F487534

General Info

Members Datasets Scaffolds Average Seq Length
986 776 1972 330

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0006661|Ga0501032_0006661_3333_4415
Length 360
Sequence MFPLKLRAPHLRHASPEFGPDGVRSLNAPESKLAERKLGEFGHAGDDHVVPFEVGALDIRGRSVQLGPILDQILGRHDYPEPVARLLAEAVVLTALLGTALKFDGKFILQTRSDGPVDMLVADFSTPQSMRAYARYDQKAVDEAAKAGDASPEALLGSGVLALTIDQGEHMQRYQGVVPLERTSLEEAARVYFRQSEQIPTDVRLAVAKMMVRGNGGAEERWRAGGLMTQFLPDSAERRRLPDLPGGDGDENGADDGMTDDAWKETLALMSTVEAVELVDPEVGAERLLFRLFHEHGVRVYDGTEVVDDCSCSREKIKAILDGFTAEEIDSSIEGGVIRVNCEFCSTSYEFDPAEFKPKN

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
19 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
58 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
76 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
77 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
78 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
79 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
80 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
82 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
83 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
84 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
85 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
87 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
125 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
126 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
127 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
128 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
131 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
132 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
133 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
136 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
137 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
138 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
143 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
144 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
146 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
155 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
156 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
157 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
158 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
159 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
160 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
161 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
162 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
163 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
168 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
169 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
170 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
171 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
172 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
173 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
174 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
175 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
176 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
179 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
184 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
187 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
202 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
203 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
204 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
205 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
208 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
209 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
210 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
211 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
226 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
227 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
234 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
235 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
238 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
241 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
242 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
243 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
246 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
247 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
248 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
249 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
250 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
251 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
252 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
253 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
254 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
255 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
256 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
257 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
258 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
259 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
260 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
261 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
262 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
263 2509276019 Ensifer aridi TW10 Isolate Nodule
264 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
265 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
266 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
267 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
268 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
269 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
270 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
271 2512875024
272 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
273 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
274 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
275 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
276 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
277 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
278 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
279 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
280 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
281 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
282 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
283 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
284 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
285 2516143018 Ensifer sp. BR816 Isolate Nodule
286 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
287 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
288 2519899620 Rhizobium sp. Pop5 Isolate Nodule
289 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
290 2534681786 Brucella suis 92/29 Isolate Unclassified
291 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
292 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
293 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
294 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
295 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
296 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
297 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
298 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
299 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
300 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
301 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
302 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
303 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
304 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
305 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
306 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
307 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
308 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
309 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
310 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
311 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
312 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
313 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
314 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
315 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
316 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
317 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
318 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
319 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
320 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
321 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
322 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
323 2643221557 Ensifer sp. Root558 Isolate Unclassified
324 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
325 2643221599 Rhizobium sp. Root708 Isolate Unclassified
326 2643221607 Rhizobium sp. Root73 Isolate Unclassified
327 2643221610 Ensifer sp. Root74 Isolate Unclassified
328 2643221618 Ensifer sp. Root231 Isolate Unclassified
329 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
330 2643221626 Ensifer sp. Root31 Isolate Unclassified
331 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
332 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
333 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
334 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
335 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
336 2643221655 Ensifer sp. Root1252 Isolate Unclassified
337 2643221659 Ensifer sp. Root127 Isolate Unclassified
338 2643221668 Ensifer sp. Root423 Isolate Unclassified
339 2643221675 Ensifer sp. Root1298 Isolate Unclassified
340 2643221680 Ensifer sp. Root1312 Isolate Unclassified
341 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
342 2643221688 Rhizobium sp. Root482 Isolate Unclassified
343 2643221698 Ensifer sp. Root142 Isolate Unclassified
344 2643221712 Ensifer sp. Root258 Isolate Unclassified
345 2643221718 Rhizobium sp. Root268 Isolate Unclassified
346 2643221719 Rhizobium sp. Root274 Isolate Unclassified
347 2643221723 Ensifer sp. Root278 Isolate Unclassified
348 2643221726 Ensifer sp. Root954 Isolate Unclassified
349 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
350 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
351 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
352 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
353 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
354 2718217927 Rhizobium sp. N324 Isolate Nodule
355 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
356 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
357 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
358 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
359 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
360 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
361 2718218423 Rhizobium sp. N941 Isolate Nodule
362 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
363 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
364 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
365 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
366 2721755809 Rhizobium sp. N541 Isolate Nodule
367 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
368 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
369 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
370 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
371 2738541293 Rhizobium sp. GV031 Isolate Unclassified
372 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
373 2738543024 Aminobacter sp. AP02 Isolate Unclassified
374 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
375 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
376 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
377 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
378 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
379 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
380 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
381 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
382 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
383 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
384 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
385 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
386 2791355256 Rhizobium sp. M10 Isolate Nodule
387 2791355260 Rhizobium sp. L9 Isolate Nodule
388 2791355261 Rhizobium sp. J15 Isolate Nodule
389 2791355262 Rhizobium sp. M1 Isolate Nodule
390 2791355263 Rhizobium chutanense C5 Isolate Nodule
391 2791355265 Rhizobium sp. H4 Isolate Nodule
392 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
393 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
