F487530

General Info

Members Datasets Scaffolds Average Seq Length
986 573 1972 280

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0031784|Ga0495603_0031784_378_1382
Length 334
Sequence MIFCAKKCAISGLFTFALRGEGASIAQSIAVLRFFMIAIRGVTVGAAHSRIVVMNSFTIRTMRPDEISLAVDWAAAEGWNPGLADDACFASVDPEGFFIAELDGKPVATVSCVNYDARFAFLGFYMVRADLRGKGFGLRIWDAAIAHAGARVIGLDGVVAQQENYKKSGFQLAYANVRYGGTVVAAPAAPRTDIMALSDIPFAAVEADDATVFPAPRSAFLRAWIGARGHIGCALMRDGRLAGWGVIRPCRKGFKIGPLVADDRASAEVVLSALLARVGGGEIFLDVPGINREAIALAQDFGLAPVFETARMYTGAIPPLRMQRVFGVTSFELG

Samples

Sample ID Description Type Environment
1 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
87 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
88 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
89 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
119 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
120 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
121 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
122 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
123 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
126 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
129 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
191 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
192 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
193 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
194 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
196 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
201 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
202 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
203 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
204 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
205 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
206 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
207 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
208 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
209 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
210 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
211 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
212 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
213 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
216 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
217 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
218 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
219 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
220 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
221 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
223 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
224 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
225 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
226 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
227 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
228 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
229 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
230 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
231 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
232 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
233 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
234 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
235 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
237 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
238 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
239 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
240 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
242 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
243 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
244 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
245 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
246 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
247 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
248 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
249 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
250 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
251 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
252 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
253 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
254 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
255 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
256 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
257 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
258 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
259 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
260 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
261 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
262 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
263 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
264 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
265 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
266 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
267 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
268 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
269 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
270 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
271 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
272 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
273 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
274 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
275 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
276 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
277 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
278 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
279 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
280 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
281 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
282 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
283 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
284 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
285 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
286 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
287 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
288 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
289 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
290 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
291 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
292 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
293 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
294 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
295 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
296 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
297 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
298 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
299 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
300 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
301 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
302 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
303 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
304 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
305 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
306 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
307 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
308 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
309 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
310 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
311 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
312 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
313 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
314 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
315 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
316 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
317 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
318 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
319 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
320 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
321 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
322 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
323 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
324 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
325 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
326 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
327 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
328 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
329 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
330 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
331 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
332 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
333 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
334 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
335 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
336 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
337 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
338 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
339 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
340 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
341 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
342 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
344 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
345 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
346 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
347 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
348 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
349 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
350 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
351 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
352 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
353 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
354 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
355 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
356 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
357 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
358 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
359 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
360 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
361 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
362 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
363 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
364 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
365 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
366 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
367 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
368 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
369 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
370 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
371 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
372 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
373 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
374 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
375 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
376 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
377 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
378 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
379 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
380 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
381 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
382 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
383 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
384 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
385 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
386 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
387 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
388 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
389 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
390 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
391 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
392 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
393 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
394 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
395 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
396 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
397 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
398 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
399 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
400 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
401 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
402 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
403 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
404 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
