0126967 | 3300047472 | Bacteria | 1516 |
| 630 | Ga0495593_0000942 | 3300047673 | Bacteria | 16962 |
| 631 | Ga0495614_0110194 | 3300048089 | Bacteria | 1208 |
| 632 | Ga0495614_0144894 | 3300048089 | Bacteria | 1057 |
| 633 | Ga0495615_0031144 | 3300048090 | Bacteria | 1278 |
| 634 | Ga0495615_0067856 | 3300048090 | Bacteria | 955 |
| 635 | Ga0496100_0332759 | 3300048903 | Bacteria | 1143 |
| 636 | Ga0496100_0440611 | 3300048903 | Bacteria | 997 |
| 637 | Ga0496101_0074176 | 3300048904 | Bacteria | 2501 |
| 638 | Ga0496101_0090953 | 3300048904 | Bacteria | 2270 |
| 639 | Ga0496101_0103682 | 3300048904 | Bacteria | 2132 |
| 640 | Ga0496101_0111802 | 3300048904 | Bacteria | 2057 |
| 641 | Ga0496101_0228021 | 3300048904 | Bacteria | 1447 |
| 642 | Ga0496102_0012884 | 3300048905 | Bacteria | 7238 |
| 643 | Ga0496102_0050685 | 3300048905 | Bacteria | 3781 |
| 644 | Ga0496102_0102199 | 3300048905 | Bacteria | 2664 |
| 645 | Ga0496102_0250623 | 3300048905 | Bacteria | 1669 |
| 646 | Ga0496102_0362380 | 3300048905 | Bacteria | 1365 |
| 647 | Ga0496103_0074034 | 3300048906 | Bacteria | 2134 |
| 648 | Ga0496104_0000916 | 3300048907 | Bacteria | 25286 |
| 649 | Ga0496104_0058187 | 3300048907 | Bacteria | 3658 |
| 650 | Ga0496104_0065281 | 3300048907 | Bacteria | 3454 |
| 651 | Ga0496104_0091319 | 3300048907 | Bacteria | 2910 |
| 652 | Ga0496104_0121880 | 3300048907 | Bacteria | 2503 |
| 653 | Ga0496104_0302932 | 3300048907 | Bacteria | 1510 |
| 654 | Ga0496104_0339954 | 3300048907 | Bacteria | 1414 |
| 655 | Ga0496105_0018517 | 3300048908 | Bacteria | 5601 |
| 656 | Ga0496105_0169445 | 3300048908 | Bacteria | 1790 |
| 657 | Ga0496105_0197699 | 3300048908 | Bacteria | 1642 |
| 658 | Ga0496105_0225750 | 3300048908 | Bacteria | 1523 |
| 659 | Ga0496105_0301692 | 3300048908 | Bacteria | 1287 |
| 660 | Ga0496105_0379562 | 3300048908 | Bacteria | 1125 |
| 661 | Ga0496106_0188090 | 3300048909 | Bacteria | 1641 |
| 662 | Ga0496106_0494849 | 3300048909 | Bacteria | 982 |
| 663 | Ga0496107_0063803 | 3300048910 | Bacteria | 2670 |
| 664 | Ga0496107_0212560 | 3300048910 | Bacteria | 1438 |
| 665 | Ga0496108_0203309 | 3300048911 | Bacteria | 1719 |
| 666 | Ga0496108_0303673 | 3300048911 | Bacteria | 1390 |
| 667 | Ga0496109_0300568 | 3300048912 | Bacteria | 1513 |
| 668 | Ga0496109_0306471 | 3300048912 | Bacteria | 1498 |
| 669 | Ga0496110_0009234 | 3300048913 | Bacteria | 7970 |
| 670 | Ga0496110_0046873 | 3300048913 | Bacteria | 3782 |
| 671 | Ga0496110_0233232 | 3300048913 | Bacteria | 1674 |
| 672 | Ga0496110_0242547 | 3300048913 | Bacteria | 1640 |
| 673 | Ga0496111_0028232 | 3300048914 | Bacteria | 3976 |
| 674 | Ga0496111_0071062 | 3300048914 | Bacteria | 2533 |
| 675 | Ga0496112_0071722 | 3300048915 | Bacteria | 3423 |
| 676 | Ga0496112_0073248 | 3300048915 | Bacteria | 3386 |
| 677 | Ga0496112_0144283 | 3300048915 | Bacteria | 2349 |
| 678 | Ga0496112_0193576 | 3300048915 | Bacteria | 1994 |
| 679 | Ga0496112_0260818 | 3300048915 | Bacteria | 1682 |
| 680 | Ga0496113_0029907 | 3300048916 | Bacteria | 3938 |
| 681 | Ga0496113_0121262 | 3300048916 | Bacteria | 2044 |
| 682 | Ga0496113_0216416 | 3300048916 | Bacteria | 1526 |
| 683 | Ga0496113_0249510 | 3300048916 | Bacteria | 1417 |
| 684 | Ga0496113_0313176 | 3300048916 | Bacteria | 1258 |
| 685 | Ga0496114_0073481 | 3300048917 | Bacteria | 2878 |
| 686 | Ga0496114_0172047 | 3300048917 | Bacteria | 1888 |
| 687 | Ga0496114_0205672 | 3300048917 | Bacteria | 1725 |
| 688 | Ga0496114_0463564 | 3300048917 | Bacteria | 1122 |
| 689 | Ga0496114_0526132 | 3300048917 | Bacteria | 1045 |
| 690 | Ga0496115_0054272 | 3300048918 | Bacteria | 3218 |
| 691 | Ga0496115_0089891 | 3300048918 | Bacteria | 2508 |
| 692 | Ga0496115_0095660 | 3300048918 | Bacteria | 2431 |
| 693 | Ga0496115_0110292 | 3300048918 | Bacteria | 2260 |
| 694 | Ga0496115_0120612 | 3300048918 | Bacteria | 2158 |
| 695 | Ga0496115_0152102 | 3300048918 | Bacteria | 1911 |
| 696 | Ga0496115_0183849 | 3300048918 | Bacteria | 1727 |
| 697 | Ga0496116_0076727 | 3300048919 | Bacteria | 2092 |
| 698 | Ga0496118_0020691 | 3300048921 | Bacteria | 5826 |
| 699 | Ga0496118_0119089 | 3300048921 | Bacteria | 1727 |
| 700 | Ga0496118_0121408 | 3300048921 | Bacteria | 1702 |
| 701 | Ga0496119_0024691 | 3300048922 | Bacteria | 4220 |
| 702 | Ga0496119_0192969 | 3300048922 | Bacteria | 1060 |
| 703 | Ga0496120_0030655 | 3300048923 | Bacteria | 3264 |
| 704 | Ga0496121_0015817 | 3300048924 | Bacteria | 7853 |
| 705 | Ga0496121_0018938 | 3300048924 | Bacteria | 6908 |
| 706 | Ga0496121_0042465 | 3300048924 | Bacteria | 3954 |
| 707 | Ga0496121_0044500 | 3300048924 | Bacteria | 3828 |
| 708 | Ga0496121_0059718 | 3300048924 | Bacteria | 3142 |
| 709 | Ga0496121_0060439 | 3300048924 | Bacteria | 3116 |
| 710 | Ga0496121_0061883 | 3300048924 | Bacteria | 3069 |
| 711 | Ga0496121_0228380 | 3300048924 | Bacteria | 1305 |
| 712 | Ga0496121_0231457 | 3300048924 | Bacteria | 1294 |
| 713 | Ga0496121_0339662 | 3300048924 | Bacteria | 1004 |
| 714 | Ga0496121_0402545 | 3300048924 | Bacteria | 896 |
| 715 | Ga0496124_0008072 | 3300048927 | Bacteria | 11068 |
| 716 | Ga0496124_0078139 | 3300048927 | Bacteria | 2728 |
| 717 | Ga0496124_0113175 | 3300048927 | Bacteria | 2181 |
| 718 | Ga0496125_0064169 | 3300048928 | Bacteria | 2921 |
| 719 | Ga0496125_0101569 | 3300048928 | Bacteria | 2116 |
| 720 | Ga0496125_0128971 | 3300048928 | Bacteria | 1785 |
| 721 | Ga0496126_0002447 | 3300048929 | Bacteria | 25067 |
| 722 | Ga0496126_0021927 | 3300048929 | Bacteria | 6228 |
| 723 | Ga0496126_0043210 | 3300048929 | Bacteria | 4158 |
| 724 | Ga0496126_0129359 | 3300048929 | Bacteria | 2183 |
| 725 | Ga0496126_0141674 | 3300048929 | Bacteria | 2069 |
| 726 | Ga0496126_0141788 | 3300048929 | Bacteria | 2068 |
| 727 | Ga0496126_0158676 | 3300048929 | Bacteria | 1934 |
| 728 | Ga0496126_0162654 | 3300048929 | Bacteria | 1906 |
| 729 | Ga0496126_0258317 | 3300048929 | Bacteria | 1449 |
| 730 | Ga0496126_0582869 | 3300048929 | Bacteria | 883 |
| 731 | Ga0501039_0454496 | 3300049575 | Bacteria | 1006 |
| 732 | Ga0501071_0008888 | 3300049587 | Bacteria | 6663 |
| 733 | Ga0501081_0128703 | 3300049743 | Bacteria | 1808 |
| 734 | Ga0501083_0357688 | 3300049744 | Bacteria | 949 |
| 735 | Ga0501045_0068998 | 3300049824 | Bacteria | 2598 |
| 736 | nmdc:mga03683_15843_c1 | 3300050489 | Bacteria | 2821 |
| 737 | nmdc:mga03n38_88327_c1 | 3300050490 | Bacteria | 1470 |
| 738 | nmdc:mga00v17_134587_c1 | 3300050491 | Bacteria | 1581 |
| 739 | nmdc:mga0yw44_26825_c1 | 3300050492 | Bacteria | 3294 |
| 740 | nmdc:mga0yw44_63600_c1 | 3300050492 | Bacteria | 2269 |
| 741 | nmdc:mga0yw44_86331_c1 | 3300050492 | Bacteria | 1976 |
| 742 | nmdc:mga06z11_27833_c1 | 3300050494 | Bacteria | 2706 |