394 2802429633 Rhizobium anhuiense J3 Isolate Nodule
395 2802429634 Rhizobium anhuiense S10 Isolate Nodule
396 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
397 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
398 2802429637 Rhizobium anhuiense C15 Isolate Nodule
399 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
400 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
401 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
402 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
403 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
404 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
405 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
406 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
407 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
408 2838048938 Rhizobium pisi 27/80 Isolate Nodule
409 2838061910 Rhizobium phaseoli L15 Isolate Nodule
410 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
411 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
412 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
413 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
414 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
415 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
416 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
417 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
418 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
419 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
420 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
421 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
422 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
423 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
424 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
425 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
426 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
427 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
428 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
429 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
430 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
431 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
432 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
433 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
434 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
435 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
436 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
437 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
438 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
439 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
440 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
441 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
442 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
443 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
444 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
445 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
446 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
447 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
448 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
449 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
450 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
451 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
452 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
453 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
454 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
455 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
456 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
457 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
458 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
459 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
460 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
461 2844163670 Ensifer sp. 1H6 Isolate Unclassified
462 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
463 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
464 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
465 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
466 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
467 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
468 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
469 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
470 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
471 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
472 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
473 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
474 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
475 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
476 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
477 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
478 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
479 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
480 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
481 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
482 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
483 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
484 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
485 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
486 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
487 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
488 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
489 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
490 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
491 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
492 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
493 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
494 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
495 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
496 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
497 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
498 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
499 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
500 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
501 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
502 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
503 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
504 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
505 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
506 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
507 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
508 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
509 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
510 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
511 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
512 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
513 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
514 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
515 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
516 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
517 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
518 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
519 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
520 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
521 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
522 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
523 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
524 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
525 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
526 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
527 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
528 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
529 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
530 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
531 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
532 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
533 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
534 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
535 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
536 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
537 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
538 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
539 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
540 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
541 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
542 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
543 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
544 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
545 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
546 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
547 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
548 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
549 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
550 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
551 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
552 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
553 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
554 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
555 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
556 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
557 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
558 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
559 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
560 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
561 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
562 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
563 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
564 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
565 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
566 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
567 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
568 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
569 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
570 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
571 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
572 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
573 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
574 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
575 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
576 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
577 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
578 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
579 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
580 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
581 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
582 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
583 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
584 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
585 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
586 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
587 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
588 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
589 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
590 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
591 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
592 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
593 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
594 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
595 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
596 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
597 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
598 2933599457 Rhizobium phaseoli M3 Isolate Nodule
599 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
600 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
601 2936381700 Rhizobium chutanense C16 Isolate Unclassified
602 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
603 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
604 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
605 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
606 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
607 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
608 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
609 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
610 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