405 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
406 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
407 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
408 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
409 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
410 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
411 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
412 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
413 2791355199
414 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
415 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
416 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
417 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
418 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
419 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
420 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
421 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
422 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
423 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
424 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
425 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
426 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
427 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
428 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
429 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
430 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
431 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
432 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
433 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
434 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
435 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
436 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
437 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
438 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
439 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
440 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
441 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
442 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
443 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
444 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
445 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
446 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
447 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
448 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
449 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
450 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
451 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
452 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
453 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
454 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
455 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
456 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
457 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
458 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
459 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
460 2904699407
461 2906610324
462 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
463 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
464 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
465 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
466 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
467 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
468 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
469 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
470 2922368715
471 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
472 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
473 2922425934
474 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
475 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
476 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
477 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
478 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
479 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
480 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
481 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
482 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
483 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
484 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
485 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
486 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
487 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
488 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
489 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
490 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
491 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
492 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
493 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
494 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
495 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
496 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
497 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
498 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
499 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
500 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
501 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
502 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
503 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
504 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
505 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
506 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
507 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
508 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
509 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
510 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
511 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
512 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
513 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
514 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
515 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
516 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
517 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
518 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
519 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
520 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
521 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
522 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
523 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
524 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
525 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
526 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
527 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
528 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
529 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
530 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
531 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
532 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
533 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
534 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
535 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
536 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
537 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
538 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
539 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
540 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
541 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
542 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
543 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
544 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
545 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
546 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
547 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
548 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
549 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
550 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
551 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
552 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
553 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
554 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
555 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
556 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
557 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
558 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
559 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
560 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
561 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
562 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
563 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
564 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
565 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
566 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
567 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
568 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
569 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
570 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
571 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
572 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
573 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.14
Metatranscriptomes 0
Isolates 18.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.51
Nodule 16.53
Rhizoplane 6.49
Rhizosphere 60.04
Stem 0
Stem Tuber 0
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495603_0031784 3300046455 Bacteria 3178
2 JGI25153J46596_10001348 3300003215 Bacteria 14698
3 JGI25153J46596_10005113 3300003215 Bacteria 6921
4 rootH2_10194050 3300003320 Bacteria 1150
5 rootH1_10218802 3300003323 Bacteria 1221
6 JGI25404J52841_10002324 3300003659 Bacteria 3580
7 JGI25404J52841_10011848 3300003659 Bacteria 1884
8 Ga0055542_1007676 3300003762 Bacteria 2168
9 Ga0055531_10017327 3300003794 Bacteria 3049
10 JGI25405J52794_10022700 3300003911 Bacteria 1274
11 Ga0055543_1015382 3300004625 Bacteria 1474
12 Ga0070658_10035994 3300005327 Bacteria 3989
13 Ga0070658_10092501 3300005327 Bacteria 2493
14 Ga0070658_10282547 3300005327 Bacteria 1413
15 Ga0070676_10026600 3300005328 Bacteria 3276
16 Ga0070683_100247212 3300005329 Bacteria 1696
17 Ga0070690_100028466 3300005330 Bacteria 3461
18 Ga0070670_100240832 3300005331 Bacteria 1575
19 Ga0068869_100011695 3300005334 Bacteria 5767
20 Ga0070666_10058884 3300005335 Bacteria 2598
21 Ga0068868_100025028 3300005338 Bacteria 4534
22 Ga0068868_100077386 3300005338 Bacteria 2661
23 Ga0068868_100080433 3300005338 Bacteria 2612
24 Ga0070689_100360228 3300005340 Bacteria 1222
25 Ga0070661_100018105 3300005344 Bacteria 5005
26 Ga0070668_100034971 3300005347 Bacteria 3829
27 Ga0070668_100041085 3300005347 Bacteria 3543
28 Ga0070668_100050372 3300005347 Bacteria 3206
29 Ga0070668_100093700 3300005347 Bacteria 2370
30 Ga0070668_100123454 3300005347 Bacteria 2072
31 Ga0070668_100472798 3300005347 Bacteria 1081
32 Ga0070668_100512617 3300005347 Bacteria 1040
33 Ga0070669_100096764 3300005353 Bacteria 2221
34 Ga0070669_100270370 3300005353 Bacteria 1359
35 Ga0070675_100015290 3300005354 Bacteria 6064
36 Ga0070675_100139137 3300005354 Bacteria 2074
37 Ga0070675_100144007 3300005354 Bacteria 2039
38 Ga0070675_100172639 3300005354 Bacteria 1865
39 Ga0070675_100260914 3300005354 Bacteria 1518
40 Ga0070671_100084323 3300005355 Bacteria 2657
41 Ga0070671_100467827 3300005355 Bacteria 1082
42 Ga0070671_100569626 3300005355 Bacteria 977
43 Ga0070674_100005849 3300005356 Bacteria 7151
44 Ga0070674_100286185 3300005356 Bacteria 1308
45 Ga0070674_100380114 3300005356 Bacteria 1149
46 Ga0070673_100049195 3300005364 Bacteria 3291
47 Ga0070673_100083303 3300005364 Bacteria 2598
48 Ga0070673_100116694 3300005364 Bacteria 2221
49 Ga0070673_100497786 3300005364 Bacteria 1102
50 Ga0070688_100188968 3300005365 Bacteria 1434
51 Ga0070688_100247229 3300005365 Bacteria 1269
52 Ga0070659_100085056 3300005366 Unclassified 2530
53 Ga0070667_100058981 3300005367 Bacteria 3246
54 Ga0070667_100234682 3300005367 Bacteria 1636
55 Ga0070667_100390250 3300005367 Bacteria 1266
56 Ga0070709_10007981 3300005434 Bacteria 5816
57 Ga0070709_10010010 3300005434 Bacteria 5240
58 Ga0070713_100018061 3300005436 Bacteria 5356
59 Ga0070713_100078575 3300005436 Bacteria 2809
60 Ga0070711_100017786 3300005439 Bacteria 4529
61 Ga0070711_100217823 3300005439 Bacteria 1482
62 Ga0070700_100059967 3300005441 Bacteria 2397
63 Ga0070700_100207291 3300005441 Bacteria 1381
64 Ga0070700_100245844 3300005441 Bacteria 1281
65 Ga0070708_100032898 3300005445 Bacteria 4501
66 Ga0070663_100015862 3300005455 Bacteria 4876
67 Ga0070663_100028129 3300005455 Bacteria 3823