| 743 | nmdc:mga06z11_48054_c1 | 3300050494 | Bacteria | 2170 |
| 744 | nmdc:mga04h51_92630_c1 | 3300050495 | Bacteria | 1090 |
| 745 | nmdc:mga07m45_17287_c1 | 3300050496 | Bacteria | 3870 |
| 746 | nmdc:mga07m45_23241_c1 | 3300050496 | Bacteria | 3387 |
| 747 | nmdc:mga07m45_3901_c1 | 3300050496 | Bacteria | 7244 |
| 748 | nmdc:mga05p37_190242_c1 | 3300050507 | Bacteria | 2492 |
| 749 | nmdc:mga05p37_38746_c1 | 3300050507 | Bacteria | 5848 |
| 750 | nmdc:mga05p37_5331_c1 | 3300050507 | Bacteria | 15103 |
| 751 | nmdc:mga09592_30838_c1 | 3300050508 | Bacteria | 4464 |
| 752 | nmdc:mga0qj67_147369_c1 | 3300050509 | Bacteria | 1908 |
| 753 | nmdc:mga0qj67_30180_c1 | 3300050509 | Bacteria | 4216 |
| 754 | nmdc:mga0qj67_48398_c1 | 3300050509 | Bacteria | 3359 |
| 755 | nmdc:mga06r32_198858_c1 | 3300050510 | Bacteria | 1992 |
| 756 | nmdc:mga06r32_320092_c1 | 3300050510 | Bacteria | 1537 |
| 757 | nmdc:mga06r32_487812_c1 | 3300050510 | Bacteria | 1210 |
| 758 | nmdc:mga08y16_308916_c1 | 3300050511 | Bacteria | 1629 |
| 759 | nmdc:mga08y16_34711_c1 | 3300050511 | Bacteria | 5300 |
| 760 | nmdc:mga0n895_160319_c1 | 3300050512 | Bacteria | 2281 |
| 761 | nmdc:mga0n895_167823_c1 | 3300050512 | Bacteria | 2227 |
| 762 | nmdc:mga0n895_219851_c1 | 3300050512 | Bacteria | 1929 |
| 763 | nmdc:mga0rr50_211700_c1 | 3300050513 | Bacteria | 1597 |
| 764 | nmdc:mga0rr50_625140_c1 | 3300050513 | Bacteria | 918 |
| 765 | nmdc:mga0a205_10385_c1 | 3300050515 | Bacteria | 8556 |
| 766 | nmdc:mga0a205_270135_c1 | 3300050515 | Bacteria | 1240 |
| 767 | nmdc:mga0a205_517752_c1 | 3300050515 | Bacteria | 1049 |
| 768 | nmdc:mga0a205_6427_c1 | 3300050515 | Bacteria | 10625 |
| 769 | nmdc:mga0sz30_43035_c1 | 3300050516 | Bacteria | 1901 |
| 770 | Ga0495601_0035361 | 3300053077 | Bacteria | 3118 |
| 771 | Ga0495601_0093556 | 3300053077 | Bacteria | 1936 |
| 772 | Ga0495619_0005502 | 3300053085 | Bacteria | 8033 |
| 773 | Ga0500578_0081033 | 3300053086 | Bacteria | 2064 |
| 774 | Ga0500643_000114 | 3300053087 | Bacteria | 84221 |
| 775 | Ga0500643_076630 | 3300053087 | Bacteria | 923 |
| 776 | Ga0500566_0001448 | 3300053094 | Bacteria | 13912 |
| 777 | Ga0500641_0118170 | 3300053096 | Bacteria | 1142 |
| 778 | Ga0500648_176918 | 3300053097 | Bacteria | 1103 |
| 779 | Ga0500556_0023415 | 3300053104 | Bacteria | 2017 |
| 780 | Ga0500557_000001 | 3300053105 | Bacteria | 241298 |
| 781 | Ga0500595_002799 | 3300053119 | Bacteria | 8399 |
| 782 | Ga0500595_010510 | 3300053119 | Bacteria | 3675 |
| 783 | Ga0500608_168768 | 3300053122 | Bacteria | 940 |
| 784 | Ga0500642_0000240 | 3300053130 | Bacteria | 21191 |
| 785 | Ga0500590_013608 | 3300053148 | Bacteria | 4180 |
| 786 | Ga0500590_126025 | 3300053148 | Bacteria | 1192 |
| 787 | Ga0500636_0129277 | 3300053177 | Bacteria | 1409 |
| 788 | Ga0500636_0145011 | 3300053177 | Bacteria | 1310 |
| 789 | Ga0500625_006844 | 3300053729 | Bacteria | 4898 |
| 790 | Ga0500645_008456 | 3300053730 | Bacteria | 3514 |
| 791 | Ga0500656_004287 | 3300053732 | Bacteria | 1374 |
| 792 | Ga0500601_000202 | 3300053737 | Bacteria | 12063 |
| 793 | Ga0501084_0163282 | 3300054114 | Bacteria | 1879 |
| 794 | Ga0500661_008088 | 3300055283 | Bacteria | 1935 |
| 795 | Ga0530510_0016583 | 3300061734 | Bacteria | 5215 |
| 796 | Ga0530510_0219456 | 3300061734 | Bacteria | 1413 |
| 797 | 2507509683 | 2507262055 | Bacteria | 8048963 |
| 798 | 2508543699 | 2508501009 | Bacteria | 7784016 |
| 799 | 2508698518 | 2508501042 | Bacteria | 8719808 |
| 800 | 2513628282 | 2513237092 | Bacteria | 8341956 |
| 801 | 2513641940 | 2513237094 | Bacteria | 8789602 |
| 802 | 2513655054 | 2513237096 | Bacteria | 8722461 |
| 803 | 2513673450 | 2513237098 | Bacteria | 9902361 |
| 804 | 2513693551 | 2513237101 | Bacteria | 7952346 |
| 805 | 2513703841 | 2513237102 | Bacteria | 7703324 |
| 806 | 2513722919 | 2513237104 | Bacteria | 10034502 |
| 807 | 2513861074 | 2513237137 | Bacteria | 9558895 |
| 808 | 2513875763 | 2513237139 | Bacteria | 8737671 |
| 809 | 2513894485 | 2513237141 | Bacteria | 8496279 |
| 810 | 2513915923 | 2513237145 | Bacteria | 8979722 |
| 811 | 2514016199 | 2513237161 | Bacteria | 8871253 |
| 812 | 2515629130 | 2515154112 | Bacteria | 8294334 |
| 813 | 2517103621 | 2517093001 | Bacteria | 9002274 |
| 814 | 2517894773 | 2517572143 | Bacteria | 9484767 |
| 815 | 2524442212 | 2524023205 | Bacteria | 8918781 |
| 816 | 2524534522 | 2524023228 | Bacteria | 10118060 |
| 817 | 2528855501 | 2528768022 | Bacteria | 10457665 |
| 818 | 2617349184 | 2617270735 | Bacteria | 9163226 |
| 819 | 2617378266 | 2617270741 | Bacteria | 8201522 |
| 820 | 2671119185 | 2667528175 | Bacteria | 7532676 |
| 821 | 2723848443 | 2721755755 | Bacteria | 8322773 |
| 822 | 2728747571 | 2728368998 | Bacteria | 8720350 |
| 823 | 2745079503 | 2744054633 | Bacteria | 8678936 |
| 824 | 2793060345 | 2791355196 | Bacteria | 7323613 |
| 825 | 2793071244 | 2791355197 | Bacteria | 8420563 |
| 826 | 2793080991 | |||
| 827 | 2805917725 | 2802429603 | Bacteria | 8777136 |
| 828 | 2818241406 | 2816332527 | Bacteria | 8933356 |
| 829 | 2824602201 | 2824600985 | Bacteria | 8488197 |
| 830 | 2824610189 | 2824609381 | Bacteria | 8672835 |
| 831 | 2824623797 | 2824617872 | Bacteria | 8814715 |
| 832 | 2824627789 | 2824626560 | Bacteria | 8813858 |
| 833 | 2824639325 | 2824635225 | Bacteria | 8785348 |
| 834 | 2824646896 | 2824644064 | Bacteria | 8743947 |
| 835 | 2824656172 | 2824653114 | Bacteria | 8493680 |
| 836 | 2824666976 | 2824661429 | Bacteria | 9877870 |
| 837 | 2824672766 | 2824671348 | Bacteria | 8369588 |
| 838 | 2824686123 | 2824679649 | Bacteria | 8248951 |
| 839 | 2824693416 | 2824687955 | Bacteria | 8360029 |
| 840 | 2824698382 | 2824696289 | Bacteria | 8335049 |
| 841 | 2824720758 | 2824714736 | Bacteria | 8717648 |
| 842 | 2824730894 | 2824723954 | Bacteria | 8758240 |
| 843 | 2824735987 | 2824732956 | Bacteria | 7810675 |
| 844 | 2824746841 | 2824746037 | Bacteria | 7911610 |
| 845 | 2824773937 | 2824773399 | Bacteria | 8360218 |
| 846 | 2838130623 | 2838122688 | Bacteria | 8803140 |
| 847 | 2841941143 | 2841941048 | Bacteria | 8688029 |
| 848 | 2841957303 | 2841949485 | Bacteria | 8680857 |
| 849 | 2841967297 | 2841966195 | Bacteria | 8673214 |
| 850 | 2841979307 | 2841974524 | Bacteria | 8931498 |
| 851 | 2841989782 | 2841983080 | Bacteria | 8395090 |
| 852 | 2842038718 | 2842038055 | Bacteria | 8002051 |
| 853 | 2842048337 | 2842045827 | Bacteria | 8006841 |
| 854 | 2847934917 | 2847930680 | Bacteria | 9342022 |
| 855 | 2847945492 | 2847939898 | Bacteria | 8606328 |
| 856 | 2849080321 | 2849076700 | Bacteria | 7039503 |
| 857 | 2857510317 | 2857509624 | Bacteria | 7472071 |
| 858 | 2874609216 | 2874604998 | Bacteria | 7834745 |
| 859 | 2874613163 | 2874612657 | Bacteria | 8252029 |
| 860 | 2874636554 | 2874628541 | Bacteria | 8630250 |