611 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
612 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
613 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
614 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
615 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
616 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
617 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
618 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
619 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
620 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
621 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
622 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
623 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
624 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
625 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
626 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
627 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
628 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
629 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
630 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
631 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
632 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
633 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
634 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
635 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
636 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
637 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
638 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
639 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
640 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
641 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
642 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
643 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
644 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
645 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
646 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
647 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
648 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
649 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
650 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
651 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
652 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
653 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
654 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
655 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
656 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
657 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
658 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
659 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
660 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
661 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
662 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
663 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
664 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
665 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
666 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
667 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
668 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
669 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
670 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
671 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
672 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
673 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
674 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
675 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
676 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
677 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
678 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
679 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
680 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
681 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
682 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
683 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
684 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
685 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
686 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
687 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
688 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
689 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
690 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
691 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
692 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
693 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
694 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
695 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
696 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
697 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
698 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
699 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
700 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
701 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
702 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
703 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
704 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
705 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
706 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
707 2996887358 Rhizobium sp. R711 Isolate Nodule
708 2996893221 Rhizobium sp. R635 Isolate Nodule
709 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
710 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
711 3004167301 Mesorhizobium loti 582 Isolate Unclassified
712 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
713 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
714 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
715 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
716 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
717 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
718 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
719 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
720 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
721 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
722 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
723 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
724 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
725 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
726 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
727 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
728 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
729 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
730 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
731 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
732 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
733 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
734 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
735 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
736 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
737 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
738 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
739 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
740 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
741 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
742 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
743 8005258706 Rhizobium sp. R693 Isolate Nodule
744 8005275841 Rhizobium sp. N4311 Isolate Nodule
745 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
746 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
747 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
748 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
749 8005321885 Rhizobium sp. R72 Isolate Nodule
750 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
751 8005382845 Rhizobium sp. R634 Isolate Nodule
752 8005395548 Rhizobium sp. R339 Isolate Nodule
753 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
754 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
755 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
756 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
757 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
758 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
759 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
760 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
761 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
762 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
763 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
764 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
765 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
766 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
767 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
768 8024501048 Rhizobium sp. H4 Isolate Nodule
769 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
770 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
771 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
772 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
773 8056382006 Rhizobium croatiense 13T Isolate Nodule
774 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
775 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
776 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 47.06
Metatranscriptomes 0.1
Isolates 52.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.2
Nodule 40.16
Rhizoplane 2.54
Rhizosphere 29.11
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0006661 3300049569 Bacteria 8478
2 JGI24740J21852_10000265 3300001979 Bacteria 21989
3 JGI24739J22299_10017602 3300001989 Bacteria 2576
4 JGI25155J39150_1000013 3300002704 Bacteria 198215
5 JGI25156J39149_1000011 3300002705 Bacteria 198215
6 JGI25162J39368_1003577 3300002737 Bacteria 4348
7 JGI25162J39368_1003648 3300002737 Bacteria 4221
8 JGI25154J39366_1000030 3300002738 Bacteria 191444
9 JGI25158J39367_1000118 3300002739 Bacteria 18246
10 JGI25157J39369_1000013 3300002741 Bacteria 198211
11 JGI25157J39369_1000297 3300002741 Bacteria 36233
12 JGI25152J39213_1002204 3300002773 Bacteria 7575
13 JGI25152J39213_1010652 3300002773 Bacteria 2087
14 JGI25150J39212_1003898 3300002774 Bacteria 3419
15 JGI25159J45721_1000003 3300002987 Bacteria 274069
16 JGI25159J45721_1000320 3300002987 Bacteria 22279
17 JGI25159J45721_1000553 3300002987 Bacteria 16968
18 JGI25151J46595_10000425 3300003187 Bacteria 42264
19 JGI25165J46597_1000019 3300003214 Bacteria 371528
20 JGI25165J46597_1001738 3300003214 Bacteria 9603
21 JGI25165J46597_1002247 3300003214 Bacteria 6708
22 JGI25153J46596_10008005 3300003215 Bacteria 5113
23 JGI25153J46596_10014819 3300003215 Bacteria 3217
24 rootH2_10086381 3300003320 Bacteria 1453
25 rootH1_10069445 3300003323 Bacteria 3424
26 JGI25160J50197_1000003 3300003354 Bacteria 482719
27 JGI25160J50197_1000041 3300003354 Bacteria 152843
28 JGI25160J50197_1001749 3300003354 Bacteria 10525
29 JGI25160J50197_1009671 3300003354 Bacteria 3554
30 JGI25161J50226_1000002 3300003374 Bacteria 420324
31 JGI25161J50226_1000184 3300003374 Bacteria 41591
32 JGI25161J50226_1000315 3300003374 Bacteria 26611
33 JGI25161J50226_1003792 3300003374 Bacteria 3345
34 Ga0055542_1000656 3300003762 Bacteria 28388
35 Ga0055529_1002709 3300003763 Bacteria 3256
36 Ga0055526_1000550 3300003771 Bacteria 29646
37 Ga0055526_1001211 3300003771 Bacteria 18589
38 Ga0055526_1004504 3300003771 Bacteria 8343
39 Ga0055526_1028537 3300003771 Bacteria 1685
40 Ga0055526_1032069 3300003771 Bacteria 1491
41 Ga0055524_1003346 3300003775 Bacteria 7816
42 Ga0055524_1006879 3300003775 Bacteria 4900
43 Ga0055524_1007140 3300003775 Bacteria 4783
44 Ga0055536_1001178 3300003781 Bacteria 16273
45 Ga0055536_1010446 3300003781 Bacteria 3682
46 Ga0055528_1008152 3300003790 Bacteria 4533
47 Ga0055528_1011664 3300003790 Bacteria 3469
48 Ga0055528_1023938 3300003790 Bacteria 1846
49 Ga0055530_10029855 3300003791 Bacteria 1452
50 Ga0055540_1001185 3300003792 Bacteria 16079
51 Ga0055540_1002438 3300003792 Bacteria 9806
52 Ga0055540_1014437 3300003792 Bacteria 2350
53 Ga0055531_10021896 3300003794 Bacteria 2458
54 Ga0055543_1000037 3300004625 Bacteria 125386
55 Ga0055543_1000203 3300004625 Bacteria 48554
56 Ga0055543_1000466 3300004625 Bacteria 23733
57 Ga0055543_1001741 3300004625 Bacteria 8153
58 Ga0065165_1000031 3300005262 Bacteria 216330