68 Ga0070663_100031284 3300005455 Bacteria 3656
69 Ga0070663_100047543 3300005455 Bacteria 3039
70 Ga0070663_100129979 3300005455 Bacteria 1911
71 Ga0070663_100153088 3300005455 Bacteria 1770
72 Ga0070663_100179236 3300005455 Bacteria 1642
73 Ga0070663_100396955 3300005455 Bacteria 1126
74 Ga0070678_100017583 3300005456 Bacteria 4611
75 Ga0070678_100025842 3300005456 Bacteria 3959
76 Ga0070678_100040466 3300005456 Bacteria 3298
77 Ga0070678_100043604 3300005456 Bacteria 3196
78 Ga0070662_100128561 3300005457 Bacteria 1950
79 Ga0070662_100145515 3300005457 Bacteria 1841
80 Ga0070681_10020209 3300005458 Bacteria 6675
81 Ga0068867_100134850 3300005459 Bacteria 1923
82 Ga0070685_10015586 3300005466 Bacteria 4039
83 Ga0070706_100288427 3300005467 Bacteria 1532
84 Ga0070707_100179894 3300005468 Bacteria 2061
85 Ga0070699_100027008 3300005518 Bacteria 4951
86 Ga0070679_100142014 3300005530 Unclassified 2380
87 Ga0070684_100132544 3300005535 Bacteria 2248
88 Ga0070697_100191014 3300005536 Bacteria 1738
89 Ga0068853_100053977 3300005539 Bacteria 3462
90 Ga0068853_100115324 3300005539 Bacteria 2390
91 Ga0068853_100151042 3300005539 Bacteria 2091
92 Ga0068853_100268674 3300005539 Bacteria 1570
93 Ga0070672_100108422 3300005543 Bacteria 2261
94 Ga0070672_100163889 3300005543 Bacteria 1846
95 Ga0070695_100000851 3300005545 Bacteria 16425
96 Ga0070665_100003924 3300005548 Bacteria 15697
97 Ga0070665_100011644 3300005548 Bacteria 8889
98 Ga0070665_100015331 3300005548 Bacteria 7695
99 Ga0070665_100039788 3300005548 Bacteria 4726
100 Ga0070665_100064243 3300005548 Bacteria 3680
101 Ga0070665_100093475 3300005548 Bacteria 3012
102 Ga0070665_100278819 3300005548 Bacteria 1673
103 Ga0070704_100152049 3300005549 Bacteria 1821
104 Ga0070704_100603643 3300005549 Bacteria 965
105 Ga0068855_100139627 3300005563 Bacteria 2763
106 Ga0068855_100140841 3300005563 Bacteria 2749
107 Ga0068855_100352618 3300005563 Bacteria 1621
108 Ga0070664_100074858 3300005564 Bacteria 2907
109 Ga0070664_100114539 3300005564 Bacteria 2356
110 Ga0068857_100768090 3300005577 Bacteria 919
111 Ga0068854_100180415 3300005578 Bacteria 1649
112 Ga0070702_100009600 3300005615 Bacteria 4744
113 Ga0068859_100116234 3300005617 Bacteria 2739
114 Ga0068859_100334823 3300005617 Bacteria 1608
115 Ga0068864_100083414 3300005618 Bacteria 2806
116 Ga0068866_10049442 3300005718 Bacteria 2131
117 Ga0068861_100094526 3300005719 Bacteria 2365
118 Ga0068861_100109378 3300005719 Bacteria 2212
119 Ga0068861_100209411 3300005719 Bacteria 1641
120 Ga0068861_100235133 3300005719 Bacteria 1556
121 Ga0068863_100120646 3300005841 Bacteria 2500
122 Ga0068863_100153799 3300005841 Bacteria 2202
123 Ga0068863_100186494 3300005841 Bacteria 1992
124 Ga0068863_100426709 3300005841 Bacteria 1299
125 Ga0068858_100034300 3300005842 Bacteria 4707
126 Ga0068858_100049819 3300005842 Bacteria 3878
127 Ga0068858_100088988 3300005842 Bacteria 2873
128 Ga0068858_100191614 3300005842 Bacteria 1932
129 Ga0068858_100335497 3300005842 Bacteria 1446
130 Ga0068860_100009962 3300005843 Bacteria 9418
131 Ga0068860_100017045 3300005843 Bacteria 7081
132 Ga0068862_100018832 3300005844 Bacteria 5753
133 Ga0068862_100049355 3300005844 Bacteria 3594
134 Ga0068862_100155323 3300005844 Bacteria 2039
135 Ga0068862_100440358 3300005844 Bacteria 1226
136 Ga0068862_100468346 3300005844 Bacteria 1190
137 Ga0081455_10001207 3300005937 Bacteria 32353
138 Ga0081455_10002021 3300005937 Bacteria 24257
139 Ga0081455_10005151 3300005937 Bacteria 14395
140 Ga0081455_10012489 3300005937 Bacteria 8475
141 Ga0081455_10026629 3300005937 Bacteria 5312
142 Ga0081455_10045635 3300005937 Bacteria 3811
143 Ga0081455_10140027 3300005937 Bacteria 1880
144 Ga0081538_10010297 3300005981 Bacteria 7676
145 Ga0081540_1000075 3300005983 Bacteria 106804
146 Ga0081540_1000199 3300005983 Bacteria 62482
147 Ga0081540_1000373 3300005983 Bacteria 44890
148 Ga0081540_1000904 3300005983 Bacteria 26798
149 Ga0081540_1002468 3300005983 Bacteria 15067
150 Ga0081540_1007774 3300005983 Bacteria 7587
151 Ga0081540_1010461 3300005983 Bacteria 6278
152 Ga0081540_1012806 3300005983 Bacteria 5488
153 Ga0081540_1019596 3300005983 Bacteria 4104
154 Ga0081540_1021716 3300005983 Bacteria 3812
155 Ga0081540_1024507 3300005983 Bacteria 3500
156 Ga0081539_10015306 3300005985 Bacteria 5585
157 Ga0075365_10009759 3300006038 Bacteria 5546
158 Ga0075365_10019345 3300006038 Bacteria 4202
159 Ga0075365_10037162 3300006038 Bacteria 3160
160 Ga0075365_10079261 3300006038 Bacteria 2222
161 Ga0075365_10123565 3300006038 Bacteria 1787
162 Ga0075368_10057946 3300006042 Bacteria 1547
163 Ga0075368_10065280 3300006042 Bacteria 1462
164 Ga0075368_10098526 3300006042 Bacteria 1199
165 Ga0075368_10141845 3300006042 Bacteria 1001
166 Ga0075364_10081732 3300006051 Bacteria 2136
167 Ga0070716_100134796 3300006173 Bacteria 1566
168 Ga0070712_100082567 3300006175 Bacteria 2331
169 Ga0070712_100158897 3300006175 Bacteria 1744
170 Ga0075362_10059855 3300006177 Bacteria 1720
171 Ga0075367_10070460 3300006178 Bacteria 2102
172 Ga0075427_10001634 3300006194 Bacteria 2906
173 Ga0075366_10055853 3300006195 Bacteria 2345
174 Ga0075366_10078980 3300006195 Bacteria 1964
175 Ga0075370_10008406 3300006353 Bacteria 5313
176 Ga0075370_10024237 3300006353 Bacteria 3350
177 Ga0075370_10051867 3300006353 Bacteria 2326
178 Ga0075370_10076862 3300006353 Bacteria 1915
179 Ga0075370_10252653 3300006353 Bacteria 1045
180 Ga0075428_100060636 3300006844 Bacteria 4143
181 Ga0075428_100082182 3300006844 Bacteria 3515
182 Ga0075428_100108421 3300006844 Bacteria 3027
183 Ga0075428_100154086 3300006844 Bacteria 2496
184 Ga0075430_100002329 3300006846 Bacteria 15774
185 Ga0075430_100089238 3300006846 Bacteria 2580
186 Ga0075430_100119211 3300006846 Bacteria 2200
187 Ga0075430_100155852 3300006846 Bacteria 1902
188 Ga0075430_100330088 3300006846 Bacteria 1260
189 Ga0075431_100082967 3300006847 Bacteria 3309
190 Ga0075431_100097653 3300006847 Bacteria 3033
191 Ga0075431_100498710 3300006847 Bacteria 1209
192 Ga0075433_10002467 3300006852 Bacteria 14080
193 Ga0075433_10024444 3300006852 Bacteria 5099
194 Ga0075433_10032543 3300006852 Bacteria 4466
195 Ga0075434_100031382 3300006871 Bacteria 5238
196 Ga0075434_100137186 3300006871 Bacteria 2465
197 Ga0075434_100219154 3300006871 Bacteria 1922
198 Ga0075429_100040222 3300006880 Bacteria 4069
199 Ga0075429_100074856 3300006880 Bacteria 2949
200 Ga0068865_100059781 3300006881 Bacteria 2666
201 Ga0068865_100122289 3300006881 Bacteria 1937
202 Ga0097620_100116231 3300006931 Bacteria 2739
203 Ga0097620_100334836 3300006931 Bacteria 1608
204 Ga0099825_1024499 3300006941 Bacteria 3511
205 Ga0099825_1039920 3300006941 Bacteria 1417
206 Ga0099824_1016075 3300006942 Bacteria 6889
207 Ga0099824_1022540 3300006942 Bacteria 4128
208 Ga0099822_1005361 3300006943 Bacteria 16734
209 Ga0099822_1033954 3300006943 Bacteria 3458
210 Ga0099823_1038759 3300006944 Bacteria 3538
211 Ga0075435_100026199 3300007076 Bacteria 4546
212 Ga0075435_100029267 3300007076 Bacteria 4322
213 Ga0075435_100121623 3300007076 Bacteria 2179
214 Ga0075435_100137889 3300007076 Bacteria 2045
215 Ga0075435_100221112 3300007076 Bacteria 1608
216 Ga0075435_100247987 3300007076 Bacteria 1515
217 Ga0099794_10001910 3300007265 Bacteria 7481
218 Ga0099795_10007092 3300007788 Bacteria 3103
219 Ga0105240_10133696 3300009093 Bacteria 2972
220 Ga0105240_10481126 3300009093 Bacteria 1384
221 Ga0111539_10004711 3300009094 Bacteria 17824
222 Ga0111539_10113788 3300009094 Bacteria 3173
223 Ga0111539_10188582 3300009094 Bacteria 2407
224 Ga0105245_10028707 3300009098 Bacteria 4909
225 Ga0105245_10071874 3300009098 Bacteria 3142
226 Ga0105245_10551295 3300009098 Bacteria 1175
227 Ga0105245_10854204 3300009098 Bacteria 950
228 Ga0105247_10137399 3300009101 Bacteria 1598
229 Ga0114129_10065176 3300009147 Bacteria 5085
230 Ga0114129_10097158 3300009147 Bacteria 4077
231 Ga0114129_10103217 3300009147 Bacteria 3942
232 Ga0114129_10122946 3300009147 Bacteria 3570
233 Ga0114129_10174002 3300009147 Bacteria 2933
234 Ga0114129_10174153 3300009147 Bacteria 2931
235 Ga0114129_10219830 3300009147 Bacteria 2563
236 Ga0114129_11014398 3300009147 Bacteria 1044
237 Ga0105243_10023886 3300009148 Bacteria 4659
238 Ga0105243_10170425 3300009148 Bacteria 1885
239 Ga0105241_10009784 3300009174 Bacteria 7046
240 Ga0105241_10022328 3300009174 Bacteria 4687
241 Ga0105241_10075397 3300009174 Bacteria 2628
242 Ga0105242_10275223 3300009176 Bacteria 1527
243 Ga0105248_10025654 3300009177 Bacteria 6554
244 Ga0105248_10239373 3300009177 Bacteria 2043
245 Ga0105248_10504104 3300009177 Bacteria 1365
246 Ga0105248_10600592 3300009177 Bacteria 1242
247 Ga0105248_10721903 3300009177 Bacteria 1124
248 Ga0105237_10001286 3300009545 Bacteria 33400
249 Ga0105237_10019561 3300009545 Bacteria 6994
250 Ga0105237_10070713 3300009545 Bacteria 3485
251 Ga0105237_10121414 3300009545 Bacteria 2607
252 Ga0105237_10250574 3300009545 Bacteria 1773
253 Ga0105237_10308261 3300009545 Bacteria 1586
254 Ga0105238_10035583 3300009551 Bacteria 5061
255 Ga0105238_10092006 3300009551 Bacteria 3020
256 Ga0105249_10282304 3300009553 Bacteria 1659
257 Ga0105249_10517955 3300009553 Bacteria 1240
258 Ga0105239_10031496 3300010375 Bacteria 5831
259 Ga0105239_10045785 3300010375 Bacteria 4794
260 Ga0105239_10126790 3300010375 Bacteria 2837
261 Ga0105239_10202408 3300010375 Bacteria 2224
262 Ga0105239_10237552 3300010375 Bacteria 2045
263 Ga0105239_10613861 3300010375 Bacteria 1241
264 Ga0105239_11156499 3300010375 Bacteria 891
265 Ga0105246_10012957 3300011119 Bacteria 5217
266 Ga0105246_10022531 3300011119 Bacteria 4064
267 Ga0105246_10061885 3300011119 Bacteria 2606
268 Ga0105246_10085648 3300011119 Bacteria 2257
269 Ga0157374_10302787 3300013296 Bacteria 1582
270 Ga0157374_10440798 3300013296 Bacteria 1303
271 Ga0157374_10441597 3300013296 Bacteria 1302
272 Ga0157378_10018279 3300013297 Bacteria 6154
273 Ga0157378_10140137 3300013297 Bacteria 2245
274 Ga0163162_10043512 3300013306 Bacteria 4497
275 Ga0163162_10233446 3300013306 Bacteria 1970
276 Ga0157372_10116018 3300013307 Unclassified 3070
277 Ga0157375_10038184 3300013308 Bacteria 4609
278 Ga0157375_10047706 3300013308 Bacteria 4185
279 Ga0157375_10056271 3300013308 Bacteria 3882
280 Ga0157375_10312170 3300013308 Bacteria 1737
281 Ga0157375_10364778 3300013308 Bacteria 1611
282 Ga0163163_10041823 3300014325 Bacteria 4484
283 Ga0163163_10078765 3300014325 Bacteria 3293
284 Ga0163163_10450467 3300014325 Bacteria 1347
285 Ga0163163_10541768 3300014325 Bacteria 1226
286 Ga0157380_10051724 3300014326 Bacteria 3250
287 Ga0157380_10079993 3300014326 Bacteria 2670
288 Ga0157380_10301187 3300014326 Bacteria 1477
289 Ga0182008_10020362 3300014497 Bacteria 3418
290 Ga0157379_10017256 3300014968 Bacteria 6359
291 Ga0157379_10187769 3300014968 Bacteria 1868
292 Ga0157379_10198000 3300014968 Bacteria 1816
293 Ga0157379_10200872 3300014968 Bacteria 1803
294 Ga0157376_10411975 3300014969 Bacteria 1309
295 Ga0163161_10022999 3300017792 Bacteria 4392
296 Ga0163161_10076433 3300017792 Bacteria 2458
297 Ga0163161_10240794 3300017792 Bacteria 1407
298 Ga0214544_1000006 3300021320 Bacteria 380728
299 Ga0214542_1000002 3300021321 Bacteria 720798
300 Ga0214545_1000002 3300021324 Bacteria 727485
301 Ga0214543_1000017 3300021327 Bacteria 290109
302 Ga0213872_10030867 3300021361 Bacteria 2456
303 Ga0209563_100471 3300025230 Bacteria 13811
304 Ga0209677_100757 3300025253 Bacteria 16368
305 Ga0209677_108436 3300025253 Bacteria 2000
306 Ga0209233_1010533 3300025261 Bacteria 2765
307 Ga0209455_1005175 3300025272 Bacteria 4090
308 Ga0209675_1004035 3300025291 Bacteria 6691
309 Ga0209758_1000216 3300025297 Bacteria 125352
310 Ga0209758_1005195 3300025297 Bacteria 10227
311 Ga0209256_1003991 3300025299 Bacteria 9675
312 Ga0207426_1002409 3300025302 Bacteria 12033
313 Ga0207426_1006600 3300025302 Bacteria 5002
314 Ga0207426_1034113 3300025302 Bacteria 1635
315 Ga0209257_1001462 3300025304 Bacteria 27887
316 Ga0207697_10053457 3300025315 Bacteria 1672
317 Ga0207653_10014263 3300025885 Bacteria 2492
318 Ga0207692_10001933 3300025898 Bacteria 7899
319 Ga0207642_10156537 3300025899 Bacteria 1219
320 Ga0207710_10020192 3300025900 Bacteria 2847
321 Ga0207710_10123374 3300025900 Bacteria 1239
322 Ga0207688_10000077 3300025901 Bacteria 37350
323 Ga0207688_10027476 3300025901 Bacteria 3130
324 Ga0207680_10018688 3300025903 Bacteria 3691
325 Ga0207680_10287248 3300025903 Bacteria 1144
326 Ga0207647_10081907 3300025904 Bacteria 1933
327 Ga0207645_10059755 3300025907 Bacteria 2435
328 Ga0207643_10036633 3300025908 Bacteria 2751
329 Ga0207705_10025430 3300025909 Bacteria 4227
330 Ga0207684_10387193 3300025910 Bacteria 1202
331 Ga0207654_10065552 3300025911 Bacteria 2139
332 Ga0207707_10057329 3300025912 Bacteria 3390
333 Ga0207695_10000342 3300025913 Bacteria 108393
334 Ga0207671_10003865 3300025914 Bacteria 14649
335 Ga0207671_10048284 3300025914 Bacteria 3151
336 Ga0207671_10276970 3300025914 Bacteria 1322
337 Ga0207671_10380243 3300025914 Bacteria 1122
