F487534
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 986 | 776 | 1972 | 330 |
Family's Representative Sequence
| Representative Sequence | 3300049569|Ga0501032_0006661|Ga0501032_0006661_3333_4415 |
| Length | 360 |
| Sequence | MFPLKLRAPHLRHASPEFGPDGVRSLNAPESKLAERKLGEFGHAGDDHVVPFEVGALDIRGRSVQLGPILDQILGRHDYPEPVARLLAEAVVLTALLGTALKFDGKFILQTRSDGPVDMLVADFSTPQSMRAYARYDQKAVDEAAKAGDASPEALLGSGVLALTIDQGEHMQRYQGVVPLERTSLEEAARVYFRQSEQIPTDVRLAVAKMMVRGNGGAEERWRAGGLMTQFLPDSAERRRLPDLPGGDGDENGADDGMTDDAWKETLALMSTVEAVELVDPEVGAERLLFRLFHEHGVRVYDGTEVVDDCSCSREKIKAILDGFTAEEIDSSIEGGVIRVNCEFCSTSYEFDPAEFKPKN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 10 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 11 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 12 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 13 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 14 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 18 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 19 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 20 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 31 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 51 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 53 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 54 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 55 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 56 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 57 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 58 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 67 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 72 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 74 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 76 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 77 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 78 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 79 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 83 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 84 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 85 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 87 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 88 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 95 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 121 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 122 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 125 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 126 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 127 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 128 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 129 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 130 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 131 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 132 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 133 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 134 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 135 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 136 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 137 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 138 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 139 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 140 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 141 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 142 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 143 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 144 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 146 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 147 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 148 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 149 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 150 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 151 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 152 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 153 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 154 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 155 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 156 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 157 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 158 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 159 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 160 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 161 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 162 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 163 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 164 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 165 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 166 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 167 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 190 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 191 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 192 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 193 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 194 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 195 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 197 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 198 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 199 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 200 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 201 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 202 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 203 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 204 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 205 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 206 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 207 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 208 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 209 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 210 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 211 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 212 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 242 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 243 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 244 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 246 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 248 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 249 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 250 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 251 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 252 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 253 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 254 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 255 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 256 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 258 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 259 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 260 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 261 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 262 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 263 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 264 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 265 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 266 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 267 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 268 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 269 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 270 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 271 | 2512875024 | |||
| 272 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 273 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 274 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 275 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 276 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 277 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 278 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 279 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 280 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 281 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 282 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 283 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 284 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 285 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 286 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 287 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 288 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 289 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 290 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 291 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 292 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 293 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 294 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 295 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 296 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 297 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 298 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 299 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 300 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 301 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 302 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 303 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 304 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 305 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 306 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 307 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 308 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 309 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 310 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 311 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 312 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 313 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 314 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 315 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 316 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 317 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 318 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 319 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 320 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 321 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 322 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 323 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 324 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 325 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 326 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 327 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 328 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 329 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 330 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 331 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 332 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 333 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 334 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 335 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 336 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 337 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 338 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 339 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 340 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 341 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 342 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 343 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 344 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 345 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 346 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 347 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 348 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 349 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 350 