59 Ga0065165_1000084 3300005262 Bacteria 154822
60 Ga0065165_1008265 3300005262 Bacteria 4913
61 Ga0070690_100103448 3300005330 Bacteria 1891
62 Ga0070668_100067082 3300005347 Bacteria 2786
63 Ga0070668_100076303 3300005347 Bacteria 2618
64 Ga0070669_100140168 3300005353 Bacteria 1864
65 Ga0070671_100076107 3300005355 Bacteria 2804
66 Ga0070674_100043508 3300005356 Bacteria 3056
67 Ga0070667_100321717 3300005367 Bacteria 1396
68 Ga0070694_100068967 3300005444 Bacteria 2431
69 Ga0070663_100030987 3300005455 Bacteria 3670
70 Ga0070678_100346334 3300005456 Bacteria 1276
71 Ga0070679_100468724 3300005530 Bacteria 1204
72 Ga0068853_100124299 3300005539 Bacteria 2304
73 Ga0068853_100218555 3300005539 Bacteria 1739
74 Ga0068853_100519442 3300005539 Bacteria 1126
75 Ga0070695_100069097 3300005545 Bacteria 2308
76 Ga0070665_100017909 3300005548 Bacteria 7114
77 Ga0068854_100255297 3300005578 Bacteria 1401
78 Ga0068856_100035770 3300005614 Bacteria 4868
79 Ga0068861_100023672 3300005719 Bacteria 4432
80 Ga0068870_10075852 3300005840 Bacteria 1845
81 Ga0068860_100216684 3300005843 Bacteria 1858
82 Ga0068860_100469015 3300005843 Bacteria 1254
83 Ga0081455_10001992 3300005937 Bacteria 24396
84 Ga0081540_1006065 3300005983 Bacteria 8886
85 Ga0070717_10333257 3300006028 Bacteria 1354
86 Ga0075365_10011524 3300006038 Bacteria 5201
87 Ga0075365_10056969 3300006038 Bacteria 2599
88 Ga0075364_10032827 3300006051 Bacteria 3338
89 Ga0075367_10000382 3300006178 Bacteria 16047
90 Ga0075367_10038876 3300006178 Bacteria 2772
91 Ga0075367_10087861 3300006178 Bacteria 1888
92 Ga0075431_100161232 3300006847 Bacteria 2306
93 Ga0075434_100551671 3300006871 Bacteria 1172
94 Ga0079104_1000033 3300006946 Bacteria 202636
95 Ga0105251_10016767 3300009011 Bacteria 3945
96 Ga0105247_10035069 3300009101 Bacteria 3057
97 Ga0105247_10219314 3300009101 Bacteria 1287
98 Ga0105237_10184662 3300009545 Bacteria 2085
99 Ga0105238_10007409 3300009551 Bacteria 10991
100 Ga0105238_10335425 3300009551 Bacteria 1500
101 Ga0105249_10188636 3300009553 Bacteria 2011
102 Ga0105249_10201682 3300009553 Bacteria 1947
103 Ga0105239_10236250 3300010375 Bacteria 2051
104 Ga0105239_10470798 3300010375 Bacteria 1427
105 Ga0157371_10134272 3300013102 Unclassified 1762
106 Ga0157369_10453215 3300013105 Bacteria 1328
107 Ga0171463_1001 3300013249 Bacteria 1406070
108 Ga0157378_10191657 3300013297 Bacteria 1928
109 Ga0163162_10197937 3300013306 Bacteria 2138
110 Ga0157375_10399565 3300013308 Bacteria 1541
111 Ga0157380_10490922 3300014326 Bacteria 1190
112 Ga0182008_10136809 3300014497 Bacteria 1224
113 Ga0157376_10048360 3300014969 Bacteria 3516
114 Ga0183363_1140 3300015690 Bacteria 18543
115 Ga0163161_10004584 3300017792 Bacteria 9620
116 Ga0214544_1002289 3300021320 Bacteria 40409
117 Ga0214542_1001074 3300021321 Bacteria 54628
118 Ga0214543_1000027 3300021327 Bacteria 215065
119 Ga0214543_1000897 3300021327 Bacteria 54534
120 Ga0209435_100026 3300025206 Bacteria 198295
121 Ga0209436_100006 3300025208 Bacteria 150277
122 Ga0209436_102572 3300025208 Bacteria 5344
123 Ga0209672_102569 3300025228 Bacteria 4339
124 Ga0209437_100056 3300025233 Bacteria 363071
125 Ga0209437_100196 3300025233 Bacteria 121199
126 Ga0207425_1004008 3300025245 Bacteria 4530
127 Ga0207425_1004857 3300025245 Bacteria 3942
128 Ga0209646_1000084 3300025246 Bacteria 198295
129 Ga0209646_1008073 3300025246 Bacteria 1703
130 Ga0209026_1000013 3300025250 Bacteria 415633
131 Ga0209026_1000080 3300025250 Bacteria 198295
132 Ga0209148_1000210 3300025254 Bacteria 102885
133 Ga0209759_1000061 3300025256 Bacteria 198295
134 Ga0209759_1000884 3300025256 Bacteria 22738
135 Ga0209129_1000206 3300025258 Bacteria 68903
136 Ga0209129_1001939 3300025258 Bacteria 10837
137 Ga0209129_1002038 3300025258 Bacteria 10450
138 Ga0209129_1005657 3300025258 Bacteria 4327
139 Ga0209129_1005918 3300025258 Bacteria 4135
140 Ga0209129_1013196 3300025258 Bacteria 1836
141 Ga0209233_1000034 3300025261 Bacteria 578898
142 Ga0209233_1000037 3300025261 Bacteria 554620
143 Ga0209233_1000071 3300025261 Bacteria 363290
144 Ga0209233_1002951 3300025261 Bacteria 6069
145 Ga0209455_1000098 3300025272 Bacteria 213890
146 Ga0209455_1007024 3300025272 Bacteria 3239
147 Ga0209673_1000063 3300025273 Bacteria 256709
148 Ga0209673_1002616 3300025273 Bacteria 12098
149 Ga0209673_1002642 3300025273 Bacteria 12012
150 Ga0209673_1003517 3300025273 Bacteria 9178
151 Ga0209130_1000002 3300025284 Bacteria 722648
152 Ga0209130_1000005 3300025284 Bacteria 599620
153 Ga0209130_1000028 3300025284 Bacteria 325668
154 Ga0209676_1003399 3300025292 Bacteria 9856
155 Ga0209676_1013859 3300025292 Bacteria 3071
156 Ga0209025_1000479 3300025294 Bacteria 77489
157 Ga0209025_1001859 3300025294 Bacteria 24728
158 Ga0209025_1009455 3300025294 Bacteria 6786
159 Ga0209025_1011580 3300025294 Bacteria 5788
160 Ga0209025_1054526 3300025294 Bacteria 1555
161 Ga0209564_1000093 3300025295 Bacteria 245793
162 Ga0209564_1000316 3300025295 Bacteria 94849
163 Ga0209564_1001013 3300025295 Bacteria 34890
164 Ga0209564_1004973 3300025295 Bacteria 7832
165 Ga0209564_1019227 3300025295 Bacteria 2563
166 Ga0209758_1000361 3300025297 Bacteria 81006
167 Ga0209758_1000441 3300025297 Bacteria 69800
168 Ga0209758_1000499 3300025297 Bacteria 63732
169 Ga0209758_1001467 3300025297 Bacteria 27671
170 Ga0209758_1011078 3300025297 Bacteria 5276
171 Ga0209758_1013517 3300025297 Bacteria 4442
172 Ga0209758_1035978 3300025297 Bacteria 1941
173 Ga0209050_1002860 3300025298 Bacteria 13672
174 Ga0209256_1000027 3300025299 Bacteria 423283
175 Ga0209256_1000880 3300025299 Bacteria 37115
176 Ga0209256_1000996 3300025299 Bacteria 33661
177 Ga0209256_1001570 3300025299 Bacteria 22473
178 Ga0209256_1012062 3300025299 Bacteria 3367
179 Ga0209256_1020034 3300025299 Bacteria 2104
180 Ga0207426_1000012 3300025302 Bacteria 730942
181 Ga0207426_1000013 3300025302 Bacteria 721897
182 Ga0207426_1000015 3300025302 Bacteria 599316
183 Ga0207426_1000070 3300025302 Bacteria 331559
184 Ga0207426_1013206 3300025302 Bacteria 3068
185 Ga0209051_1004813 3300025303 Bacteria 8141
186 Ga0209051_1004984 3300025303 Bacteria 7929
187 Ga0209051_1009423 3300025303 Bacteria 5036
188 Ga0209051_1012648 3300025303 Bacteria 4069
189 Ga0209051_1014436 3300025303 Bacteria 3686
190 Ga0209051_1017369 3300025303 Bacteria 3216
191 Ga0209051_1064052 3300025303 Bacteria 1141
192 Ga0209257_1008097 3300025304 Bacteria 6113
193 Ga0209257_1011029 3300025304 Bacteria 4433
194 Ga0209257_1012026 3300025304 Bacteria 4069
195 Ga0207713_1034733 3300025735 Bacteria 2186
196 Ga0207647_10016047 3300025904 Bacteria 5118
197 Ga0207695_10230515 3300025913 Bacteria 1757
198 Ga0207671_10009356 3300025914 Bacteria 8195
199 Ga0207671_10111158 3300025914 Bacteria 2085
200 Ga0207681_10075906 3300025923 Bacteria 2359
201 Ga0207694_10350759 3300025924 Bacteria 1221
202 Ga0207650_10466205 3300025925 Bacteria 1053
203 Ga0207659_10087207 3300025926 Bacteria 2323
204 Ga0207706_10082611 3300025933 Bacteria 2824
205 Ga0207669_10003568 3300025937 Bacteria 6744
206 Ga0207704_10159443 3300025938 Bacteria 1603
207 Ga0207704_10254827 3300025938 Bacteria 1320
208 Ga0207667_10288615 3300025949 Bacteria 1676
209 Ga0207668_10137274 3300025972 Bacteria 1875
210 Ga0207668_10345281 3300025972 Bacteria 1243
211 Ga0207658_10283605 3300025986 Bacteria 1421
212 Ga0207703_10154447 3300026035 Bacteria 2004
213 Ga0207639_10011429 3300026041 Bacteria 6166
214 Ga0207678_10030176 3300026067 Bacteria 4733
215 Ga0207678_10047528 3300026067 Bacteria 3711
216 Ga0207708_10289112 3300026075 Bacteria 1330
217 Ga0207675_100112509 3300026118 Bacteria 2569
218 Ga0209281_1000043 3300027111 Bacteria 341543
219 Ga0207428_10055125 3300027907 Bacteria 3162
220 Ga0268266_10042461 3300028379 Bacteria 3884
221 Ga0268266_10281037 3300028379 Bacteria 1548
222 Ga0268264_10148674 3300028381 Bacteria 2098
223 Ga0265318_10013013 3300028577 Bacteria 3526
224 Ga0307515_10000029 3300028794 Bacteria 365410
225 Ga0265330_10121657 3300031235 Bacteria 1112
226 Ga0265340_10033570 3300031247 Bacteria 2554
227 Ga0265339_10048410 3300031249 Bacteria 2331
228 Ga0265339_10059055 3300031249 Bacteria 2069
229 Ga0265316_10014953 3300031344 Bacteria 6806
230 Ga0307513_10077823 3300031456 Bacteria 3433
231 Ga0265313_10037440 3300031595 Bacteria 2426
232 Ga0316575_10055441 3300031665 Bacteria 1578
233 Ga0316579_10000691 3300031691 Bacteria 11484
234 Ga0316579_10104134 3300031691 Bacteria 1360
235 Ga0265314_10008035 3300031711 Bacteria 9094
236 Ga0265342_10005385 3300031712 Bacteria 9775
237 Ga0316576_10030168 3300031727 Bacteria 3837
238 Ga0316578_10077237 3300031728 Bacteria 1977
239 Ga0316577_10004501 3300031733 Bacteria 7200
240 Ga0307412_10015975 3300031911 Bacteria 4460
241 Ga0307416_100113679 3300032002 Bacteria 2393
242 Ga0307414_10108571 3300032004 Bacteria 2106
243 Ga0316585_10020147 3300032137 Bacteria 2039
244 Ga0316580_10000591 3300032139 Bacteria 8527
245 Ga0316593_10032241 3300032168 Bacteria 1711
246 Ga0373932_0011103 3300035112 Bacteria 2194
247 Ga0316574_0010281 3300035398 Bacteria 5280
248 Ga0373931_0211494 3300035691 Bacteria 1163
249 Ga0316584_0003285 3300036712 Bacteria 10461
250 Ga0316584_0133733 3300036712 Bacteria 1852
251 Ga0395899_0000014 3300037312 Bacteria 488813
252 Ga0395900_0000007 3300037418 Bacteria 488860
253 Ga0395900_0077780 3300037418 Bacteria 3409
254 Ga0395900_0234212 3300037418 Bacteria 1845
255 Ga0395900_0296292 3300037418 Bacteria 1605
256 Ga0395898_0000011 3300037466 Bacteria 488860
257 Ga0395905_0000008 3300037471 Bacteria 488860
258 Ga0395905_0117976 3300037471 Bacteria 2494
259 Ga0395901_0000020 3300038443 Bacteria 314918
260 Ga0395901_0019029 3300038443 Bacteria 7021
261 Ga0400483_092583 3300039062 Bacteria 3821
262 Ga0400483_271870 3300039062 Bacteria 11015
263 Ga0439436_0003581 3300041404 Bacteria 4723
264 Ga0439465_0058412 3300041413 Bacteria 1274
265 Ga0439449_0032697 3300042007 Bacteria 1939
266 Ga0439449_0095654 3300042007 Bacteria 1097
267 Ga0450910_004115 3300042147 Bacteria 1957
268 Ga0439440_0006427 3300042993 Bacteria 2364
269 Ga0466972_0018944 3300044658 Bacteria 3439
270 Ga0466963_0120449 3300044694 Bacteria 1805
271 Ga0466968_0049060 3300044735 Bacteria 1798
272 Ga0466970_0130788 3300044765 Bacteria 1378
273 Ga0466970_0166427 3300044765 Bacteria 1221
274 Ga0466957_0124803 3300044842 Bacteria 1644
275 Ga0466960_0049247 3300044901 Bacteria 2028
276 Ga0466967_0300753 3300045976 Bacteria 1544
277 Ga0495650_0038058 3300046471 Bacteria 2087
278 Ga0495584_0032541 3300046491 Bacteria 2639
279 Ga0495583_0014293 3300046506 Bacteria 4386
280 Ga0495606_0016089 3300046507 Bacteria 5725
281 Ga0495606_0054400 3300046507 Bacteria 2592
282 Ga0495606_0112742 3300046507 Bacteria 1638
283 Ga0495608_0102088 3300046511 Bacteria 1849
284 Ga0495610_0092901 3300046512 Bacteria 1364
285 Ga0495631_0058744 3300046518 Bacteria 1672
286 Ga0495632_0056429 3300046519 Bacteria 1920
287 Ga0495632_0093396 3300046519 Bacteria 1424
288 Ga0495643_0012892 3300046522 Bacteria 5027
289 Ga0495643_0045533 3300046522 Bacteria 2381
290 Ga0495648_0100372 3300046524 Bacteria 1599
291 Ga0495652_0250731 3300046529 Bacteria 1312
292 Ga0495654_0001320 3300046530 Bacteria 17329
293 Ga0495654_0086587 3300046530 Bacteria 1460
294 Ga0495587_0084163 3300046536 Bacteria 1842
295 Ga0495633_0043713 3300046558 Bacteria 2125
296 Ga0495668_0055056 3300046616 Bacteria 2197
297 Ga0495625_0236122 3300046660 Bacteria 1192
298 Ga0495670_0152810 3300046691 Bacteria 1211
299 Ga0495649_0186431 3300046694 Bacteria 1081
300 Ga0495604_0120220 3300047317 Bacteria 1903
301 Ga0495686_0023921 3300047472 Bacteria 4018
302 Ga0495686_0034123 3300047472 Bacteria 3279
303 Ga0495686_0128532 3300047472 Bacteria 1504
304 Ga0495686_0228855 3300047472 Bacteria 1054
305 Ga0495626_0078187 3300048091 Bacteria 1474
306 Ga0496100_0029288 3300048903 Bacteria 3404
307 Ga0496102_0013134 3300048905 Bacteria 7165
308 Ga0496103_0034601 3300048906 Bacteria 3090
309 Ga0496104_0127081 3300048907 Bacteria 2448
310 Ga0496105_0053588 3300048908 Bacteria 3331
311 Ga0496106_0048515 3300048909 Bacteria 3197
312 Ga0496106_0071357 3300048909 Bacteria 2654
313 Ga0496106_0606942 3300048909 Bacteria 876
314 Ga0496107_0018512 3300048910 Bacteria 4905
315 Ga0496107_0102663 3300048910 Bacteria 2097
316 Ga0496107_0119267 3300048910 Bacteria 1943
317 Ga0496109_0056052 3300048912 Bacteria 3596
318 Ga0496110_0092977 3300048913 Bacteria 2699
319 Ga0496110_0231354 3300048913 Bacteria 1681
320 Ga0496111_0007743 3300048914 Bacteria 7067
321 Ga0496111_0208067 3300048914 Bacteria 1454
322 Ga0496113_0188069 3300048916 Bacteria 1639