| 861 | 2879086308 | 2879083081 | Bacteria | 8587928 |
| 862 | 2879109428 | 2879099564 | Bacteria | 10442239 |
| 863 | 2879119197 | 2879110137 | Bacteria | 8907982 |
| 864 | 2881366310 | 2881364244 | Bacteria | 7710352 |
| 865 | 2881672943 | 2881665667 | Bacteria | 8175609 |
| 866 | 2885378787 | 2885374607 | Bacteria | 8927485 |
| 867 | 2885416660 | 2885409591 | Bacteria | 9235467 |
| 868 | 2888394882 | 2888388044 | Bacteria | 7304136 |
| 869 | 2888423381 | 2888419890 | Bacteria | 7857137 |
| 870 | 2889036991 | 2889033259 | Bacteria | 9099371 |
| 871 | 2903749629 | 2903748898 | Bacteria | 9972761 |
| 872 | 2904697755 | 2904690495 | Bacteria | 9412302 |
| 873 | 2904705907 | |||
| 874 | 2906611486 | |||
| 875 | 2906628181 | 2906626472 | Bacteria | 8826946 |
| 876 | 2906641671 | 2906635258 | Bacteria | 8601019 |
| 877 | 2906649823 | 2906643746 | Bacteria | 8722424 |
| 878 | 2906660773 | 2906660503 | Bacteria | 8595048 |
| 879 | 2908745079 | 2908739725 | Bacteria | 8628932 |
| 880 | 2908757148 | 2908756301 | Bacteria | 8864324 |
| 881 | 2908779020 | 2908775508 | Bacteria | 8092255 |
| 882 | 2922363627 | 2922361189 | Bacteria | 7436256 |
| 883 | 2922373127 | |||
| 884 | 2922392804 | 2922386360 | Bacteria | 7017218 |
| 885 | 2922395323 | 2922393267 | Bacteria | 8285685 |
| 886 | 2922427869 | |||
| 887 | 2929615816 | 2929615660 | Bacteria | 9193770 |
| 888 | 2929630429 | 2929624759 | Bacteria | 9339455 |
| 889 | 2932792072 | 2932784394 | Bacteria | 9704911 |
| 890 | 2932814061 | 2932809354 | Bacteria | 9135765 |
| 891 | 2932819451 | 2932818245 | Bacteria | 9955613 |
| 892 | 2932833840 | 2932828146 | Bacteria | 9745859 |
| 893 | 2933578898 | 2933577622 | Bacteria | 9116884 |
| 894 | 2935611458 | 2935608549 | Bacteria | 8203142 |
| 895 | 2935618630 | 2935616580 | Bacteria | 9032984 |
| 896 | 2935632200 | 2935630451 | Bacteria | 8169952 |
| 897 | 2935644527 | 2935638405 | Bacteria | 10015038 |
| 898 | 2935648844 | 2935648319 | Bacteria | 8801166 |
| 899 | 2935657074 | 2935656913 | Bacteria | 8965014 |
| 900 | 2935673582 | 2935665750 | Bacteria | 9571747 |
| 901 | 2935678469 | 2935675223 | Bacteria | 9928132 |
| 902 | 2935688097 | 2935684952 | Bacteria | 9590419 |
| 903 | 2935701361 | 2935694250 | Bacteria | 9291695 |
| 904 | 2935708384 | 2935703347 | Bacteria | 10242284 |
| 905 | 2935715116 | 2935713505 | Bacteria | 9608509 |
| 906 | 2935726319 | 2935722832 | Bacteria | 9608746 |
| 907 | 2935733935 | 2935732158 | Bacteria | 9706831 |
| 908 | 2935743314 | 2935741537 | Bacteria | 9707219 |
| 909 | 2935754648 | 2935750917 | Bacteria | 9590372 |
| 910 | 2935765422 | 2935760218 | Bacteria | 9817913 |
| 911 | 2935776300 | 2935769743 | Bacteria | 7878163 |
| 912 | 2935784176 | 2935777560 | Bacteria | 8077691 |
| 913 | 2935790289 | 2935785616 | Bacteria | 7962367 |
| 914 | 2935798872 | 2935793552 | Bacteria | 8012592 |
| 915 | 2935805373 | 2935801545 | Bacteria | 9301974 |
| 916 | 2935816671 | 2935810662 | Bacteria | 9401221 |
| 917 | 2935820935 | 2935819856 | Bacteria | 8261050 |
| 918 | 2935833724 | 2935827899 | Bacteria | 10038562 |
| 919 | 2935839590 | 2935837841 | Bacteria | 9454360 |
| 920 | 2935850805 | 2935847175 | Bacteria | 8228321 |
| 921 | 2935856995 | 2935855204 | Bacteria | 9035059 |
| 922 | 2935871177 | 2935864058 | Bacteria | 9784707 |
| 923 | 2935876320 | 2935873716 | Bacteria | 9632195 |
| 924 | 2935913827 | 2935908558 | Bacteria | 8568796 |
| 925 | 2935920183 | 2935916978 | Bacteria | 9113783 |
| 926 | 2935930522 | 2935926038 | Bacteria | 8601059 |
| 927 | 2935939505 | 2935934488 | Bacteria | 8602579 |
| 928 | 2935946454 | 2935942939 | Bacteria | 8599779 |
| 929 | 2935955707 | 2935951376 | Bacteria | 8602333 |
| 930 | 2935964600 | 2935959822 | Bacteria | 7869783 |
| 931 | 2935972583 | 2935967501 | Bacteria | 8603075 |
| 932 | 2935989026 | 2935984226 | Bacteria | 8302647 |
| 933 | 2935997716 | 2935992306 | Bacteria | 9802711 |
| 934 | 2936007229 | 2936002035 | Bacteria | 9362176 |
| 935 | 2936011754 | 2936011229 | Bacteria | 8801034 |
| 936 | 2936020349 | 2936019824 | Bacteria | 8804134 |
| 937 | 2936029043 | 2936028420 | Bacteria | 8965941 |
| 938 | 2936043067 | 2936037263 | Bacteria | 9446081 |
| 939 | 2936047072 | 2936046547 | Bacteria | 8903709 |
| 940 | 2936061303 | 2936055302 | Bacteria | 8785755 |
| 941 | 2940559975 | 2940556831 | Bacteria | 9590747 |
| 942 | 2941508148 | 2941507105 | Bacteria | 8166816 |
| 943 | 2941515347 | 2941515067 | Bacteria | 8166720 |
| 944 | 2941524078 | 2941523033 | Bacteria | 8169134 |
| 945 | 2941535992 | 2941531003 | Bacteria | 7653939 |
| 946 | 2941540279 | 2941538514 | Bacteria | 9402094 |
| 947 | 3005477576 | 3005474847 | Bacteria | 9259049 |
| 948 | 3005489864 | 3005483717 | Bacteria | 7877331 |
| 949 | 3005507808 | 3005506211 | Bacteria | 6943378 |
| 950 | 3005590388 | 3005587118 | Bacteria | 7794411 |
| 951 | 3005598160 | 3005594810 | Bacteria | 8716512 |
| 952 | 3005713835 | 3005710791 | Bacteria | 7622528 |
| 953 | 3005721346 | 3005718088 | Bacteria | 8283608 |
| 954 | 8006931591 | 8006926726 | Bacteria | 6749210 |
| 955 | 8006933648 | 8006933436 | Bacteria | 10410654 |
| 956 | 8006983320 | 8006973647 | Bacteria | 10679141 |
| 957 | 8006988924 | 8006984368 | Bacteria | 9651211 |
| 958 | 8016514593 | 8016511872 | Bacteria | 9921665 |
| 959 | 8016530693 | 8016522445 | Bacteria | 8156687 |
| 960 | 8016535979 | 8016530956 | Bacteria | 8155261 |
| 961 | 8016540259 | 8016539877 | Bacteria | 8155419 |
| 962 | 8016552973 | 8016548790 | Bacteria | 8155074 |
| 963 | 8016561349 | 8016557553 | Bacteria | 8154380 |
| 964 | 8016574324 | 8016566248 | Bacteria | 8158151 |
| 965 | 8016578424 | 8016575299 | Bacteria | 8154085 |
| 966 | 8016591373 | 8016583857 | Bacteria | 10421953 |
| 967 | 8016599206 | 8016595262 | Bacteria | 8149947 |
| 968 | 8016611840 | 8016603502 | Bacteria | 8731218 |
| 969 | 8016621967 | 8016613128 | Bacteria | 8794220 |
| 970 | 8016627888 | 8016622563 | Bacteria | 7999408 |
| 971 | 8016632197 | 8016630954 | Bacteria | 9217207 |
| 972 | 8017061837 | 8017057580 | Bacteria | 10023680 |
| 973 | 8019535705 | 8019530166 | Bacteria | 8155624 |
| 974 | 8019543773 | 8019538911 | Bacteria | 7872763 |
| 975 | 8019559583 | 8019555841 | Bacteria | 9642137 |
| 976 | 8019569684 | 8019565922 | Bacteria | 9639779 |
| 977 | 8019581366 | 8019576017 | Bacteria | 10049540 |
| 978 | 8019588992 | 8019586578 | Bacteria | 10212056 |
| 979 | 8019602241 | 8019597564 | Bacteria | 10041141 |
| 980 | 8019616321 | 8019608314 | Bacteria | 10042931 |
| 981 | 8019626972 | 8019619141 | Bacteria | 9218857 |
| 982 | 8019657111 | 8019648815 | Bacteria | 10014479 |
| 983 | 8019688840 | 8019687851 | Bacteria | 8712826 |
| 984 | 8055747463 | 8055742211 | Bacteria | 9226248 |
| 985 | 8056676901 | 8056673599 | Bacteria | 7871253 |