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 351 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 352 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 353 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 354 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 355 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 356 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 357 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 358 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 359 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 360 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 361 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 362 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 363 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 364 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 365 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 366 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 367 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 368 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 369 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 370 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 371 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 372 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 373 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 374 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 375 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 376 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 377 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 378 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 379 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 380 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 381 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 382 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 383 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 384 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 385 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 386 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 387 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 388 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 389 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 390 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 391 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 392 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 393 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 394 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 395 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 396 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 397 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 398 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 399 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 400 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 401 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 402 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 403 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 404 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 405 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 406 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 407 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 408 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 409 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 410 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 411 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 412 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 413 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 414 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 415 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 416 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 417 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 418 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 419 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 420 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 421 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 422 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 423 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 424 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 425 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 426 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 427 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 428 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 429 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 430 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 431 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 432 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 433 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 434 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 435 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 436 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 437 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 438 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 439 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 440 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 441 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 442 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 443 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 444 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 445 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 446 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 447 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 448 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 449 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 450 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 451 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 452 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 453 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 454 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 455 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 456 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 457 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 458 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 459 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 460 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 461 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 462 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 463 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 464 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 465 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 466 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 467 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 468 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 469 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 470 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 471 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 472 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 473 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 474 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 475 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 476 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 477 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 478 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 479 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 480 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 481 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 482 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 483 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 484 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 485 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 486 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 487 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 488 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 489 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 490 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 491 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 492 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 493 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 494 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 495 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 496 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 497 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 498 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 499 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 500 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 501 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 502 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 503 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 504 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 505 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 506 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 507 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 508 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 509 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 510 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 511 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 512 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 513 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 514 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 515 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 516 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 517 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 518 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 519 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 520 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 521 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 522 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 523 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 524 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 525 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 526 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 527 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 528 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 529 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 530 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 531 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 532 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 533 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 534 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 535 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 536 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 537 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 538 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 539 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 540 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 541 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 542 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 543 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 544 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 545 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 546 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 547 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 548 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 549 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 550 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 551 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 552 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 553 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 554 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 555 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 556 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 557 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 558 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 559 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 560 