323 Ga0496114_0264368 3300048917 Bacteria 1515
324 Ga0496115_0184709 3300048918 Bacteria 1723
325 Ga0496116_0114002 3300048919 Bacteria 1580
326 Ga0496117_0061719 3300048920 Bacteria 2574
327 Ga0496117_0064374 3300048920 Bacteria 2500
328 Ga0496117_0088886 3300048920 Bacteria 1997
329 Ga0496118_0125828 3300048921 Bacteria 1659
330 Ga0496119_0010822 3300048922 Bacteria 7634
331 Ga0496119_0029723 3300048922 Bacteria 3696
332 Ga0496120_0002411 3300048923 Bacteria 18988
333 Ga0496121_0000897 3300048924 Bacteria 53790
334 Ga0496121_0009130 3300048924 Bacteria 11472
335 Ga0496121_0090466 3300048924 Bacteria 2392
336 Ga0496121_0122316 3300048924 Bacteria 1963
337 Ga0496121_0176103 3300048924 Bacteria 1548
338 Ga0496122_0001480 3300048925 Bacteria 37788
339 Ga0496122_0042450 3300048925 Bacteria 3578
340 Ga0496122_0091633 3300048925 Bacteria 2069
341 Ga0496122_0121105 3300048925 Bacteria 1687
342 Ga0496122_0178034 3300048925 Bacteria 1272
343 Ga0496123_0000238 3300048926 Bacteria 111297
344 Ga0496123_0045841 3300048926 Bacteria 2973
345 Ga0496123_0053294 3300048926 Bacteria 2674
346 Ga0496123_0060351 3300048926 Bacteria 2446
347 Ga0496123_0074481 3300048926 Bacteria 2101
348 Ga0496124_0045806 3300048927 Bacteria 3749
349 Ga0496124_0091196 3300048927 Bacteria 2484
350 Ga0496124_0117498 3300048927 Bacteria 2130
351 Ga0496124_0161759 3300048927 Bacteria 1744
352 Ga0496124_0190433 3300048927 Bacteria 1570
353 Ga0496124_0230812 3300048927 Bacteria 1384
354 Ga0496125_0059637 3300048928 Bacteria 3073
355 Ga0496125_0104159 3300048928 Bacteria 2079
356 Ga0496125_0219797 3300048928 Bacteria 1225
357 Ga0496126_0007048 3300048929 Bacteria 12397
358 Ga0501032_0097143 3300049569 Bacteria 1952
359 Ga0501033_0000230 3300049570 Bacteria 53911
360 Ga0501033_0211351 3300049570 Bacteria 1383
361 Ga0501034_0004622 3300049571 Bacteria 15254
362 Ga0501034_0070434 3300049571 Bacteria 3508
363 Ga0501034_0070998 3300049571 Bacteria 3493
364 Ga0501034_0075278 3300049571 Bacteria 3383
365 Ga0501034_0144598 3300049571 Bacteria 2356
366 Ga0501034_0170929 3300049571 Bacteria 2140
367 Ga0501034_0175220 3300049571 Bacteria 2111
368 Ga0501036_0140606 3300049572 Bacteria 2037
369 Ga0501037_0000168 3300049573 Bacteria 61484
370 Ga0501038_0115121 3300049574 Bacteria 2223
371 Ga0501038_0147589 3300049574 Bacteria 1919
372 Ga0501038_0254124 3300049574 Bacteria 1391
373 Ga0501039_0043737 3300049575 Bacteria 3459
374 Ga0501039_0101405 3300049575 Bacteria 2247
375 Ga0501039_0132202 3300049575 Bacteria 1958
376 Ga0501040_0062748 3300049576 Bacteria 2556
377 Ga0501041_0038368 3300049577 Bacteria 2905
378 Ga0501041_0040076 3300049577 Bacteria 2843
379 Ga0501042_0039797 3300049578 Bacteria 3342
380 Ga0501043_0000005 3300049579 Bacteria 254466
381 Ga0501043_0134348 3300049579 Bacteria 1938
382 Ga0501043_0320673 3300049579 Bacteria 1181
383 Ga0501046_0046525 3300049580 Bacteria 3443
384 Ga0501047_0079985 3300049581 Bacteria 3142
385 Ga0501047_0086492 3300049581 Bacteria 3012
386 Ga0501047_0181292 3300049581 Bacteria 1972
387 Ga0501047_0235932 3300049581 Bacteria 1681
388 Ga0501047_0420830 3300049581 Bacteria 1167
389 Ga0501047_0477004 3300049581 Bacteria 1075
390 Ga0501048_0017659 3300049582 Bacteria 5251
391 Ga0501048_0070175 3300049582 Bacteria 2475
392 Ga0501048_0161329 3300049582 Bacteria 1587
393 Ga0501048_0244463 3300049582 Unclassified 1273
394 Ga0501048_0277090 3300049582 Bacteria 1192
395 Ga0501067_0077644 3300049583 Bacteria 1840
396 Ga0501068_0042829 3300049584 Bacteria 2722
397 Ga0501068_0215368 3300049584 Bacteria 1220
398 Ga0501069_0000011 3300049585 Bacteria 153214
399 Ga0501069_0018803 3300049585 Bacteria 3731
400 Ga0501070_0000055 3300049586 Bacteria 99156
401 Ga0501070_0002216 3300049586 Bacteria 17069
402 Ga0501070_0039582 3300049586 Bacteria 3932
403 Ga0501070_0155291 3300049586 Bacteria 1887
404 Ga0501070_0310881 3300049586 Bacteria 1283
405 Ga0501071_0048975 3300049587 Bacteria 3040
406 Ga0501071_0353498 3300049587 Bacteria 1118
407 Ga0501072_0040508 3300049588 Bacteria 3658
408 Ga0501073_0013583 3300049589 Bacteria 5922
409 Ga0501073_0014419 3300049589 Bacteria 5743
410 Ga0501073_0020706 3300049589 Bacteria 4743
411 Ga0501073_0169723 3300049589 Bacteria 1510
412 Ga0501074_0000039 3300049590 Bacteria 60866
413 Ga0501075_0134219 3300049591 Bacteria 1885
414 Ga0501075_0157217 3300049591 Bacteria 1733
415 Ga0501077_0057239 3300049593 Bacteria 2475
416 Ga0501079_0127909 3300049741 Bacteria 1976
417 Ga0501080_0000217 3300049742 Bacteria 42758
418 Ga0501080_0019895 3300049742 Bacteria 6216
419 Ga0501080_0031716 3300049742 Bacteria 4924
420 Ga0501081_0019053 3300049743 Bacteria 4565
421 Ga0501081_0050183 3300049743 Bacteria 2874
422 Ga0501081_0224180 3300049743 Bacteria 1367
423 Ga0501083_0000063 3300049744 Bacteria 74976
424 Ga0501083_0175208 3300049744 Bacteria 1401
425 Ga0501083_0189321 3300049744 Bacteria 1343
426 Ga0501035_0000086 3300049822 Bacteria 115822
427 Ga0501035_0002112 3300049822 Bacteria 19769
428 Ga0501035_0003189 3300049822 Bacteria 15719
429 Ga0501035_0035579 3300049822 Bacteria 4518
430 Ga0501035_0187199 3300049822 Bacteria 1781
431 Ga0501035_0280496 3300049822 Bacteria 1408
432 Ga0501044_0000242 3300049823 Bacteria 69190
433 Ga0501044_0021180 3300049823 Bacteria 6942
434 Ga0501044_0067968 3300049823 Bacteria 3630
435 Ga0501044_0071341 3300049823 Bacteria 3532
436 Ga0501044_0088669 3300049823 Bacteria 3122
437 Ga0501044_0143247 3300049823 Bacteria 2377
438 Ga0501044_0145817 3300049823 Bacteria 2353
439 Ga0501044_0184803 3300049823 Bacteria 2050
440 Ga0501044_0253372 3300049823 Bacteria 1700
441 Ga0501044_0331954 3300049823 Bacteria 1443
442 nmdc:mga00v17_47549_c1 3300050491 Bacteria 2599
443 nmdc:mga0yw44_1652_c1 3300050492 Bacteria 8990
444 nmdc:mga0yw44_28299_c1 3300050492 Bacteria 3222
445 nmdc:mga06z11_192206_c1 3300050494 Bacteria 1182
446 nmdc:mga06z11_49753_c1 3300050494 Bacteria 2139
447 nmdc:mga06z11_50337_c1 3300050494 Bacteria 2129
448 nmdc:mga06r32_111936_c1 3300050510 Bacteria 2686
449 nmdc:mga0sz30_33645_c1 3300050516 Bacteria 2131
450 Ga0495601_0090979 3300053077 Bacteria 1964
451 Ga0500610_0042845 3300053079 Bacteria 2344
452 Ga0500578_0045718 3300053086 Bacteria 2809
453 Ga0500618_006337 3300053125 Bacteria 3488
454 Ga0500568_0019857 3300053139 Bacteria 2913
455 Ga0500604_0007549 3300053151 Bacteria 2880
456 Ga0500616_0001322 3300053153 Bacteria 24433
457 Ga0500620_000168 3300053155 Bacteria 13148
458 Ga0500622_0001167 3300053156 Bacteria 21767
459 Ga0500627_0142835 3300053158 Bacteria 1081
460 Ga0501082_0017789 3300060353 Bacteria 6124
461 Ga0501082_0087868 3300060353 Bacteria 2682
462 Ga0501082_0099129 3300060353 Bacteria 2519
463 Ga0501082_0329509 3300060353 Bacteria 1330
464 Ga0530510_0093161 3300061734 Bacteria 2199
465 Ga0530510_0175422 3300061734 Bacteria 1588
466 2503204693 2503198000 Bacteria 6884444
467 2509109089 2508501122 Bacteria 6292184
468 2509113535 2508501123 Bacteria 6283661
469 2509145086 2508501127 Bacteria 7037543
470 2509370221 2509276018 Bacteria 6910194
471 2509375179 2509276019 Bacteria 6802256
472 2509398952 2509276022 Bacteria 6200534
473 2510131206 2510065019 Bacteria 6903379
474 2510314292 2510065059 Bacteria 6847884
475 2511134733 2510917022 Bacteria 6504556
476 2511184593 2510917028 Bacteria 6185411
477 2511197740 2510917030 Bacteria 7460662
478 2512934572 2512875016 Bacteria 6529530
479 2512962918 2512875024 Bacteria 7195110
480 2513570410 2513237084 Bacteria 7231967
481 2513574581 2513237085 Bacteria 7695351
482 2513597294 2513237088 Bacteria 6927906
483 2513613544 2513237090 Bacteria 7096802
484 2513707220 2513237103 Bacteria 7647401
485 2513865059 2513237138 Bacteria 7368160
486 2513911196 2513237144 Bacteria 7530820
487 2513924602 2513237146 Bacteria 7166346
488 2513996563 2513237159 Bacteria 6810126
489 2514416940 2513237305 Bacteria 7293571
490 2515110144 2515075009 Bacteria 7288508
491 2515643580 2515154114 Bacteria 7848616
492 2515740783 2515154134 Bacteria 7220242
493 2516204514 2516143018 Bacteria 6951533
494 2517038828 2516653077 Bacteria 7555578
495 2517079083 2516653085 Bacteria 7346596
496 2520379014 2519899620 Bacteria 6499161
497 2530648020 2529292951 Bacteria 6916614
498 2535484080 2534681786 Bacteria 3308809
499 2535514892 2534681796 Bacteria 7146037
500 2558866281 2558860100 Bacteria 8458965
501 2585164717 2582581283 Bacteria 6030556
502 2585205629 2582581294 Bacteria 6626667
503 2585223582 2582581298 Bacteria 7315509
504 2585229643 2582581299 Bacteria 6518058
505 2585265062 2582581306 Bacteria 6450535
506 2585273800 2582581307 Bacteria 6597605
507 2585385878 2582581865 Bacteria 6644329
508 2585392114 2582581866 Bacteria 6859583
509 2585398765 2582581867 Bacteria 7184437
510 2585541997 2585427528 Bacteria 6842387
511 2585545822 2585427529 Bacteria 7395659
512 2585559976 2585427531 Bacteria 6992870
513 2585819113 2585427590 Bacteria 6824633
514 2585840355 2585427593 Bacteria 7141551
515 2585844028 2585427594 Bacteria 6180594
516 2585900651 2585427608 Bacteria 6544331
517 2585905844 2585427609 Bacteria 6667127
518 2585994223 2585427633 Bacteria 6413184
519 2585998741 2585427634 Bacteria 6455027
520 2587979040 2585428125 Bacteria 6662905
521 2588514179 2588253730 Bacteria 6881675
522 2597816537 2597489875 Bacteria 7010078
523 2599332839 2599185156 Bacteria 5403036
524 2599419434 2599185170 Bacteria 7295545
525 2599719052 2599185236 Bacteria 6875203
526 2599935858 2599185301 Bacteria 6161860
527 2600191214 2599185352 Bacteria 7228948
528 2600376511 2600254933 Bacteria 4750527
529 2616553264 2615840698 Bacteria 7319877
530 2617380401 2617270742 Bacteria 6808054
531 2643806101 2643221557 Bacteria 7184309
532 2643984905 2643221595 Bacteria 6565519
533 2644004716 2643221599 Bacteria 6292121
534 2644047413 2643221607 Bacteria 6314006
535 2644070345 2643221610 Bacteria 7480339
536 2644103482 2643221618 Bacteria 7717186
537 2644130008 2643221623 Bacteria 5239945
538 2644144361 2643221626 Bacteria 8069654
539 2644155518 2643221627 Bacteria 6761570
540 2644199831 2643221636 Bacteria 6583769
541 2644207044 2643221637 Bacteria 5345260
542 2644237356 2643221643 Bacteria 5749658
543 2644297813 2643221653 Bacteria 4569637
544 2644306412 2643221655 Bacteria 7722067
545 2644330602 2643221659 Bacteria 7890716
546 2644377362 2643221668 Bacteria 7306521
547 2644421107 2643221675 Bacteria 7473456
548 2644454630 2643221680 Bacteria 7473610
549 2644480202 2643221686 Bacteria 6310811
550 2644495653 2643221688 Bacteria 5260751
551 2644542594 2643221698 Bacteria 7756764
552 2644612023 2643221712 Bacteria 7729434
553 2644650692 2643221718 Bacteria 5345506
554 2644656066 2643221719 Bacteria 4568197
555 2644671788 2643221723 Bacteria 7095460
556 2644692569 2643221726 Bacteria 7455827
557 2671113805 2667528174 Bacteria 6435400
558 2688601322 2687453392 Bacteria 6880454
559 2692317471 2690316117 Bacteria 6800650
560 2694630448 2693429783 Bacteria 7019804
561 2694637767 2693429784 Bacteria 7241525
562 2719383919 2718217927 Bacteria 6972593
563 2719663708 2718217997 Bacteria 6740740
564 2720490127 2718218199 Bacteria 6740745
565 2720611507 2718218232 Bacteria 6720332
566 2720618357 2718218233 Bacteria 6662049
567 2720629763 2718218235 Bacteria 6630699
568 2720773459 2718218269 Bacteria 6906114
569 2721397689 2718218423 Bacteria 6438183
570 2723025129 2721755556 Bacteria 6745503
571 2723558714 2721755684 Bacteria 6859907
572 2723565285 2721755685 Bacteria 6704835
573 2723578487 2721755686 Bacteria 7343952
574 2724036499 2721755809 Bacteria 6438790
575 2724088066 2721755819 Bacteria 6906405
576 2724102550 2721755822 Bacteria 6726041
577 2724108447 2721755823 Bacteria 6752556
578 2730106065 2728369352 Bacteria 6745171
579 2738801415 2738541293 Bacteria 7065685
580 2739036774 2738541333 Bacteria 7106503
581 2739309995 2738543024 Bacteria 5603683
582 2753462632 2751185821 Bacteria 6189929
583 2756674670 2756170246 Bacteria 7451806
584 2758640879 2758568016 Bacteria 5645291
585 2766063523 2765235942 Bacteria 7445910
586 2776911827 2775507049 Bacteria 6284736
587 2778179573 2775507266 Bacteria 7392367
588 2792583095 2791355082 Bacteria 5973319
589 2792621233 2791355091 Bacteria 6135441
590 2792625448 2791355092 Bacteria 6248105
591 2792637882 2791355094 Bacteria 7011481
592 2792746457 2791355123 Bacteria 8049106
593 2793282201 2791355253 Bacteria 5171699
594 2793299827 2791355256 Bacteria 6798008
595 2793325451 2791355260 Bacteria 6598818
596 2793330004 2791355261 Bacteria 6661293
597 2793338285 2791355262 Bacteria 6774204
598 2793344197 2791355263 Bacteria 6872478
599 2793352814 2791355265 Bacteria 6539969
600 2805931699 2802429605 Bacteria 6875453