| 986 | 8056695191 | 8056689827 | Bacteria | 6712655 |
| 987 | Ga0495603_0031784 | |||
| 988 | JGI25153J46596_10001348 | |||
| 989 | JGI25153J46596_10005113 | |||
| 990 | rootH2_10194050 | |||
| 991 | rootH1_10218802 | |||
| 992 | JGI25404J52841_10002324 | |||
| 993 | JGI25404J52841_10011848 | |||
| 994 | Ga0055542_1007676 | |||
| 995 | Ga0055531_10017327 | |||
| 996 | JGI25405J52794_10022700 | |||
| 997 | Ga0055543_1015382 | |||
| 998 | Ga0070658_10035994 | |||
| 999 | Ga0070658_10092501 | |||
| 1000 | Ga0070658_10282547 | |||
| 1001 | Ga0070676_10026600 | |||
| 1002 | Ga0070683_100247212 | |||
| 1003 | Ga0070690_100028466 | |||
| 1004 | Ga0070670_100240832 | |||
| 1005 | Ga0068869_100011695 | |||
| 1006 | Ga0070666_10058884 | |||
| 1007 | Ga0068868_100025028 | |||
| 1008 | Ga0068868_100077386 | |||
| 1009 | Ga0068868_100080433 | |||
| 1010 | Ga0070689_100360228 | |||
| 1011 | Ga0070661_100018105 | |||
| 1012 | Ga0070668_100034971 | |||
| 1013 | Ga0070668_100041085 | |||
| 1014 | Ga0070668_100050372 | |||
| 1015 | Ga0070668_100093700 | |||
| 1016 | Ga0070668_100123454 | |||
| 1017 | Ga0070668_100472798 | |||
| 1018 | Ga0070668_100512617 | |||
| 1019 | Ga0070669_100096764 | |||
| 1020 | Ga0070669_100270370 | |||
| 1021 | Ga0070675_100015290 | |||
| 1022 | Ga0070675_100139137 | |||
| 1023 | Ga0070675_100144007 | |||
| 1024 | Ga0070675_100172639 | |||
| 1025 | Ga0070675_100260914 | |||
| 1026 | Ga0070671_100084323 | |||
| 1027 | Ga0070671_100467827 | |||
| 1028 | Ga0070671_100569626 | |||
| 1029 | Ga0070674_100005849 | |||
| 1030 | Ga0070674_100286185 | |||
| 1031 | Ga0070674_100380114 | |||
| 1032 | Ga0070673_100049195 | |||
| 1033 | Ga0070673_100083303 | |||
| 1034 | Ga0070673_100116694 | |||
| 1035 | Ga0070673_100497786 | |||
| 1036 | Ga0070688_100188968 | |||
| 1037 | Ga0070688_100247229 | |||
| 1038 | Ga0070659_100085056 | |||
| 1039 | Ga0070667_100058981 | |||
| 1040 | Ga0070667_100234682 | |||
| 1041 | Ga0070667_100390250 | |||
| 1042 | Ga0070709_10007981 | |||
| 1043 | Ga0070709_10010010 | |||
| 1044 | Ga0070713_100018061 | |||
| 1045 | Ga0070713_100078575 | |||
| 1046 | Ga0070711_100017786 | |||
| 1047 | Ga0070711_100217823 | |||
| 1048 | Ga0070700_100059967 | |||
| 1049 | Ga0070700_100207291 | |||
| 1050 | Ga0070700_100245844 | |||
| 1051 | Ga0070708_100032898 | |||
| 1052 | Ga0070663_100015862 | |||
| 1053 | Ga0070663_100028129 | |||
| 1054 | Ga0070663_100031284 | |||
| 1055 | Ga0070663_100047543 | |||
| 1056 | Ga0070663_100129979 | |||
| 1057 | Ga0070663_100153088 | |||
| 1058 | Ga0070663_100179236 | |||
| 1059 | Ga0070663_100396955 | |||
| 1060 | Ga0070678_100017583 | |||
| 1061 | Ga0070678_100025842 | |||
| 1062 | Ga0070678_100040466 | |||
| 1063 | Ga0070678_100043604 | |||
| 1064 | Ga0070662_100128561 | |||
| 1065 | Ga0070662_100145515 | |||
| 1066 | Ga0070681_10020209 | |||
| 1067 | Ga0068867_100134850 | |||
| 1068 | Ga0070685_10015586 | |||
| 1069 | Ga0070706_100288427 | |||
| 1070 | Ga0070707_100179894 | |||
| 1071 | Ga0070699_100027008 | |||
| 1072 | Ga0070679_100142014 | |||
| 1073 | Ga0070684_100132544 | |||
| 1074 | Ga0070697_100191014 | |||
| 1075 | Ga0068853_100053977 | |||
| 1076 | Ga0068853_100115324 | |||
| 1077 | Ga0068853_100151042 | |||
| 1078 | Ga0068853_100268674 | |||
| 1079 | Ga0070672_100108422 | |||
| 1080 | Ga0070672_100163889 | |||
| 1081 | Ga0070695_100000851 | |||
| 1082 | Ga0070665_100003924 | |||
| 1083 | Ga0070665_100011644 | |||
| 1084 | Ga0070665_100015331 | |||
| 1085 | Ga0070665_100039788 | |||
| 1086 | Ga0070665_100064243 | |||
| 1087 | Ga0070665_100093475 | |||
| 1088 | Ga0070665_100278819 | |||
| 1089 | Ga0070704_100152049 | |||
| 1090 | Ga0070704_100603643 | |||
| 1091 | Ga0068855_100139627 | |||
| 1092 | Ga0068855_100140841 | |||
| 1093 | Ga0068855_100352618 | |||
| 1094 | Ga0070664_100074858 | |||
| 1095 | Ga0070664_100114539 | |||
| 1096 | Ga0068857_100768090 | |||
| 1097 | Ga0068854_100180415 | |||
| 1098 | Ga0070702_100009600 | |||
| 1099 | Ga0068859_100116234 | |||
| 1100 | Ga0068859_100334823 | |||
| 1101 | Ga0068864_100083414 | |||
| 1102 | Ga0068866_10049442 | |||
| 1103 | Ga0068861_100094526 | |||
| 1104 | Ga0068861_100109378 | |||
| 1105 | Ga0068861_100209411 | |||
| 1106 | Ga0068861_100235133 | |||
| 1107 | Ga0068863_100120646 | |||
| 1108 | Ga0068863_100153799 | |||
| 1109 | Ga0068863_100186494 | |||
| 1110 | Ga0068863_100426709 | |||
| 1111 | Ga0068858_100034300 | |||
| 1112 | Ga0068858_100049819 | |||
| 1113 | Ga0068858_100088988 | |||
| 1114 | Ga0068858_100191614 | |||
| 1115 | Ga0068858_100335497 | |||
| 1116 | Ga0068860_100009962 | |||
| 1117 | Ga0068860_100017045 | |||
| 1118 | Ga0068862_100018832 | |||
| 1119 | Ga0068862_100049355 | |||
| 1120 | Ga0068862_100155323 | |||
| 1121 | Ga0068862_100440358 | |||
| 1122 | Ga0068862_100468346 | |||
| 1123 | Ga0081455_10001207 | |||
| 1124 | Ga0081455_10002021 | |||
| 1125 | Ga0081455_10005151 | |||
| 1126 | Ga0081455_10012489 | |||
| 1127 | Ga0081455_10026629 | |||
| 1128 | Ga0081455_10045635 | |||
| 1129 | Ga0081455_10140027 | |||
| 1130 | Ga0081538_10010297 | |||
| 1131 | Ga0081540_1000075 | |||
| 1132 | Ga0081540_1000199 | |||
| 1133 | Ga0081540_1000373 | |||
| 1134 | Ga0081540_1000904 | |||
| 1135 | Ga0081540_1002468 | |||
| 1136 | Ga0081540_1007774 | |||
| 1137 | Ga0081540_1010461 | |||
| 1138 | Ga0081540_1012806 | |||
| 1139 | Ga0081540_1019596 | |||
| 1140 | Ga0081540_1021716 | |||
| 1141 | Ga0081540_1024507 | |||
| 1142 | Ga0081539_10015306 | |||
| 1143 | Ga0075365_10009759 | |||
| 1144 | Ga0075365_10019345 | |||
| 1145 | Ga0075365_10037162 | |||
| 1146 | Ga0075365_10079261 | |||
| 1147 | Ga0075365_10123565 | |||
| 1148 | Ga0075368_10057946 | |||
| 1149 | Ga0075368_10065280 | |||
| 1150 | Ga0075368_10098526 | |||
| 1151 | Ga0075368_10141845 | |||
| 1152 | Ga0075364_10081732 | |||
| 1153 | Ga0070716_100134796 | |||
| 1154 | Ga0070712_100082567 | |||
| 1155 | Ga0070712_100158897 | |||
| 1156 | Ga0075362_10059855 | |||
| 1157 | Ga0075367_10070460 | |||
| 1158 | Ga0075427_10001634 | |||
| 1159 | Ga0075366_10055853 | |||
| 1160 | Ga0075366_10078980 | |||
| 1161 | Ga0075370_10008406 | |||
| 1162 | Ga0075370_10024237 | |||
| 1163 | Ga0075370_10051867 | |||
| 1164 | Ga0075370_10076862 | |||
| 1165 | Ga0075370_10252653 | |||
| 1166 | Ga0075428_100060636 | |||
| 1167 | Ga0075428_100082182 | |||
| 1168 | Ga0075428_100108421 | |||
| 1169 | Ga0075428_100154086 | |||
| 1170 | Ga0075430_100002329 | |||
| 1171 | Ga0075430_100089238 | |||
| 1172 | Ga0075430_100119211 | |||
| 1173 | Ga0075430_100155852 | |||
| 1174 | Ga0075430_100330088 | |||
| 1175 | Ga0075431_100082967 | |||
| 1176 | Ga0075431_100097653 | |||
| 1177 | Ga0075431_100498710 | |||
| 1178 | Ga0075433_10002467 | |||
| 1179 | Ga0075433_10024444 | |||
| 1180 | Ga0075433_10032543 | |||