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 561 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 562 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 563 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 564 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 565 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 566 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 567 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 568 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 569 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 570 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 571 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 572 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 573 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 574 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 575 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 576 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 577 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 578 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 579 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 580 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 581 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 582 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 583 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 584 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 585 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 586 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 587 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 588 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 589 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 590 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 591 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 592 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 593 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 594 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 595 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 596 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 597 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 598 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 599 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 600 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 601 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 602 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 603 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 604 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 605 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 606 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 607 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 608 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 609 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 610 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 611 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 612 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 613 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 614 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 615 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 616 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 617 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 618 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 619 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 620 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 621 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 622 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 623 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 624 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 625 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 626 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 627 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 628 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 629 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 630 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 631 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 632 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 633 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 634 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 635 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 636 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 637 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 638 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 639 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 640 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 641 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 642 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 643 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 644 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 645 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 646 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 647 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 648 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 649 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 650 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 651 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 652 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 653 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 654 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 655 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 656 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 657 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 658 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 659 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 660 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 661 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 662 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 663 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 664 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 665 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 666 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 667 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 668 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 669 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 670 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 671 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 672 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 673 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 674 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 675 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 676 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 677 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 678 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 679 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 680 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 681 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 682 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 683 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 684 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 685 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 686 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 687 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 688 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 689 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 690 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 691 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 692 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 693 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 694 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 695 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 696 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 697 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 698 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 699 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 700 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 701 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 702 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 703 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 704 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 705 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 706 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 707 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 708 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 709 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 710 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 711 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 712 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 713 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 714 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 715 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 716 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 717 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 718 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 719 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 720 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 721 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 722 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 723 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 724 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 725 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 726 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 727 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 728 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 729 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 730 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 731 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 732 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 733 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 734 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 735 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 736 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 737 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 738 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 739 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 740 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 741 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 742 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 743 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 744 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 745 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 746 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 747 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 748 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 749 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 750 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 751 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 752 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 753 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 754 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 755 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 756 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 757 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 758 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 759 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 760 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 761 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 762 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 763 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 764 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 765 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 766 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 767 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 768 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 769 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 770 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 771 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 772 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 773 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 774 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 775 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 776 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 47.06 |