601 2805932562 2802429606 Bacteria 6346811
602 2806048474 2802429633 Bacteria 7341974
603 2806055947 2802429634 Bacteria 7083200
604 2806062725 2802429635 Bacteria 7650140
605 2806066467 2802429636 Bacteria 7597525
606 2806073530 2802429637 Bacteria 7067217
607 2819245057 2818991272 Bacteria 4622173
608 2819686079 2818991461 Bacteria 7026071
609 2821123473 2821123053 Bacteria 7836056
610 2837681505 2837678835 Bacteria 5252418
611 2838022611 2838016132 Bacteria 6577831
612 2838027691 2838022645 Bacteria 6494267
613 2838029434 2838029111 Bacteria 6603031
614 2838040034 2838035591 Bacteria 7166484
615 2838048646 2838042994 Bacteria 6046894
616 2838054604 2838048938 Bacteria 6044578
617 2838064277 2838061910 Bacteria 6794874
618 2838070901 2838068647 Bacteria 6208656
619 2838075164 2838074704 Bacteria 6785777
620 2838666060 2838661181 Bacteria 7385261
621 2838673337 2838668709 Bacteria 6671819
622 2838693685 2838686498 Bacteria 7807632
623 2838706084 2838701080 Bacteria 6669771
624 2838736361 2838729681 Bacteria 7400765
625 2838739504 2838736955 Bacteria 5760694
626 2838749180 2838742623 Bacteria 7396178
627 2841735723 2841734538 Bacteria 6784580
628 2841844372 2841840854 Bacteria 5761912
629 2841858477 2841851746 Bacteria 7532261
630 2842111975 2842110456 Bacteria 7656360
631 2842144093 2842140634 Bacteria 5759631
632 2842150573 2842146304 Bacteria 5957337
633 2842163313 2842156927 Bacteria 6894975
634 2842165385 2842163707 Bacteria 6916235
635 2842186922 2842180545 Bacteria 6888678
636 2842198028 2842192696 Bacteria 6147454
637 2842204248 2842198810 Bacteria 6608673
638 2842207150 2842205361 Bacteria 6340321
639 2842236500 2842229732 Bacteria 7475766
640 2842250079 2842243621 Bacteria 7421798
641 2842255548 2842250916 Bacteria 6579627
642 2842264108 2842257432 Bacteria 7401195
643 2842270691 2842264693 Bacteria 6472963
644 2842278241 2842271015 Bacteria 7807131
645 2842280157 2842278818 Bacteria 6340002
646 2842286616 2842285085 Bacteria 6011953
647 2842310471 2842304105 Bacteria 7023636
648 2842317659 2842311132 Bacteria 6616990
649 2842323922 2842317721 Bacteria 6793725
650 2842403831 2842402390 Bacteria 6681310
651 2842410467 2842409023 Bacteria 6687331
652 2842417114 2842415677 Bacteria 6596907
653 2842424516 2842422224 Bacteria 6239196
654 2842434575 2842428310 Bacteria 6767288
655 2842440965 2842434925 Bacteria 6502746
656 2842447563 2842441272 Bacteria 6769273
657 2842454301 2842447887 Bacteria 6754142
658 2842468936 2842462802 Bacteria 6588055
659 2842475529 2842469257 Bacteria 6752936
660 2842476136 2842475841 Bacteria 6603183
661 2842486223 2842482326 Bacteria 7212537
662 2842492656 2842489311 Bacteria 6620893
663 2842500245 2842495871 Bacteria 6820686
664 2842502962 2842502639 Bacteria 6604161
665 2842521490 2842521101 Bacteria 6569494
666 2842923128 2842922631 Bacteria 5824079
667 2844004228 2844002411 Bacteria 7168230
668 2844009982 2844009547 Bacteria 6728125
669 2844165066 2844163670 Bacteria 7266046
670 2844456229 2844454524 Bacteria 7952546
671 2847417460 2847417321 Bacteria 6913799
672 2847672852 2847670302 Bacteria 6165597
673 2847689326 2847686936 Bacteria 6278406
674 2848992295 2848992105 Bacteria 6810864
675 2850079798 2850079185 Bacteria 6848280
676 2855873565 2855872281 Bacteria 6964271
677 2856314802 2856314179 Bacteria 6477897
678 2856327974 2856320880 Bacteria 7263508
679 2856332149 2856328259 Bacteria 6528202
680 2856335137 2856334872 Bacteria 7037011
681 2856346689 2856342000 Bacteria 7176905
682 2856354799 2856349417 Bacteria 6230045
683 2856360698 2856356410 Bacteria 6297484
684 2856371133 2856364286 Bacteria 6939991
685 2857354225 2857349434 Bacteria 7926032
686 2857370346 2857367948 Bacteria 6965560
687 2857521907 2857516855 Bacteria 7787325
688 2857533577 2857531043 Bacteria 6754041
689 2869164636 2869162929 Bacteria 6399702
690 2869174869 2869169390 Bacteria 6659796
691 2869242108 2869234852 Bacteria 6654993
692 2869248364 2869242130 Bacteria 6609239
693 2869253918 2869249662 Bacteria 6868783
694 2869263681 2869256925 Bacteria 6981691
695 2869270309 2869264136 Bacteria 6880765
696 2869275905 2869271264 Bacteria 6908218
697 2869279925 2869278585 Bacteria 7077053
698 2869292356 2869285874 Bacteria 6901219
699 2871429171 2871429161 Bacteria 6547891
700 2871443861 2871435913 Bacteria 6880295
701 2871445374 2871444079 Bacteria 6423508
702 2871455305 2871451962 Bacteria 7336357
703 2871460785 2871459585 Bacteria 6866887
704 2871470950 2871466892 Bacteria 6923287
705 2871480293 2871474448 Bacteria 6806570
706 2871485427 2871481445 Bacteria 6700002
707 2871490694 2871488783 Bacteria 6929816
708 2871499269 2871495908 Bacteria 6935695
709 2874108923 2874102143 Bacteria 6342645
710 2874114363 2874109183 Bacteria 6517025
711 2874121849 2874116593 Bacteria 6674494
712 2874129623 2874123672 Bacteria 7238285
713 2874145581 2874139085 Bacteria 7021506
714 2874154077 2874146452 Bacteria 7533118
715 2874161579 2874155637 Bacteria 6724144
716 2874162675 2874162495 Bacteria 6174670
717 2874171647 2874168670 Bacteria 8062617
718 2876363166 2876363079 Bacteria 6544991
719 2876385075 2876377896 Bacteria 6565995
720 2876388495 2876386047 Bacteria 6698674
721 2876393038 2876392853 Bacteria 6660880
722 2876404323 2876399893 Bacteria 6927900
723 2876411951 2876406927 Bacteria 6191900
724 2876419761 2876413966 Bacteria 6831344
725 2876427612 2876420981 Bacteria 6687741
726 2878036117 2878035449 Bacteria 6555736
727 2878738261 2878730984 Bacteria 6380721
728 2878740233 2878738818 Bacteria 7136951
729 2878752699 2878745973 Bacteria 6867388
730 2878755097 2878753008 Bacteria 6922523
731 2878763459 2878760144 Bacteria 6823465
732 2878770457 2878767105 Bacteria 6898628
733 2878776577 2878774303 Bacteria 6108671
734 2878784420 2878781027 Bacteria 6834456
735 2878793666 2878788777 Bacteria 6567085
736 2881147502 2881147464 Bacteria 7779814
737 2881158606 2881155292 Bacteria 6461656
738 2881164278 2881161766 Bacteria 7127907
739 2881853066 2881845957 Bacteria 6611900
740 2881854969 2881853255 Bacteria 6698367
741 2881868863 2881861095 Bacteria 7128710
742 2882632879 2882632389 Bacteria 8154593
743 2882917594 2882912400 Bacteria 6801539
744 2885306142 2885305155 Bacteria 7348390
745 2885314802 2885312484 Bacteria 6415165
746 2885320301 2885318864 Bacteria 6729568
747 2885331221 2885326080 Bacteria 7134805
748 2885337709 2885334103 Bacteria 7216818
749 2885346796 2885342637 Bacteria 7011821
750 2885353849 2885350715 Bacteria 6787678
751 2888342593 2888337043 Bacteria 6629336
752 2888350297 2888343758 Bacteria 6611049
753 2888352159 2888350351 Bacteria 7372807
754 2889014149 2889010040 Bacteria 6749192
755 2889021145 2889016732 Bacteria 6700763
756 2889793363 2889790730 Bacteria 5689708
757 2889916305 2889914905 Bacteria 5702301
758 2891049527 2891048133 Bacteria 4447501
759 2896388581 2896384573 Bacteria 7700774
760 2899794629 2899792073 Bacteria 4926588
761 2899805495 2899803654 Bacteria 5577784
762 2903454760 2903448605 Bacteria 7357801
763 2903494798 2903492973 Bacteria 13473544
764 2903499421 2903492973 Bacteria 13473544
765 2903521517 2903513507 Bacteria 6344008
766 2903525116 2903521522 Bacteria 6525694
767 2903532140 2903528002 Bacteria 6586099
768 2903544074 2903540706 Bacteria 7062119
769 2904659744 2904659560 Bacteria 6685615
770 2906315090 2906308376 Bacteria 6841989
771 2906321346 2906321335 Bacteria 6579571
772 2906334663 2906328253 Bacteria 6585166
773 2906366210 2906363423 Bacteria 6856682
774 2906370953 2906370794 Bacteria 6881062
775 2906396934 2906393657 Bacteria 6790866
776 2906407553 2906401398 Bacteria 6693206
777 2906411519 2906408224 Bacteria 6162342
778 2906414991 2906414383 Bacteria 6580790
779 2906433187 2906427513 Bacteria 6375796
780 2913298165 2913295892 Bacteria 6333755
781 2915651090 2915650412 Bacteria 4288180
782 2919101532 2919100787 Bacteria 7710546
783 2919172212 2919171160 Bacteria 6499771
784 2919408656 2919408235 Bacteria 6149349
785 2920763582 2920760137 Bacteria 7427611
786 2920823194 2920822456 Bacteria 6897201
787 2922133934 2922130491 Bacteria 7173936
788 2922154222 2922151315 Bacteria 6902399
789 2922164387 2922158528 Bacteria 6573167
790 2922174068 2922172374 Bacteria 6167644
791 2922179151 2922178524 Bacteria 6025201
792 2922192974 2922185730 Bacteria 7113964
793 2923556514 2923556063 Bacteria 6793593
794 2924715143 2924710171 Bacteria 6752351
795 2924723440 2924718760 Bacteria 6331356
796 2924729890 2924726620 Bacteria 6271473
797 2924735771 2924733363 Bacteria 7574837
798 2924746526 2924741084 Bacteria 6661321
799 2924750234 2924748358 Bacteria 6154725
800 2924758934 2924754689 Bacteria 6774424
801 2924767584 2924762789 Bacteria 6561353
802 2924777833 2924776078 Bacteria 7492003
803 2924791316 2924784321 Bacteria 7416538
804 2933020805 2933016740 Bacteria 6355406
805 2933576909 2933570622 Bacteria 7023390
806 2933587305 2933586486 Bacteria 7667493
807 2933601702 2933599457 Bacteria 5858799
808 2935902695 2935901341 Bacteria 7341747
809 2936369162 2936367885 Bacteria 7324495
810 2936387213 2936381700 Bacteria 7006523
811 2937821631 2937813078 Bacteria 7783518
812 2937825902 2937822353 Bacteria 7290551
813 2937837152 2937836603 Bacteria 6811263
814 2937844766 2937843397 Bacteria 5256375
815 2937853362 2937848649 Bacteria 6983481
816 2937865386 2937861824 Bacteria 6660327
817 2937877071 2937868953 Bacteria 6639878
818 2937884395 2937877337 Bacteria 7246526
819 2937892359 2937891427 Bacteria 6357007
820 2937980418 2937972304 Bacteria 7532020
821 2937981536 2937980651 Bacteria 6517427
822 2937997919 2937994558 Bacteria 7036190
823 2938017254 2938014810 Bacteria 6700592
824 2939672579 2939669807 Bacteria 5028511
825 2941500907 2941499720 Bacteria 7599444
826 2958035792 2958034702 Bacteria 6989922
827 2958044823 2958041894 Bacteria 13082850
828 2958048038 2958041894 Bacteria 13082850
829 2958066622 2958064165 Bacteria 7158582
830 2958076411 2958071322 Bacteria 6815895
831 2958091706 2958084443 Bacteria 7312792
832 2958098040 2958092219 Bacteria 6861151
833 2958101401 2958100919 Bacteria 6800575
834 2958112132 2958108152 Bacteria 6681128
835 2958119784 2958115193 Bacteria 6923548
836 2958125221 2958122699 Bacteria 7280457
837 2958136756 2958130278 Bacteria 6897202
838 2958144033 2958137437 Bacteria 6050276
839 2958145657 2958144490 Bacteria 6677056
840 2958161629 2958158011 Bacteria 6058449
841 2958168394 2958165035 Bacteria 6906348
842 2958179456 2958172287 Bacteria 6716688
843 2958186639 2958179912 Bacteria 6874908
844 2961085140 2961077736 Bacteria 7079850
845 2961115068 2961114664 Bacteria 6680456
846 2961128277 2961127735 Bacteria 7196641
847 2961137043 2961136820 Bacteria 6775228
848 2961166858 2961163497 Bacteria 6901077
849 2961176861 2961170736 Bacteria 7072258
850 2961190605 2961183825 Bacteria 6688536
851 2963651045 2963644680 Bacteria 6530403
852 2965021682 2965018300 Bacteria 6883036
853 2965028956 2965025482 Bacteria 6532201
854 2965033869 2965032056 Bacteria 6887443
855 2965044165 2965040258 Bacteria 6855979
856 2965055052 2965047637 Bacteria 6623551
857 2965068115 2965062239 Bacteria 7412989
858 2965090090 2965089291 Bacteria 6866420
859 2965103139 2965102966 Bacteria 6800987
860 2965116898 2965110997 Bacteria 6693150
861 2965121619 2965119406 Bacteria 6956431
862 2968001032 2967996073 Bacteria 6787468
863 2968007085 2968003550 Bacteria 6929263
864 2968021518 2968016561 Bacteria 7022047
865 2968089099 2968083720 Bacteria 7351627
866 2968093039 2968091066 Bacteria 6052692
867 2968102677 2968097103 Bacteria 6107094
868 2968110796 2968110612 Bacteria 6814636
869 2968121477 2968117919 Bacteria 6536078
870 2968131490 2968128360 Bacteria 6270294
871 2968143411 2968138860 Bacteria 6605449
872 2968175264 2968171901 Bacteria 6894245
873 2970476803 2970469710 Bacteria 6969209
874 2970494261 2970489779 Bacteria 6517260
875 2970509533 2970503327 Bacteria 7099517
876 2970515059 2970510686 Bacteria 7006402
877 2970525409 2970524798 Bacteria 6840927
878 2970537567 2970532167 Bacteria 6553173
879 2970543269 2970540015 Bacteria 6977556
880 2970552257 2970547951 Bacteria 6931819
881 2970558302 2970554993 Bacteria 6814252
882 2970594524 2970593180 Bacteria 7073582
883 2970623717 2970619444 Bacteria 6986144
884 2977824237 2977821940 Bacteria 6906439
885 2977834641 2977828996 Bacteria 7007971
886 2977850143 2977843712 Bacteria 6753583
887 2977852385 2977851361 Bacteria 6694324
888 2977860878 2977858184 Bacteria 6215359
889 2977868434 2977864932 Bacteria 7534097
890 2977875268 2977872689 Bacteria 7270173
891 2977904138 2977898635 Bacteria 6675551
892 2977914488 2977907340 Bacteria 6577984