| 1181 | Ga0075434_100031382 | |||
| 1182 | Ga0075434_100137186 | |||
| 1183 | Ga0075434_100219154 | |||
| 1184 | Ga0075429_100040222 | |||
| 1185 | Ga0075429_100074856 | |||
| 1186 | Ga0068865_100059781 | |||
| 1187 | Ga0068865_100122289 | |||
| 1188 | Ga0097620_100116231 | |||
| 1189 | Ga0097620_100334836 | |||
| 1190 | Ga0099825_1024499 | |||
| 1191 | Ga0099825_1039920 | |||
| 1192 | Ga0099824_1016075 | |||
| 1193 | Ga0099824_1022540 | |||
| 1194 | Ga0099822_1005361 | |||
| 1195 | Ga0099822_1033954 | |||
| 1196 | Ga0099823_1038759 | |||
| 1197 | Ga0075435_100026199 | |||
| 1198 | Ga0075435_100029267 | |||
| 1199 | Ga0075435_100121623 | |||
| 1200 | Ga0075435_100137889 | |||
| 1201 | Ga0075435_100221112 | |||
| 1202 | Ga0075435_100247987 | |||
| 1203 | Ga0099794_10001910 | |||
| 1204 | Ga0099795_10007092 | |||
| 1205 | Ga0105240_10133696 | |||
| 1206 | Ga0105240_10481126 | |||
| 1207 | Ga0111539_10004711 | |||
| 1208 | Ga0111539_10113788 | |||
| 1209 | Ga0111539_10188582 | |||
| 1210 | Ga0105245_10028707 | |||
| 1211 | Ga0105245_10071874 | |||
| 1212 | Ga0105245_10551295 | |||
| 1213 | Ga0105245_10854204 | |||
| 1214 | Ga0105247_10137399 | |||
| 1215 | Ga0114129_10065176 | |||
| 1216 | Ga0114129_10097158 | |||
| 1217 | Ga0114129_10103217 | |||
| 1218 | Ga0114129_10122946 | |||
| 1219 | Ga0114129_10174002 | |||
| 1220 | Ga0114129_10174153 | |||
| 1221 | Ga0114129_10219830 | |||
| 1222 | Ga0114129_11014398 | |||
| 1223 | Ga0105243_10023886 | |||
| 1224 | Ga0105243_10170425 | |||
| 1225 | Ga0105241_10009784 | |||
| 1226 | Ga0105241_10022328 | |||
| 1227 | Ga0105241_10075397 | |||
| 1228 | Ga0105242_10275223 | |||
| 1229 | Ga0105248_10025654 | |||
| 1230 | Ga0105248_10239373 | |||
| 1231 | Ga0105248_10504104 | |||
| 1232 | Ga0105248_10600592 | |||
| 1233 | Ga0105248_10721903 | |||
| 1234 | Ga0105237_10001286 | |||
| 1235 | Ga0105237_10019561 | |||
| 1236 | Ga0105237_10070713 | |||
| 1237 | Ga0105237_10121414 | |||
| 1238 | Ga0105237_10250574 | |||
| 1239 | Ga0105237_10308261 | |||
| 1240 | Ga0105238_10035583 | |||
| 1241 | Ga0105238_10092006 | |||
| 1242 | Ga0105249_10282304 | |||
| 1243 | Ga0105249_10517955 | |||
| 1244 | Ga0105239_10031496 | |||
| 1245 | Ga0105239_10045785 | |||
| 1246 | Ga0105239_10126790 | |||
| 1247 | Ga0105239_10202408 | |||
| 1248 | Ga0105239_10237552 | |||
| 1249 | Ga0105239_10613861 | |||
| 1250 | Ga0105239_11156499 | |||
| 1251 | Ga0105246_10012957 | |||
| 1252 | Ga0105246_10022531 | |||
| 1253 | Ga0105246_10061885 | |||
| 1254 | Ga0105246_10085648 | |||
| 1255 | Ga0157374_10302787 | |||
| 1256 | Ga0157374_10440798 | |||
| 1257 | Ga0157374_10441597 | |||
| 1258 | Ga0157378_10018279 | |||
| 1259 | Ga0157378_10140137 | |||
| 1260 | Ga0163162_10043512 | |||
| 1261 | Ga0163162_10233446 | |||
| 1262 | Ga0157372_10116018 | |||
| 1263 | Ga0157375_10038184 | |||
| 1264 | Ga0157375_10047706 | |||
| 1265 | Ga0157375_10056271 | |||
| 1266 | Ga0157375_10312170 | |||
| 1267 | Ga0157375_10364778 | |||
| 1268 | Ga0163163_10041823 | |||
| 1269 | Ga0163163_10078765 | |||
| 1270 | Ga0163163_10450467 | |||
| 1271 | Ga0163163_10541768 | |||
| 1272 | Ga0157380_10051724 | |||
| 1273 | Ga0157380_10079993 | |||
| 1274 | Ga0157380_10301187 | |||
| 1275 | Ga0182008_10020362 | |||
| 1276 | Ga0157379_10017256 | |||
| 1277 | Ga0157379_10187769 | |||
| 1278 | Ga0157379_10198000 | |||
| 1279 | Ga0157379_10200872 | |||
| 1280 | Ga0157376_10411975 | |||
| 1281 | Ga0163161_10022999 | |||
| 1282 | Ga0163161_10076433 | |||
| 1283 | Ga0163161_10240794 | |||
| 1284 | Ga0214544_1000006 | |||
| 1285 | Ga0214542_1000002 | |||
| 1286 | Ga0214545_1000002 | |||
| 1287 | Ga0214543_1000017 | |||
| 1288 | Ga0213872_10030867 | |||
| 1289 | Ga0209563_100471 | |||
| 1290 | Ga0209677_100757 | |||
| 1291 | Ga0209677_108436 | |||
| 1292 | Ga0209233_1010533 | |||
| 1293 | Ga0209455_1005175 | |||
| 1294 | Ga0209675_1004035 | |||
| 1295 | Ga0209758_1000216 | |||
| 1296 | Ga0209758_1005195 | |||
| 1297 | Ga0209256_1003991 | |||
| 1298 | Ga0207426_1002409 | |||
| 1299 | Ga0207426_1006600 | |||
| 1300 | Ga0207426_1034113 | |||
| 1301 | Ga0209257_1001462 | |||
| 1302 | Ga0207697_10053457 | |||
| 1303 | Ga0207653_10014263 | |||
| 1304 | Ga0207692_10001933 | |||
| 1305 | Ga0207642_10156537 | |||
| 1306 | Ga0207710_10020192 | |||
| 1307 | Ga0207710_10123374 | |||
| 1308 | Ga0207688_10000077 | |||
| 1309 | Ga0207688_10027476 | |||
| 1310 | Ga0207680_10018688 | |||
| 1311 | Ga0207680_10287248 | |||
| 1312 | Ga0207647_10081907 | |||
| 1313 | Ga0207645_10059755 | |||
| 1314 | Ga0207643_10036633 | |||
| 1315 | Ga0207705_10025430 | |||
| 1316 | Ga0207684_10387193 | |||
| 1317 | Ga0207654_10065552 | |||
| 1318 | Ga0207707_10057329 | |||
| 1319 | Ga0207695_10000342 | |||
| 1320 | Ga0207671_10003865 | |||
| 1321 | Ga0207671_10048284 | |||
| 1322 | Ga0207671_10276970 | |||
| 1323 | Ga0207671_10380243 | |||
| 1324 | Ga0207693_10007359 | |||
| 1325 | Ga0207663_10010822 | |||
| 1326 | Ga0207663_10012418 | |||
| 1327 | Ga0207660_10469289 | |||
| 1328 | Ga0207662_10122803 | |||
| 1329 | Ga0207657_10199814 | |||
| 1330 | Ga0207649_10010842 | |||
| 1331 | Ga0207652_10170220 | |||
| 1332 | Ga0207646_10431598 | |||
| 1333 | Ga0207681_10141929 | |||
| 1334 | Ga0207681_10294011 | |||
| 1335 | Ga0207681_10533665 | |||
| 1336 | Ga0207694_10136289 | |||
| 1337 | Ga0207694_10172060 | |||
| 1338 | Ga0207650_10125013 | |||
| 1339 | Ga0207659_10168954 | |||
| 1340 | Ga0207687_10081618 | |||
| 1341 | Ga0207664_10012334 | |||
| 1342 | Ga0207644_10302496 | |||
| 1343 | Ga0207690_10062447 | |||
| 1344 | Ga0207706_10001566 | |||
| 1345 | Ga0207706_10024495 | |||
| 1346 | Ga0207706_10045202 | |||
| 1347 | Ga0207706_10121570 | |||
| 1348 | Ga0207686_10121522 | |||
| 1349 | Ga0207709_10015580 | |||
| 1350 | Ga0207670_10113344 | |||
| 1351 | Ga0207670_10386086 | |||
| 1352 | Ga0207670_10390743 | |||
| 1353 | Ga0207669_10082312 | |||
| 1354 | Ga0207665_10014843 | |||
| 1355 | Ga0207665_10055607 | |||
| 1356 | Ga0207691_10116641 | |||
| 1357 | Ga0207691_10133599 | |||
| 1358 | Ga0207711_10014612 | |||
| 1359 | Ga0207711_10072116 | |||
| 1360 | Ga0207711_10307545 | |||
| 1361 | Ga0207711_10457356 | |||
| 1362 | Ga0207689_10002811 | |||
| 1363 | Ga0207689_10056696 | |||
| 1364 | Ga0207689_10078711 | |||
| 1365 | Ga0207661_10432011 | |||
| 1366 | Ga0207651_10027057 | |||
| 1367 | Ga0207651_10182020 | |||
| 1368 | Ga0207651_10504668 | |||
| 1369 | Ga0207712_10114698 | |||
| 1370 | Ga0207712_10157922 | |||
| 1371 | Ga0207712_10347826 | |||
| 1372 | Ga0207712_10367331 | |||
| 1373 | Ga0207668_10014121 | |||
| 1374 | Ga0207668_10100003 | |||
| 1375 | Ga0207668_10175145 | |||
| 1376 | Ga0207668_10189653 | |||
| 1377 | Ga0207668_10190269 | |||
| 1378 | Ga0207668_10203020 | |||
| 1379 | Ga0207668_10391802 | |||