| Metatranscriptomes | 0.1 |
| Isolates | 52.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.2 |
| Nodule | 40.16 |
| Rhizoplane | 2.54 |
| Rhizosphere | 29.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501032_0006661 | 3300049569 | Bacteria | 8478 |
| 2 | JGI24740J21852_10000265 | 3300001979 | Bacteria | 21989 |
| 3 | JGI24739J22299_10017602 | 3300001989 | Bacteria | 2576 |
| 4 | JGI25155J39150_1000013 | 3300002704 | Bacteria | 198215 |
| 5 | JGI25156J39149_1000011 | 3300002705 | Bacteria | 198215 |
| 6 | JGI25162J39368_1003577 | 3300002737 | Bacteria | 4348 |
| 7 | JGI25162J39368_1003648 | 3300002737 | Bacteria | 4221 |
| 8 | JGI25154J39366_1000030 | 3300002738 | Bacteria | 191444 |
| 9 | JGI25158J39367_1000118 | 3300002739 | Bacteria | 18246 |
| 10 | JGI25157J39369_1000013 | 3300002741 | Bacteria | 198211 |
| 11 | JGI25157J39369_1000297 | 3300002741 | Bacteria | 36233 |
| 12 | JGI25152J39213_1002204 | 3300002773 | Bacteria | 7575 |
| 13 | JGI25152J39213_1010652 | 3300002773 | Bacteria | 2087 |
| 14 | JGI25150J39212_1003898 | 3300002774 | Bacteria | 3419 |
| 15 | JGI25159J45721_1000003 | 3300002987 | Bacteria | 274069 |
| 16 | JGI25159J45721_1000320 | 3300002987 | Bacteria | 22279 |
| 17 | JGI25159J45721_1000553 | 3300002987 | Bacteria | 16968 |
| 18 | JGI25151J46595_10000425 | 3300003187 | Bacteria | 42264 |
| 19 | JGI25165J46597_1000019 | 3300003214 | Bacteria | 371528 |
| 20 | JGI25165J46597_1001738 | 3300003214 | Bacteria | 9603 |
| 21 | JGI25165J46597_1002247 | 3300003214 | Bacteria | 6708 |
| 22 | JGI25153J46596_10008005 | 3300003215 | Bacteria | 5113 |
| 23 | JGI25153J46596_10014819 | 3300003215 | Bacteria | 3217 |
| 24 | rootH2_10086381 | 3300003320 | Bacteria | 1453 |
| 25 | rootH1_10069445 | 3300003323 | Bacteria | 3424 |
| 26 | JGI25160J50197_1000003 | 3300003354 | Bacteria | 482719 |
| 27 | JGI25160J50197_1000041 | 3300003354 | Bacteria | 152843 |
| 28 | JGI25160J50197_1001749 | 3300003354 | Bacteria | 10525 |
| 29 | JGI25160J50197_1009671 | 3300003354 | Bacteria | 3554 |
| 30 | JGI25161J50226_1000002 | 3300003374 | Bacteria | 420324 |
| 31 | JGI25161J50226_1000184 | 3300003374 | Bacteria | 41591 |
| 32 | JGI25161J50226_1000315 | 3300003374 | Bacteria | 26611 |
| 33 | JGI25161J50226_1003792 | 3300003374 | Bacteria | 3345 |
| 34 | Ga0055542_1000656 | 3300003762 | Bacteria | 28388 |
| 35 | Ga0055529_1002709 | 3300003763 | Bacteria | 3256 |
| 36 | Ga0055526_1000550 | 3300003771 | Bacteria | 29646 |
| 37 | Ga0055526_1001211 | 3300003771 | Bacteria | 18589 |
| 38 | Ga0055526_1004504 | 3300003771 | Bacteria | 8343 |
| 39 | Ga0055526_1028537 | 3300003771 | Bacteria | 1685 |
| 40 | Ga0055526_1032069 | 3300003771 | Bacteria | 1491 |
| 41 | Ga0055524_1003346 | 3300003775 | Bacteria | 7816 |
| 42 | Ga0055524_1006879 | 3300003775 | Bacteria | 4900 |
| 43 | Ga0055524_1007140 | 3300003775 | Bacteria | 4783 |
| 44 | Ga0055536_1001178 | 3300003781 | Bacteria | 16273 |
| 45 | Ga0055536_1010446 | 3300003781 | Bacteria | 3682 |
| 46 | Ga0055528_1008152 | 3300003790 | Bacteria | 4533 |
| 47 | Ga0055528_1011664 | 3300003790 | Bacteria | 3469 |
| 48 | Ga0055528_1023938 | 3300003790 | Bacteria | 1846 |
| 49 | Ga0055530_10029855 | 3300003791 | Bacteria | 1452 |
| 50 | Ga0055540_1001185 | 3300003792 | Bacteria | 16079 |
| 51 | Ga0055540_1002438 | 3300003792 | Bacteria | 9806 |
| 52 | Ga0055540_1014437 | 3300003792 | Bacteria | 2350 |
| 53 | Ga0055531_10021896 | 3300003794 | Bacteria | 2458 |
| 54 | Ga0055543_1000037 | 3300004625 | Bacteria | 125386 |
| 55 | Ga0055543_1000203 | 3300004625 | Bacteria | 48554 |
| 56 | Ga0055543_1000466 | 3300004625 | Bacteria | 23733 |
| 57 | Ga0055543_1001741 | 3300004625 | Bacteria | 8153 |
| 58 | Ga0065165_1000031 | 3300005262 | Bacteria | 216330 |
| 59 | Ga0065165_1000084 | 3300005262 | Bacteria | 154822 |
| 60 | Ga0065165_1008265 | 3300005262 | Bacteria | 4913 |
| 61 | Ga0070690_100103448 | 3300005330 | Bacteria | 1891 |
| 62 | Ga0070668_100067082 | 3300005347 | Bacteria | 2786 |
| 63 | Ga0070668_100076303 | 3300005347 | Bacteria | 2618 |
| 64 | Ga0070669_100140168 | 3300005353 | Bacteria | 1864 |
| 65 | Ga0070671_100076107 | 3300005355 | Bacteria | 2804 |
| 66 | Ga0070674_100043508 | 3300005356 | Bacteria | 3056 |
| 67 | Ga0070667_100321717 | 3300005367 | Bacteria | 1396 |
| 68 | Ga0070694_100068967 | 3300005444 | Bacteria | 2431 |
| 69 | Ga0070663_100030987 | 3300005455 | Bacteria | 3670 |
| 70 | Ga0070678_100346334 | 3300005456 | Bacteria | 1276 |
| 71 | Ga0070679_100468724 | 3300005530 | Bacteria | 1204 |
| 72 | Ga0068853_100124299 | 3300005539 | Bacteria | 2304 |
| 73 | Ga0068853_100218555 | 3300005539 | Bacteria | 1739 |
| 74 | Ga0068853_100519442 | 3300005539 | Bacteria | 1126 |
| 75 | Ga0070695_100069097 | 3300005545 | Bacteria | 2308 |
| 76 | Ga0070665_100017909 | 3300005548 | Bacteria | 7114 |
| 77 | Ga0068854_100255297 | 3300005578 | Bacteria | 1401 |
| 78 | Ga0068856_100035770 | 3300005614 | Bacteria | 4868 |
| 79 | Ga0068861_100023672 | 3300005719 | Bacteria | 4432 |
| 80 | Ga0068870_10075852 | 3300005840 | Bacteria | 1845 |
| 81 | Ga0068860_100216684 | 3300005843 | Bacteria | 1858 |
| 82 | Ga0068860_100469015 | 3300005843 | Bacteria | 1254 |
| 83 | Ga0081455_10001992 | 3300005937 | Bacteria | 24396 |
| 84 | Ga0081540_1006065 | 3300005983 | Bacteria | 8886 |
| 85 | Ga0070717_10333257 | 3300006028 | Bacteria | 1354 |
| 86 | Ga0075365_10011524 | 3300006038 | Bacteria | 5201 |
| 87 | Ga0075365_10056969 | 3300006038 | Bacteria | 2599 |
| 88 | Ga0075364_10032827 | 3300006051 | Bacteria | 3338 |
| 89 | Ga0075367_10000382 | 3300006178 | Bacteria | 16047 |
| 90 | Ga0075367_10038876 | 3300006178 | Bacteria | 2772 |
| 91 | Ga0075367_10087861 | 3300006178 | Bacteria | 1888 |
| 92 | Ga0075431_100161232 | 3300006847 | Bacteria | 2306 |
| 93 | Ga0075434_100551671 | 3300006871 | Bacteria | 1172 |
| 94 | Ga0079104_1000033 | 3300006946 | Bacteria | 202636 |
| 95 | Ga0105251_10016767 | 3300009011 | Bacteria | 3945 |
| 96 | Ga0105247_10035069 | 3300009101 | Bacteria | 3057 |
| 97 | Ga0105247_10219314 | 3300009101 | Bacteria | 1287 |
| 98 | Ga0105237_10184662 | 3300009545 | Bacteria | 2085 |
| 99 | Ga0105238_10007409 | 3300009551 | Bacteria | 10991 |
| 100 | Ga0105238_10335425 | 3300009551 | Bacteria | 1500 |
| 101 | Ga0105249_10188636 | 3300009553 | Bacteria | 2011 |
| 102 | Ga0105249_10201682 | 3300009553 | Bacteria | 1947 |
| 103 | Ga0105239_10236250 | 3300010375 | Bacteria | 2051 |
| 104 | Ga0105239_10470798 | 3300010375 | Bacteria | 1427 |
| 105 | Ga0157371_10134272 | 3300013102 | Unclassified | 1762 |
| 106 | Ga0157369_10453215 | 3300013105 | Bacteria | 1328 |
| 107 | Ga0171463_1001 | 3300013249 | Bacteria | 1406070 |
| 108 | Ga0157378_10191657 | 3300013297 | Bacteria | 1928 |
| 109 | Ga0163162_10197937 | 3300013306 | Bacteria | 2138 |
| 110 | Ga0157375_10399565 | 3300013308 | Bacteria | 1541 |
| 111 | Ga0157380_10490922 | 3300014326 | Bacteria | 1190 |
| 112 | Ga0182008_10136809 | 3300014497 | Bacteria | 1224 |
| 113 | Ga0157376_10048360 | 3300014969 | Bacteria | 3516 |
| 114 | Ga0183363_1140 | 3300015690 | Bacteria | 18543 |
| 115 | Ga0163161_10004584 | 3300017792 | Bacteria | 9620 |
| 116 | Ga0214544_1002289 | 3300021320 | Bacteria | 40409 |
| 117 | Ga0214542_1001074 | 3300021321 | Bacteria | 54628 |
| 118 | Ga0214543_1000027 | 3300021327 | Bacteria | 215065 |
| 119 | Ga0214543_1000897 | 3300021327 | Bacteria | 54534 |
| 120 | Ga0209435_100026 | 3300025206 | Bacteria | 198295 |
| 121 | Ga0209436_100006 | 3300025208 | Bacteria | 150277 |
| 122 | Ga0209436_102572 | 3300025208 | Bacteria | 5344 |
| 123 | Ga0209672_102569 | 3300025228 | Bacteria | 4339 |
| 124 | Ga0209437_100056 | 3300025233 | Bacteria | 363071 |
| 125 | Ga0209437_100196 | 3300025233 | Bacteria | 121199 |
| 126 | Ga0207425_1004008 | 3300025245 | Bacteria | 4530 |
| 127 | Ga0207425_1004857 | 3300025245 | Bacteria | 3942 |
| 128 | Ga0209646_1000084 | 3300025246 | Bacteria | 198295 |
| 129 | Ga0209646_1008073 | 3300025246 | Bacteria | 1703 |
| 130 | Ga0209026_1000013 | 3300025250 | Bacteria | 415633 |
| 131 | Ga0209026_1000080 | 3300025250 | Bacteria | 198295 |
| 132 | Ga0209148_1000210 | 3300025254 | Bacteria | 102885 |
| 133 | Ga0209759_1000061 | 3300025256 | Bacteria | 198295 |
| 134 | Ga0209759_1000884 | 3300025256 | Bacteria | 22738 |
| 135 | Ga0209129_1000206 | 3300025258 | Bacteria | 68903 |
| 136 | Ga0209129_1001939 | 3300025258 | Bacteria | 10837 |
| 137 | Ga0209129_1002038 | 3300025258 | Bacteria | 10450 |
| 138 | Ga0209129_1005657 | 3300025258 | Bacteria | 4327 |
| 139 | Ga0209129_1005918 | 3300025258 | Bacteria | 4135 |
| 140 | Ga0209129_1013196 | 3300025258 | Bacteria | 1836 |
| 141 | Ga0209233_1000034 | 3300025261 | Bacteria | 578898 |
| 142 | Ga0209233_1000037 | 3300025261 | Bacteria | 554620 |
| 143 | Ga0209233_1000071 | 3300025261 | Bacteria | 363290 |
| 144 | Ga0209233_1002951 | 3300025261 | Bacteria | 6069 |
| 145 | Ga0209455_1000098 | 3300025272 | Bacteria | 213890 |
| 146 | Ga0209455_1007024 | 3300025272 | Bacteria | 3239 |
| 147 | Ga0209673_1000063 | 3300025273 | Bacteria | 256709 |
| 148 | Ga0209673_1002616 | 3300025273 | Bacteria | 12098 |
| 149 | Ga0209673_1002642 | 3300025273 | Bacteria | 12012 |
| 150 | Ga0209673_1003517 | 3300025273 | Bacteria | 9178 |
| 151 | Ga0209130_1000002 | 3300025284 | Bacteria | 722648 |
| 152 | Ga0209130_1000005 | 3300025284 | Bacteria | 599620 |
| 153 | Ga0209130_1000028 | 3300025284 | Bacteria | 325668 |
| 154 | Ga0209676_1003399 | 3300025292 | Bacteria | 9856 |
| 155 | Ga0209676_1013859 | 3300025292 | Bacteria | 3071 |
| 156 | Ga0209025_1000479 | 3300025294 | Bacteria | 77489 |
| 157 | Ga0209025_1001859 | 3300025294 | Bacteria | 24728 |
| 158 | Ga0209025_1009455 | 3300025294 | Bacteria | 6786 |
| 159 | Ga0209025_1011580 | 3300025294 | Bacteria | 5788 |
| 160 | Ga0209025_1054526 | 3300025294 | Bacteria | 1555 |
| 161 | Ga0209564_1000093 | 3300025295 | Bacteria | 245793 |
| 162 | Ga0209564_1000316 | 3300025295 | Bacteria | 94849 |
| 163 | Ga0209564_1001013 | 3300025295 | Bacteria | 34890 |
| 164 | Ga0209564_1004973 | 3300025295 | Bacteria | 7832 |
| 165 | Ga0209564_1019227 | 3300025295 | Bacteria | 2563 |
| 166 | Ga0209758_1000361 | 3300025297 | Bacteria | 81006 |
| 167 | Ga0209758_1000441 | 3300025297 | Bacteria | 69800 |
| 168 | Ga0209758_1000499 | 3300025297 | Bacteria | 63732 |
| 169 | Ga0209758_1001467 | 3300025297 | Bacteria | 27671 |
| 170 | Ga0209758_1011078 | 3300025297 | Bacteria | 5276 |
| 171 | Ga0209758_1013517 | 3300025297 | Bacteria | 4442 |
| 172 | Ga0209758_1035978 | 3300025297 | Bacteria | 1941 |
| 173 | Ga0209050_1002860 | 3300025298 | Bacteria | 13672 |
| 174 | Ga0209256_1000027 | 3300025299 | Bacteria | 423283 |
| 175 | Ga0209256_1000880 | 3300025299 | Bacteria | 37115 |
| 176 | Ga0209256_1000996 | 3300025299 | Bacteria | 33661 |
| 177 | Ga0209256_1001570 | 3300025299 | Bacteria | 22473 |
| 178 | Ga0209256_1012062 | 3300025299 | Bacteria | 3367 |
| 179 | Ga0209256_1020034 | 3300025299 | Bacteria | 2104 |
| 180 | Ga0207426_1000012 | 3300025302 | Bacteria | 730942 |
| 181 | Ga0207426_1000013 | 3300025302 | Bacteria | 721897 |
| 182 | Ga0207426_1000015 | 3300025302 | Bacteria | 599316 |
| 183 | Ga0207426_1000070 | 3300025302 | Bacteria | 331559 |
| 184 | Ga0207426_1013206 | 3300025302 | Bacteria | 3068 |
| 185 | Ga0209051_1004813 | 3300025303 | Bacteria | 8141 |
| 186 | Ga0209051_1004984 | 3300025303 | Bacteria | 7929 |
| 187 | Ga0209051_1009423 | 3300025303 | Bacteria | 5036 |
| 188 | Ga0209051_1012648 | 3300025303 | Bacteria | 4069 |
| 189 | Ga0209051_1014436 | 3300025303 | Bacteria | 3686 |
| 190 | Ga0209051_1017369 | 3300025303 | Bacteria | 3216 |
| 191 | Ga0209051_1064052 | 3300025303 | Bacteria | 1141 |
| 192 | Ga0209257_1008097 | 3300025304 | Bacteria | 6113 |
| 193 | Ga0209257_1011029 | 3300025304 | Bacteria | 4433 |