893 2977915920 2977915119 Bacteria 6829656
894 2977927277 2977922695 Bacteria 6956781
895 2977940013 2977935797 Bacteria 6252826
896 2977949614 2977942078 Bacteria 7570577
897 2977952982 2977950692 Bacteria 6893264
898 2977957819 2977957713 Bacteria 6877875
899 2977979144 2977971508 Bacteria 7472917
900 2977991393 2977986579 Bacteria 6581278
901 2979715157 2979710463 Bacteria 6785254
902 2979766287 2979764755 Bacteria 6610066
903 2979774414 2979772303 Bacteria 6618277
904 2979785711 2979779861 Bacteria 6219781
905 2979800512 2979793036 Bacteria 6808957
906 2979814321 2979808191 Bacteria 7179355
907 2987642365 2987636660 Bacteria 8088555
908 2987646702 2987645492 Bacteria 6117018
909 2987662870 2987659509 Bacteria 6966464
910 2987668056 2987666974 Bacteria 6509233
911 2987677399 2987673487 Bacteria 6884027
912 2989772602 2989771324 Bacteria 5605128
913 2996312750 2996310559 Bacteria 6357320
914 2996346388 2996341866 Bacteria 6643098
915 2996356228 2996348954 Bacteria 7239054
916 2996393606 2996386984 Bacteria 6978667
917 2996888308 2996887358 Bacteria 5795980
918 2996893240 2996893221 Bacteria 5823108
919 3000135827 3000135777 Bacteria 6891109
920 3003931732 3003930520 Bacteria 5667563
921 3004172429 3004167301 Bacteria 8330599
922 3004191922 3004188549 Bacteria 6952365
923 3004201026 3004195979 Bacteria 6776956
924 3004210446 3004203850 Bacteria 7307914
925 3004216802 3004211236 Bacteria 7417683
926 3004219835 3004218560 Bacteria 7421728
927 3004235203 3004232784 Bacteria 6662140
928 3004244939 3004239961 Bacteria 6892290
929 3004269625 3004268573 Bacteria 7043476
930 3004282542 3004275668 Bacteria 7114440
931 3004296848 3004289098 Bacteria 6135450
932 3004338177 3004334049 Bacteria 8449246
933 3005410968 3005409236 Bacteria 7188837
934 3005446004 3005445848 Bacteria 6906074
935 3005456677 3005452660 Bacteria 5889319
936 637077743 637000159 Bacteria 7596297
937 643824362 643692032 Bacteria 6891900
938 649875751 649633066 Bacteria 6690028
939 8002288477 8002285264 Bacteria 6717907
940 8004306327 8004300914 Bacteria 6132239
941 8004315954 8004312739 Bacteria 7444653
942 8004364512 8004361976 Bacteria 6858373
943 8004376676 8004374579 Bacteria 6898112
944 8004395030 8004387939 Bacteria 7049250
945 8004400874 8004395343 Bacteria 6620908
946 8004447749 8004445564 Bacteria 6322258
947 8004635646 8004633249 Bacteria 6723080
948 8004647028 8004640170 Bacteria 6723001
949 8004695631 8004695233 Bacteria 6731676
950 8004707368 8004703790 Bacteria 8006957
951 8004721351 8004714634 Bacteria 6776161
952 8004734166 8004727605 Bacteria 6643904
953 8005261135 8005258706 Bacteria 6184835
954 8005278628 8005275841 Bacteria 6929066
955 8005288468 8005282627 Bacteria 6675747
956 8005291294 8005289223 Bacteria 6634003
957 8005301338 8005301065 Bacteria 6614431
958 8005310621 8005307578 Bacteria 7395396
959 8005322835 8005321885 Bacteria 5795980
960 8005377655 8005376324 Bacteria 6590079
961 8005387521 8005382845 Bacteria 6732062
962 8005399924 8005395548 Bacteria 6806915
963 8005432720 8005430974 Bacteria 6689030
964 8005460780 8005460587 Bacteria 7157962
965 8005498450 8005497431 Bacteria 6477605
966 8005543564 8005542996 Bacteria 7077758
967 8005573722 8005570704 Bacteria 6957481
968 8005619643 8005619151 Bacteria 7030230
969 8005628212 8005626139 Bacteria 6534237
970 8005660142 8005658619 Bacteria 4500593
971 8005669859 8005668836 Bacteria 6953162
972 8005685259 8005682033 Bacteria 6726518
973 8005692455 8005688590 Bacteria 6610080
974 8018154452 8018150411 Bacteria 5549903
975 8023684464 8023680758 Bacteria 7729763
976 8024480069 8024479707 Bacteria 6954785
977 8024491559 8024486573 Bacteria 6540512
978 8024502325 8024501048 Bacteria 6427847
979 8046770848 8046767195 Bacteria 7547379
980 8049293298 8049293176 Bacteria 6128433
981 8054562643 8054558443 Bacteria 5204801
982 8055624719 8055617313 Bacteria 7548464
983 8056385565 8056382006 Bacteria 6408074
984 8056878024 8056875544 Bacteria 4355797
985 8057580543 8057575449 Bacteria 7367519
986 8057879676 8057874678 Bacteria 7494653
987 Ga0501032_0006661
988 JGI24740J21852_10000265
989 JGI24739J22299_10017602
990 JGI25155J39150_1000013
991 JGI25156J39149_1000011
992 JGI25162J39368_1003577
993 JGI25162J39368_1003648
994 JGI25154J39366_1000030
995 JGI25158J39367_1000118
996 JGI25157J39369_1000013
997 JGI25157J39369_1000297
998 JGI25152J39213_1002204
999 JGI25152J39213_1010652
1000 JGI25150J39212_1003898
1001 JGI25159J45721_1000003
1002 JGI25159J45721_1000320
1003 JGI25159J45721_1000553
1004 JGI25151J46595_10000425
1005 JGI25165J46597_1000019
1006 JGI25165J46597_1001738
1007 JGI25165J46597_1002247
1008 JGI25153J46596_10008005
1009 JGI25153J46596_10014819
1010 rootH2_10086381
1011 rootH1_10069445
1012 JGI25160J50197_1000003
1013 JGI25160J50197_1000041
1014 JGI25160J50197_1001749
1015 JGI25160J50197_1009671
1016 JGI25161J50226_1000002
1017 JGI25161J50226_1000184
1018 JGI25161J50226_1000315
1019 JGI25161J50226_1003792
1020 Ga0055542_1000656
1021 Ga0055529_1002709
1022 Ga0055526_1000550
1023 Ga0055526_1001211
1024 Ga0055526_1004504
1025 Ga0055526_1028537
1026 Ga0055526_1032069
1027 Ga0055524_1003346
1028 Ga0055524_1006879
1029 Ga0055524_1007140
1030 Ga0055536_1001178
1031 Ga0055536_1010446
1032 Ga0055528_1008152
1033 Ga0055528_1011664
1034 Ga0055528_1023938
1035 Ga0055530_10029855
1036 Ga0055540_1001185
1037 Ga0055540_1002438
1038 Ga0055540_1014437
1039 Ga0055531_10021896
1040 Ga0055543_1000037
1041 Ga0055543_1000203
1042 Ga0055543_1000466
1043 Ga0055543_1001741
1044 Ga0065165_1000031
1045 Ga0065165_1000084
1046 Ga0065165_1008265
1047 Ga0070690_100103448
1048 Ga0070668_100067082
1049 Ga0070668_100076303
1050 Ga0070669_100140168
1051 Ga0070671_100076107
1052 Ga0070674_100043508
1053 Ga0070667_100321717
1054 Ga0070694_100068967
1055 Ga0070663_100030987
1056 Ga0070678_100346334
1057 Ga0070679_100468724
1058 Ga0068853_100124299
1059 Ga0068853_100218555
1060 Ga0068853_100519442
1061 Ga0070695_100069097
1062 Ga0070665_100017909
1063 Ga0068854_100255297
1064 Ga0068856_100035770
1065 Ga0068861_100023672
1066 Ga0068870_10075852
1067 Ga0068860_100216684
1068 Ga0068860_100469015
1069 Ga0081455_10001992
1070 Ga0081540_1006065
1071 Ga0070717_10333257
1072 Ga0075365_10011524
1073 Ga0075365_10056969
1074 Ga0075364_10032827
1075 Ga0075367_10000382
1076 Ga0075367_10038876
1077 Ga0075367_10087861
1078 Ga0075431_100161232
1079 Ga0075434_100551671
1080 Ga0079104_1000033
1081 Ga0105251_10016767
1082 Ga0105247_10035069
1083 Ga0105247_10219314
1084 Ga0105237_10184662
1085 Ga0105238_10007409
1086 Ga0105238_10335425
1087 Ga0105249_10188636
1088 Ga0105249_10201682
1089 Ga0105239_10236250
1090 Ga0105239_10470798
1091 Ga0157371_10134272
1092 Ga0157369_10453215
1093 Ga0171463_1001
1094 Ga0157378_10191657
1095 Ga0163162_10197937
1096 Ga0157375_10399565
1097 Ga0157380_10490922
1098 Ga0182008_10136809
1099 Ga0157376_10048360
1100 Ga0183363_1140
1101 Ga0163161_10004584
1102 Ga0214544_1002289
1103 Ga0214542_1001074
1104 Ga0214543_1000027
1105 Ga0214543_1000897
1106 Ga0209435_100026
1107 Ga0209436_100006
1108 Ga0209436_102572
1109 Ga0209672_102569
1110 Ga0209437_100056
1111 Ga0209437_100196
1112 Ga0207425_1004008
1113 Ga0207425_1004857
1114 Ga0209646_1000084
1115 Ga0209646_1008073
1116 Ga0209026_1000013
1117 Ga0209026_1000080
1118 Ga0209148_1000210
1119 Ga0209759_1000061
1120 Ga0209759_1000884
1121 Ga0209129_1000206
1122 Ga0209129_1001939
1123 Ga0209129_1002038
1124 Ga0209129_1005657
1125 Ga0209129_1005918
1126 Ga0209129_1013196
1127 Ga0209233_1000034
1128 Ga0209233_1000037
1129 Ga0209233_1000071
1130 Ga0209233_1002951
1131 Ga0209455_1000098
1132 Ga0209455_1007024
1133 Ga0209673_1000063
1134 Ga0209673_1002616
1135 Ga0209673_1002642
1136 Ga0209673_1003517
1137 Ga0209130_1000002
1138 Ga0209130_1000005
1139 Ga0209130_1000028
1140 Ga0209676_1003399
1141 Ga0209676_1013859
1142 Ga0209025_1000479
1143 Ga0209025_1001859
1144 Ga0209025_1009455
1145 Ga0209025_1011580
1146 Ga0209025_1054526
1147 Ga0209564_1000093
1148 Ga0209564_1000316
1149 Ga0209564_1001013
1150 Ga0209564_1004973
1151 Ga0209564_1019227
1152 Ga0209758_1000361
1153 Ga0209758_1000441
1154 Ga0209758_1000499
1155 Ga0209758_1001467
1156 Ga0209758_1011078
1157 Ga0209758_1013517
1158 Ga0209758_1035978
1159 Ga0209050_1002860
1160 Ga0209256_1000027
1161 Ga0209256_1000880
1162 Ga0209256_1000996
1163 Ga0209256_1001570
1164 Ga0209256_1012062
1165 Ga0209256_1020034
1166 Ga0207426_1000012
1167 Ga0207426_1000013
1168 Ga0207426_1000015
1169 Ga0207426_1000070
1170 Ga0207426_1013206
1171 Ga0209051_1004813
1172 Ga0209051_1004984
1173 Ga0209051_1009423
1174 Ga0209051_1012648
1175 Ga0209051_1014436
1176 Ga0209051_1017369
1177 Ga0209051_1064052
1178 Ga0209257_1008097
1179 Ga0209257_1011029
1180 Ga0209257_1012026
1181 Ga0207713_1034733
1182 Ga0207647_10016047
1183 Ga0207695_10230515
1184 Ga0207671_10009356
1185 Ga0207671_10111158
1186 Ga0207681_10075906
1187 Ga0207694_10350759
1188 Ga0207650_10466205
1189 Ga0207659_10087207
1190 Ga0207706_10082611
1191 Ga0207669_10003568
1192 Ga0207704_10159443
1193 Ga0207704_10254827
1194 Ga0207667_10288615
1195 Ga0207668_10137274
1196 Ga0207668_10345281
1197 Ga0207658_10283605
1198 Ga0207703_10154447
1199 Ga0207639_10011429
1200 Ga0207678_10030176
1201 Ga0207678_10047528
1202 Ga0207708_10289112
1203 Ga0207675_100112509
1204 Ga0209281_1000043
1205 Ga0207428_10055125
1206 Ga0268266_10042461
1207 Ga0268266_10281037
1208 Ga0268264_10148674
1209 Ga0265318_10013013
1210 Ga0307515_10000029
1211 Ga0265330_10121657
1212 Ga0265340_10033570
1213 Ga0265339_10048410
1214 Ga0265339_10059055
1215 Ga0265316_10014953
1216 Ga0307513_10077823
1217 Ga0265313_10037440
1218 Ga0316575_10055441
1219 Ga0316579_10000691
1220 Ga0316579_10104134
1221 Ga0265314_10008035
1222 Ga0265342_10005385
1223 Ga0316576_10030168
1224 Ga0316578_10077237
1225 Ga0316577_10004501
1226 Ga0307412_10015975
1227 Ga0307416_100113679
1228 Ga0307414_10108571
1229 Ga0316585_10020147
1230 Ga0316580_10000591
1231 Ga0316593_10032241
1232 Ga0373932_0011103
1233 Ga0316574_0010281
1234 Ga0373931_0211494
1235 Ga0316584_0003285
1236 Ga0316584_0133733
1237 Ga0395899_0000014
1238 Ga0395900_0000007
1239 Ga0395900_0077780
1240 Ga0395900_0234212
1241 Ga0395900_0296292
1242 Ga0395898_0000011
1243 Ga0395905_0000008
1244 Ga0395905_0117976
1245 Ga0395901_0000020
1246 Ga0395901_0019029
1247 Ga0400483_092583
1248 Ga0400483_271870
1249 Ga0439436_0003581
1250 Ga0439465_0058412
1251 Ga0439449_0032697
1252 Ga0439449_0095654
1253 Ga0450910_004115
1254 Ga0439440_0006427
1255 Ga0466972_0018944
1256 Ga0466963_0120449
1257 Ga0466968_0049060
1258 Ga0466970_0130788
1259 Ga0466970_0166427
1260 Ga0466957_0124803
1261 Ga0466960_0049247
1262 Ga0466967_0300753
1263 Ga0495650_0038058
1264 Ga0495584_0032541
1265 Ga0495583_0014293
1266 Ga0495606_0016089
1267 Ga0495606_0054400
1268 Ga0495606_0112742
1269 Ga0495608_0102088
1270 Ga0495610_0092901
1271 Ga0495631_0058744
1272 Ga0495632_0056429
1273 Ga0495632_0093396
1274 Ga0495643_0012892
1275 Ga0495643_0045533
1276 Ga0495648_0100372
1277 Ga0495652_0250731
1278 Ga0495654_0001320
1279 Ga0495654_0086587
1280 Ga0495587_0084163
1281 Ga0495633_0043713
1282 Ga0495668_0055056
1283 Ga0495625_0236122
1284 Ga0495670_0152810
1285 Ga0495649_0186431
1286 Ga0495604_0120220
1287 Ga0495686_0023921
1288 Ga0495686_0034123
1289 Ga0495686_0128532
1290 Ga0495686_0228855
1291 Ga0495626_0078187
1292 Ga0496100_0029288
1293 Ga0496102_0013134
1294 Ga0496103_0034601
1295 Ga0496104_0127081
1296 Ga0496105_0053588
1297 Ga0496106_0048515
1298 Ga0496106_0071357
1299 Ga0496106_0606942
1300 Ga0496107_0018512
1301 Ga0496107_0102663
1302 Ga0496107_0119267
1303 Ga0496109_0056052
1304 Ga0496110_0092977
1305 Ga0496110_0231354
1306 Ga0496111_0007743
1307 Ga0496111_0208067
1308 Ga0496113_0188069
1309 Ga0496114_0264368
1310 Ga0496115_0184709
1311 Ga0496116_0114002
1312 Ga0496117_0061719
1313 Ga0496117_0064374
1314 Ga0496117_0088886
1315 Ga0496118_0125828
1316 Ga0496119_0010822
1317 Ga0496119_0029723
1318 Ga0496120_0002411
1319 Ga0496121_0000897
1320 Ga0496121_0009130
1321 Ga0496121_0090466
1322 Ga0496121_0122316
1323 Ga0496121_0176103
1324 Ga0496122_0001480
1325 Ga0496122_0042450
1326 Ga0496122_0091633
1327 Ga0496122_0121105
1328 Ga0496122_0178034
1329 Ga0496123_0000238
1330 Ga0496123_0045841
1331 Ga0496123_0053294
1332 Ga0496123_0060351
1333 Ga0496123_0074481
1334 Ga0496124_0045806
1335 Ga0496124_0091196
1336 Ga0496124_0117498
1337 Ga0496124_0161759
1338 Ga0496124_0190433
1339 Ga0496124_0230812
1340 Ga0496125_0059637
1341 Ga0496125_0104159
1342 Ga0496125_0219797
1343 Ga0496126_0007048
1344 Ga0501032_0097143
1345 Ga0501033_0000230
1346 Ga0501033_0211351
1347 Ga0501034_0004622