| 1380 | Ga0207668_10414000 | |||
| 1381 | Ga0207640_10028836 | |||
| 1382 | Ga0207640_10087828 | |||
| 1383 | Ga0207658_10029667 | |||
| 1384 | Ga0207677_10089401 | |||
| 1385 | Ga0207677_10110273 | |||
| 1386 | Ga0207703_10041818 | |||
| 1387 | Ga0207703_10132767 | |||
| 1388 | Ga0207703_10168877 | |||
| 1389 | Ga0207678_10016327 | |||
| 1390 | Ga0207678_10019801 | |||
| 1391 | Ga0207678_10023742 | |||
| 1392 | Ga0207678_10044292 | |||
| 1393 | Ga0207678_10054649 | |||
| 1394 | Ga0207678_10054664 | |||
| 1395 | Ga0207678_10070409 | |||
| 1396 | Ga0207708_10062016 | |||
| 1397 | Ga0207708_10068790 | |||
| 1398 | Ga0207641_10094128 | |||
| 1399 | Ga0207641_10273835 | |||
| 1400 | Ga0207641_10298532 | |||
| 1401 | Ga0207648_10001800 | |||
| 1402 | Ga0207648_10198539 | |||
| 1403 | Ga0207648_10540914 | |||
| 1404 | Ga0207676_10072722 | |||
| 1405 | Ga0207676_10143852 | |||
| 1406 | Ga0207674_10071136 | |||
| 1407 | Ga0207675_100008275 | |||
| 1408 | Ga0207675_100024973 | |||
| 1409 | Ga0207675_100081999 | |||
| 1410 | Ga0207675_100244883 | |||
| 1411 | Ga0207683_10018799 | |||
| 1412 | Ga0207683_10021283 | |||
| 1413 | Ga0207683_10033761 | |||
| 1414 | Ga0207683_10036754 | |||
| 1415 | Ga0207698_10815684 | |||
| 1416 | Ga0209389_1000196 | |||
| 1417 | Ga0209389_1000284 | |||
| 1418 | Ga0209589_1000006 | |||
| 1419 | Ga0209589_1001029 | |||
| 1420 | Ga0209489_100007 | |||
| 1421 | Ga0209489_101824 | |||
| 1422 | Ga0209489_117016 | |||
| 1423 | Ga0209700_100008 | |||
| 1424 | Ga0209700_103273 | |||
| 1425 | Ga0209588_1030098 | |||
| 1426 | Ga0209588_1035751 | |||
| 1427 | Ga0209813_10019693 | |||
| 1428 | Ga0209813_10034302 | |||
| 1429 | Ga0209813_10042184 | |||
| 1430 | Ga0207428_10003095 | |||
| 1431 | Ga0268266_10000544 | |||
| 1432 | Ga0268266_10001633 | |||
| 1433 | Ga0268266_10027900 | |||
| 1434 | Ga0268266_10079594 | |||
| 1435 | Ga0268266_10213358 | |||
| 1436 | Ga0268266_10269456 | |||
| 1437 | Ga0268265_10048073 | |||
| 1438 | Ga0268265_10051918 | |||
| 1439 | Ga0268265_10383668 | |||
| 1440 | Ga0268264_10037322 | |||
| 1441 | Ga0265337_1007475 | |||
| 1442 | Ga0265319_1002882 | |||
| 1443 | Ga0265334_10009925 | |||
| 1444 | Ga0265318_10013021 | |||
| 1445 | Ga0265336_10001981 | |||
| 1446 | Ga0307517_10228684 | |||
| 1447 | Ga0307515_10059588 | |||
| 1448 | Ga0265338_10000013 | |||
| 1449 | Ga0265324_10003322 | |||
| 1450 | Ga0307509_10274011 | |||
| 1451 | Ga0307408_100485484 | |||
| 1452 | Ga0307516_10006378 | |||
| 1453 | Ga0307516_10144193 | |||
| 1454 | Ga0307516_10204159 | |||
| 1455 | Ga0307413_10038382 | |||
| 1456 | Ga0307409_100187443 | |||
| 1457 | Ga0307415_100034576 | |||
| 1458 | Ga0307510_10004428 | |||
| 1459 | Ga0307510_10017480 | |||
| 1460 | Ga0315911_1000010 | |||
| 1461 | Ga0373926_0065719 | |||
| 1462 | Ga0373928_0021744 | |||
| 1463 | Ga0373929_0023510 | |||
| 1464 | Ga0373952_0019731 | |||
| 1465 | Ga0373923_0126224 | |||
| 1466 | Ga0373932_0017972 | |||
| 1467 | Ga0373932_0047206 | |||
| 1468 | Ga0373932_0062846 | |||
| 1469 | Ga0373936_0053244 | |||
| 1470 | Ga0373939_0005708 | |||
| 1471 | Ga0373939_0138478 | |||
| 1472 | Ga0373941_0053037 | |||
| 1473 | Ga0373945_0061371 | |||
| 1474 | Ga0373960_0030197 | |||
| 1475 | Ga0373960_0078200 | |||
| 1476 | Ga0373943_0012834 | |||
| 1477 | Ga0373943_0071923 | |||
| 1478 | Ga0373943_0114119 | |||
| 1479 | Ga0373946_0006617 | |||
| 1480 | Ga0373955_0152426 | |||
| 1481 | Ga0373942_0010929 | |||
| 1482 | Ga0373961_0012173 | |||
| 1483 | Ga0373962_0012362 | |||
| 1484 | Ga0373962_0028315 | |||
| 1485 | Ga0373931_0000589 | |||
| 1486 | Ga0373931_0013520 | |||
| 1487 | Ga0373935_0052593 | |||
| 1488 | Ga0373935_0056830 | |||
| 1489 | Ga0373935_0080948 | |||
| 1490 | Ga0373927_0007128 | |||
| 1491 | Ga0373927_0041681 | |||
| 1492 | Ga0373927_0048146 | |||
| 1493 | Ga0373927_0071342 | |||
| 1494 | Ga0373927_0156791 | |||
| 1495 | Ga0373933_0038204 | |||
| 1496 | Ga0373947_0001699 | |||
| 1497 | Ga0373947_0007402 | |||
| 1498 | Ga0373947_0055264 | |||
| 1499 | Ga0373947_0069905 | |||
| 1500 | Ga0373937_0009747 | |||
| 1501 | Ga0373937_0376498 | |||
| 1502 | Ga0373925_0022773 | |||
| 1503 | Ga0373925_0067599 | |||
| 1504 | Ga0373925_0089875 | |||
| 1505 | Ga0373925_0116895 | |||
| 1506 | Ga0395905_0124921 | |||
| 1507 | Ga0395905_0160393 | |||
| 1508 | Ga0395901_0404554 | |||
| 1509 | Ga0436365_1610361 | |||
| 1510 | Ga0436360_0737618 | |||
| 1511 | Ga0436361_0102531 | |||
| 1512 | Ga0436361_0496474 | |||
| 1513 | Ga0436361_0857818 | |||
| 1514 | Ga0436363_0112888 | |||
| 1515 | Ga0436362_1154959 | |||
| 1516 | Ga0439465_0017091 | |||
| 1517 | Ga0439465_0078545 | |||
| 1518 | Ga0451807_2471553 | |||
| 1519 | Ga0450897_009266 | |||
| 1520 | Ga0439446_0037075 | |||
| 1521 | Ga0466972_0068802 | |||
| 1522 | Ga0466972_0114728 | |||
| 1523 | Ga0466961_0271468 | |||
| 1524 | Ga0466959_0246904 | |||
| 1525 | Ga0466967_0013831 | |||
| 1526 | Ga0495617_004300 | |||
| 1527 | Ga0495617_056880 | |||
| 1528 | Ga0495592_0027994 | |||
| 1529 | Ga0495603_0002549 | |||
| 1530 | Ga0495603_0007037 | |||
| 1531 | Ga0495603_0045565 | |||
| 1532 | Ga0495603_0166349 | |||
| 1533 | Ga0495629_0004300 | |||
| 1534 | Ga0495629_0005021 | |||
| 1535 | Ga0495638_0035509 | |||
| 1536 | Ga0495638_0037407 | |||
| 1537 | Ga0495580_0041029 | |||
| 1538 | Ga0495582_0114352 | |||
| 1539 | Ga0495605_0072932 | |||
| 1540 | Ga0495639_0004473 | |||
| 1541 | Ga0495639_0095316 | |||
| 1542 | Ga0495639_0176879 | |||
| 1543 | Ga0495662_0012054 | |||
| 1544 | Ga0495664_0009734 | |||
| 1545 | Ga0495664_0132492 | |||
| 1546 | Ga0495585_0079024 | |||
| 1547 | Ga0495585_0155111 | |||
| 1548 | Ga0495585_0175457 | |||
| 1549 | Ga0495594_0010444 | |||
| 1550 | Ga0495594_0023889 | |||
| 1551 | Ga0495596_0118653 | |||
| 1552 | Ga0495607_0149066 | |||
| 1553 | Ga0495606_0038752 | |||
| 1554 | Ga0495616_0144378 | |||
| 1555 | Ga0495618_0025545 | |||
| 1556 | Ga0495628_0091771 | |||
| 1557 | Ga0495628_0137156 | |||
| 1558 | Ga0495631_0131545 | |||
| 1559 | Ga0495643_0081618 | |||
| 1560 | Ga0495644_0024670 | |||
| 1561 | Ga0495644_0157517 | |||
| 1562 | Ga0495663_0068741 | |||
| 1563 | Ga0495666_0043604 | |||
| 1564 | Ga0495642_0062807 | |||
| 1565 | Ga0495665_0026950 | |||
| 1566 | Ga0495640_0023620 | |||
| 1567 | Ga0495640_0040831 | |||
| 1568 | Ga0495598_0013894 | |||
| 1569 | Ga0495609_0152860 | |||
| 1570 | Ga0495621_0050282 | |||
| 1571 | Ga0495597_0025896 | |||
| 1572 | Ga0495667_0035623 | |||
| 1573 | Ga0495656_0002595 | |||
| 1574 | Ga0495656_0189933 | |||
| 1575 | Ga0495668_0069745 | |||
| 1576 | Ga0495634_0012735 | |||
| 1577 | Ga0495611_0150360 | |||
| 1578 | Ga0495625_0009575 | |||
| 1579 | Ga0495625_0048587 | |||
| 1580 | Ga0495625_0121291 | |||
| 1581 | Ga0495625_0317169 | |||
| 1582 | Ga0495635_0005943 | |||