| 194 | Ga0209257_1012026 | 3300025304 | Bacteria | 4069 |
| 195 | Ga0207713_1034733 | 3300025735 | Bacteria | 2186 |
| 196 | Ga0207647_10016047 | 3300025904 | Bacteria | 5118 |
| 197 | Ga0207695_10230515 | 3300025913 | Bacteria | 1757 |
| 198 | Ga0207671_10009356 | 3300025914 | Bacteria | 8195 |
| 199 | Ga0207671_10111158 | 3300025914 | Bacteria | 2085 |
| 200 | Ga0207681_10075906 | 3300025923 | Bacteria | 2359 |
| 201 | Ga0207694_10350759 | 3300025924 | Bacteria | 1221 |
| 202 | Ga0207650_10466205 | 3300025925 | Bacteria | 1053 |
| 203 | Ga0207659_10087207 | 3300025926 | Bacteria | 2323 |
| 204 | Ga0207706_10082611 | 3300025933 | Bacteria | 2824 |
| 205 | Ga0207669_10003568 | 3300025937 | Bacteria | 6744 |
| 206 | Ga0207704_10159443 | 3300025938 | Bacteria | 1603 |
| 207 | Ga0207704_10254827 | 3300025938 | Bacteria | 1320 |
| 208 | Ga0207667_10288615 | 3300025949 | Bacteria | 1676 |
| 209 | Ga0207668_10137274 | 3300025972 | Bacteria | 1875 |
| 210 | Ga0207668_10345281 | 3300025972 | Bacteria | 1243 |
| 211 | Ga0207658_10283605 | 3300025986 | Bacteria | 1421 |
| 212 | Ga0207703_10154447 | 3300026035 | Bacteria | 2004 |
| 213 | Ga0207639_10011429 | 3300026041 | Bacteria | 6166 |
| 214 | Ga0207678_10030176 | 3300026067 | Bacteria | 4733 |
| 215 | Ga0207678_10047528 | 3300026067 | Bacteria | 3711 |
| 216 | Ga0207708_10289112 | 3300026075 | Bacteria | 1330 |
| 217 | Ga0207675_100112509 | 3300026118 | Bacteria | 2569 |
| 218 | Ga0209281_1000043 | 3300027111 | Bacteria | 341543 |
| 219 | Ga0207428_10055125 | 3300027907 | Bacteria | 3162 |
| 220 | Ga0268266_10042461 | 3300028379 | Bacteria | 3884 |
| 221 | Ga0268266_10281037 | 3300028379 | Bacteria | 1548 |
| 222 | Ga0268264_10148674 | 3300028381 | Bacteria | 2098 |
| 223 | Ga0265318_10013013 | 3300028577 | Bacteria | 3526 |
| 224 | Ga0307515_10000029 | 3300028794 | Bacteria | 365410 |
| 225 | Ga0265330_10121657 | 3300031235 | Bacteria | 1112 |
| 226 | Ga0265340_10033570 | 3300031247 | Bacteria | 2554 |
| 227 | Ga0265339_10048410 | 3300031249 | Bacteria | 2331 |
| 228 | Ga0265339_10059055 | 3300031249 | Bacteria | 2069 |
| 229 | Ga0265316_10014953 | 3300031344 | Bacteria | 6806 |
| 230 | Ga0307513_10077823 | 3300031456 | Bacteria | 3433 |
| 231 | Ga0265313_10037440 | 3300031595 | Bacteria | 2426 |
| 232 | Ga0316575_10055441 | 3300031665 | Bacteria | 1578 |
| 233 | Ga0316579_10000691 | 3300031691 | Bacteria | 11484 |
| 234 | Ga0316579_10104134 | 3300031691 | Bacteria | 1360 |
| 235 | Ga0265314_10008035 | 3300031711 | Bacteria | 9094 |
| 236 | Ga0265342_10005385 | 3300031712 | Bacteria | 9775 |
| 237 | Ga0316576_10030168 | 3300031727 | Bacteria | 3837 |
| 238 | Ga0316578_10077237 | 3300031728 | Bacteria | 1977 |
| 239 | Ga0316577_10004501 | 3300031733 | Bacteria | 7200 |
| 240 | Ga0307412_10015975 | 3300031911 | Bacteria | 4460 |
| 241 | Ga0307416_100113679 | 3300032002 | Bacteria | 2393 |
| 242 | Ga0307414_10108571 | 3300032004 | Bacteria | 2106 |
| 243 | Ga0316585_10020147 | 3300032137 | Bacteria | 2039 |
| 244 | Ga0316580_10000591 | 3300032139 | Bacteria | 8527 |
| 245 | Ga0316593_10032241 | 3300032168 | Bacteria | 1711 |
| 246 | Ga0373932_0011103 | 3300035112 | Bacteria | 2194 |
| 247 | Ga0316574_0010281 | 3300035398 | Bacteria | 5280 |
| 248 | Ga0373931_0211494 | 3300035691 | Bacteria | 1163 |
| 249 | Ga0316584_0003285 | 3300036712 | Bacteria | 10461 |
| 250 | Ga0316584_0133733 | 3300036712 | Bacteria | 1852 |
| 251 | Ga0395899_0000014 | 3300037312 | Bacteria | 488813 |
| 252 | Ga0395900_0000007 | 3300037418 | Bacteria | 488860 |
| 253 | Ga0395900_0077780 | 3300037418 | Bacteria | 3409 |
| 254 | Ga0395900_0234212 | 3300037418 | Bacteria | 1845 |
| 255 | Ga0395900_0296292 | 3300037418 | Bacteria | 1605 |
| 256 | Ga0395898_0000011 | 3300037466 | Bacteria | 488860 |
| 257 | Ga0395905_0000008 | 3300037471 | Bacteria | 488860 |
| 258 | Ga0395905_0117976 | 3300037471 | Bacteria | 2494 |
| 259 | Ga0395901_0000020 | 3300038443 | Bacteria | 314918 |
| 260 | Ga0395901_0019029 | 3300038443 | Bacteria | 7021 |
| 261 | Ga0400483_092583 | 3300039062 | Bacteria | 3821 |
| 262 | Ga0400483_271870 | 3300039062 | Bacteria | 11015 |
| 263 | Ga0439436_0003581 | 3300041404 | Bacteria | 4723 |
| 264 | Ga0439465_0058412 | 3300041413 | Bacteria | 1274 |
| 265 | Ga0439449_0032697 | 3300042007 | Bacteria | 1939 |
| 266 | Ga0439449_0095654 | 3300042007 | Bacteria | 1097 |
| 267 | Ga0450910_004115 | 3300042147 | Bacteria | 1957 |
| 268 | Ga0439440_0006427 | 3300042993 | Bacteria | 2364 |
| 269 | Ga0466972_0018944 | 3300044658 | Bacteria | 3439 |
| 270 | Ga0466963_0120449 | 3300044694 | Bacteria | 1805 |
| 271 | Ga0466968_0049060 | 3300044735 | Bacteria | 1798 |
| 272 | Ga0466970_0130788 | 3300044765 | Bacteria | 1378 |
| 273 | Ga0466970_0166427 | 3300044765 | Bacteria | 1221 |
| 274 | Ga0466957_0124803 | 3300044842 | Bacteria | 1644 |
| 275 | Ga0466960_0049247 | 3300044901 | Bacteria | 2028 |
| 276 | Ga0466967_0300753 | 3300045976 | Bacteria | 1544 |
| 277 | Ga0495650_0038058 | 3300046471 | Bacteria | 2087 |
| 278 | Ga0495584_0032541 | 3300046491 | Bacteria | 2639 |
| 279 | Ga0495583_0014293 | 3300046506 | Bacteria | 4386 |
| 280 | Ga0495606_0016089 | 3300046507 | Bacteria | 5725 |
| 281 | Ga0495606_0054400 | 3300046507 | Bacteria | 2592 |
| 282 | Ga0495606_0112742 | 3300046507 | Bacteria | 1638 |
| 283 | Ga0495608_0102088 | 3300046511 | Bacteria | 1849 |
| 284 | Ga0495610_0092901 | 3300046512 | Bacteria | 1364 |
| 285 | Ga0495631_0058744 | 3300046518 | Bacteria | 1672 |
| 286 | Ga0495632_0056429 | 3300046519 | Bacteria | 1920 |
| 287 | Ga0495632_0093396 | 3300046519 | Bacteria | 1424 |
| 288 | Ga0495643_0012892 | 3300046522 | Bacteria | 5027 |
| 289 | Ga0495643_0045533 | 3300046522 | Bacteria | 2381 |
| 290 | Ga0495648_0100372 | 3300046524 | Bacteria | 1599 |
| 291 | Ga0495652_0250731 | 3300046529 | Bacteria | 1312 |
| 292 | Ga0495654_0001320 | 3300046530 | Bacteria | 17329 |
| 293 | Ga0495654_0086587 | 3300046530 | Bacteria | 1460 |
| 294 | Ga0495587_0084163 | 3300046536 | Bacteria | 1842 |
| 295 | Ga0495633_0043713 | 3300046558 | Bacteria | 2125 |
| 296 | Ga0495668_0055056 | 3300046616 | Bacteria | 2197 |
| 297 | Ga0495625_0236122 | 3300046660 | Bacteria | 1192 |
| 298 | Ga0495670_0152810 | 3300046691 | Bacteria | 1211 |
| 299 | Ga0495649_0186431 | 3300046694 | Bacteria | 1081 |
| 300 | Ga0495604_0120220 | 3300047317 | Bacteria | 1903 |
| 301 | Ga0495686_0023921 | 3300047472 | Bacteria | 4018 |
| 302 | Ga0495686_0034123 | 3300047472 | Bacteria | 3279 |
| 303 | Ga0495686_0128532 | 3300047472 | Bacteria | 1504 |
| 304 | Ga0495686_0228855 | 3300047472 | Bacteria | 1054 |
| 305 | Ga0495626_0078187 | 3300048091 | Bacteria | 1474 |
| 306 | Ga0496100_0029288 | 3300048903 | Bacteria | 3404 |
| 307 | Ga0496102_0013134 | 3300048905 | Bacteria | 7165 |
| 308 | Ga0496103_0034601 | 3300048906 | Bacteria | 3090 |
| 309 | Ga0496104_0127081 | 3300048907 | Bacteria | 2448 |
| 310 | Ga0496105_0053588 | 3300048908 | Bacteria | 3331 |
| 311 | Ga0496106_0048515 | 3300048909 | Bacteria | 3197 |
| 312 | Ga0496106_0071357 | 3300048909 | Bacteria | 2654 |
| 313 | Ga0496106_0606942 | 3300048909 | Bacteria | 876 |
| 314 | Ga0496107_0018512 | 3300048910 | Bacteria | 4905 |
| 315 | Ga0496107_0102663 | 3300048910 | Bacteria | 2097 |
| 316 | Ga0496107_0119267 | 3300048910 | Bacteria | 1943 |
| 317 | Ga0496109_0056052 | 3300048912 | Bacteria | 3596 |
| 318 | Ga0496110_0092977 | 3300048913 | Bacteria | 2699 |
| 319 | Ga0496110_0231354 | 3300048913 | Bacteria | 1681 |
| 320 | Ga0496111_0007743 | 3300048914 | Bacteria | 7067 |
| 321 | Ga0496111_0208067 | 3300048914 | Bacteria | 1454 |
| 322 | Ga0496113_0188069 | 3300048916 | Bacteria | 1639 |
| 323 | Ga0496114_0264368 | 3300048917 | Bacteria | 1515 |
| 324 | Ga0496115_0184709 | 3300048918 | Bacteria | 1723 |
| 325 | Ga0496116_0114002 | 3300048919 | Bacteria | 1580 |
| 326 | Ga0496117_0061719 | 3300048920 | Bacteria | 2574 |
| 327 | Ga0496117_0064374 | 3300048920 | Bacteria | 2500 |
| 328 | Ga0496117_0088886 | 3300048920 | Bacteria | 1997 |
| 329 | Ga0496118_0125828 | 3300048921 | Bacteria | 1659 |
| 330 | Ga0496119_0010822 | 3300048922 | Bacteria | 7634 |
| 331 | Ga0496119_0029723 | 3300048922 | Bacteria | 3696 |
| 332 | Ga0496120_0002411 | 3300048923 | Bacteria | 18988 |
| 333 | Ga0496121_0000897 | 3300048924 | Bacteria | 53790 |
| 334 | Ga0496121_0009130 | 3300048924 | Bacteria | 11472 |
| 335 | Ga0496121_0090466 | 3300048924 | Bacteria | 2392 |
| 336 | Ga0496121_0122316 | 3300048924 | Bacteria | 1963 |
| 337 | Ga0496121_0176103 | 3300048924 | Bacteria | 1548 |
| 338 | Ga0496122_0001480 | 3300048925 | Bacteria | 37788 |
| 339 | Ga0496122_0042450 | 3300048925 | Bacteria | 3578 |
| 340 | Ga0496122_0091633 | 3300048925 | Bacteria | 2069 |
| 341 | Ga0496122_0121105 | 3300048925 | Bacteria | 1687 |
| 342 | Ga0496122_0178034 | 3300048925 | Bacteria | 1272 |
| 343 | Ga0496123_0000238 | 3300048926 | Bacteria | 111297 |
| 344 | Ga0496123_0045841 | 3300048926 | Bacteria | 2973 |
| 345 | Ga0496123_0053294 | 3300048926 | Bacteria | 2674 |
| 346 | Ga0496123_0060351 | 3300048926 | Bacteria | 2446 |
| 347 | Ga0496123_0074481 | 3300048926 | Bacteria | 2101 |
| 348 | Ga0496124_0045806 | 3300048927 | Bacteria | 3749 |
| 349 | Ga0496124_0091196 | 3300048927 | Bacteria | 2484 |
| 350 | Ga0496124_0117498 | 3300048927 | Bacteria | 2130 |
| 351 | Ga0496124_0161759 | 3300048927 | Bacteria | 1744 |
| 352 | Ga0496124_0190433 | 3300048927 | Bacteria | 1570 |
| 353 | Ga0496124_0230812 | 3300048927 | Bacteria | 1384 |
| 354 | Ga0496125_0059637 | 3300048928 | Bacteria | 3073 |
| 355 | Ga0496125_0104159 | 3300048928 | Bacteria | 2079 |
| 356 | Ga0496125_0219797 | 3300048928 | Bacteria | 1225 |
| 357 | Ga0496126_0007048 | 3300048929 | Bacteria | 12397 |
| 358 | Ga0501032_0097143 | 3300049569 | Bacteria | 1952 |
| 359 | Ga0501033_0000230 | 3300049570 | Bacteria | 53911 |
| 360 | Ga0501033_0211351 | 3300049570 | Bacteria | 1383 |
| 361 | Ga0501034_0004622 | 3300049571 | Bacteria | 15254 |
| 362 | Ga0501034_0070434 | 3300049571 | Bacteria | 3508 |
| 363 | Ga0501034_0070998 | 3300049571 | Bacteria | 3493 |
| 364 | Ga0501034_0075278 | 3300049571 | Bacteria | 3383 |
| 365 | Ga0501034_0144598 | 3300049571 | Bacteria | 2356 |
| 366 | Ga0501034_0170929 | 3300049571 | Bacteria | 2140 |
| 367 | Ga0501034_0175220 | 3300049571 | Bacteria | 2111 |
| 368 | Ga0501036_0140606 | 3300049572 | Bacteria | 2037 |
| 369 | Ga0501037_0000168 | 3300049573 | Bacteria | 61484 |
| 370 | Ga0501038_0115121 | 3300049574 | Bacteria | 2223 |
| 371 | Ga0501038_0147589 | 3300049574 | Bacteria | 1919 |
| 372 | Ga0501038_0254124 | 3300049574 | Bacteria | 1391 |
| 373 | Ga0501039_0043737 | 3300049575 | Bacteria | 3459 |
| 374 | Ga0501039_0101405 | 3300049575 | Bacteria | 2247 |
| 375 | Ga0501039_0132202 | 3300049575 | Bacteria | 1958 |
| 376 | Ga0501040_0062748 | 3300049576 | Bacteria | 2556 |
| 377 | Ga0501041_0038368 | 3300049577 | Bacteria | 2905 |
| 378 | Ga0501041_0040076 | 3300049577 | Bacteria | 2843 |
| 379 | Ga0501042_0039797 | 3300049578 | Bacteria | 3342 |
| 380 | Ga0501043_0000005 | 3300049579 | Bacteria | 254466 |
| 381 | Ga0501043_0134348 | 3300049579 | Bacteria | 1938 |
| 382 | Ga0501043_0320673 | 3300049579 | Bacteria | 1181 |
| 383 | Ga0501046_0046525 | 3300049580 | Bacteria | 3443 |
| 384 | Ga0501047_0079985 | 3300049581 | Bacteria | 3142 |
| 385 | Ga0501047_0086492 | 3300049581 | Bacteria | 3012 |
| 386 | Ga0501047_0181292 | 3300049581 | Bacteria | 1972 |
| 387 | Ga0501047_0235932 | 3300049581 | Bacteria | 1681 |
| 388 | Ga0501047_0420830 | 3300049581 | Bacteria | 1167 |
| 389 | Ga0501047_0477004 | 3300049581 | Bacteria | 1075 |
| 390 | Ga0501048_0017659 | 3300049582 | Bacteria | 5251 |
| 391 | Ga0501048_0070175 | 3300049582 | Bacteria | 2475 |
| 392 | Ga0501048_0161329 | 3300049582 | Bacteria | 1587 |
| 393 | Ga0501048_0244463 | 3300049582 | Unclassified | 1273 |
| 394 | Ga0501048_0277090 | 3300049582 | Bacteria | 1192 |
| 395 | Ga0501067_0077644 | 3300049583 | Bacteria | 1840 |
| 396 | Ga0501068_0042829 | 3300049584 | Bacteria | 2722 |
| 397 | Ga0501068_0215368 | 3300049584 | Bacteria | 1220 |
| 398 | Ga0501069_0000011 | 3300049585 | Bacteria | 153214 |
| 399 | Ga0501069_0018803 | 3300049585 | Bacteria | 3731 |