1348 Ga0501034_0070434
1349 Ga0501034_0070998
1350 Ga0501034_0075278
1351 Ga0501034_0144598
1352 Ga0501034_0170929
1353 Ga0501034_0175220
1354 Ga0501036_0140606
1355 Ga0501037_0000168
1356 Ga0501038_0115121
1357 Ga0501038_0147589
1358 Ga0501038_0254124
1359 Ga0501039_0043737
1360 Ga0501039_0101405
1361 Ga0501039_0132202
1362 Ga0501040_0062748
1363 Ga0501041_0038368
1364 Ga0501041_0040076
1365 Ga0501042_0039797
1366 Ga0501043_0000005
1367 Ga0501043_0134348
1368 Ga0501043_0320673
1369 Ga0501046_0046525
1370 Ga0501047_0079985
1371 Ga0501047_0086492
1372 Ga0501047_0181292
1373 Ga0501047_0235932
1374 Ga0501047_0420830
1375 Ga0501047_0477004
1376 Ga0501048_0017659
1377 Ga0501048_0070175
1378 Ga0501048_0161329
1379 Ga0501048_0244463
1380 Ga0501048_0277090
1381 Ga0501067_0077644
1382 Ga0501068_0042829
1383 Ga0501068_0215368
1384 Ga0501069_0000011
1385 Ga0501069_0018803
1386 Ga0501070_0000055
1387 Ga0501070_0002216
1388 Ga0501070_0039582
1389 Ga0501070_0155291
1390 Ga0501070_0310881
1391 Ga0501071_0048975
1392 Ga0501071_0353498
1393 Ga0501072_0040508
1394 Ga0501073_0013583
1395 Ga0501073_0014419
1396 Ga0501073_0020706
1397 Ga0501073_0169723
1398 Ga0501074_0000039
1399 Ga0501075_0134219
1400 Ga0501075_0157217
1401 Ga0501077_0057239
1402 Ga0501079_0127909
1403 Ga0501080_0000217
1404 Ga0501080_0019895
1405 Ga0501080_0031716
1406 Ga0501081_0019053
1407 Ga0501081_0050183
1408 Ga0501081_0224180
1409 Ga0501083_0000063
1410 Ga0501083_0175208
1411 Ga0501083_0189321
1412 Ga0501035_0000086
1413 Ga0501035_0002112
1414 Ga0501035_0003189
1415 Ga0501035_0035579
1416 Ga0501035_0187199
1417 Ga0501035_0280496
1418 Ga0501044_0000242
1419 Ga0501044_0021180
1420 Ga0501044_0067968
1421 Ga0501044_0071341
1422 Ga0501044_0088669
1423 Ga0501044_0143247
1424 Ga0501044_0145817
1425 Ga0501044_0184803
1426 Ga0501044_0253372
1427 Ga0501044_0331954
1428 nmdc:mga00v17_47549_c1
1429 nmdc:mga0yw44_1652_c1
1430 nmdc:mga0yw44_28299_c1
1431 nmdc:mga06z11_192206_c1
1432 nmdc:mga06z11_49753_c1
1433 nmdc:mga06z11_50337_c1
1434 nmdc:mga06r32_111936_c1
1435 nmdc:mga0sz30_33645_c1
1436 Ga0495601_0090979
1437 Ga0500610_0042845
1438 Ga0500578_0045718
1439 Ga0500618_006337
1440 Ga0500568_0019857
1441 Ga0500604_0007549
1442 Ga0500616_0001322
1443 Ga0500620_000168
1444 Ga0500622_0001167
1445 Ga0500627_0142835
1446 Ga0501082_0017789
1447 Ga0501082_0087868
1448 Ga0501082_0099129
1449 Ga0501082_0329509
1450 Ga0530510_0093161
1451 Ga0530510_0175422
1452 2503204693
1453 2509109089
1454 2509113535
1455 2509145086
1456 2509370221
1457 2509375179
1458 2509398952
1459 2510131206
1460 2510314292
1461 2511134733
1462 2511184593
1463 2511197740
1464 2512934572
1465 2512962918
1466 2513570410
1467 2513574581
1468 2513597294
1469 2513613544
1470 2513707220
1471 2513865059
1472 2513911196
1473 2513924602
1474 2513996563
1475 2514416940
1476 2515110144
1477 2515643580
1478 2515740783
1479 2516204514
1480 2517038828
1481 2517079083
1482 2520379014
1483 2530648020
1484 2535484080
1485 2535514892
1486 2558866281
1487 2585164717
1488 2585205629
1489 2585223582
1490 2585229643
1491 2585265062
1492 2585273800
1493 2585385878
1494 2585392114
1495 2585398765
1496 2585541997
1497 2585545822
1498 2585559976
1499 2585819113
1500 2585840355
1501 2585844028
1502 2585900651
1503 2585905844
1504 2585994223
1505 2585998741
1506 2587979040
1507 2588514179
1508 2597816537
1509 2599332839
1510 2599419434
1511 2599719052
1512 2599935858
1513 2600191214
1514 2600376511
1515 2616553264
1516 2617380401
1517 2643806101
1518 2643984905
1519 2644004716
1520 2644047413
1521 2644070345
1522 2644103482
1523 2644130008
1524 2644144361
1525 2644155518
1526 2644199831
1527 2644207044
1528 2644237356
1529 2644297813
1530 2644306412
1531 2644330602
1532 2644377362
1533 2644421107
1534 2644454630
1535 2644480202
1536 2644495653
1537 2644542594
1538 2644612023
1539 2644650692
1540 2644656066
1541 2644671788
1542 2644692569
1543 2671113805
1544 2688601322
1545 2692317471
1546 2694630448
1547 2694637767
1548 2719383919
1549 2719663708
1550 2720490127
1551 2720611507
1552 2720618357
1553 2720629763
1554 2720773459
1555 2721397689
1556 2723025129
1557 2723558714
1558 2723565285
1559 2723578487
1560 2724036499
1561 2724088066
1562 2724102550
1563 2724108447
1564 2730106065
1565 2738801415
1566 2739036774
1567 2739309995
1568 2753462632
1569 2756674670
1570 2758640879
1571 2766063523
1572 2776911827
1573 2778179573
1574 2792583095
1575 2792621233
1576 2792625448
1577 2792637882
1578 2792746457
1579 2793282201
1580 2793299827
1581 2793325451
1582 2793330004
1583 2793338285
1584 2793344197
1585 2793352814
1586 2805931699
1587 2805932562
1588 2806048474
1589 2806055947
1590 2806062725
1591 2806066467
1592 2806073530
1593 2819245057
1594 2819686079
1595 2821123473
1596 2837681505
1597 2838022611
1598 2838027691
1599 2838029434
1600 2838040034
1601 2838048646
1602 2838054604
1603 2838064277
1604 2838070901
1605 2838075164
1606 2838666060
1607 2838673337
1608 2838693685
1609 2838706084
1610 2838736361
1611 2838739504
1612 2838749180
1613 2841735723
1614 2841844372
1615 2841858477
1616 2842111975
1617 2842144093
1618 2842150573
1619 2842163313
1620 2842165385
1621 2842186922
1622 2842198028
1623 2842204248
1624 2842207150
1625 2842236500
1626 2842250079
1627 2842255548
1628 2842264108
1629 2842270691
1630 2842278241
1631 2842280157
1632 2842286616
1633 2842310471
1634 2842317659
1635 2842323922
1636 2842403831
1637 2842410467
1638 2842417114
1639 2842424516
1640 2842434575
1641 2842440965
1642 2842447563
1643 2842454301
1644 2842468936
1645 2842475529
1646 2842476136
1647 2842486223
1648 2842492656
1649 2842500245
1650 2842502962
1651 2842521490
1652 2842923128
1653 2844004228
1654 2844009982
1655 2844165066
1656 2844456229
1657 2847417460
1658 2847672852
1659 2847689326
1660 2848992295
1661 2850079798
1662 2855873565
1663 2856314802
1664 2856327974
1665 2856332149
1666 2856335137
1667 2856346689
1668 2856354799
1669 2856360698
1670 2856371133
1671 2857354225
1672 2857370346
1673 2857521907
1674 2857533577
1675 2869164636
1676 2869174869
1677 2869242108
1678 2869248364
1679 2869253918
1680 2869263681
1681 2869270309
1682 2869275905
1683 2869279925
1684 2869292356
1685 2871429171
1686 2871443861
1687 2871445374
1688 2871455305
1689 2871460785
1690 2871470950
1691 2871480293
1692 2871485427
1693 2871490694
1694 2871499269
1695 2874108923
1696 2874114363
1697 2874121849
1698 2874129623
1699 2874145581
1700 2874154077
1701 2874161579
1702 2874162675
1703 2874171647
1704 2876363166
1705 2876385075
1706 2876388495
1707 2876393038
1708 2876404323
1709 2876411951
1710 2876419761
1711 2876427612
1712 2878036117
1713 2878738261
1714 2878740233
1715 2878752699
1716 2878755097
1717 2878763459
1718 2878770457
1719 2878776577
1720 2878784420
1721 2878793666
1722 2881147502
1723 2881158606
1724 2881164278
1725 2881853066
1726 2881854969
1727 2881868863
1728 2882632879
1729 2882917594
1730 2885306142
1731 2885314802
1732 2885320301
1733 2885331221
1734 2885337709
1735 2885346796
1736 2885353849
1737 2888342593
1738 2888350297
1739 2888352159
1740 2889014149
1741 2889021145
1742 2889793363
1743 2889916305
1744 2891049527
1745 2896388581
1746 2899794629
1747 2899805495
1748 2903454760
1749 2903494798
1750 2903499421
1751 2903521517
1752 2903525116
1753 2903532140
1754 2903544074
1755 2904659744
1756 2906315090
1757 2906321346
1758 2906334663
1759 2906366210
1760 2906370953
1761 2906396934
1762 2906407553
1763 2906411519
1764 2906414991
1765 2906433187
1766 2913298165
1767 2915651090
1768 2919101532
1769 2919172212
1770 2919408656
1771 2920763582
1772 2920823194
1773 2922133934
1774 2922154222
1775 2922164387
1776 2922174068
1777 2922179151
1778 2922192974
1779 2923556514
1780 2924715143
1781 2924723440
1782 2924729890
1783 2924735771
1784 2924746526
1785 2924750234
1786 2924758934
1787 2924767584
1788 2924777833
1789 2924791316
1790 2933020805
1791 2933576909
1792 2933587305
1793 2933601702
1794 2935902695
1795 2936369162
1796 2936387213
1797 2937821631
1798 2937825902
1799 2937837152
1800 2937844766
1801 2937853362
1802 2937865386
1803 2937877071
1804 2937884395
1805 2937892359
1806 2937980418
1807 2937981536
1808 2937997919
1809 2938017254
1810 2939672579
1811 2941500907
1812 2958035792
1813 2958044823
1814 2958048038
1815 2958066622
1816 2958076411
1817 2958091706
1818 2958098040
1819 2958101401
1820 2958112132
1821 2958119784
1822 2958125221
1823 2958136756
1824 2958144033
1825 2958145657
1826 2958161629
1827 2958168394
1828 2958179456
1829 2958186639
1830 2961085140
1831 2961115068
1832 2961128277
1833 2961137043
1834 2961166858
1835 2961176861
1836 2961190605
1837 2963651045
1838 2965021682
1839 2965028956
1840 2965033869
1841 2965044165
1842 2965055052
1843 2965068115
1844 2965090090
1845 2965103139
1846 2965116898
1847 2965121619
1848 2968001032
1849 2968007085
1850 2968021518
1851 2968089099
1852 2968093039
1853 2968102677
1854 2968110796
1855 2968121477
1856 2968131490
1857 2968143411
1858 2968175264
1859 2970476803
1860 2970494261
1861 2970509533
1862 2970515059
1863 2970525409
1864 2970537567
1865 2970543269
1866 2970552257
1867 2970558302
1868 2970594524
1869 2970623717
1870 2977824237
1871 2977834641
1872 2977850143
1873 2977852385
1874 2977860878
1875 2977868434
1876 2977875268
1877 2977904138
1878 2977914488
1879 2977915920
1880 2977927277
1881 2977940013
1882 2977949614
1883 2977952982
1884 2977957819
1885 2977979144
1886 2977991393
1887 2979715157
1888 2979766287
1889 2979774414
1890 2979785711
1891 2979800512
1892 2979814321
1893 2987642365
1894 2987646702
1895 2987662870
1896 2987668056
1897 2987677399
1898 2989772602
1899 2996312750
1900 2996346388
1901 2996356228
1902 2996393606
1903 2996888308
1904 2996893240
1905 3000135827
1906 3003931732
1907 3004172429
1908 3004191922
1909 3004201026
1910 3004210446
1911 3004216802
1912 3004219835
1913 3004235203
1914 3004244939
1915 3004269625
1916 3004282542
1917 3004296848
1918 3004338177
1919 3005410968
1920 3005446004
1921 3005456677
1922 637077743
1923 643824362
1924 649875751
1925 8002288477
1926 8004306327
1927 8004315954
1928 8004364512
1929 8004376676
1930 8004395030
1931 8004400874
1932 8004447749
1933 8004635646
1934 8004647028
1935 8004695631
1936 8004707368
1937 8004721351
1938 8004734166
1939 8005261135
1940 8005278628
1941 8005288468
1942 8005291294
1943 8005301338
1944 8005310621
1945 8005322835
1946 8005377655
1947 8005387521
1948 8005399924
1949 8005432720
1950 8005460780
1951 8005498450
1952 8005543564
1953 8005573722
1954 8005619643
1955 8005628212
1956 8005660142
1957 8005669859
1958 8005685259
1959 8005692455
1960 8018154452
1961 8023684464
1962 8024480069
1963 8024491559
1964 8024502325
1965 8046770848
1966 8049293298
1967 8054562643
1968 8055624719
1969 8056385565
1970 8056878024
1971 8057580543
1972 8057879676

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01430

HSP33

Hsp33 protein

47

352

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m7m-assembly1.cif.gz_X crystal structure of monomeric hsp33 0.894 16 280
3m7m-assembly1.cif.gz_X crystal structure of monomeric hsp33 0.8758 16 280
1vq0-assembly1.cif.gz_B crystal structure of 33 kda chaperonin (heat shock protein 33 homolog) (hsp33) (tm1394) from thermotoga maritima at 2.20 a resolution 0.8126 17 327
1vq0-assembly1.cif.gz_B crystal structure of 33 kda chaperonin (heat shock protein 33 homolog) (hsp33) (tm1394) from thermotoga maritima at 2.20 a resolution 0.784 17 327
1vzy-assembly1.cif.gz_A crystal structure of the bacillus subtilis hsp33 0.7604 17 327
ID Description Score Start End Superfamily
1i7fA01 Alpha Beta;3-Layer(bab) Sandwich;Hsp33 domain;Hsp33 domain 0.8993 19 203 3.55.30.10
1i7fA01 Alpha Beta;3-Layer(bab) Sandwich;Hsp33 domain;Hsp33 domain 0.8791 19 203 3.55.30.10
af_P0A6Y5_226_285_3.90.1280.10 Alpha Beta;Alpha-Beta Complex;CBS domain Like;HSP33 redox switch-like 0.8621 276 326 3.90.1280.10
1vq0B02 Alpha Beta;Alpha-Beta Complex;CBS domain Like;HSP33 redox switch-like 0.7967 280 327 3.90.1280.10
1vq0B01 Alpha Beta;3-Layer(bab) Sandwich;Hsp33 domain;Hsp33 domain 0.7911 17 279 3.55.30.10
ID Description Score Start End GO Terms
AF-A0A529SKM0-F1-model_v4 Hsp33 family molecular chaperone 0.9759 34 194 GO:0005737
GO:0042026
GO:0044183
GO:0051082
AF-A0A529I961-F1-model_v4 deleted 0.9604 1 199
AF-F7QIK8-F1-model_v4 Chaperone protein Hsp33 0.9581 16 329 GO:0005737
GO:0042026
GO:0044183
GO:0051082
AF-B9JQS2-F1-model_v4 Chaperonin heat shock protein 33 0.9578 40 329 GO:0005737
GO:0042026
GO:0044183
GO:0051082
AF-A0A847ZUN3-F1-model_v4 Hsp33 family molecular chaperone 0.9567 19 155 GO:0005737
GO:0042026
GO:0044183
GO:0051082

Map