| 1583 | Ga0495635_0085160 | |||
| 1584 | Ga0495659_0008078 | |||
| 1585 | Ga0495661_0218414 | |||
| 1586 | Ga0495588_0025133 | |||
| 1587 | Ga0495588_0103725 | |||
| 1588 | Ga0495588_0154253 | |||
| 1589 | Ga0495657_0041743 | |||
| 1590 | Ga0495646_0139351 | |||
| 1591 | Ga0495647_0003332 | |||
| 1592 | Ga0495647_0047611 | |||
| 1593 | Ga0495658_0017021 | |||
| 1594 | Ga0495658_0091052 | |||
| 1595 | Ga0495658_0135977 | |||
| 1596 | Ga0495669_0001655 | |||
| 1597 | Ga0495613_0060267 | |||
| 1598 | Ga0495613_0098560 | |||
| 1599 | Ga0495624_0003239 | |||
| 1600 | Ga0495624_0148702 | |||
| 1601 | Ga0495649_0004412 | |||
| 1602 | Ga0495589_0061947 | |||
| 1603 | Ga0495600_0029114 | |||
| 1604 | Ga0495581_0002498 | |||
| 1605 | Ga0495581_0097956 | |||
| 1606 | Ga0495604_0102779 | |||
| 1607 | Ga0495636_0056022 | |||
| 1608 | Ga0495674_0031540 | |||
| 1609 | Ga0495672_0058508 | |||
| 1610 | Ga0495676_0015378 | |||
| 1611 | Ga0495683_0109795 | |||
| 1612 | Ga0495683_0134017 | |||
| 1613 | Ga0495673_0042343 | |||
| 1614 | Ga0495686_0047811 | |||
| 1615 | Ga0495686_0126967 | |||
| 1616 | Ga0495593_0000942 | |||
| 1617 | Ga0495614_0110194 | |||
| 1618 | Ga0495614_0144894 | |||
| 1619 | Ga0495615_0031144 | |||
| 1620 | Ga0495615_0067856 | |||
| 1621 | Ga0496100_0332759 | |||
| 1622 | Ga0496100_0440611 | |||
| 1623 | Ga0496101_0074176 | |||
| 1624 | Ga0496101_0090953 | |||
| 1625 | Ga0496101_0103682 | |||
| 1626 | Ga0496101_0111802 | |||
| 1627 | Ga0496101_0228021 | |||
| 1628 | Ga0496102_0012884 | |||
| 1629 | Ga0496102_0050685 | |||
| 1630 | Ga0496102_0102199 | |||
| 1631 | Ga0496102_0250623 | |||
| 1632 | Ga0496102_0362380 | |||
| 1633 | Ga0496103_0074034 | |||
| 1634 | Ga0496104_0000916 | |||
| 1635 | Ga0496104_0058187 | |||
| 1636 | Ga0496104_0065281 | |||
| 1637 | Ga0496104_0091319 | |||
| 1638 | Ga0496104_0121880 | |||
| 1639 | Ga0496104_0302932 | |||
| 1640 | Ga0496104_0339954 | |||
| 1641 | Ga0496105_0018517 | |||
| 1642 | Ga0496105_0169445 | |||
| 1643 | Ga0496105_0197699 | |||
| 1644 | Ga0496105_0225750 | |||
| 1645 | Ga0496105_0301692 | |||
| 1646 | Ga0496105_0379562 | |||
| 1647 | Ga0496106_0188090 | |||
| 1648 | Ga0496106_0494849 | |||
| 1649 | Ga0496107_0063803 | |||
| 1650 | Ga0496107_0212560 | |||
| 1651 | Ga0496108_0203309 | |||
| 1652 | Ga0496108_0303673 | |||
| 1653 | Ga0496109_0300568 | |||
| 1654 | Ga0496109_0306471 | |||
| 1655 | Ga0496110_0009234 | |||
| 1656 | Ga0496110_0046873 | |||
| 1657 | Ga0496110_0233232 | |||
| 1658 | Ga0496110_0242547 | |||
| 1659 | Ga0496111_0028232 | |||
| 1660 | Ga0496111_0071062 | |||
| 1661 | Ga0496112_0071722 | |||
| 1662 | Ga0496112_0073248 | |||
| 1663 | Ga0496112_0144283 | |||
| 1664 | Ga0496112_0193576 | |||
| 1665 | Ga0496112_0260818 | |||
| 1666 | Ga0496113_0029907 | |||
| 1667 | Ga0496113_0121262 | |||
| 1668 | Ga0496113_0216416 | |||
| 1669 | Ga0496113_0249510 | |||
| 1670 | Ga0496113_0313176 | |||
| 1671 | Ga0496114_0073481 | |||
| 1672 | Ga0496114_0172047 | |||
| 1673 | Ga0496114_0205672 | |||
| 1674 | Ga0496114_0463564 | |||
| 1675 | Ga0496114_0526132 | |||
| 1676 | Ga0496115_0054272 | |||
| 1677 | Ga0496115_0089891 | |||
| 1678 | Ga0496115_0095660 | |||
| 1679 | Ga0496115_0110292 | |||
| 1680 | Ga0496115_0120612 | |||
| 1681 | Ga0496115_0152102 | |||
| 1682 | Ga0496115_0183849 | |||
| 1683 | Ga0496116_0076727 | |||
| 1684 | Ga0496118_0020691 | |||
| 1685 | Ga0496118_0119089 | |||
| 1686 | Ga0496118_0121408 | |||
| 1687 | Ga0496119_0024691 | |||
| 1688 | Ga0496119_0192969 | |||
| 1689 | Ga0496120_0030655 | |||
| 1690 | Ga0496121_0015817 | |||
| 1691 | Ga0496121_0018938 | |||
| 1692 | Ga0496121_0042465 | |||
| 1693 | Ga0496121_0044500 | |||
| 1694 | Ga0496121_0059718 | |||
| 1695 | Ga0496121_0060439 | |||
| 1696 | Ga0496121_0061883 | |||
| 1697 | Ga0496121_0228380 | |||
| 1698 | Ga0496121_0231457 | |||
| 1699 | Ga0496121_0339662 | |||
| 1700 | Ga0496121_0402545 | |||
| 1701 | Ga0496124_0008072 | |||
| 1702 | Ga0496124_0078139 | |||
| 1703 | Ga0496124_0113175 | |||
| 1704 | Ga0496125_0064169 | |||
| 1705 | Ga0496125_0101569 | |||
| 1706 | Ga0496125_0128971 | |||
| 1707 | Ga0496126_0002447 | |||
| 1708 | Ga0496126_0021927 | |||
| 1709 | Ga0496126_0043210 | |||
| 1710 | Ga0496126_0129359 | |||
| 1711 | Ga0496126_0141674 | |||
| 1712 | Ga0496126_0141788 | |||
| 1713 | Ga0496126_0158676 | |||
| 1714 | Ga0496126_0162654 | |||
| 1715 | Ga0496126_0258317 | |||
| 1716 | Ga0496126_0582869 | |||
| 1717 | Ga0501039_0454496 | |||
| 1718 | Ga0501071_0008888 | |||
| 1719 | Ga0501081_0128703 | |||
| 1720 | Ga0501083_0357688 | |||
| 1721 | Ga0501045_0068998 | |||
| 1722 | nmdc:mga03683_15843_c1 | |||
| 1723 | nmdc:mga03n38_88327_c1 | |||
| 1724 | nmdc:mga00v17_134587_c1 | |||
| 1725 | nmdc:mga0yw44_26825_c1 | |||
| 1726 | nmdc:mga0yw44_63600_c1 | |||
| 1727 | nmdc:mga0yw44_86331_c1 | |||
| 1728 | nmdc:mga06z11_27833_c1 | |||
| 1729 | nmdc:mga06z11_48054_c1 | |||
| 1730 | nmdc:mga04h51_92630_c1 | |||
| 1731 | nmdc:mga07m45_17287_c1 | |||
| 1732 | nmdc:mga07m45_23241_c1 | |||
| 1733 | nmdc:mga07m45_3901_c1 | |||
| 1734 | nmdc:mga05p37_190242_c1 | |||
| 1735 | nmdc:mga05p37_38746_c1 | |||
| 1736 | nmdc:mga05p37_5331_c1 | |||
| 1737 | nmdc:mga09592_30838_c1 | |||
| 1738 | nmdc:mga0qj67_147369_c1 | |||
| 1739 | nmdc:mga0qj67_30180_c1 | |||
| 1740 | nmdc:mga0qj67_48398_c1 | |||
| 1741 | nmdc:mga06r32_198858_c1 | |||
| 1742 | nmdc:mga06r32_320092_c1 | |||
| 1743 | nmdc:mga06r32_487812_c1 | |||
| 1744 | nmdc:mga08y16_308916_c1 | |||
| 1745 | nmdc:mga08y16_34711_c1 | |||
| 1746 | nmdc:mga0n895_160319_c1 | |||
| 1747 | nmdc:mga0n895_167823_c1 | |||
| 1748 | nmdc:mga0n895_219851_c1 | |||
| 1749 | nmdc:mga0rr50_211700_c1 | |||
| 1750 | nmdc:mga0rr50_625140_c1 | |||
| 1751 | nmdc:mga0a205_10385_c1 | |||
| 1752 | nmdc:mga0a205_270135_c1 | |||
| 1753 | nmdc:mga0a205_517752_c1 | |||
| 1754 | nmdc:mga0a205_6427_c1 | |||
| 1755 | nmdc:mga0sz30_43035_c1 | |||
| 1756 | Ga0495601_0035361 | |||
| 1757 | Ga0495601_0093556 | |||
| 1758 | Ga0495619_0005502 | |||
| 1759 | Ga0500578_0081033 | |||
| 1760 | Ga0500643_000114 | |||
| 1761 | Ga0500643_076630 | |||
| 1762 | Ga0500566_0001448 | |||
| 1763 | Ga0500641_0118170 | |||
| 1764 | Ga0500648_176918 | |||
| 1765 | Ga0500556_0023415 | |||
| 1766 | Ga0500557_000001 | |||
| 1767 | Ga0500595_002799 | |||
| 1768 | Ga0500595_010510 | |||
| 1769 | Ga0500608_168768 | |||
| 1770 | Ga0500642_0000240 | |||
| 1771 | Ga0500590_013608 | |||
| 1772 | Ga0500590_126025 | |||
| 1773 | Ga0500636_0129277 | |||
| 1774 | Ga0500636_0145011 | |||
| 1775 | Ga0500625_006844 | |||
| 1776 | Ga0500645_008456 | |||
| 1777 | Ga0500656_004287 | |||
| 1778 | Ga0500601_000202 | |||
| 1779 | Ga0501084_0163282 | |||
| 1780 | Ga0500661_008088 | |||
| 1781 | Ga0530510_0016583 | |||
| 1782 | Ga0530510_0219456 | |||
| 1783 | 2507509683 | |||