338 Ga0207693_10007359 3300025915 Bacteria 9056
339 Ga0207663_10010822 3300025916 Bacteria 4871
340 Ga0207663_10012418 3300025916 Bacteria 4605
341 Ga0207660_10469289 3300025917 Bacteria 1019
342 Ga0207662_10122803 3300025918 Bacteria 1630
343 Ga0207657_10199814 3300025919 Bacteria 1609
344 Ga0207649_10010842 3300025920 Bacteria 5010
345 Ga0207652_10170220 3300025921 Unclassified 1954
346 Ga0207646_10431598 3300025922 Bacteria 1189
347 Ga0207681_10141929 3300025923 Bacteria 1790
348 Ga0207681_10294011 3300025923 Bacteria 1283
349 Ga0207681_10533665 3300025923 Bacteria 964
350 Ga0207694_10136289 3300025924 Bacteria 1972
351 Ga0207694_10172060 3300025924 Bacteria 1754
352 Ga0207650_10125013 3300025925 Bacteria 2007
353 Ga0207659_10168954 3300025926 Bacteria 1724
354 Ga0207687_10081618 3300025927 Bacteria 2337
355 Ga0207664_10012334 3300025929 Bacteria 6106
356 Ga0207644_10302496 3300025931 Bacteria 1289
357 Ga0207690_10062447 3300025932 Unclassified 2536
358 Ga0207706_10001566 3300025933 Bacteria 22667
359 Ga0207706_10024495 3300025933 Bacteria 5410
360 Ga0207706_10045202 3300025933 Bacteria 3902
361 Ga0207706_10121570 3300025933 Bacteria 2296
362 Ga0207686_10121522 3300025934 Bacteria 1778
363 Ga0207709_10015580 3300025935 Bacteria 4216
364 Ga0207670_10113344 3300025936 Bacteria 1958
365 Ga0207670_10386086 3300025936 Bacteria 1116
366 Ga0207670_10390743 3300025936 Bacteria 1110
367 Ga0207669_10082312 3300025937 Bacteria 2066
368 Ga0207665_10014843 3300025939 Bacteria 5121
369 Ga0207665_10055607 3300025939 Bacteria 2671
370 Ga0207691_10116641 3300025940 Bacteria 2370
371 Ga0207691_10133599 3300025940 Bacteria 2190
372 Ga0207711_10014612 3300025941 Bacteria 6525
373 Ga0207711_10072116 3300025941 Bacteria 2999
374 Ga0207711_10307545 3300025941 Bacteria 1463
375 Ga0207711_10457356 3300025941 Bacteria 1188
376 Ga0207689_10002811 3300025942 Bacteria 16084
377 Ga0207689_10056696 3300025942 Bacteria 3224
378 Ga0207689_10078711 3300025942 Bacteria 2709
379 Ga0207661_10432011 3300025944 Bacteria 1197
380 Ga0207651_10027057 3300025960 Bacteria 3596
381 Ga0207651_10182020 3300025960 Bacteria 1668
382 Ga0207651_10504668 3300025960 Bacteria 1046
383 Ga0207712_10114698 3300025961 Bacteria 2027
384 Ga0207712_10157922 3300025961 Bacteria 1759
385 Ga0207712_10347826 3300025961 Bacteria 1231
386 Ga0207712_10367331 3300025961 Bacteria 1200
387 Ga0207668_10014121 3300025972 Bacteria 4938
388 Ga0207668_10100003 3300025972 Bacteria 2152
389 Ga0207668_10175145 3300025972 Bacteria 1686
390 Ga0207668_10189653 3300025972 Bacteria 1628
391 Ga0207668_10190269 3300025972 Bacteria 1626
392 Ga0207668_10203020 3300025972 Bacteria 1580
393 Ga0207668_10391802 3300025972 Bacteria 1172
394 Ga0207668_10414000 3300025972 Bacteria 1142
395 Ga0207640_10028836 3300025981 Bacteria 3399
396 Ga0207640_10087828 3300025981 Bacteria 2145
397 Ga0207658_10029667 3300025986 Bacteria 3866
398 Ga0207677_10089401 3300026023 Bacteria 2236
399 Ga0207677_10110273 3300026023 Bacteria 2048
400 Ga0207703_10041818 3300026035 Bacteria 3674
401 Ga0207703_10132767 3300026035 Bacteria 2152
402 Ga0207703_10168877 3300026035 Bacteria 1922
403 Ga0207678_10016327 3300026067 Bacteria 6518
404 Ga0207678_10019801 3300026067 Bacteria 5918
405 Ga0207678_10023742 3300026067 Bacteria 5362
406 Ga0207678_10044292 3300026067 Bacteria 3849
407 Ga0207678_10054649 3300026067 Bacteria 3439
408 Ga0207678_10054664 3300026067 Bacteria 3439
409 Ga0207678_10070409 3300026067 Bacteria 2999
410 Ga0207708_10062016 3300026075 Bacteria 2856
411 Ga0207708_10068790 3300026075 Bacteria 2710
412 Ga0207641_10094128 3300026088 Bacteria 2627
413 Ga0207641_10273835 3300026088 Bacteria 1585
414 Ga0207641_10298532 3300026088 Bacteria 1521
415 Ga0207648_10001800 3300026089 Bacteria 23485
416 Ga0207648_10198539 3300026089 Bacteria 1779
417 Ga0207648_10540914 3300026089 Bacteria 1069
418 Ga0207676_10072722 3300026095 Bacteria 2765
419 Ga0207676_10143852 3300026095 Bacteria 2045
420 Ga0207674_10071136 3300026116 Bacteria 3495
421 Ga0207675_100008275 3300026118 Bacteria 9797
422 Ga0207675_100024973 3300026118 Bacteria 5560
423 Ga0207675_100081999 3300026118 Bacteria 3024
424 Ga0207675_100244883 3300026118 Bacteria 1733
425 Ga0207683_10018799 3300026121 Bacteria 5895
426 Ga0207683_10021283 3300026121 Bacteria 5549
427 Ga0207683_10033761 3300026121 Bacteria 4446
428 Ga0207683_10036754 3300026121 Bacteria 4265
429 Ga0207698_10815684 3300026142 Bacteria 936
430 Ga0209389_1000196 3300027296 Bacteria 43831
431 Ga0209389_1000284 3300027296 Bacteria 31998
432 Ga0209589_1000006 3300027357 Bacteria 436292
433 Ga0209589_1001029 3300027357 Bacteria 43810
434 Ga0209489_100007 3300027361 Bacteria 436292
435 Ga0209489_101824 3300027361 Bacteria 43831
436 Ga0209489_117016 3300027361 Bacteria 3539
437 Ga0209700_100008 3300027363 Bacteria 436292
438 Ga0209700_103273 3300027363 Bacteria 31313
439 Ga0209588_1030098 3300027671 Bacteria 1733
440 Ga0209588_1035751 3300027671 Bacteria 1597
441 Ga0209813_10019693 3300027866 Bacteria 1879
442 Ga0209813_10034302 3300027866 Bacteria 1514
443 Ga0209813_10042184 3300027866 Bacteria 1393
444 Ga0207428_10003095 3300027907 Bacteria 16361
445 Ga0268266_10000544 3300028379 Bacteria 52629
446 Ga0268266_10001633 3300028379 Bacteria 26087
447 Ga0268266_10027900 3300028379 Bacteria 4801
448 Ga0268266_10079594 3300028379 Bacteria 2853
449 Ga0268266_10213358 3300028379 Bacteria 1771
450 Ga0268266_10269456 3300028379 Bacteria 1580
451 Ga0268265_10048073 3300028380 Bacteria 3200
452 Ga0268265_10051918 3300028380 Bacteria 3098
453 Ga0268265_10383668 3300028380 Bacteria 1293
454 Ga0268264_10037322 3300028381 Bacteria 4006
455 Ga0265337_1007475 3300028556 Bacteria 4086
456 Ga0265319_1002882 3300028563 Bacteria 9186
457 Ga0265334_10009925 3300028573 Bacteria 4025
458 Ga0265318_10013021 3300028577 Bacteria 3525
459 Ga0265336_10001981 3300028666 Bacteria 8764
460 Ga0307517_10228684 3300028786 Bacteria 1120
461 Ga0307515_10059588 3300028794 Bacteria 5467
462 Ga0265338_10000013 3300028800 Bacteria 379065
463 Ga0265324_10003322 3300029957 Bacteria 7721
464 Ga0307509_10274011 3300031507 Bacteria 1453
465 Ga0307408_100485484 3300031548 Bacteria 1079
466 Ga0307516_10006378 3300031730 Bacteria 13828
467 Ga0307516_10144193 3300031730 Bacteria 2148
468 Ga0307516_10204159 3300031730 Bacteria 1694
469 Ga0307413_10038382 3300031824 Bacteria 2775
470 Ga0307409_100187443 3300031995 Bacteria 1838
471 Ga0307415_100034576 3300032126 Bacteria 3292
472 Ga0307510_10004428 3300033180 Bacteria 16533
473 Ga0307510_10017480 3300033180 Bacteria 8455
474 Ga0315911_1000010 3300033442 Bacteria 322197
475 Ga0373926_0065719 3300035083 Bacteria 1327
476 Ga0373928_0021744 3300035084 Bacteria 1355
477 Ga0373929_0023510 3300035085 Bacteria 1267
478 Ga0373952_0019731 3300035092 Bacteria 1407
479 Ga0373923_0126224 3300035111 Bacteria 1147
480 Ga0373932_0017972 3300035112 Bacteria 1824
481 Ga0373932_0047206 3300035112 Bacteria 1265
482 Ga0373932_0062846 3300035112 Bacteria 1133
483 Ga0373936_0053244 3300035113 Bacteria 1641
484 Ga0373939_0005708 3300035114 Bacteria 2967
485 Ga0373939_0138478 3300035114 Bacteria 875
486 Ga0373941_0053037 3300035115 Bacteria 1295
487 Ga0373945_0061371 3300035116 Bacteria 1404
488 Ga0373960_0030197 3300035121 Bacteria 1508
489 Ga0373960_0078200 3300035121 Bacteria 1036
490 Ga0373943_0012834 3300035170 Bacteria 3776
491 Ga0373943_0071923 3300035170 Bacteria 1753
492 Ga0373943_0114119 3300035170 Bacteria 1428
493 Ga0373946_0006617 3300035171 Bacteria 4208
494 Ga0373955_0152426 3300035172 Bacteria 1361
495 Ga0373942_0010929 3300035207 Bacteria 2143
496 Ga0373961_0012173 3300035241 Bacteria 2149
497 Ga0373962_0012362 3300035242 Bacteria 2150
498 Ga0373962_0028315 3300035242 Bacteria 1519
499 Ga0373931_0000589 3300035691 Bacteria 14992
500 Ga0373931_0013520 3300035691 Bacteria 3976
501 Ga0373935_0052593 3300035692 Bacteria 2589
502 Ga0373935_0056830 3300035692 Bacteria 2496
503 Ga0373935_0080948 3300035692 Bacteria 2110
504 Ga0373927_0007128 3300035695 Bacteria 7587
505 Ga0373927_0041681 3300035695 Bacteria 2977
506 Ga0373927_0048146 3300035695 Bacteria 2757
507 Ga0373927_0071342 3300035695 Bacteria 2248
508 Ga0373927_0156791 3300035695 Bacteria 1491
509 Ga0373933_0038204 3300035724 Bacteria 2821
510 Ga0373947_0001699 3300035725 Bacteria 13502
511 Ga0373947_0007402 3300035725 Bacteria 6356
512 Ga0373947_0055264 3300035725 Unclassified 2397
513 Ga0373947_0069905 3300035725 Bacteria 2150
514 Ga0373937_0009747 3300036401 Bacteria 8373
515 Ga0373937_0376498 3300036401 Bacteria 1346
516 Ga0373925_0022773 3300037068 Bacteria 4572
517 Ga0373925_0067599 3300037068 Bacteria 2696
518 Ga0373925_0089875 3300037068 Bacteria 2347
519 Ga0373925_0116895 3300037068 Bacteria 2066
520 Ga0395905_0124921 3300037471 Bacteria 2420
521 Ga0395905_0160393 3300037471 Bacteria 2114
522 Ga0395901_0404554 3300038443 Bacteria 1402
523 Ga0436365_1610361 3300039437 Bacteria 1154
524 Ga0436360_0737618 3300039438 Bacteria 2741
525 Ga0436361_0102531 3300039447 Bacteria 4162
526 Ga0436361_0496474 3300039447 Bacteria 7367
527 Ga0436361_0857818 3300039447 Bacteria 13715
528 Ga0436363_0112888 3300039450 Bacteria 1089
529 Ga0436362_1154959 3300039453 Bacteria 3540
530 Ga0439465_0017091 3300041413 Bacteria 2264
531 Ga0439465_0078545 3300041413 Bacteria 1116
532 Ga0451807_2471553 3300041486 Bacteria 909
533 Ga0450897_009266 3300042128 Bacteria 929
534 Ga0439446_0037075 3300042156 Bacteria 1427
535 Ga0466972_0068802 3300044658 Bacteria 1691
536 Ga0466972_0114728 3300044658 Bacteria 1272
537 Ga0466961_0271468 3300044693 Bacteria 1039
538 Ga0466959_0246904 3300045049 Bacteria 1232
539 Ga0466967_0013831 3300045976 Bacteria 6257
540 Ga0495617_004300 3300046452 Bacteria 5193
541 Ga0495617_056880 3300046452 Bacteria 1297
542 Ga0495592_0027994 3300046454 Bacteria 4269
543 Ga0495603_0002549 3300046455 Bacteria 10732
544 Ga0495603_0007037 3300046455 Bacteria 6750
545 Ga0495603_0045565 3300046455 Bacteria 2615
546 Ga0495603_0166349 3300046455 Bacteria 1278
547 Ga0495629_0004300 3300046459 Bacteria 10676
548 Ga0495629_0005021 3300046459 Bacteria 9917
549 Ga0495638_0035509 3300046460 Bacteria 3177
550 Ga0495638_0037407 3300046460 Bacteria 3087
551 Ga0495580_0041029 3300046472 Bacteria 3302
552 Ga0495582_0114352 3300046473 Bacteria 1517
553 Ga0495605_0072932 3300046474 Bacteria 1618
554 Ga0495639_0004473 3300046475 Bacteria 5988
555 Ga0495639_0095316 3300046475 Bacteria 1400
556 Ga0495639_0176879 3300046475 Bacteria 1038
557 Ga0495662_0012054 3300046476 Bacteria 4225
558 Ga0495664_0009734 3300046477 Bacteria 5386
559 Ga0495664_0132492 3300046477 Bacteria 1510
560 Ga0495585_0079024 3300046492 Bacteria 1784
561 Ga0495585_0155111 3300046492 Bacteria 1192
562 Ga0495585_0175457 3300046492 Bacteria 1104
563 Ga0495594_0010444 3300046499 Bacteria 4816
564 Ga0495594_0023889 3300046499 Bacteria 3279
565 Ga0495596_0118653 3300046500 Bacteria 1027
566 Ga0495607_0149066 3300046501 Bacteria 1199
567 Ga0495606_0038752 3300046507 Bacteria 3220
568 Ga0495616_0144378 3300046513 Bacteria 1081
569 Ga0495618_0025545 3300046514 Bacteria 3667
570 Ga0495628_0091771 3300046516 Bacteria 2350
571 Ga0495628_0137156 3300046516 Bacteria 1869
572 Ga0495631_0131545 3300046518 Bacteria 1075
573 Ga0495643_0081618 3300046522 Bacteria 1681
574 Ga0495644_0024670 3300046523 Bacteria 2287
575 Ga0495644_0157517 3300046523 Bacteria 870
576 Ga0495663_0068741 3300046525 Bacteria 1125
577 Ga0495666_0043604 3300046526 Bacteria 2167
578 Ga0495642_0062807 3300046528 Bacteria 1543
579 Ga0495665_0026950 3300046531 Bacteria 3085
580 Ga0495640_0023620 3300046533 Bacteria 4475
581 Ga0495640_0040831 3300046533 Bacteria 3246
582 Ga0495598_0013894 3300046537 Bacteria 2005
583 Ga0495609_0152860 3300046538 Bacteria 981
584 Ga0495621_0050282 3300046539 Bacteria 1489
585 Ga0495597_0025896 3300046542 Bacteria 2698
586 Ga0495667_0035623 3300046559 Bacteria 3325
587 Ga0495656_0002595 3300046615 Bacteria 6028
588 Ga0495656_0189933 3300046615 Bacteria 1014
589 Ga0495668_0069745 3300046616 Bacteria 1933
590 Ga0495634_0012735 3300046642 Bacteria 6088
591 Ga0495611_0150360 3300046648 Bacteria 1087
592 Ga0495625_0009575 3300046660 Bacteria 8094
593 Ga0495625_0048587 3300046660 Bacteria 3054
594 Ga0495625_0121291 3300046660 Bacteria 1779
595 Ga0495625_0317169 3300046660 Bacteria 993
596 Ga0495635_0005943 3300046663 Bacteria 8515
597 Ga0495635_0085160 3300046663 Bacteria 2162
598 Ga0495659_0008078 3300046664 Bacteria 3343
599 Ga0495661_0218414 3300046665 Bacteria 989
600 Ga0495588_0025133 3300046674 Bacteria 2965
601 Ga0495588_0103725 3300046674 Bacteria 1495
602 Ga0495588_0154253 3300046674 Bacteria 1214
603 Ga0495657_0041743 3300046675 Bacteria 3137
604 Ga0495646_0139351 3300046680 Bacteria 1358
605 Ga0495647_0003332 3300046681 Bacteria 5149
606 Ga0495647_0047611 3300046681 Bacteria 1655
607 Ga0495658_0017021 3300046683 Bacteria 3748
608 Ga0495658_0091052 3300046683 Bacteria 1806
609 Ga0495658_0135977 3300046683 Bacteria 1499
610 Ga0495669_0001655 3300046684 Bacteria 9153
611 Ga0495613_0060267 3300046689 Bacteria 2780