| 400 | Ga0501070_0000055 | 3300049586 | Bacteria | 99156 |
| 401 | Ga0501070_0002216 | 3300049586 | Bacteria | 17069 |
| 402 | Ga0501070_0039582 | 3300049586 | Bacteria | 3932 |
| 403 | Ga0501070_0155291 | 3300049586 | Bacteria | 1887 |
| 404 | Ga0501070_0310881 | 3300049586 | Bacteria | 1283 |
| 405 | Ga0501071_0048975 | 3300049587 | Bacteria | 3040 |
| 406 | Ga0501071_0353498 | 3300049587 | Bacteria | 1118 |
| 407 | Ga0501072_0040508 | 3300049588 | Bacteria | 3658 |
| 408 | Ga0501073_0013583 | 3300049589 | Bacteria | 5922 |
| 409 | Ga0501073_0014419 | 3300049589 | Bacteria | 5743 |
| 410 | Ga0501073_0020706 | 3300049589 | Bacteria | 4743 |
| 411 | Ga0501073_0169723 | 3300049589 | Bacteria | 1510 |
| 412 | Ga0501074_0000039 | 3300049590 | Bacteria | 60866 |
| 413 | Ga0501075_0134219 | 3300049591 | Bacteria | 1885 |
| 414 | Ga0501075_0157217 | 3300049591 | Bacteria | 1733 |
| 415 | Ga0501077_0057239 | 3300049593 | Bacteria | 2475 |
| 416 | Ga0501079_0127909 | 3300049741 | Bacteria | 1976 |
| 417 | Ga0501080_0000217 | 3300049742 | Bacteria | 42758 |
| 418 | Ga0501080_0019895 | 3300049742 | Bacteria | 6216 |
| 419 | Ga0501080_0031716 | 3300049742 | Bacteria | 4924 |
| 420 | Ga0501081_0019053 | 3300049743 | Bacteria | 4565 |
| 421 | Ga0501081_0050183 | 3300049743 | Bacteria | 2874 |
| 422 | Ga0501081_0224180 | 3300049743 | Bacteria | 1367 |
| 423 | Ga0501083_0000063 | 3300049744 | Bacteria | 74976 |
| 424 | Ga0501083_0175208 | 3300049744 | Bacteria | 1401 |
| 425 | Ga0501083_0189321 | 3300049744 | Bacteria | 1343 |
| 426 | Ga0501035_0000086 | 3300049822 | Bacteria | 115822 |
| 427 | Ga0501035_0002112 | 3300049822 | Bacteria | 19769 |
| 428 | Ga0501035_0003189 | 3300049822 | Bacteria | 15719 |
| 429 | Ga0501035_0035579 | 3300049822 | Bacteria | 4518 |
| 430 | Ga0501035_0187199 | 3300049822 | Bacteria | 1781 |
| 431 | Ga0501035_0280496 | 3300049822 | Bacteria | 1408 |
| 432 | Ga0501044_0000242 | 3300049823 | Bacteria | 69190 |
| 433 | Ga0501044_0021180 | 3300049823 | Bacteria | 6942 |
| 434 | Ga0501044_0067968 | 3300049823 | Bacteria | 3630 |
| 435 | Ga0501044_0071341 | 3300049823 | Bacteria | 3532 |
| 436 | Ga0501044_0088669 | 3300049823 | Bacteria | 3122 |
| 437 | Ga0501044_0143247 | 3300049823 | Bacteria | 2377 |
| 438 | Ga0501044_0145817 | 3300049823 | Bacteria | 2353 |
| 439 | Ga0501044_0184803 | 3300049823 | Bacteria | 2050 |
| 440 | Ga0501044_0253372 | 3300049823 | Bacteria | 1700 |
| 441 | Ga0501044_0331954 | 3300049823 | Bacteria | 1443 |
| 442 | nmdc:mga00v17_47549_c1 | 3300050491 | Bacteria | 2599 |
| 443 | nmdc:mga0yw44_1652_c1 | 3300050492 | Bacteria | 8990 |
| 444 | nmdc:mga0yw44_28299_c1 | 3300050492 | Bacteria | 3222 |
| 445 | nmdc:mga06z11_192206_c1 | 3300050494 | Bacteria | 1182 |
| 446 | nmdc:mga06z11_49753_c1 | 3300050494 | Bacteria | 2139 |
| 447 | nmdc:mga06z11_50337_c1 | 3300050494 | Bacteria | 2129 |
| 448 | nmdc:mga06r32_111936_c1 | 3300050510 | Bacteria | 2686 |
| 449 | nmdc:mga0sz30_33645_c1 | 3300050516 | Bacteria | 2131 |
| 450 | Ga0495601_0090979 | 3300053077 | Bacteria | 1964 |
| 451 | Ga0500610_0042845 | 3300053079 | Bacteria | 2344 |
| 452 | Ga0500578_0045718 | 3300053086 | Bacteria | 2809 |
| 453 | Ga0500618_006337 | 3300053125 | Bacteria | 3488 |
| 454 | Ga0500568_0019857 | 3300053139 | Bacteria | 2913 |
| 455 | Ga0500604_0007549 | 3300053151 | Bacteria | 2880 |
| 456 | Ga0500616_0001322 | 3300053153 | Bacteria | 24433 |
| 457 | Ga0500620_000168 | 3300053155 | Bacteria | 13148 |
| 458 | Ga0500622_0001167 | 3300053156 | Bacteria | 21767 |
| 459 | Ga0500627_0142835 | 3300053158 | Bacteria | 1081 |
| 460 | Ga0501082_0017789 | 3300060353 | Bacteria | 6124 |
| 461 | Ga0501082_0087868 | 3300060353 | Bacteria | 2682 |
| 462 | Ga0501082_0099129 | 3300060353 | Bacteria | 2519 |
| 463 | Ga0501082_0329509 | 3300060353 | Bacteria | 1330 |
| 464 | Ga0530510_0093161 | 3300061734 | Bacteria | 2199 |
| 465 | Ga0530510_0175422 | 3300061734 | Bacteria | 1588 |
| 466 | 2503204693 | 2503198000 | Bacteria | 6884444 |
| 467 | 2509109089 | 2508501122 | Bacteria | 6292184 |
| 468 | 2509113535 | 2508501123 | Bacteria | 6283661 |
| 469 | 2509145086 | 2508501127 | Bacteria | 7037543 |
| 470 | 2509370221 | 2509276018 | Bacteria | 6910194 |
| 471 | 2509375179 | 2509276019 | Bacteria | 6802256 |
| 472 | 2509398952 | 2509276022 | Bacteria | 6200534 |
| 473 | 2510131206 | 2510065019 | Bacteria | 6903379 |
| 474 | 2510314292 | 2510065059 | Bacteria | 6847884 |
| 475 | 2511134733 | 2510917022 | Bacteria | 6504556 |
| 476 | 2511184593 | 2510917028 | Bacteria | 6185411 |
| 477 | 2511197740 | 2510917030 | Bacteria | 7460662 |
| 478 | 2512934572 | 2512875016 | Bacteria | 6529530 |
| 479 | 2512962918 | 2512875024 | Bacteria | 7195110 |
| 480 | 2513570410 | 2513237084 | Bacteria | 7231967 |
| 481 | 2513574581 | 2513237085 | Bacteria | 7695351 |
| 482 | 2513597294 | 2513237088 | Bacteria | 6927906 |
| 483 | 2513613544 | 2513237090 | Bacteria | 7096802 |
| 484 | 2513707220 | 2513237103 | Bacteria | 7647401 |
| 485 | 2513865059 | 2513237138 | Bacteria | 7368160 |
| 486 | 2513911196 | 2513237144 | Bacteria | 7530820 |
| 487 | 2513924602 | 2513237146 | Bacteria | 7166346 |
| 488 | 2513996563 | 2513237159 | Bacteria | 6810126 |
| 489 | 2514416940 | 2513237305 | Bacteria | 7293571 |
| 490 | 2515110144 | 2515075009 | Bacteria | 7288508 |
| 491 | 2515643580 | 2515154114 | Bacteria | 7848616 |
| 492 | 2515740783 | 2515154134 | Bacteria | 7220242 |
| 493 | 2516204514 | 2516143018 | Bacteria | 6951533 |
| 494 | 2517038828 | 2516653077 | Bacteria | 7555578 |
| 495 | 2517079083 | 2516653085 | Bacteria | 7346596 |
| 496 | 2520379014 | 2519899620 | Bacteria | 6499161 |
| 497 | 2530648020 | 2529292951 | Bacteria | 6916614 |
| 498 | 2535484080 | 2534681786 | Bacteria | 3308809 |
| 499 | 2535514892 | 2534681796 | Bacteria | 7146037 |
| 500 | 2558866281 | 2558860100 | Bacteria | 8458965 |
| 501 | 2585164717 | 2582581283 | Bacteria | 6030556 |
| 502 | 2585205629 | 2582581294 | Bacteria | 6626667 |
| 503 | 2585223582 | 2582581298 | Bacteria | 7315509 |
| 504 | 2585229643 | 2582581299 | Bacteria | 6518058 |
| 505 | 2585265062 | 2582581306 | Bacteria | 6450535 |
| 506 | 2585273800 | 2582581307 | Bacteria | 6597605 |
| 507 | 2585385878 | 2582581865 | Bacteria | 6644329 |
| 508 | 2585392114 | 2582581866 | Bacteria | 6859583 |
| 509 | 2585398765 | 2582581867 | Bacteria | 7184437 |
| 510 | 2585541997 | 2585427528 | Bacteria | 6842387 |
| 511 | 2585545822 | 2585427529 | Bacteria | 7395659 |
| 512 | 2585559976 | 2585427531 | Bacteria | 6992870 |
| 513 | 2585819113 | 2585427590 | Bacteria | 6824633 |
| 514 | 2585840355 | 2585427593 | Bacteria | 7141551 |
| 515 | 2585844028 | 2585427594 | Bacteria | 6180594 |
| 516 | 2585900651 | 2585427608 | Bacteria | 6544331 |
| 517 | 2585905844 | 2585427609 | Bacteria | 6667127 |
| 518 | 2585994223 | 2585427633 | Bacteria | 6413184 |
| 519 | 2585998741 | 2585427634 | Bacteria | 6455027 |
| 520 | 2587979040 | 2585428125 | Bacteria | 6662905 |
| 521 | 2588514179 | 2588253730 | Bacteria | 6881675 |
| 522 | 2597816537 | 2597489875 | Bacteria | 7010078 |
| 523 | 2599332839 | 2599185156 | Bacteria | 5403036 |
| 524 | 2599419434 | 2599185170 | Bacteria | 7295545 |
| 525 | 2599719052 | 2599185236 | Bacteria | 6875203 |
| 526 | 2599935858 | 2599185301 | Bacteria | 6161860 |
| 527 | 2600191214 | 2599185352 | Bacteria | 7228948 |
| 528 | 2600376511 | 2600254933 | Bacteria | 4750527 |
| 529 | 2616553264 | 2615840698 | Bacteria | 7319877 |
| 530 | 2617380401 | 2617270742 | Bacteria | 6808054 |
| 531 | 2643806101 | 2643221557 | Bacteria | 7184309 |
| 532 | 2643984905 | 2643221595 | Bacteria | 6565519 |
| 533 | 2644004716 | 2643221599 | Bacteria | 6292121 |
| 534 | 2644047413 | 2643221607 | Bacteria | 6314006 |
| 535 | 2644070345 | 2643221610 | Bacteria | 7480339 |
| 536 | 2644103482 | 2643221618 | Bacteria | 7717186 |
| 537 | 2644130008 | 2643221623 | Bacteria | 5239945 |
| 538 | 2644144361 | 2643221626 | Bacteria | 8069654 |
| 539 | 2644155518 | 2643221627 | Bacteria | 6761570 |
| 540 | 2644199831 | 2643221636 | Bacteria | 6583769 |
| 541 | 2644207044 | 2643221637 | Bacteria | 5345260 |
| 542 | 2644237356 | 2643221643 | Bacteria | 5749658 |
| 543 | 2644297813 | 2643221653 | Bacteria | 4569637 |
| 544 | 2644306412 | 2643221655 | Bacteria | 7722067 |
| 545 | 2644330602 | 2643221659 | Bacteria | 7890716 |
| 546 | 2644377362 | 2643221668 | Bacteria | 7306521 |
| 547 | 2644421107 | 2643221675 | Bacteria | 7473456 |
| 548 | 2644454630 | 2643221680 | Bacteria | 7473610 |
| 549 | 2644480202 | 2643221686 | Bacteria | 6310811 |
| 550 | 2644495653 | 2643221688 | Bacteria | 5260751 |
| 551 | 2644542594 | 2643221698 | Bacteria | 7756764 |
| 552 | 2644612023 | 2643221712 | Bacteria | 7729434 |
| 553 | 2644650692 | 2643221718 | Bacteria | 5345506 |
| 554 | 2644656066 | 2643221719 | Bacteria | 4568197 |
| 555 | 2644671788 | 2643221723 | Bacteria | 7095460 |
| 556 | 2644692569 | 2643221726 | Bacteria | 7455827 |
| 557 | 2671113805 | 2667528174 | Bacteria | 6435400 |
| 558 | 2688601322 | 2687453392 | Bacteria | 6880454 |
| 559 | 2692317471 | 2690316117 | Bacteria | 6800650 |
| 560 | 2694630448 | 2693429783 | Bacteria | 7019804 |
| 561 | 2694637767 | 2693429784 | Bacteria | 7241525 |
| 562 | 2719383919 | 2718217927 | Bacteria | 6972593 |
| 563 | 2719663708 | 2718217997 | Bacteria | 6740740 |
| 564 | 2720490127 | 2718218199 | Bacteria | 6740745 |
| 565 | 2720611507 | 2718218232 | Bacteria | 6720332 |
| 566 | 2720618357 | 2718218233 | Bacteria | 6662049 |
| 567 | 2720629763 | 2718218235 | Bacteria | 6630699 |
| 568 | 2720773459 | 2718218269 | Bacteria | 6906114 |
| 569 | 2721397689 | 2718218423 | Bacteria | 6438183 |
| 570 | 2723025129 | 2721755556 | Bacteria | 6745503 |
| 571 | 2723558714 | 2721755684 | Bacteria | 6859907 |
| 572 | 2723565285 | 2721755685 | Bacteria | 6704835 |
| 573 | 2723578487 | 2721755686 | Bacteria | 7343952 |
| 574 | 2724036499 | 2721755809 | Bacteria | 6438790 |
| 575 | 2724088066 | 2721755819 | Bacteria | 6906405 |
| 576 | 2724102550 | 2721755822 | Bacteria | 6726041 |
| 577 | 2724108447 | 2721755823 | Bacteria | 6752556 |
| 578 | 2730106065 | 2728369352 | Bacteria | 6745171 |
| 579 | 2738801415 | 2738541293 | Bacteria | 7065685 |
| 580 | 2739036774 | 2738541333 | Bacteria | 7106503 |
| 581 | 2739309995 | 2738543024 | Bacteria | 5603683 |
| 582 | 2753462632 | 2751185821 | Bacteria | 6189929 |
| 583 | 2756674670 | 2756170246 | Bacteria | 7451806 |
| 584 | 2758640879 | 2758568016 | Bacteria | 5645291 |
| 585 | 2766063523 | 2765235942 | Bacteria | 7445910 |
| 586 | 2776911827 | 2775507049 | Bacteria | 6284736 |
| 587 | 2778179573 | 2775507266 | Bacteria | 7392367 |
| 588 | 2792583095 | 2791355082 | Bacteria | 5973319 |
| 589 | 2792621233 | 2791355091 | Bacteria | 6135441 |
| 590 | 2792625448 | 2791355092 | Bacteria | 6248105 |
| 591 | 2792637882 | 2791355094 | Bacteria | 7011481 |
| 592 | 2792746457 | 2791355123 | Bacteria | 8049106 |
| 593 | 2793282201 | 2791355253 | Bacteria | 5171699 |
| 594 | 2793299827 | 2791355256 | Bacteria | 6798008 |
| 595 | 2793325451 | 2791355260 | Bacteria | 6598818 |
| 596 | 2793330004 | 2791355261 | Bacteria | 6661293 |
| 597 | 2793338285 | 2791355262 | Bacteria | 6774204 |
| 598 | 2793344197 | 2791355263 | Bacteria | 6872478 |
| 599 | 2793352814 | 2791355265 | Bacteria | 6539969 |
| 600 | 2805931699 | 2802429605 | Bacteria | 6875453 |
| 601 | 2805932562 | 2802429606 | Bacteria | 6346811 |
| 602 | 2806048474 | 2802429633 | Bacteria | 7341974 |
| 603 | 2806055947 | 2802429634 | Bacteria | 7083200 |
| 604 | 2806062725 | 2802429635 | Bacteria | 7650140 |
| 605 | 2806066467 | 2802429636 | Bacteria | 7597525 |
| 606 | 2806073530 | 2802429637 | Bacteria | 7067217 |
| 607 | 2819245057 | 2818991272 | Bacteria | 4622173 |
| 608 | 2819686079 | 2818991461 | Bacteria | 7026071 |
| 609 | 2821123473 | 2821123053 | Bacteria | 7836056 |
| 610 | 2837681505 | 2837678835 | Bacteria | 5252418 |
| 611 | 2838022611 | 2838016132 | Bacteria | 6577831 |
| 612 | 2838027691 | 2838022645 | Bacteria | 6494267 |
| 613 | 2838029434 | 2838029111 | Bacteria | 6603031 |
| 614 | 2838040034 | 2838035591 | Bacteria | 7166484 |
| 615 | 2838048646 | 2838042994 | Bacteria | 6046894 |