| 1784 | 2508543699 | |||
| 1785 | 2508698518 | |||
| 1786 | 2513628282 | |||
| 1787 | 2513641940 | |||
| 1788 | 2513655054 | |||
| 1789 | 2513673450 | |||
| 1790 | 2513693551 | |||
| 1791 | 2513703841 | |||
| 1792 | 2513722919 | |||
| 1793 | 2513861074 | |||
| 1794 | 2513875763 | |||
| 1795 | 2513894485 | |||
| 1796 | 2513915923 | |||
| 1797 | 2514016199 | |||
| 1798 | 2515629130 | |||
| 1799 | 2517103621 | |||
| 1800 | 2517894773 | |||
| 1801 | 2524442212 | |||
| 1802 | 2524534522 | |||
| 1803 | 2528855501 | |||
| 1804 | 2617349184 | |||
| 1805 | 2617378266 | |||
| 1806 | 2671119185 | |||
| 1807 | 2723848443 | |||
| 1808 | 2728747571 | |||
| 1809 | 2745079503 | |||
| 1810 | 2793060345 | |||
| 1811 | 2793071244 | |||
| 1812 | 2793080991 | |||
| 1813 | 2805917725 | |||
| 1814 | 2818241406 | |||
| 1815 | 2824602201 | |||
| 1816 | 2824610189 | |||
| 1817 | 2824623797 | |||
| 1818 | 2824627789 | |||
| 1819 | 2824639325 | |||
| 1820 | 2824646896 | |||
| 1821 | 2824656172 | |||
| 1822 | 2824666976 | |||
| 1823 | 2824672766 | |||
| 1824 | 2824686123 | |||
| 1825 | 2824693416 | |||
| 1826 | 2824698382 | |||
| 1827 | 2824720758 | |||
| 1828 | 2824730894 | |||
| 1829 | 2824735987 | |||
| 1830 | 2824746841 | |||
| 1831 | 2824773937 | |||
| 1832 | 2838130623 | |||
| 1833 | 2841941143 | |||
| 1834 | 2841957303 | |||
| 1835 | 2841967297 | |||
| 1836 | 2841979307 | |||
| 1837 | 2841989782 | |||
| 1838 | 2842038718 | |||
| 1839 | 2842048337 | |||
| 1840 | 2847934917 | |||
| 1841 | 2847945492 | |||
| 1842 | 2849080321 | |||
| 1843 | 2857510317 | |||
| 1844 | 2874609216 | |||
| 1845 | 2874613163 | |||
| 1846 | 2874636554 | |||
| 1847 | 2879086308 | |||
| 1848 | 2879109428 | |||
| 1849 | 2879119197 | |||
| 1850 | 2881366310 | |||
| 1851 | 2881672943 | |||
| 1852 | 2885378787 | |||
| 1853 | 2885416660 | |||
| 1854 | 2888394882 | |||
| 1855 | 2888423381 | |||
| 1856 | 2889036991 | |||
| 1857 | 2903749629 | |||
| 1858 | 2904697755 | |||
| 1859 | 2904705907 | |||
| 1860 | 2906611486 | |||
| 1861 | 2906628181 | |||
| 1862 | 2906641671 | |||
| 1863 | 2906649823 | |||
| 1864 | 2906660773 | |||
| 1865 | 2908745079 | |||
| 1866 | 2908757148 | |||
| 1867 | 2908779020 | |||
| 1868 | 2922363627 | |||
| 1869 | 2922373127 | |||
| 1870 | 2922392804 | |||
| 1871 | 2922395323 | |||
| 1872 | 2922427869 | |||
| 1873 | 2929615816 | |||
| 1874 | 2929630429 | |||
| 1875 | 2932792072 | |||
| 1876 | 2932814061 | |||
| 1877 | 2932819451 | |||
| 1878 | 2932833840 | |||
| 1879 | 2933578898 | |||
| 1880 | 2935611458 | |||
| 1881 | 2935618630 | |||
| 1882 | 2935632200 | |||
| 1883 | 2935644527 | |||
| 1884 | 2935648844 | |||
| 1885 | 2935657074 | |||
| 1886 | 2935673582 | |||
| 1887 | 2935678469 | |||
| 1888 | 2935688097 | |||
| 1889 | 2935701361 | |||
| 1890 | 2935708384 | |||
| 1891 | 2935715116 | |||
| 1892 | 2935726319 | |||
| 1893 | 2935733935 | |||
| 1894 | 2935743314 | |||
| 1895 | 2935754648 | |||
| 1896 | 2935765422 | |||
| 1897 | 2935776300 | |||
| 1898 | 2935784176 | |||
| 1899 | 2935790289 | |||
| 1900 | 2935798872 | |||
| 1901 | 2935805373 | |||
| 1902 | 2935816671 | |||
| 1903 | 2935820935 | |||
| 1904 | 2935833724 | |||
| 1905 | 2935839590 | |||
| 1906 | 2935850805 | |||
| 1907 | 2935856995 | |||
| 1908 | 2935871177 | |||
| 1909 | 2935876320 | |||
| 1910 | 2935913827 | |||
| 1911 | 2935920183 | |||
| 1912 | 2935930522 | |||
| 1913 | 2935939505 | |||
| 1914 | 2935946454 | |||
| 1915 | 2935955707 | |||
| 1916 | 2935964600 | |||
| 1917 | 2935972583 | |||
| 1918 | 2935989026 | |||
| 1919 | 2935997716 | |||
| 1920 | 2936007229 | |||
| 1921 | 2936011754 | |||
| 1922 | 2936020349 | |||
| 1923 | 2936029043 | |||
| 1924 | 2936043067 | |||
| 1925 | 2936047072 | |||
| 1926 | 2936061303 | |||
| 1927 | 2940559975 | |||
| 1928 | 2941508148 | |||
| 1929 | 2941515347 | |||
| 1930 | 2941524078 | |||
| 1931 | 2941535992 | |||
| 1932 | 2941540279 | |||
| 1933 | 3005477576 | |||
| 1934 | 3005489864 | |||
| 1935 | 3005507808 | |||
| 1936 | 3005590388 | |||
| 1937 | 3005598160 | |||
| 1938 | 3005713835 | |||
| 1939 | 3005721346 | |||
| 1940 | 8006931591 | |||
| 1941 | 8006933648 | |||
| 1942 | 8006983320 | |||
| 1943 | 8006988924 | |||
| 1944 | 8016514593 | |||
| 1945 | 8016530693 | |||
| 1946 | 8016535979 | |||
| 1947 | 8016540259 | |||
| 1948 | 8016552973 | |||
| 1949 | 8016561349 | |||
| 1950 | 8016574324 | |||
| 1951 | 8016578424 | |||
| 1952 | 8016591373 | |||
| 1953 | 8016599206 | |||
| 1954 | 8016611840 | |||
| 1955 | 8016621967 | |||
| 1956 | 8016627888 | |||
| 1957 | 8016632197 | |||
| 1958 | 8017061837 | |||
| 1959 | 8019535705 | |||
| 1960 | 8019543773 | |||
| 1961 | 8019559583 | |||
| 1962 | 8019569684 | |||
| 1963 | 8019581366 | |||
| 1964 | 8019588992 | |||
| 1965 | 8019602241 | |||
| 1966 | 8019616321 | |||
| 1967 | 8019626972 | |||
| 1968 | 8019657111 | |||
| 1969 | 8019688840 | |||
| 1970 | 8055747463 | |||
| 1971 | 8056676901 | |||
| 1972 | 8056695191 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ddd-assembly1.cif.gz_A | crystal structure of a putative acetyltransferase (np_142035.1) from pyrococcus horikoshii at 2.25 a resolution | 0.8475 | 4 | 280 |
| 7daj-assembly1.cif.gz_B | the crystal structure of serotonin n-acetyltransferase in complex with acetyl-coa from oryza sativa | 0.8365 | 44 | 118 |
| 5xxs-assembly1.cif.gz_A | crystal structure of native ribt from bacillus subtilis | 0.8135 | 44 | 100 |
| 3ddd-assembly1.cif.gz_A | crystal structure of a putative acetyltransferase (np_142035.1) from pyrococcus horikoshii at 2.25 a resolution | 0.8134 | 4 | 280 |
| 4pv6-assembly8.cif.gz_N | crystal structure analysis of ard1 from thermoplasma volcanium | 0.8113 | 4 | 122 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9NAR2_219_339_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8906 | 174 | 225 | 3.40.630.30 |
| af_I1KMR4_18_159_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8779 | 44 | 93 | 3.40.630.30 |
| af_I1MRQ6_38_162_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8779 | 44 | 93 | 3.40.630.30 |
| 1y9wB01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8708 | 44 | 122 | 3.40.630.30 |
| af_Q9N5J3_186_300_3.40.630.90 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase; | 0.8704 | 138 | 223 | 3.40.630.90 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A090D1U8-F1-model_v4 | Acetyltransferase, GNAT family | 0.9732 | 1 | 280 |
GO:0016747
|
| AF-A0A2N1VL18-F1-model_v4 | GNAT family N-acetyltransferase | 0.9728 | 3 | 280 |
GO:0016747
|
| AF-B3SBF2-F1-model_v4 | N-acetyltransferase domain-containing protein | 0.9722 | 2 | 275 |
GO:0016747
|
| AF-A0A7C7WKX4-F1-model_v4 | GNAT family N-acetyltransferase | 0.9721 | 9 | 280 |
GO:0016747
|
| AF-A0A5B7V481-F1-model_v4 | Acetyltransferase (GNAT) family protein | 0.972 | 2 | 280 |
GO:0016747
|