612 Ga0495613_0098560 3300046689 Bacteria 2112
613 Ga0495624_0003239 3300046690 Bacteria 12139
614 Ga0495624_0148702 3300046690 Bacteria 1433
615 Ga0495649_0004412 3300046694 Bacteria 9195
616 Ga0495589_0061947 3300046794 Bacteria 1835
617 Ga0495600_0029114 3300046809 Bacteria 3575
618 Ga0495581_0002498 3300047315 Bacteria 10427
619 Ga0495581_0097956 3300047315 Bacteria 1703
620 Ga0495604_0102779 3300047317 Bacteria 2097
621 Ga0495636_0056022 3300047318 Bacteria 1659
622 Ga0495674_0031540 3300047319 Bacteria 4814
623 Ga0495672_0058508 3300047320 Bacteria 2234
624 Ga0495676_0015378 3300047321 Bacteria 6815
625 Ga0495683_0109795 3300047323 Bacteria 1318
626 Ga0495683_0134017 3300047323 Bacteria 1166
627 Ga0495673_0042343 3300047469 Bacteria 2045
628 Ga0495686_0047811 3300047472 Bacteria 2700
629 Ga0495686_0126967 3300047472 Bacteria 1516
630 Ga0495593_0000942 3300047673 Bacteria 16962
631 Ga0495614_0110194 3300048089 Bacteria 1208
632 Ga0495614_0144894 3300048089 Bacteria 1057
633 Ga0495615_0031144 3300048090 Bacteria 1278
634 Ga0495615_0067856 3300048090 Bacteria 955
635 Ga0496100_0332759 3300048903 Bacteria 1143
636 Ga0496100_0440611 3300048903 Bacteria 997
637 Ga0496101_0074176 3300048904 Bacteria 2501
638 Ga0496101_0090953 3300048904 Bacteria 2270
639 Ga0496101_0103682 3300048904 Bacteria 2132
640 Ga0496101_0111802 3300048904 Bacteria 2057
641 Ga0496101_0228021 3300048904 Bacteria 1447
642 Ga0496102_0012884 3300048905 Bacteria 7238
643 Ga0496102_0050685 3300048905 Bacteria 3781
644 Ga0496102_0102199 3300048905 Bacteria 2664
645 Ga0496102_0250623 3300048905 Bacteria 1669
646 Ga0496102_0362380 3300048905 Bacteria 1365
647 Ga0496103_0074034 3300048906 Bacteria 2134
648 Ga0496104_0000916 3300048907 Bacteria 25286
649 Ga0496104_0058187 3300048907 Bacteria 3658
650 Ga0496104_0065281 3300048907 Bacteria 3454
651 Ga0496104_0091319 3300048907 Bacteria 2910
652 Ga0496104_0121880 3300048907 Bacteria 2503
653 Ga0496104_0302932 3300048907 Bacteria 1510
654 Ga0496104_0339954 3300048907 Bacteria 1414
655 Ga0496105_0018517 3300048908 Bacteria 5601
656 Ga0496105_0169445 3300048908 Bacteria 1790
657 Ga0496105_0197699 3300048908 Bacteria 1642
658 Ga0496105_0225750 3300048908 Bacteria 1523
659 Ga0496105_0301692 3300048908 Bacteria 1287
660 Ga0496105_0379562 3300048908 Bacteria 1125
661 Ga0496106_0188090 3300048909 Bacteria 1641
662 Ga0496106_0494849 3300048909 Bacteria 982
663 Ga0496107_0063803 3300048910 Bacteria 2670
664 Ga0496107_0212560 3300048910 Bacteria 1438
665 Ga0496108_0203309 3300048911 Bacteria 1719
666 Ga0496108_0303673 3300048911 Bacteria 1390
667 Ga0496109_0300568 3300048912 Bacteria 1513
668 Ga0496109_0306471 3300048912 Bacteria 1498
669 Ga0496110_0009234 3300048913 Bacteria 7970
670 Ga0496110_0046873 3300048913 Bacteria 3782
671 Ga0496110_0233232 3300048913 Bacteria 1674
672 Ga0496110_0242547 3300048913 Bacteria 1640
673 Ga0496111_0028232 3300048914 Bacteria 3976
674 Ga0496111_0071062 3300048914 Bacteria 2533
675 Ga0496112_0071722 3300048915 Bacteria 3423
676 Ga0496112_0073248 3300048915 Bacteria 3386
677 Ga0496112_0144283 3300048915 Bacteria 2349
678 Ga0496112_0193576 3300048915 Bacteria 1994
679 Ga0496112_0260818 3300048915 Bacteria 1682
680 Ga0496113_0029907 3300048916 Bacteria 3938
681 Ga0496113_0121262 3300048916 Bacteria 2044
682 Ga0496113_0216416 3300048916 Bacteria 1526
683 Ga0496113_0249510 3300048916 Bacteria 1417
684 Ga0496113_0313176 3300048916 Bacteria 1258
685 Ga0496114_0073481 3300048917 Bacteria 2878
686 Ga0496114_0172047 3300048917 Bacteria 1888
687 Ga0496114_0205672 3300048917 Bacteria 1725
688 Ga0496114_0463564 3300048917 Bacteria 1122
689 Ga0496114_0526132 3300048917 Bacteria 1045
690 Ga0496115_0054272 3300048918 Bacteria 3218
691 Ga0496115_0089891 3300048918 Bacteria 2508
692 Ga0496115_0095660 3300048918 Bacteria 2431
693 Ga0496115_0110292 3300048918 Bacteria 2260
694 Ga0496115_0120612 3300048918 Bacteria 2158
695 Ga0496115_0152102 3300048918 Bacteria 1911
696 Ga0496115_0183849 3300048918 Bacteria 1727
697 Ga0496116_0076727 3300048919 Bacteria 2092
698 Ga0496118_0020691 3300048921 Bacteria 5826
699 Ga0496118_0119089 3300048921 Bacteria 1727
700 Ga0496118_0121408 3300048921 Bacteria 1702
701 Ga0496119_0024691 3300048922 Bacteria 4220
702 Ga0496119_0192969 3300048922 Bacteria 1060
703 Ga0496120_0030655 3300048923 Bacteria 3264
704 Ga0496121_0015817 3300048924 Bacteria 7853
705 Ga0496121_0018938 3300048924 Bacteria 6908
706 Ga0496121_0042465 3300048924 Bacteria 3954
707 Ga0496121_0044500 3300048924 Bacteria 3828
708 Ga0496121_0059718 3300048924 Bacteria 3142
709 Ga0496121_0060439 3300048924 Bacteria 3116
710 Ga0496121_0061883 3300048924 Bacteria 3069
711 Ga0496121_0228380 3300048924 Bacteria 1305
712 Ga0496121_0231457 3300048924 Bacteria 1294
713 Ga0496121_0339662 3300048924 Bacteria 1004
714 Ga0496121_0402545 3300048924 Bacteria 896
715 Ga0496124_0008072 3300048927 Bacteria 11068
716 Ga0496124_0078139 3300048927 Bacteria 2728
717 Ga0496124_0113175 3300048927 Bacteria 2181
718 Ga0496125_0064169 3300048928 Bacteria 2921
719 Ga0496125_0101569 3300048928 Bacteria 2116
720 Ga0496125_0128971 3300048928 Bacteria 1785
721 Ga0496126_0002447 3300048929 Bacteria 25067
722 Ga0496126_0021927 3300048929 Bacteria 6228
723 Ga0496126_0043210 3300048929 Bacteria 4158
724 Ga0496126_0129359 3300048929 Bacteria 2183
725 Ga0496126_0141674 3300048929 Bacteria 2069
726 Ga0496126_0141788 3300048929 Bacteria 2068
727 Ga0496126_0158676 3300048929 Bacteria 1934
728 Ga0496126_0162654 3300048929 Bacteria 1906
729 Ga0496126_0258317 3300048929 Bacteria 1449
730 Ga0496126_0582869 3300048929 Bacteria 883
731 Ga0501039_0454496 3300049575 Bacteria 1006
732 Ga0501071_0008888 3300049587 Bacteria 6663
733 Ga0501081_0128703 3300049743 Bacteria 1808
734 Ga0501083_0357688 3300049744 Bacteria 949
735 Ga0501045_0068998 3300049824 Bacteria 2598
736 nmdc:mga03683_15843_c1 3300050489 Bacteria 2821
737 nmdc:mga03n38_88327_c1 3300050490 Bacteria 1470
738 nmdc:mga00v17_134587_c1 3300050491 Bacteria 1581
739 nmdc:mga0yw44_26825_c1 3300050492 Bacteria 3294
740 nmdc:mga0yw44_63600_c1 3300050492 Bacteria 2269
741 nmdc:mga0yw44_86331_c1 3300050492 Bacteria 1976
742 nmdc:mga06z11_27833_c1 3300050494 Bacteria 2706
743 nmdc:mga06z11_48054_c1 3300050494 Bacteria 2170
744 nmdc:mga04h51_92630_c1 3300050495 Bacteria 1090
745 nmdc:mga07m45_17287_c1 3300050496 Bacteria 3870
746 nmdc:mga07m45_23241_c1 3300050496 Bacteria 3387
747 nmdc:mga07m45_3901_c1 3300050496 Bacteria 7244
748 nmdc:mga05p37_190242_c1 3300050507 Bacteria 2492
749 nmdc:mga05p37_38746_c1 3300050507 Bacteria 5848
750 nmdc:mga05p37_5331_c1 3300050507 Bacteria 15103
751 nmdc:mga09592_30838_c1 3300050508 Bacteria 4464
752 nmdc:mga0qj67_147369_c1 3300050509 Bacteria 1908
753 nmdc:mga0qj67_30180_c1 3300050509 Bacteria 4216
754 nmdc:mga0qj67_48398_c1 3300050509 Bacteria 3359
755 nmdc:mga06r32_198858_c1 3300050510 Bacteria 1992
756 nmdc:mga06r32_320092_c1 3300050510 Bacteria 1537
757 nmdc:mga06r32_487812_c1 3300050510 Bacteria 1210
758 nmdc:mga08y16_308916_c1 3300050511 Bacteria 1629
759 nmdc:mga08y16_34711_c1 3300050511 Bacteria 5300
760 nmdc:mga0n895_160319_c1 3300050512 Bacteria 2281
761 nmdc:mga0n895_167823_c1 3300050512 Bacteria 2227
762 nmdc:mga0n895_219851_c1 3300050512 Bacteria 1929
763 nmdc:mga0rr50_211700_c1 3300050513 Bacteria 1597
764 nmdc:mga0rr50_625140_c1 3300050513 Bacteria 918
765 nmdc:mga0a205_10385_c1 3300050515 Bacteria 8556
766 nmdc:mga0a205_270135_c1 3300050515 Bacteria 1240
767 nmdc:mga0a205_517752_c1 3300050515 Bacteria 1049
768 nmdc:mga0a205_6427_c1 3300050515 Bacteria 10625
769 nmdc:mga0sz30_43035_c1 3300050516 Bacteria 1901
770 Ga0495601_0035361 3300053077 Bacteria 3118
771 Ga0495601_0093556 3300053077 Bacteria 1936
772 Ga0495619_0005502 3300053085 Bacteria 8033
773 Ga0500578_0081033 3300053086 Bacteria 2064
774 Ga0500643_000114 3300053087 Bacteria 84221
775 Ga0500643_076630 3300053087 Bacteria 923
776 Ga0500566_0001448 3300053094 Bacteria 13912
777 Ga0500641_0118170 3300053096 Bacteria 1142
778 Ga0500648_176918 3300053097 Bacteria 1103
779 Ga0500556_0023415 3300053104 Bacteria 2017
780 Ga0500557_000001 3300053105 Bacteria 241298
781 Ga0500595_002799 3300053119 Bacteria 8399
782 Ga0500595_010510 3300053119 Bacteria 3675
783 Ga0500608_168768 3300053122 Bacteria 940
784 Ga0500642_0000240 3300053130 Bacteria 21191
785 Ga0500590_013608 3300053148 Bacteria 4180
786 Ga0500590_126025 3300053148 Bacteria 1192
787 Ga0500636_0129277 3300053177 Bacteria 1409
788 Ga0500636_0145011 3300053177 Bacteria 1310
789 Ga0500625_006844 3300053729 Bacteria 4898
790 Ga0500645_008456 3300053730 Bacteria 3514
791 Ga0500656_004287 3300053732 Bacteria 1374
792 Ga0500601_000202 3300053737 Bacteria 12063
793 Ga0501084_0163282 3300054114 Bacteria 1879
794 Ga0500661_008088 3300055283 Bacteria 1935
795 Ga0530510_0016583 3300061734 Bacteria 5215
796 Ga0530510_0219456 3300061734 Bacteria 1413
797 2507509683 2507262055 Bacteria 8048963
798 2508543699 2508501009 Bacteria 7784016
799 2508698518 2508501042 Bacteria 8719808
800 2513628282 2513237092 Bacteria 8341956
801 2513641940 2513237094 Bacteria 8789602
802 2513655054 2513237096 Bacteria 8722461
803 2513673450 2513237098 Bacteria 9902361
804 2513693551 2513237101 Bacteria 7952346
805 2513703841 2513237102 Bacteria 7703324
806 2513722919 2513237104 Bacteria 10034502
807 2513861074 2513237137 Bacteria 9558895
808 2513875763 2513237139 Bacteria 8737671
809 2513894485 2513237141 Bacteria 8496279
810 2513915923 2513237145 Bacteria 8979722
811 2514016199 2513237161 Bacteria 8871253
812 2515629130 2515154112 Bacteria 8294334
813 2517103621 2517093001 Bacteria 9002274
814 2517894773 2517572143 Bacteria 9484767
815 2524442212 2524023205 Bacteria 8918781
816 2524534522 2524023228 Bacteria 10118060
817 2528855501 2528768022 Bacteria 10457665
818 2617349184 2617270735 Bacteria 9163226
819 2617378266 2617270741 Bacteria 8201522
820 2671119185 2667528175 Bacteria 7532676
821 2723848443 2721755755 Bacteria 8322773
822 2728747571 2728368998 Bacteria 8720350
823 2745079503 2744054633 Bacteria 8678936
824 2793060345 2791355196 Bacteria 7323613
825 2793071244 2791355197 Bacteria 8420563
826 2793080991
827 2805917725 2802429603 Bacteria 8777136
828 2818241406 2816332527 Bacteria 8933356
829 2824602201 2824600985 Bacteria 8488197
830 2824610189 2824609381 Bacteria 8672835
831 2824623797 2824617872 Bacteria 8814715
832 2824627789 2824626560 Bacteria 8813858
833 2824639325 2824635225 Bacteria 8785348
834 2824646896 2824644064 Bacteria 8743947
835 2824656172 2824653114 Bacteria 8493680
836 2824666976 2824661429 Bacteria 9877870
837 2824672766 2824671348 Bacteria 8369588
838 2824686123 2824679649 Bacteria 8248951
839 2824693416 2824687955 Bacteria 8360029
840 2824698382 2824696289 Bacteria 8335049
841 2824720758 2824714736 Bacteria 8717648
842 2824730894 2824723954 Bacteria 8758240
843 2824735987 2824732956 Bacteria 7810675
844 2824746841 2824746037 Bacteria 7911610
845 2824773937 2824773399 Bacteria 8360218
846 2838130623 2838122688 Bacteria 8803140
847 2841941143 2841941048 Bacteria 8688029
848 2841957303 2841949485 Bacteria 8680857
849 2841967297 2841966195 Bacteria 8673214
850 2841979307 2841974524 Bacteria 8931498
851 2841989782 2841983080 Bacteria 8395090
852 2842038718 2842038055 Bacteria 8002051
853 2842048337 2842045827 Bacteria 8006841
854 2847934917 2847930680 Bacteria 9342022
855 2847945492 2847939898 Bacteria 8606328
856 2849080321 2849076700 Bacteria 7039503
857 2857510317 2857509624 Bacteria 7472071
858 2874609216 2874604998 Bacteria 7834745
859 2874613163 2874612657 Bacteria 8252029
860 2874636554 2874628541 Bacteria 8630250
861 2879086308 2879083081 Bacteria 8587928
862 2879109428 2879099564 Bacteria 10442239
863 2879119197 2879110137 Bacteria 8907982
864 2881366310 2881364244 Bacteria 7710352
865 2881672943 2881665667 Bacteria 8175609
866 2885378787 2885374607 Bacteria 8927485
867 2885416660 2885409591 Bacteria 9235467
868 2888394882 2888388044 Bacteria 7304136
869 2888423381 2888419890 Bacteria 7857137
870 2889036991 2889033259 Bacteria 9099371
871 2903749629 2903748898 Bacteria 9972761
872 2904697755 2904690495 Bacteria 9412302
873 2904705907
874 2906611486
875 2906628181 2906626472 Bacteria 8826946
876 2906641671 2906635258 Bacteria 8601019
877 2906649823 2906643746 Bacteria 8722424
878 2906660773 2906660503 Bacteria 8595048
879 2908745079 2908739725 Bacteria 8628932
880 2908757148 2908756301 Bacteria 8864324
881 2908779020 2908775508 Bacteria 8092255
882 2922363627 2922361189 Bacteria 7436256
883 2922373127
884 2922392804 2922386360 Bacteria 7017218
885 2922395323 2922393267 Bacteria 8285685
886 2922427869
887 2929615816 2929615660 Bacteria 9193770
888 2929630429 2929624759 Bacteria 9339455
889 2932792072 2932784394 Bacteria 9704911
890 2932814061 2932809354 Bacteria 9135765
891 2932819451 2932818245 Bacteria 9955613
892 2932833840 2932828146 Bacteria 9745859
893 2933578898 2933577622 Bacteria 9116884
894 2935611458 2935608549 Bacteria 8203142
895 2935618630 2935616580 Bacteria 9032984