| 616 | 2838054604 | 2838048938 | Bacteria | 6044578 |
| 617 | 2838064277 | 2838061910 | Bacteria | 6794874 |
| 618 | 2838070901 | 2838068647 | Bacteria | 6208656 |
| 619 | 2838075164 | 2838074704 | Bacteria | 6785777 |
| 620 | 2838666060 | 2838661181 | Bacteria | 7385261 |
| 621 | 2838673337 | 2838668709 | Bacteria | 6671819 |
| 622 | 2838693685 | 2838686498 | Bacteria | 7807632 |
| 623 | 2838706084 | 2838701080 | Bacteria | 6669771 |
| 624 | 2838736361 | 2838729681 | Bacteria | 7400765 |
| 625 | 2838739504 | 2838736955 | Bacteria | 5760694 |
| 626 | 2838749180 | 2838742623 | Bacteria | 7396178 |
| 627 | 2841735723 | 2841734538 | Bacteria | 6784580 |
| 628 | 2841844372 | 2841840854 | Bacteria | 5761912 |
| 629 | 2841858477 | 2841851746 | Bacteria | 7532261 |
| 630 | 2842111975 | 2842110456 | Bacteria | 7656360 |
| 631 | 2842144093 | 2842140634 | Bacteria | 5759631 |
| 632 | 2842150573 | 2842146304 | Bacteria | 5957337 |
| 633 | 2842163313 | 2842156927 | Bacteria | 6894975 |
| 634 | 2842165385 | 2842163707 | Bacteria | 6916235 |
| 635 | 2842186922 | 2842180545 | Bacteria | 6888678 |
| 636 | 2842198028 | 2842192696 | Bacteria | 6147454 |
| 637 | 2842204248 | 2842198810 | Bacteria | 6608673 |
| 638 | 2842207150 | 2842205361 | Bacteria | 6340321 |
| 639 | 2842236500 | 2842229732 | Bacteria | 7475766 |
| 640 | 2842250079 | 2842243621 | Bacteria | 7421798 |
| 641 | 2842255548 | 2842250916 | Bacteria | 6579627 |
| 642 | 2842264108 | 2842257432 | Bacteria | 7401195 |
| 643 | 2842270691 | 2842264693 | Bacteria | 6472963 |
| 644 | 2842278241 | 2842271015 | Bacteria | 7807131 |
| 645 | 2842280157 | 2842278818 | Bacteria | 6340002 |
| 646 | 2842286616 | 2842285085 | Bacteria | 6011953 |
| 647 | 2842310471 | 2842304105 | Bacteria | 7023636 |
| 648 | 2842317659 | 2842311132 | Bacteria | 6616990 |
| 649 | 2842323922 | 2842317721 | Bacteria | 6793725 |
| 650 | 2842403831 | 2842402390 | Bacteria | 6681310 |
| 651 | 2842410467 | 2842409023 | Bacteria | 6687331 |
| 652 | 2842417114 | 2842415677 | Bacteria | 6596907 |
| 653 | 2842424516 | 2842422224 | Bacteria | 6239196 |
| 654 | 2842434575 | 2842428310 | Bacteria | 6767288 |
| 655 | 2842440965 | 2842434925 | Bacteria | 6502746 |
| 656 | 2842447563 | 2842441272 | Bacteria | 6769273 |
| 657 | 2842454301 | 2842447887 | Bacteria | 6754142 |
| 658 | 2842468936 | 2842462802 | Bacteria | 6588055 |
| 659 | 2842475529 | 2842469257 | Bacteria | 6752936 |
| 660 | 2842476136 | 2842475841 | Bacteria | 6603183 |
| 661 | 2842486223 | 2842482326 | Bacteria | 7212537 |
| 662 | 2842492656 | 2842489311 | Bacteria | 6620893 |
| 663 | 2842500245 | 2842495871 | Bacteria | 6820686 |
| 664 | 2842502962 | 2842502639 | Bacteria | 6604161 |
| 665 | 2842521490 | 2842521101 | Bacteria | 6569494 |
| 666 | 2842923128 | 2842922631 | Bacteria | 5824079 |
| 667 | 2844004228 | 2844002411 | Bacteria | 7168230 |
| 668 | 2844009982 | 2844009547 | Bacteria | 6728125 |
| 669 | 2844165066 | 2844163670 | Bacteria | 7266046 |
| 670 | 2844456229 | 2844454524 | Bacteria | 7952546 |
| 671 | 2847417460 | 2847417321 | Bacteria | 6913799 |
| 672 | 2847672852 | 2847670302 | Bacteria | 6165597 |
| 673 | 2847689326 | 2847686936 | Bacteria | 6278406 |
| 674 | 2848992295 | 2848992105 | Bacteria | 6810864 |
| 675 | 2850079798 | 2850079185 | Bacteria | 6848280 |
| 676 | 2855873565 | 2855872281 | Bacteria | 6964271 |
| 677 | 2856314802 | 2856314179 | Bacteria | 6477897 |
| 678 | 2856327974 | 2856320880 | Bacteria | 7263508 |
| 679 | 2856332149 | 2856328259 | Bacteria | 6528202 |
| 680 | 2856335137 | 2856334872 | Bacteria | 7037011 |
| 681 | 2856346689 | 2856342000 | Bacteria | 7176905 |
| 682 | 2856354799 | 2856349417 | Bacteria | 6230045 |
| 683 | 2856360698 | 2856356410 | Bacteria | 6297484 |
| 684 | 2856371133 | 2856364286 | Bacteria | 6939991 |
| 685 | 2857354225 | 2857349434 | Bacteria | 7926032 |
| 686 | 2857370346 | 2857367948 | Bacteria | 6965560 |
| 687 | 2857521907 | 2857516855 | Bacteria | 7787325 |
| 688 | 2857533577 | 2857531043 | Bacteria | 6754041 |
| 689 | 2869164636 | 2869162929 | Bacteria | 6399702 |
| 690 | 2869174869 | 2869169390 | Bacteria | 6659796 |
| 691 | 2869242108 | 2869234852 | Bacteria | 6654993 |
| 692 | 2869248364 | 2869242130 | Bacteria | 6609239 |
| 693 | 2869253918 | 2869249662 | Bacteria | 6868783 |
| 694 | 2869263681 | 2869256925 | Bacteria | 6981691 |
| 695 | 2869270309 | 2869264136 | Bacteria | 6880765 |
| 696 | 2869275905 | 2869271264 | Bacteria | 6908218 |
| 697 | 2869279925 | 2869278585 | Bacteria | 7077053 |
| 698 | 2869292356 | 2869285874 | Bacteria | 6901219 |
| 699 | 2871429171 | 2871429161 | Bacteria | 6547891 |
| 700 | 2871443861 | 2871435913 | Bacteria | 6880295 |
| 701 | 2871445374 | 2871444079 | Bacteria | 6423508 |
| 702 | 2871455305 | 2871451962 | Bacteria | 7336357 |
| 703 | 2871460785 | 2871459585 | Bacteria | 6866887 |
| 704 | 2871470950 | 2871466892 | Bacteria | 6923287 |
| 705 | 2871480293 | 2871474448 | Bacteria | 6806570 |
| 706 | 2871485427 | 2871481445 | Bacteria | 6700002 |
| 707 | 2871490694 | 2871488783 | Bacteria | 6929816 |
| 708 | 2871499269 | 2871495908 | Bacteria | 6935695 |
| 709 | 2874108923 | 2874102143 | Bacteria | 6342645 |
| 710 | 2874114363 | 2874109183 | Bacteria | 6517025 |
| 711 | 2874121849 | 2874116593 | Bacteria | 6674494 |
| 712 | 2874129623 | 2874123672 | Bacteria | 7238285 |
| 713 | 2874145581 | 2874139085 | Bacteria | 7021506 |
| 714 | 2874154077 | 2874146452 | Bacteria | 7533118 |
| 715 | 2874161579 | 2874155637 | Bacteria | 6724144 |
| 716 | 2874162675 | 2874162495 | Bacteria | 6174670 |
| 717 | 2874171647 | 2874168670 | Bacteria | 8062617 |
| 718 | 2876363166 | 2876363079 | Bacteria | 6544991 |
| 719 | 2876385075 | 2876377896 | Bacteria | 6565995 |
| 720 | 2876388495 | 2876386047 | Bacteria | 6698674 |
| 721 | 2876393038 | 2876392853 | Bacteria | 6660880 |
| 722 | 2876404323 | 2876399893 | Bacteria | 6927900 |
| 723 | 2876411951 | 2876406927 | Bacteria | 6191900 |
| 724 | 2876419761 | 2876413966 | Bacteria | 6831344 |
| 725 | 2876427612 | 2876420981 | Bacteria | 6687741 |
| 726 | 2878036117 | 2878035449 | Bacteria | 6555736 |
| 727 | 2878738261 | 2878730984 | Bacteria | 6380721 |
| 728 | 2878740233 | 2878738818 | Bacteria | 7136951 |
| 729 | 2878752699 | 2878745973 | Bacteria | 6867388 |
| 730 | 2878755097 | 2878753008 | Bacteria | 6922523 |
| 731 | 2878763459 | 2878760144 | Bacteria | 6823465 |
| 732 | 2878770457 | 2878767105 | Bacteria | 6898628 |
| 733 | 2878776577 | 2878774303 | Bacteria | 6108671 |
| 734 | 2878784420 | 2878781027 | Bacteria | 6834456 |
| 735 | 2878793666 | 2878788777 | Bacteria | 6567085 |
| 736 | 2881147502 | 2881147464 | Bacteria | 7779814 |
| 737 | 2881158606 | 2881155292 | Bacteria | 6461656 |
| 738 | 2881164278 | 2881161766 | Bacteria | 7127907 |
| 739 | 2881853066 | 2881845957 | Bacteria | 6611900 |
| 740 | 2881854969 | 2881853255 | Bacteria | 6698367 |
| 741 | 2881868863 | 2881861095 | Bacteria | 7128710 |
| 742 | 2882632879 | 2882632389 | Bacteria | 8154593 |
| 743 | 2882917594 | 2882912400 | Bacteria | 6801539 |
| 744 | 2885306142 | 2885305155 | Bacteria | 7348390 |
| 745 | 2885314802 | 2885312484 | Bacteria | 6415165 |
| 746 | 2885320301 | 2885318864 | Bacteria | 6729568 |
| 747 | 2885331221 | 2885326080 | Bacteria | 7134805 |
| 748 | 2885337709 | 2885334103 | Bacteria | 7216818 |
| 749 | 2885346796 | 2885342637 | Bacteria | 7011821 |
| 750 | 2885353849 | 2885350715 | Bacteria | 6787678 |
| 751 | 2888342593 | 2888337043 | Bacteria | 6629336 |
| 752 | 2888350297 | 2888343758 | Bacteria | 6611049 |
| 753 | 2888352159 | 2888350351 | Bacteria | 7372807 |
| 754 | 2889014149 | 2889010040 | Bacteria | 6749192 |
| 755 | 2889021145 | 2889016732 | Bacteria | 6700763 |
| 756 | 2889793363 | 2889790730 | Bacteria | 5689708 |
| 757 | 2889916305 | 2889914905 | Bacteria | 5702301 |
| 758 | 2891049527 | 2891048133 | Bacteria | 4447501 |
| 759 | 2896388581 | 2896384573 | Bacteria | 7700774 |
| 760 | 2899794629 | 2899792073 | Bacteria | 4926588 |
| 761 | 2899805495 | 2899803654 | Bacteria | 5577784 |
| 762 | 2903454760 | 2903448605 | Bacteria | 7357801 |
| 763 | 2903494798 | 2903492973 | Bacteria | 13473544 |
| 764 | 2903499421 | 2903492973 | Bacteria | 13473544 |
| 765 | 2903521517 | 2903513507 | Bacteria | 6344008 |
| 766 | 2903525116 | 2903521522 | Bacteria | 6525694 |
| 767 | 2903532140 | 2903528002 | Bacteria | 6586099 |
| 768 | 2903544074 | 2903540706 | Bacteria | 7062119 |
| 769 | 2904659744 | 2904659560 | Bacteria | 6685615 |
| 770 | 2906315090 | 2906308376 | Bacteria | 6841989 |
| 771 | 2906321346 | 2906321335 | Bacteria | 6579571 |
| 772 | 2906334663 | 2906328253 | Bacteria | 6585166 |
| 773 | 2906366210 | 2906363423 | Bacteria | 6856682 |
| 774 | 2906370953 | 2906370794 | Bacteria | 6881062 |
| 775 | 2906396934 | 2906393657 | Bacteria | 6790866 |
| 776 | 2906407553 | 2906401398 | Bacteria | 6693206 |
| 777 | 2906411519 | 2906408224 | Bacteria | 6162342 |
| 778 | 2906414991 | 2906414383 | Bacteria | 6580790 |
| 779 | 2906433187 | 2906427513 | Bacteria | 6375796 |
| 780 | 2913298165 | 2913295892 | Bacteria | 6333755 |
| 781 | 2915651090 | 2915650412 | Bacteria | 4288180 |
| 782 | 2919101532 | 2919100787 | Bacteria | 7710546 |
| 783 | 2919172212 | 2919171160 | Bacteria | 6499771 |
| 784 | 2919408656 | 2919408235 | Bacteria | 6149349 |
| 785 | 2920763582 | 2920760137 | Bacteria | 7427611 |
| 786 | 2920823194 | 2920822456 | Bacteria | 6897201 |
| 787 | 2922133934 | 2922130491 | Bacteria | 7173936 |
| 788 | 2922154222 | 2922151315 | Bacteria | 6902399 |
| 789 | 2922164387 | 2922158528 | Bacteria | 6573167 |
| 790 | 2922174068 | 2922172374 | Bacteria | 6167644 |
| 791 | 2922179151 | 2922178524 | Bacteria | 6025201 |
| 792 | 2922192974 | 2922185730 | Bacteria | 7113964 |
| 793 | 2923556514 | 2923556063 | Bacteria | 6793593 |
| 794 | 2924715143 | 2924710171 | Bacteria | 6752351 |
| 795 | 2924723440 | 2924718760 | Bacteria | 6331356 |
| 796 | 2924729890 | 2924726620 | Bacteria | 6271473 |
| 797 | 2924735771 | 2924733363 | Bacteria | 7574837 |
| 798 | 2924746526 | 2924741084 | Bacteria | 6661321 |
| 799 | 2924750234 | 2924748358 | Bacteria | 6154725 |
| 800 | 2924758934 | 2924754689 | Bacteria | 6774424 |
| 801 | 2924767584 | 2924762789 | Bacteria | 6561353 |
| 802 | 2924777833 | 2924776078 | Bacteria | 7492003 |
| 803 | 2924791316 | 2924784321 | Bacteria | 7416538 |
| 804 | 2933020805 | 2933016740 | Bacteria | 6355406 |
| 805 | 2933576909 | 2933570622 | Bacteria | 7023390 |
| 806 | 2933587305 | 2933586486 | Bacteria | 7667493 |
| 807 | 2933601702 | 2933599457 | Bacteria | 5858799 |
| 808 | 2935902695 | 2935901341 | Bacteria | 7341747 |
| 809 | 2936369162 | 2936367885 | Bacteria | 7324495 |
| 810 | 2936387213 | 2936381700 | Bacteria | 7006523 |
| 811 | 2937821631 | 2937813078 | Bacteria | 7783518 |
| 812 | 2937825902 | 2937822353 | Bacteria | 7290551 |
| 813 | 2937837152 | 2937836603 | Bacteria | 6811263 |
| 814 | 2937844766 | 2937843397 | Bacteria | 5256375 |
| 815 | 2937853362 | 2937848649 | Bacteria | 6983481 |
| 816 | 2937865386 | 2937861824 | Bacteria | 6660327 |
| 817 | 2937877071 | 2937868953 | Bacteria | 6639878 |
| 818 | 2937884395 | 2937877337 | Bacteria | 7246526 |
| 819 | 2937892359 | 2937891427 | Bacteria | 6357007 |
| 820 | 2937980418 | 2937972304 | Bacteria | 7532020 |
| 821 | 2937981536 | 2937980651 | Bacteria | 6517427 |
| 822 | 2937997919 | 2937994558 | Bacteria | 7036190 |
| 823 | 2938017254 | 2938014810 | Bacteria | 6700592 |
| 824 | 2939672579 | 2939669807 | Bacteria | 5028511 |
| 825 | 2941500907 | 2941499720 | Bacteria | 7599444 |
| 826 | 2958035792 | 2958034702 | Bacteria | 6989922 |
| 827 | 2958044823 | 2958041894 | Bacteria | 13082850 |
| 828 | 2958048038 | 2958041894 | Bacteria | 13082850 |
| 829 | 2958066622 | 2958064165 | Bacteria | 7158582 |
| 830 | 2958076411 | 2958071322 | Bacteria | 6815895 |
| 831 | 2958091706 | 2958084443 | Bacteria | 7312792 |
| 832 | 2958098040 | 2958092219 | Bacteria | 6861151 |
| 833 | 2958101401 | 2958100919 | Bacteria | 6800575 |
| 834 | 2958112132 | 2958108152 | Bacteria | 6681128 |
| 835 | 2958119784 | 2958115193 | Bacteria | 6923548 |
| 836 | 2958125221 | 2958122699 | Bacteria | 7280457 |