896 2935632200 2935630451 Bacteria 8169952
897 2935644527 2935638405 Bacteria 10015038
898 2935648844 2935648319 Bacteria 8801166
899 2935657074 2935656913 Bacteria 8965014
900 2935673582 2935665750 Bacteria 9571747
901 2935678469 2935675223 Bacteria 9928132
902 2935688097 2935684952 Bacteria 9590419
903 2935701361 2935694250 Bacteria 9291695
904 2935708384 2935703347 Bacteria 10242284
905 2935715116 2935713505 Bacteria 9608509
906 2935726319 2935722832 Bacteria 9608746
907 2935733935 2935732158 Bacteria 9706831
908 2935743314 2935741537 Bacteria 9707219
909 2935754648 2935750917 Bacteria 9590372
910 2935765422 2935760218 Bacteria 9817913
911 2935776300 2935769743 Bacteria 7878163
912 2935784176 2935777560 Bacteria 8077691
913 2935790289 2935785616 Bacteria 7962367
914 2935798872 2935793552 Bacteria 8012592
915 2935805373 2935801545 Bacteria 9301974
916 2935816671 2935810662 Bacteria 9401221
917 2935820935 2935819856 Bacteria 8261050
918 2935833724 2935827899 Bacteria 10038562
919 2935839590 2935837841 Bacteria 9454360
920 2935850805 2935847175 Bacteria 8228321
921 2935856995 2935855204 Bacteria 9035059
922 2935871177 2935864058 Bacteria 9784707
923 2935876320 2935873716 Bacteria 9632195
924 2935913827 2935908558 Bacteria 8568796
925 2935920183 2935916978 Bacteria 9113783
926 2935930522 2935926038 Bacteria 8601059
927 2935939505 2935934488 Bacteria 8602579
928 2935946454 2935942939 Bacteria 8599779
929 2935955707 2935951376 Bacteria 8602333
930 2935964600 2935959822 Bacteria 7869783
931 2935972583 2935967501 Bacteria 8603075
932 2935989026 2935984226 Bacteria 8302647
933 2935997716 2935992306 Bacteria 9802711
934 2936007229 2936002035 Bacteria 9362176
935 2936011754 2936011229 Bacteria 8801034
936 2936020349 2936019824 Bacteria 8804134
937 2936029043 2936028420 Bacteria 8965941
938 2936043067 2936037263 Bacteria 9446081
939 2936047072 2936046547 Bacteria 8903709
940 2936061303 2936055302 Bacteria 8785755
941 2940559975 2940556831 Bacteria 9590747
942 2941508148 2941507105 Bacteria 8166816
943 2941515347 2941515067 Bacteria 8166720
944 2941524078 2941523033 Bacteria 8169134
945 2941535992 2941531003 Bacteria 7653939
946 2941540279 2941538514 Bacteria 9402094
947 3005477576 3005474847 Bacteria 9259049
948 3005489864 3005483717 Bacteria 7877331
949 3005507808 3005506211 Bacteria 6943378
950 3005590388 3005587118 Bacteria 7794411
951 3005598160 3005594810 Bacteria 8716512
952 3005713835 3005710791 Bacteria 7622528
953 3005721346 3005718088 Bacteria 8283608
954 8006931591 8006926726 Bacteria 6749210
955 8006933648 8006933436 Bacteria 10410654
956 8006983320 8006973647 Bacteria 10679141
957 8006988924 8006984368 Bacteria 9651211
958 8016514593 8016511872 Bacteria 9921665
959 8016530693 8016522445 Bacteria 8156687
960 8016535979 8016530956 Bacteria 8155261
961 8016540259 8016539877 Bacteria 8155419
962 8016552973 8016548790 Bacteria 8155074
963 8016561349 8016557553 Bacteria 8154380
964 8016574324 8016566248 Bacteria 8158151
965 8016578424 8016575299 Bacteria 8154085
966 8016591373 8016583857 Bacteria 10421953
967 8016599206 8016595262 Bacteria 8149947
968 8016611840 8016603502 Bacteria 8731218
969 8016621967 8016613128 Bacteria 8794220
970 8016627888 8016622563 Bacteria 7999408
971 8016632197 8016630954 Bacteria 9217207
972 8017061837 8017057580 Bacteria 10023680
973 8019535705 8019530166 Bacteria 8155624
974 8019543773 8019538911 Bacteria 7872763
975 8019559583 8019555841 Bacteria 9642137
976 8019569684 8019565922 Bacteria 9639779
977 8019581366 8019576017 Bacteria 10049540
978 8019588992 8019586578 Bacteria 10212056
979 8019602241 8019597564 Bacteria 10041141
980 8019616321 8019608314 Bacteria 10042931
981 8019626972 8019619141 Bacteria 9218857
982 8019657111 8019648815 Bacteria 10014479
983 8019688840 8019687851 Bacteria 8712826
984 8055747463 8055742211 Bacteria 9226248
985 8056676901 8056673599 Bacteria 7871253
986 8056695191 8056689827 Bacteria 6712655
987 Ga0495603_0031784
988 JGI25153J46596_10001348
989 JGI25153J46596_10005113
990 rootH2_10194050
991 rootH1_10218802
992 JGI25404J52841_10002324
993 JGI25404J52841_10011848
994 Ga0055542_1007676
995 Ga0055531_10017327
996 JGI25405J52794_10022700
997 Ga0055543_1015382
998 Ga0070658_10035994
999 Ga0070658_10092501
1000 Ga0070658_10282547
1001 Ga0070676_10026600
1002 Ga0070683_100247212
1003 Ga0070690_100028466
1004 Ga0070670_100240832
1005 Ga0068869_100011695
1006 Ga0070666_10058884
1007 Ga0068868_100025028
1008 Ga0068868_100077386
1009 Ga0068868_100080433
1010 Ga0070689_100360228
1011 Ga0070661_100018105
1012 Ga0070668_100034971
1013 Ga0070668_100041085
1014 Ga0070668_100050372
1015 Ga0070668_100093700
1016 Ga0070668_100123454
1017 Ga0070668_100472798
1018 Ga0070668_100512617
1019 Ga0070669_100096764
1020 Ga0070669_100270370
1021 Ga0070675_100015290
1022 Ga0070675_100139137
1023 Ga0070675_100144007
1024 Ga0070675_100172639
1025 Ga0070675_100260914
1026 Ga0070671_100084323
1027 Ga0070671_100467827
1028 Ga0070671_100569626
1029 Ga0070674_100005849
1030 Ga0070674_100286185
1031 Ga0070674_100380114
1032 Ga0070673_100049195
1033 Ga0070673_100083303
1034 Ga0070673_100116694
1035 Ga0070673_100497786
1036 Ga0070688_100188968
1037 Ga0070688_100247229
1038 Ga0070659_100085056
1039 Ga0070667_100058981
1040 Ga0070667_100234682
1041 Ga0070667_100390250
1042 Ga0070709_10007981
1043 Ga0070709_10010010
1044 Ga0070713_100018061
1045 Ga0070713_100078575
1046 Ga0070711_100017786
1047 Ga0070711_100217823
1048 Ga0070700_100059967
1049 Ga0070700_100207291
1050 Ga0070700_100245844
1051 Ga0070708_100032898
1052 Ga0070663_100015862
1053 Ga0070663_100028129
1054 Ga0070663_100031284
1055 Ga0070663_100047543
1056 Ga0070663_100129979
1057 Ga0070663_100153088
1058 Ga0070663_100179236
1059 Ga0070663_100396955
1060 Ga0070678_100017583
1061 Ga0070678_100025842
1062 Ga0070678_100040466
1063 Ga0070678_100043604
1064 Ga0070662_100128561
1065 Ga0070662_100145515
1066 Ga0070681_10020209
1067 Ga0068867_100134850
1068 Ga0070685_10015586
1069 Ga0070706_100288427
1070 Ga0070707_100179894
1071 Ga0070699_100027008
1072 Ga0070679_100142014
1073 Ga0070684_100132544
1074 Ga0070697_100191014
1075 Ga0068853_100053977
1076 Ga0068853_100115324
1077 Ga0068853_100151042
1078 Ga0068853_100268674
1079 Ga0070672_100108422
1080 Ga0070672_100163889
1081 Ga0070695_100000851
1082 Ga0070665_100003924
1083 Ga0070665_100011644
1084 Ga0070665_100015331
1085 Ga0070665_100039788
1086 Ga0070665_100064243
1087 Ga0070665_100093475
1088 Ga0070665_100278819
1089 Ga0070704_100152049
1090 Ga0070704_100603643
1091 Ga0068855_100139627
1092 Ga0068855_100140841
1093 Ga0068855_100352618
1094 Ga0070664_100074858
1095 Ga0070664_100114539
1096 Ga0068857_100768090
1097 Ga0068854_100180415
1098 Ga0070702_100009600
1099 Ga0068859_100116234
1100 Ga0068859_100334823
1101 Ga0068864_100083414
1102 Ga0068866_10049442
1103 Ga0068861_100094526
1104 Ga0068861_100109378
1105 Ga0068861_100209411
1106 Ga0068861_100235133
1107 Ga0068863_100120646
1108 Ga0068863_100153799
1109 Ga0068863_100186494
1110 Ga0068863_100426709
1111 Ga0068858_100034300
1112 Ga0068858_100049819
1113 Ga0068858_100088988
1114 Ga0068858_100191614
1115 Ga0068858_100335497
1116 Ga0068860_100009962
1117 Ga0068860_100017045
1118 Ga0068862_100018832
1119 Ga0068862_100049355
1120 Ga0068862_100155323
1121 Ga0068862_100440358
1122 Ga0068862_100468346
1123 Ga0081455_10001207
1124 Ga0081455_10002021
1125 Ga0081455_10005151
1126 Ga0081455_10012489
1127 Ga0081455_10026629
1128 Ga0081455_10045635
1129 Ga0081455_10140027
1130 Ga0081538_10010297
1131 Ga0081540_1000075
1132 Ga0081540_1000199
1133 Ga0081540_1000373
1134 Ga0081540_1000904
1135 Ga0081540_1002468
1136 Ga0081540_1007774
1137 Ga0081540_1010461
1138 Ga0081540_1012806
1139 Ga0081540_1019596
1140 Ga0081540_1021716
1141 Ga0081540_1024507
1142 Ga0081539_10015306
1143 Ga0075365_10009759
1144 Ga0075365_10019345
1145 Ga0075365_10037162
1146 Ga0075365_10079261
1147 Ga0075365_10123565
1148 Ga0075368_10057946
1149 Ga0075368_10065280
1150 Ga0075368_10098526
1151 Ga0075368_10141845
1152 Ga0075364_10081732
1153 Ga0070716_100134796
1154 Ga0070712_100082567
1155 Ga0070712_100158897
1156 Ga0075362_10059855
1157 Ga0075367_10070460
1158 Ga0075427_10001634
1159 Ga0075366_10055853
1160 Ga0075366_10078980
1161 Ga0075370_10008406
1162 Ga0075370_10024237
1163 Ga0075370_10051867
1164 Ga0075370_10076862
1165 Ga0075370_10252653
1166 Ga0075428_100060636
1167 Ga0075428_100082182
1168 Ga0075428_100108421
1169 Ga0075428_100154086
1170 Ga0075430_100002329
1171 Ga0075430_100089238
1172 Ga0075430_100119211
1173 Ga0075430_100155852
1174 Ga0075430_100330088
1175 Ga0075431_100082967
1176 Ga0075431_100097653
1177 Ga0075431_100498710
1178 Ga0075433_10002467
1179 Ga0075433_10024444
1180 Ga0075433_10032543
1181 Ga0075434_100031382
1182 Ga0075434_100137186
1183 Ga0075434_100219154
1184 Ga0075429_100040222
1185 Ga0075429_100074856
1186 Ga0068865_100059781
1187 Ga0068865_100122289
1188 Ga0097620_100116231
1189 Ga0097620_100334836
1190 Ga0099825_1024499
1191 Ga0099825_1039920
1192 Ga0099824_1016075
1193 Ga0099824_1022540
1194 Ga0099822_1005361
1195 Ga0099822_1033954
1196 Ga0099823_1038759
1197 Ga0075435_100026199
1198 Ga0075435_100029267
1199 Ga0075435_100121623
1200 Ga0075435_100137889
1201 Ga0075435_100221112
1202 Ga0075435_100247987
1203 Ga0099794_10001910
1204 Ga0099795_10007092
1205 Ga0105240_10133696
1206 Ga0105240_10481126
1207 Ga0111539_10004711
1208 Ga0111539_10113788
1209 Ga0111539_10188582
1210 Ga0105245_10028707
1211 Ga0105245_10071874
1212 Ga0105245_10551295
1213 Ga0105245_10854204
1214 Ga0105247_10137399
1215 Ga0114129_10065176
1216 Ga0114129_10097158
1217 Ga0114129_10103217
1218 Ga0114129_10122946
1219 Ga0114129_10174002
1220 Ga0114129_10174153
1221 Ga0114129_10219830
1222 Ga0114129_11014398
1223 Ga0105243_10023886
1224 Ga0105243_10170425
1225 Ga0105241_10009784
1226 Ga0105241_10022328
1227 Ga0105241_10075397
1228 Ga0105242_10275223
1229 Ga0105248_10025654
1230 Ga0105248_10239373
1231 Ga0105248_10504104
1232 Ga0105248_10600592
1233 Ga0105248_10721903
1234 Ga0105237_10001286
1235 Ga0105237_10019561
1236 Ga0105237_10070713
1237 Ga0105237_10121414
1238 Ga0105237_10250574
1239 Ga0105237_10308261
1240 Ga0105238_10035583
1241 Ga0105238_10092006
1242 Ga0105249_10282304
1243 Ga0105249_10517955
1244 Ga0105239_10031496
1245 Ga0105239_10045785
1246 Ga0105239_10126790
1247 Ga0105239_10202408
1248 Ga0105239_10237552
1249 Ga0105239_10613861
1250 Ga0105239_11156499
1251 Ga0105246_10012957
1252 Ga0105246_10022531
1253 Ga0105246_10061885
1254 Ga0105246_10085648
1255 Ga0157374_10302787
1256 Ga0157374_10440798
1257 Ga0157374_10441597
1258 Ga0157378_10018279
1259 Ga0157378_10140137
1260 Ga0163162_10043512
1261 Ga0163162_10233446
1262 Ga0157372_10116018
1263 Ga0157375_10038184
1264 Ga0157375_10047706
1265 Ga0157375_10056271
1266 Ga0157375_10312170
1267 Ga0157375_10364778
1268 Ga0163163_10041823
1269 Ga0163163_10078765
1270 Ga0163163_10450467
1271 Ga0163163_10541768
1272 Ga0157380_10051724
1273 Ga0157380_10079993
1274 Ga0157380_10301187
1275 Ga0182008_10020362
1276 Ga0157379_10017256
1277 Ga0157379_10187769
1278 Ga0157379_10198000
1279 Ga0157379_10200872
1280 Ga0157376_10411975
1281 Ga0163161_10022999
1282 Ga0163161_10076433
1283 Ga0163161_10240794
1284 Ga0214544_1000006
1285 Ga0214542_1000002
1286 Ga0214545_1000002
1287 Ga0214543_1000017
1288 Ga0213872_10030867
1289 Ga0209563_100471
1290 Ga0209677_100757
1291 Ga0209677_108436
1292 Ga0209233_1010533
1293 Ga0209455_1005175
1294 Ga0209675_1004035
1295 Ga0209758_1000216
1296 Ga0209758_1005195
1297 Ga0209256_1003991
1298 Ga0207426_1002409
1299 Ga0207426_1006600
1300 Ga0207426_1034113
1301 Ga0209257_1001462
1302 Ga0207697_10053457
1303 Ga0207653_10014263
1304 Ga0207692_10001933
1305 Ga0207642_10156537
1306 Ga0207710_10020192
1307 Ga0207710_10123374
1308 Ga0207688_10000077
1309 Ga0207688_10027476
1310 Ga0207680_10018688
1311 Ga0207680_10287248
1312 Ga0207647_10081907
1313 Ga0207645_10059755
1314 Ga0207643_10036633
1315 Ga0207705_10025430
1316 Ga0207684_10387193
1317 Ga0207654_10065552
1318 Ga0207707_10057329
1319 Ga0207695_10000342
1320 Ga0207671_10003865
1321 Ga0207671_10048284
1322 Ga0207671_10276970
1323 Ga0207671_10380243
1324 Ga0207693_10007359
1325 Ga0207663_10010822
1326 Ga0207663_10012418
1327 Ga0207660_10469289
1328 Ga0207662_10122803
1329 Ga0207657_10199814
1330 Ga0207649_10010842
1331 Ga0207652_10170220
1332 Ga0207646_10431598
1333 Ga0207681_10141929
1334 Ga0207681_10294011
1335 Ga0207681_10533665
1336 Ga0207694_10136289
1337 Ga0207694_10172060
1338 Ga0207650_10125013
1339 Ga0207659_10168954
1340 Ga0207687_10081618
1341 Ga0207664_10012334
1342 Ga0207644_10302496
1343 Ga0207690_10062447
1344 Ga0207706_10001566
1345 Ga0207706_10024495
1346 Ga0207706_10045202
1347 Ga0207706_10121570
1348 Ga0207686_10121522
1349 Ga0207709_10015580
1350 Ga0207670_10113344
1351 Ga0207670_10386086
1352 Ga0207670_10390743
1353 Ga0207669_10082312
1354 Ga0207665_10014843
1355 Ga0207665_10055607
1356 Ga0207691_10116641
1357 Ga0207691_10133599
1358 Ga0207711_10014612
1359 Ga0207711_10072116
1360 Ga0207711_10307545
1361 Ga0207711_10457356
1362 Ga0207689_10002811
1363 Ga0207689_10056696
1364 Ga0207689_10078711
1365 Ga0207661_10432011
1366 Ga0207651_10027057
1367 Ga0207651_10182020
1368 Ga0207651_10504668
1369 Ga0207712_10114698
1370 Ga0207712_10157922
1371 Ga0207712_10347826
1372 Ga0207712_10367331
1373 Ga0207668_10014121
1374 Ga0207668_10100003
1375 Ga0207668_10175145
1376 Ga0207668_10189653
1377 Ga0207668_10190269
1378 Ga0207668_10203020
1379 Ga0207668_10391802
1380 Ga0207668_10414000
1381 Ga0207640_10028836
1382 Ga0207640_10087828
1383 Ga0207658_10029667
1384 Ga0207677_10089401
1385 Ga0207677_10110273
1386 Ga0207703_10041818
1387 Ga0207703_10132767
1388 Ga0207703_10168877
1389 Ga0207678_10016327
1390 Ga0207678_10019801
1391 Ga0207678_10023742
1392 Ga0207678_10044292
1393 Ga0207678_10054649
1394 Ga0207678_10054664
1395 Ga0207678_10070409
1396 Ga0207708_10062016
1397 Ga0207708_10068790
1398 Ga0207641_10094128
1399 Ga0207641_10273835
1400 Ga0207641_10298532
1401 Ga0207648_10001800
1402 Ga0207648_10198539
1403 Ga0207648_10540914
1404 Ga0207676_10072722
1405 Ga0207676_10143852
1406 Ga0207674_10071136
1407 Ga0207675_100008275
1408 Ga0207675_100024973
1409 Ga0207675_100081999
1410 Ga0207675_100244883
1411 Ga0207683_10018799
1412 Ga0207683_10021283
1413 Ga0207683_10033761
1414 Ga0207683_10036754
1415 Ga0207698_10815684
1416 Ga0209389_1000196
1417 Ga0209389_1000284
1418 Ga0209589_1000006
1419 Ga0209589_1001029
1420 Ga0209489_100007
1421 Ga0209489_101824
1422 Ga0209489_117016
1423 Ga0209700_100008
1424 Ga0209700_103273
1425 Ga0209588_1030098
1426 Ga0209588_1035751
1427 Ga0209813_10019693
1428 Ga0209813_10034302
1429 Ga0209813_10042184
1430 Ga0207428_10003095
1431 Ga0268266_10000544
1432 Ga0268266_10001633
1433 Ga0268266_10027900
1434 Ga0268266_10079594
1435 Ga0268266_10213358
1436 Ga0268266_10269456
1437 Ga0268265_10048073
1438 Ga0268265_10051918
1439 Ga0268265_10383668
1440 Ga0268264_10037322
1441 Ga0265337_1007475
1442 Ga0265319_1002882
1443 Ga0265334_10009925
1444 Ga0265318_10013021
1445 Ga0265336_10001981
1446 Ga0307517_10228684
1447 Ga0307515_10059588
1448 Ga0265338_10000013
1449 Ga0265324_10003322
1450 Ga0307509_10274011
1451 Ga0307408_100485484
1452 Ga0307516_10006378
1453 Ga0307516_10144193
1454 Ga0307516_10204159
1455 Ga0307413_10038382
1456 Ga0307409_100187443
1457 Ga0307415_100034576
1458 Ga0307510_10004428
1459 Ga0307510_10017480
1460 Ga0315911_1000010
1461 Ga0373926_0065719
1462 Ga0373928_0021744
1463 Ga0373929_0023510
1464 Ga0373952_0019731
1465 Ga0373923_0126224
1466 Ga0373932_0017972
1467 Ga0373932_0047206
1468 Ga0373932_0062846
1469 Ga0373936_0053244
1470 Ga0373939_0005708
1471 Ga0373939_0138478
1472 Ga0373941_0053037
1473 Ga0373945_0061371
1474 Ga0373960_0030197
1475 Ga0373960_0078200
1476 Ga0373943_0012834
1477 Ga0373943_0071923
1478 Ga0373943_0114119
1479 Ga0373946_0006617
1480 Ga0373955_0152426
1481 Ga0373942_0010929
1482 Ga0373961_0012173
1483 Ga0373962_0012362
1484 Ga0373962_0028315
1485 Ga0373931_0000589
1486 Ga0373931_0013520
1487 Ga0373935_0052593
1488 Ga0373935_0056830
1489 Ga0373935_0080948
1490 Ga0373927_0007128
1491 Ga0373927_0041681
1492 Ga0373927_0048146
1493 Ga0373927_0071342
1494 Ga0373927_0156791
1495 Ga0373933_0038204
1496 Ga0373947_0001699
1497 Ga0373947_0007402
1498 Ga0373947_0055264
1499 Ga0373947_0069905
1500 Ga0373937_0009747
1501 Ga0373937_0376498
1502 Ga0373925_0022773
1503 Ga0373925_0067599
1504 Ga0373925_0089875
1505 Ga0373925_0116895
1506 Ga0395905_0124921
1507 Ga0395905_0160393
1508 Ga0395901_0404554
1509 Ga0436365_1610361
1510 Ga0436360_0737618
1511 Ga0436361_0102531
1512 Ga0436361_0496474
1513 Ga0436361_0857818
1514 Ga0436363_0112888
1515 Ga0436362_1154959
1516 Ga0439465_0017091
1517 Ga0439465_0078545
1518 Ga0451807_2471553
1519 Ga0450897_009266
1520 Ga0439446_0037075
1521 Ga0466972_0068802
1522 Ga0466972_0114728
1523 Ga0466961_0271468
1524 Ga0466959_0246904
1525 Ga0466967_0013831
1526 Ga0495617_004300
1527 Ga0495617_056880
1528 Ga0495592_0027994
1529 Ga0495603_0002549
1530 Ga0495603_0007037
1531 Ga0495603_0045565
1532 Ga0495603_0166349
1533 Ga0495629_0004300
1534 Ga0495629_0005021
1535 Ga0495638_0035509
1536 Ga0495638_0037407
1537 Ga0495580_0041029
1538 Ga0495582_0114352
1539 Ga0495605_0072932
1540 Ga0495639_0004473
1541 Ga0495639_0095316
1542 Ga0495639_0176879
1543 Ga0495662_0012054
1544 Ga0495664_0009734
1545 Ga0495664_0132492
1546 Ga0495585_0079024
1547 Ga0495585_0155111
1548 Ga0495585_0175457
1549 Ga0495594_0010444
1550 Ga0495594_0023889
1551 Ga0495596_0118653
1552 Ga0495607_0149066
1553 Ga0495606_0038752
1554 Ga0495616_0144378
1555 Ga0495618_0025545
1556 Ga0495628_0091771
1557 Ga0495628_0137156
1558 Ga0495631_0131545
1559 Ga0495643_0081618
1560 Ga0495644_0024670
1561 Ga0495644_0157517
1562 Ga0495663_0068741
1563 Ga0495666_0043604
1564 Ga0495642_0062807
1565 Ga0495665_0026950
1566 Ga0495640_0023620
1567 Ga0495640_0040831
1568 Ga0495598_0013894
1569 Ga0495609_0152860
1570 Ga0495621_0050282
1571 Ga0495597_0025896
1572 Ga0495667_0035623
1573 Ga0495656_0002595
1574 Ga0495656_0189933
1575 Ga0495668_0069745
1576 Ga0495634_0012735
1577 Ga0495611_0150360
1578 Ga0495625_0009575
1579 Ga0495625_0048587
1580 Ga0495625_0121291
1581 Ga0495625_0317169
1582 Ga0495635_0005943
1583 Ga0495635_0085160
1584 Ga0495659_0008078
1585 Ga0495661_0218414
1586 Ga0495588_0025133
1587 Ga0495588_0103725
1588 Ga0495588_0154253
1589 Ga0495657_0041743
1590 Ga0495646_0139351
1591 Ga0495647_0003332
1592 Ga0495647_0047611
1593 Ga0495658_0017021
1594 Ga0495658_0091052
1595 Ga0495658_0135977
1596 Ga0495669_0001655
1597 Ga0495613_0060267
1598 Ga0495613_0098560
1599 Ga0495624_0003239
1600 Ga0495624_0148702
1601 Ga0495649_0004412
1602 Ga0495589_0061947
1603 Ga0495600_0029114
1604 Ga0495581_0002498
1605 Ga0495581_0097956
1606 Ga0495604_0102779
1607 Ga0495636_0056022
1608 Ga0495674_0031540
1609 Ga0495672_0058508
1610 Ga0495676_0015378
1611 Ga0495683_0109795
1612 Ga0495683_0134017
1613 Ga0495673_0042343
1614 Ga0495686_0047811
1615 Ga0495686_0126967
1616 Ga0495593_0000942
1617 Ga0495614_0110194
1618 Ga0495614_0144894
1619 Ga0495615_0031144
1620 Ga0495615_0067856
1621 Ga0496100_0332759
1622 Ga0496100_0440611
1623 Ga0496101_0074176
1624 Ga0496101_0090953
1625 Ga0496101_0103682
1626 Ga0496101_0111802
1627 Ga0496101_0228021
1628 Ga0496102_0012884
1629 Ga0496102_0050685
1630 Ga0496102_0102199
1631 Ga0496102_0250623
1632 Ga0496102_0362380
1633 Ga0496103_0074034
1634 Ga0496104_0000916
1635 Ga0496104_0058187
1636 Ga0496104_0065281
1637 Ga0496104_0091319
1638 Ga0496104_0121880
1639 Ga0496104_0302932
1640 Ga0496104_0339954
1641 Ga0496105_0018517
1642 Ga0496105_0169445
1643 Ga0496105_0197699
1644 Ga0496105_0225750
1645 Ga0496105_0301692
1646 Ga0496105_0379562
1647 Ga0496106_0188090
1648 Ga0496106_0494849
1649 Ga0496107_0063803
1650 Ga0496107_0212560
1651 Ga0496108_0203309
1652 Ga0496108_0303673
1653 Ga0496109_0300568
1654 Ga0496109_0306471
1655 Ga0496110_0009234
1656 Ga0496110_0046873
1657 Ga0496110_0233232
1658 Ga0496110_0242547
1659 Ga0496111_0028232
1660 Ga0496111_0071062
1661 Ga0496112_0071722
1662 Ga0496112_0073248
1663 Ga0496112_0144283
1664 Ga0496112_0193576
1665 Ga0496112_0260818
1666 Ga0496113_0029907
1667 Ga0496113_0121262
1668 Ga0496113_0216416
1669 Ga0496113_0249510
1670 Ga0496113_0313176
1671 Ga0496114_0073481
1672 Ga0496114_0172047
1673 Ga0496114_0205672
1674 Ga0496114_0463564
1675 Ga0496114_0526132
1676 Ga0496115_0054272
1677 Ga0496115_0089891
1678 Ga0496115_0095660
1679 Ga0496115_0110292
1680 Ga0496115_0120612
1681 Ga0496115_0152102
1682 Ga0496115_0183849
1683 Ga0496116_0076727
1684 Ga0496118_0020691
1685 Ga0496118_0119089
1686 Ga0496118_0121408
1687 Ga0496119_0024691
1688 Ga0496119_0192969
1689 Ga0496120_0030655
1690 Ga0496121_0015817
1691 Ga0496121_0018938
1692 Ga0496121_0042465
1693 Ga0496121_0044500
1694 Ga0496121_0059718
1695 Ga0496121_0060439
1696 Ga0496121_0061883
1697 Ga0496121_0228380
1698 Ga0496121_0231457
1699 Ga0496121_0339662
1700 Ga0496121_0402545
1701 Ga0496124_0008072
1702 Ga0496124_0078139
1703 Ga0496124_0113175
1704 Ga0496125_0064169
1705 Ga0496125_0101569
1706 Ga0496125_0128971
1707 Ga0496126_0002447
1708 Ga0496126_0021927
1709 Ga0496126_0043210
1710 Ga0496126_0129359
1711 Ga0496126_0141674
1712 Ga0496126_0141788
1713 Ga0496126_0158676
1714 Ga0496126_0162654
1715 Ga0496126_0258317
1716 Ga0496126_0582869
1717 Ga0501039_0454496
1718 Ga0501071_0008888
1719 Ga0501081_0128703
1720 Ga0501083_0357688
1721 Ga0501045_0068998
1722 nmdc:mga03683_15843_c1
1723 nmdc:mga03n38_88327_c1
1724 nmdc:mga00v17_134587_c1
1725 nmdc:mga0yw44_26825_c1
1726 nmdc:mga0yw44_63600_c1
1727 nmdc:mga0yw44_86331_c1
1728 nmdc:mga06z11_27833_c1
1729 nmdc:mga06z11_48054_c1
1730 nmdc:mga04h51_92630_c1
1731 nmdc:mga07m45_17287_c1
1732 nmdc:mga07m45_23241_c1
1733 nmdc:mga07m45_3901_c1
1734 nmdc:mga05p37_190242_c1
1735 nmdc:mga05p37_38746_c1
1736 nmdc:mga05p37_5331_c1
1737 nmdc:mga09592_30838_c1
1738 nmdc:mga0qj67_147369_c1
1739 nmdc:mga0qj67_30180_c1
1740 nmdc:mga0qj67_48398_c1
1741 nmdc:mga06r32_198858_c1
1742 nmdc:mga06r32_320092_c1
1743 nmdc:mga06r32_487812_c1
1744 nmdc:mga08y16_308916_c1
1745 nmdc:mga08y16_34711_c1
1746 nmdc:mga0n895_160319_c1
1747 nmdc:mga0n895_167823_c1
1748 nmdc:mga0n895_219851_c1
1749 nmdc:mga0rr50_211700_c1
1750 nmdc:mga0rr50_625140_c1
1751 nmdc:mga0a205_10385_c1
1752 nmdc:mga0a205_270135_c1
1753 nmdc:mga0a205_517752_c1
1754 nmdc:mga0a205_6427_c1
1755 nmdc:mga0sz30_43035_c1
1756 Ga0495601_0035361
1757 Ga0495601_0093556
1758 Ga0495619_0005502
1759 Ga0500578_0081033
1760 Ga0500643_000114
1761 Ga0500643_076630
1762 Ga0500566_0001448
1763 Ga0500641_0118170
1764 Ga0500648_176918
1765 Ga0500556_0023415
1766 Ga0500557_000001
1767 Ga0500595_002799
1768 Ga0500595_010510
1769 Ga0500608_168768
1770 Ga0500642_0000240
1771 Ga0500590_013608
1772 Ga0500590_126025
1773 Ga0500636_0129277
1774 Ga0500636_0145011
1775 Ga0500625_006844
1776 Ga0500645_008456
1777 Ga0500656_004287
1778 Ga0500601_000202
1779 Ga0501084_0163282
1780 Ga0500661_008088
1781 Ga0530510_0016583
1782 Ga0530510_0219456
1783 2507509683
1784 2508543699
1785 2508698518
1786 2513628282
1787 2513641940
1788 2513655054
1789 2513673450
1790 2513693551
1791 2513703841
1792 2513722919
1793 2513861074
1794 2513875763
1795 2513894485
1796 2513915923
1797 2514016199
1798 2515629130
1799 2517103621
1800 2517894773
1801 2524442212
1802 2524534522
1803 2528855501
1804 2617349184
1805 2617378266
1806 2671119185
1807 2723848443
1808 2728747571
1809 2745079503
1810 2793060345
1811 2793071244
1812 2793080991
1813 2805917725
1814 2818241406
1815 2824602201
1816 2824610189
1817 2824623797
1818 2824627789
1819 2824639325
1820 2824646896
1821 2824656172
1822 2824666976
1823 2824672766
1824 2824686123
1825 2824693416
1826 2824698382
1827 2824720758
1828 2824730894
1829 2824735987
1830 2824746841
1831 2824773937
1832 2838130623
1833 2841941143
1834 2841957303
1835 2841967297
1836 2841979307
1837 2841989782
1838 2842038718
1839 2842048337
1840 2847934917
1841 2847945492
1842 2849080321
1843 2857510317
1844 2874609216
1845 2874613163
1846 2874636554
1847 2879086308
1848 2879109428
1849 2879119197
1850 2881366310
1851 2881672943
1852 2885378787
1853 2885416660
1854 2888394882
1855 2888423381
1856 2889036991
1857 2903749629
1858 2904697755
1859 2904705907
1860 2906611486
1861 2906628181
1862 2906641671
1863 2906649823
1864 2906660773
1865 2908745079
1866 2908757148
1867 2908779020
1868 2922363627
1869 2922373127
1870 2922392804
1871 2922395323
1872 2922427869
1873 2929615816
1874 2929630429
1875 2932792072
1876 2932814061
1877 2932819451
1878 2932833840
1879 2933578898
1880 2935611458
1881 2935618630
1882 2935632200
1883 2935644527
1884 2935648844
1885 2935657074
1886 2935673582
1887 2935678469
1888 2935688097
1889 2935701361
1890 2935708384
1891 2935715116
1892 2935726319
1893 2935733935
1894 2935743314
1895 2935754648
1896 2935765422
1897 2935776300
1898 2935784176
1899 2935790289
1900 2935798872
1901 2935805373
1902 2935816671
1903 2935820935
1904 2935833724
1905 2935839590
1906 2935850805
1907 2935856995
1908 2935871177
1909 2935876320
1910 2935913827
1911 2935920183
1912 2935930522
1913 2935939505
1914 2935946454
1915 2935955707
1916 2935964600
1917 2935972583
1918 2935989026
1919 2935997716
1920 2936007229
1921 2936011754
1922 2936020349
1923 2936029043
1924 2936043067
1925 2936047072
1926 2936061303
1927 2940559975
1928 2941508148
1929 2941515347
1930 2941524078
1931 2941535992
1932 2941540279
1933 3005477576
1934 3005489864
1935 3005507808
1936 3005590388
1937 3005598160
1938 3005713835
1939 3005721346
1940 8006931591
1941 8006933648
1942 8006983320
1943 8006988924
1944 8016514593
1945 8016530693
1946 8016535979
1947 8016540259
1948 8016552973
1949 8016561349
1950 8016574324
1951 8016578424
1952 8016591373
1953 8016599206
1954 8016611840
1955 8016621967
1956 8016627888
1957 8016632197
1958 8017061837
1959 8019535705
1960 8019543773
1961 8019559583
1962 8019569684
1963 8019581366
1964 8019588992
1965 8019602241
1966 8019616321
1967 8019626972
1968 8019657111
1969 8019688840
1970 8055747463
1971 8056676901
1972 8056695191

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18014

Acetyltransf_18

Acetyltransferase (GNAT) domain

205

327

0.98

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

63

170

0.77

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

93

172

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ddd-assembly1.cif.gz_A crystal structure of a putative acetyltransferase (np_142035.1) from pyrococcus horikoshii at 2.25 a resolution 0.8475 4 280
7daj-assembly1.cif.gz_B the crystal structure of serotonin n-acetyltransferase in complex with acetyl-coa from oryza sativa 0.8365 44 118
5xxs-assembly1.cif.gz_A crystal structure of native ribt from bacillus subtilis 0.8135 44 100
3ddd-assembly1.cif.gz_A crystal structure of a putative acetyltransferase (np_142035.1) from pyrococcus horikoshii at 2.25 a resolution 0.8134 4 280
4pv6-assembly8.cif.gz_N crystal structure analysis of ard1 from thermoplasma volcanium 0.8113 4 122
ID Description Score Start End Superfamily
af_Q9NAR2_219_339_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8906 174 225 3.40.630.30
af_I1KMR4_18_159_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8779 44 93 3.40.630.30
af_I1MRQ6_38_162_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8779 44 93 3.40.630.30
1y9wB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8708 44 122 3.40.630.30
af_Q9N5J3_186_300_3.40.630.90 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase; 0.8704 138 223 3.40.630.90
ID Description Score Start End GO Terms
AF-A0A090D1U8-F1-model_v4 Acetyltransferase, GNAT family 0.9732 1 280 GO:0016747
AF-A0A2N1VL18-F1-model_v4 GNAT family N-acetyltransferase 0.9728 3 280 GO:0016747
AF-B3SBF2-F1-model_v4 N-acetyltransferase domain-containing protein 0.9722 2 275 GO:0016747
AF-A0A7C7WKX4-F1-model_v4 GNAT family N-acetyltransferase 0.9721 9 280 GO:0016747
AF-A0A5B7V481-F1-model_v4 Acetyltransferase (GNAT) family protein 0.972 2 280 GO:0016747

Map