| 837 | 2958136756 | 2958130278 | Bacteria | 6897202 |
| 838 | 2958144033 | 2958137437 | Bacteria | 6050276 |
| 839 | 2958145657 | 2958144490 | Bacteria | 6677056 |
| 840 | 2958161629 | 2958158011 | Bacteria | 6058449 |
| 841 | 2958168394 | 2958165035 | Bacteria | 6906348 |
| 842 | 2958179456 | 2958172287 | Bacteria | 6716688 |
| 843 | 2958186639 | 2958179912 | Bacteria | 6874908 |
| 844 | 2961085140 | 2961077736 | Bacteria | 7079850 |
| 845 | 2961115068 | 2961114664 | Bacteria | 6680456 |
| 846 | 2961128277 | 2961127735 | Bacteria | 7196641 |
| 847 | 2961137043 | 2961136820 | Bacteria | 6775228 |
| 848 | 2961166858 | 2961163497 | Bacteria | 6901077 |
| 849 | 2961176861 | 2961170736 | Bacteria | 7072258 |
| 850 | 2961190605 | 2961183825 | Bacteria | 6688536 |
| 851 | 2963651045 | 2963644680 | Bacteria | 6530403 |
| 852 | 2965021682 | 2965018300 | Bacteria | 6883036 |
| 853 | 2965028956 | 2965025482 | Bacteria | 6532201 |
| 854 | 2965033869 | 2965032056 | Bacteria | 6887443 |
| 855 | 2965044165 | 2965040258 | Bacteria | 6855979 |
| 856 | 2965055052 | 2965047637 | Bacteria | 6623551 |
| 857 | 2965068115 | 2965062239 | Bacteria | 7412989 |
| 858 | 2965090090 | 2965089291 | Bacteria | 6866420 |
| 859 | 2965103139 | 2965102966 | Bacteria | 6800987 |
| 860 | 2965116898 | 2965110997 | Bacteria | 6693150 |
| 861 | 2965121619 | 2965119406 | Bacteria | 6956431 |
| 862 | 2968001032 | 2967996073 | Bacteria | 6787468 |
| 863 | 2968007085 | 2968003550 | Bacteria | 6929263 |
| 864 | 2968021518 | 2968016561 | Bacteria | 7022047 |
| 865 | 2968089099 | 2968083720 | Bacteria | 7351627 |
| 866 | 2968093039 | 2968091066 | Bacteria | 6052692 |
| 867 | 2968102677 | 2968097103 | Bacteria | 6107094 |
| 868 | 2968110796 | 2968110612 | Bacteria | 6814636 |
| 869 | 2968121477 | 2968117919 | Bacteria | 6536078 |
| 870 | 2968131490 | 2968128360 | Bacteria | 6270294 |
| 871 | 2968143411 | 2968138860 | Bacteria | 6605449 |
| 872 | 2968175264 | 2968171901 | Bacteria | 6894245 |
| 873 | 2970476803 | 2970469710 | Bacteria | 6969209 |
| 874 | 2970494261 | 2970489779 | Bacteria | 6517260 |
| 875 | 2970509533 | 2970503327 | Bacteria | 7099517 |
| 876 | 2970515059 | 2970510686 | Bacteria | 7006402 |
| 877 | 2970525409 | 2970524798 | Bacteria | 6840927 |
| 878 | 2970537567 | 2970532167 | Bacteria | 6553173 |
| 879 | 2970543269 | 2970540015 | Bacteria | 6977556 |
| 880 | 2970552257 | 2970547951 | Bacteria | 6931819 |
| 881 | 2970558302 | 2970554993 | Bacteria | 6814252 |
| 882 | 2970594524 | 2970593180 | Bacteria | 7073582 |
| 883 | 2970623717 | 2970619444 | Bacteria | 6986144 |
| 884 | 2977824237 | 2977821940 | Bacteria | 6906439 |
| 885 | 2977834641 | 2977828996 | Bacteria | 7007971 |
| 886 | 2977850143 | 2977843712 | Bacteria | 6753583 |
| 887 | 2977852385 | 2977851361 | Bacteria | 6694324 |
| 888 | 2977860878 | 2977858184 | Bacteria | 6215359 |
| 889 | 2977868434 | 2977864932 | Bacteria | 7534097 |
| 890 | 2977875268 | 2977872689 | Bacteria | 7270173 |
| 891 | 2977904138 | 2977898635 | Bacteria | 6675551 |
| 892 | 2977914488 | 2977907340 | Bacteria | 6577984 |
| 893 | 2977915920 | 2977915119 | Bacteria | 6829656 |
| 894 | 2977927277 | 2977922695 | Bacteria | 6956781 |
| 895 | 2977940013 | 2977935797 | Bacteria | 6252826 |
| 896 | 2977949614 | 2977942078 | Bacteria | 7570577 |
| 897 | 2977952982 | 2977950692 | Bacteria | 6893264 |
| 898 | 2977957819 | 2977957713 | Bacteria | 6877875 |
| 899 | 2977979144 | 2977971508 | Bacteria | 7472917 |
| 900 | 2977991393 | 2977986579 | Bacteria | 6581278 |
| 901 | 2979715157 | 2979710463 | Bacteria | 6785254 |
| 902 | 2979766287 | 2979764755 | Bacteria | 6610066 |
| 903 | 2979774414 | 2979772303 | Bacteria | 6618277 |
| 904 | 2979785711 | 2979779861 | Bacteria | 6219781 |
| 905 | 2979800512 | 2979793036 | Bacteria | 6808957 |
| 906 | 2979814321 | 2979808191 | Bacteria | 7179355 |
| 907 | 2987642365 | 2987636660 | Bacteria | 8088555 |
| 908 | 2987646702 | 2987645492 | Bacteria | 6117018 |
| 909 | 2987662870 | 2987659509 | Bacteria | 6966464 |
| 910 | 2987668056 | 2987666974 | Bacteria | 6509233 |
| 911 | 2987677399 | 2987673487 | Bacteria | 6884027 |
| 912 | 2989772602 | 2989771324 | Bacteria | 5605128 |
| 913 | 2996312750 | 2996310559 | Bacteria | 6357320 |
| 914 | 2996346388 | 2996341866 | Bacteria | 6643098 |
| 915 | 2996356228 | 2996348954 | Bacteria | 7239054 |
| 916 | 2996393606 | 2996386984 | Bacteria | 6978667 |
| 917 | 2996888308 | 2996887358 | Bacteria | 5795980 |
| 918 | 2996893240 | 2996893221 | Bacteria | 5823108 |
| 919 | 3000135827 | 3000135777 | Bacteria | 6891109 |
| 920 | 3003931732 | 3003930520 | Bacteria | 5667563 |
| 921 | 3004172429 | 3004167301 | Bacteria | 8330599 |
| 922 | 3004191922 | 3004188549 | Bacteria | 6952365 |
| 923 | 3004201026 | 3004195979 | Bacteria | 6776956 |
| 924 | 3004210446 | 3004203850 | Bacteria | 7307914 |
| 925 | 3004216802 | 3004211236 | Bacteria | 7417683 |
| 926 | 3004219835 | 3004218560 | Bacteria | 7421728 |
| 927 | 3004235203 | 3004232784 | Bacteria | 6662140 |
| 928 | 3004244939 | 3004239961 | Bacteria | 6892290 |
| 929 | 3004269625 | 3004268573 | Bacteria | 7043476 |
| 930 | 3004282542 | 3004275668 | Bacteria | 7114440 |
| 931 | 3004296848 | 3004289098 | Bacteria | 6135450 |
| 932 | 3004338177 | 3004334049 | Bacteria | 8449246 |
| 933 | 3005410968 | 3005409236 | Bacteria | 7188837 |
| 934 | 3005446004 | 3005445848 | Bacteria | 6906074 |
| 935 | 3005456677 | 3005452660 | Bacteria | 5889319 |
| 936 | 637077743 | 637000159 | Bacteria | 7596297 |
| 937 | 643824362 | 643692032 | Bacteria | 6891900 |
| 938 | 649875751 | 649633066 | Bacteria | 6690028 |
| 939 | 8002288477 | 8002285264 | Bacteria | 6717907 |
| 940 | 8004306327 | 8004300914 | Bacteria | 6132239 |
| 941 | 8004315954 | 8004312739 | Bacteria | 7444653 |
| 942 | 8004364512 | 8004361976 | Bacteria | 6858373 |
| 943 | 8004376676 | 8004374579 | Bacteria | 6898112 |
| 944 | 8004395030 | 8004387939 | Bacteria | 7049250 |
| 945 | 8004400874 | 8004395343 | Bacteria | 6620908 |
| 946 | 8004447749 | 8004445564 | Bacteria | 6322258 |
| 947 | 8004635646 | 8004633249 | Bacteria | 6723080 |
| 948 | 8004647028 | 8004640170 | Bacteria | 6723001 |
| 949 | 8004695631 | 8004695233 | Bacteria | 6731676 |
| 950 | 8004707368 | 8004703790 | Bacteria | 8006957 |
| 951 | 8004721351 | 8004714634 | Bacteria | 6776161 |
| 952 | 8004734166 | 8004727605 | Bacteria | 6643904 |
| 953 | 8005261135 | 8005258706 | Bacteria | 6184835 |
| 954 | 8005278628 | 8005275841 | Bacteria | 6929066 |
| 955 | 8005288468 | 8005282627 | Bacteria | 6675747 |
| 956 | 8005291294 | 8005289223 | Bacteria | 6634003 |
| 957 | 8005301338 | 8005301065 | Bacteria | 6614431 |
| 958 | 8005310621 | 8005307578 | Bacteria | 7395396 |
| 959 | 8005322835 | 8005321885 | Bacteria | 5795980 |
| 960 | 8005377655 | 8005376324 | Bacteria | 6590079 |
| 961 | 8005387521 | 8005382845 | Bacteria | 6732062 |
| 962 | 8005399924 | 8005395548 | Bacteria | 6806915 |
| 963 | 8005432720 | 8005430974 | Bacteria | 6689030 |
| 964 | 8005460780 | 8005460587 | Bacteria | 7157962 |
| 965 | 8005498450 | 8005497431 | Bacteria | 6477605 |
| 966 | 8005543564 | 8005542996 | Bacteria | 7077758 |
| 967 | 8005573722 | 8005570704 | Bacteria | 6957481 |
| 968 | 8005619643 | 8005619151 | Bacteria | 7030230 |
| 969 | 8005628212 | 8005626139 | Bacteria | 6534237 |
| 970 | 8005660142 | 8005658619 | Bacteria | 4500593 |
| 971 | 8005669859 | 8005668836 | Bacteria | 6953162 |
| 972 | 8005685259 | 8005682033 | Bacteria | 6726518 |
| 973 | 8005692455 | 8005688590 | Bacteria | 6610080 |
| 974 | 8018154452 | 8018150411 | Bacteria | 5549903 |
| 975 | 8023684464 | 8023680758 | Bacteria | 7729763 |
| 976 | 8024480069 | 8024479707 | Bacteria | 6954785 |
| 977 | 8024491559 | 8024486573 | Bacteria | 6540512 |
| 978 | 8024502325 | 8024501048 | Bacteria | 6427847 |
| 979 | 8046770848 | 8046767195 | Bacteria | 7547379 |
| 980 | 8049293298 | 8049293176 | Bacteria | 6128433 |
| 981 | 8054562643 | 8054558443 | Bacteria | 5204801 |
| 982 | 8055624719 | 8055617313 | Bacteria | 7548464 |
| 983 | 8056385565 | 8056382006 | Bacteria | 6408074 |
| 984 | 8056878024 | 8056875544 | Bacteria | 4355797 |
| 985 | 8057580543 | 8057575449 | Bacteria | 7367519 |
| 986 | 8057879676 | 8057874678 | Bacteria | 7494653 |
| 987 | Ga0501032_0006661 | |||
| 988 | JGI24740J21852_10000265 | |||
| 989 | JGI24739J22299_10017602 | |||
| 990 | JGI25155J39150_1000013 | |||
| 991 | JGI25156J39149_1000011 | |||
| 992 | JGI25162J39368_1003577 | |||
| 993 | JGI25162J39368_1003648 | |||
| 994 | JGI25154J39366_1000030 | |||
| 995 | JGI25158J39367_1000118 | |||
| 996 | JGI25157J39369_1000013 | |||
| 997 | JGI25157J39369_1000297 | |||
| 998 | JGI25152J39213_1002204 | |||
| 999 | JGI25152J39213_1010652 | |||
| 1000 | JGI25150J39212_1003898 | |||
| 1001 | JGI25159J45721_1000003 | |||
| 1002 | JGI25159J45721_1000320 | |||
| 1003 | JGI25159J45721_1000553 | |||
| 1004 | JGI25151J46595_10000425 | |||
| 1005 | JGI25165J46597_1000019 | |||
| 1006 | JGI25165J46597_1001738 | |||
| 1007 | JGI25165J46597_1002247 | |||
| 1008 | JGI25153J46596_10008005 | |||
| 1009 | JGI25153J46596_10014819 | |||
| 1010 | rootH2_10086381 | |||
| 1011 | rootH1_10069445 | |||
| 1012 | JGI25160J50197_1000003 | |||
| 1013 | JGI25160J50197_1000041 | |||
| 1014 | JGI25160J50197_1001749 | |||
| 1015 | JGI25160J50197_1009671 | |||
| 1016 | JGI25161J50226_1000002 | |||
| 1017 | JGI25161J50226_1000184 | |||
| 1018 | JGI25161J50226_1000315 | |||
| 1019 | JGI25161J50226_1003792 | |||
| 1020 | Ga0055542_1000656 | |||
| 1021 | Ga0055529_1002709 | |||
| 1022 | Ga0055526_1000550 | |||
| 1023 | Ga0055526_1001211 | |||
| 1024 | Ga0055526_1004504 | |||
| 1025 | Ga0055526_1028537 | |||
| 1026 | Ga0055526_1032069 | |||
| 1027 | Ga0055524_1003346 | |||
| 1028 | Ga0055524_1006879 | |||
| 1029 | Ga0055524_1007140 | |||
| 1030 | Ga0055536_1001178 | |||
| 1031 | Ga0055536_1010446 | |||
| 1032 | Ga0055528_1008152 | |||
| 1033 | Ga0055528_1011664 | |||
| 1034 | Ga0055528_1023938 | |||
| 1035 | Ga0055530_10029855 | |||
| 1036 | Ga0055540_1001185 | |||
| 1037 | Ga0055540_1002438 | |||
| 1038 | Ga0055540_1014437 | |||
| 1039 | Ga0055531_10021896 | |||
| 1040 | Ga0055543_1000037 | |||
| 1041 | Ga0055543_1000203 | |||
| 1042 | Ga0055543_1000466 | |||
| 1043 | Ga0055543_1001741 | |||
| 1044 | Ga0065165_1000031 | |||
| 1045 | Ga0065165_1000084 | |||
| 1046 | Ga0065165_1008265 | |||
| 1047 | Ga0070690_100103448 | |||
| 1048 | Ga0070668_100067082 | |||
| 1049 | Ga0070668_100076303 | |||
| 1050 | Ga0070669_100140168 | |||
| 1051 | Ga0070671_100076107 | |||
| 1052 | Ga0070674_100043508 | |||
| 1053 | Ga0070667_100321717 | |||
| 1054 | Ga0070694_100068967 | |||
| 1055 | Ga0070663_100030987 | |||
| 1056 | Ga0070678_100346334 | |||
| 1057 | Ga0070679_100468724 | |||
| 1058 | Ga0068853_100124299 | |||
| 1059 | Ga0068853_100218555 | |||
| 1060 | Ga0068853_100519442 | |||
| 1061 | Ga0070695_100069097 | |||
| 1062 | Ga0070665_100017909 | |||
| 1063 | Ga0068854_100255297 | |||
| 1064 | Ga0068856_100035770 | |||
| 1065 | Ga0068861_100023672 | |||
| 1066 | Ga0068870_10075852 | |||
| 1067 | Ga0068860_100216684 | |||
| 1068 | Ga0068860_100469015 | |||
| 1069 | Ga0081455_10001992 | |||
| 1070 | Ga0081540_1006065 | |||
| 1071 | Ga0070717_10333257 | |||
| 1072 | Ga0075365_10011524 | |||
| 1073 | Ga0075365_10056969 | |||
| 1074 | Ga0075364_10032827 | |||
| 1075 | Ga0075367_10000382 | |||
| 1076 | Ga0075367_10038876 | |||
| 1077 | Ga0075367_10087861 | |||
| 1078 | Ga0075431_100161232 | |||
| 1079 | Ga0075434_100551671 | |||
| 1080 | Ga0079104_1000033 | |||
| 1081 | Ga0105251_10016767 | |||
| 1082 | Ga0105247_10035069 | |||
| 1083 | Ga0105247_10219314 | |||
| 1084 | Ga0105237_10184662 | |||
| 1085 | Ga0105238_10007409 | |||
| 1086 | Ga0105238_10335425 | |||
| 1087 | Ga0105249_10188636 | |||
| 1088 | Ga0105249_10201682 | |||
| 1089 | Ga0105239_10236250 | |||
| 1090 | Ga0105239_10470798 | |||
| 1091 | Ga0157371_10134272 | |||
| 1092 | Ga0157369_10453215 | |||
| 1093 | Ga0171463_1001 | |||
| 1094 | Ga0157378_10191657 | |||
| 1095 | Ga0163162_10197937 | |||
| 1096 | Ga0157375_10399565 | |||
| 1097 | Ga0157380_10490922 | |||
| 1098 | Ga0182008_10136809 | |||
| 1099 | Ga0157376_10048360 | |||
| 1100 | Ga0183363_1140 | |||
| 1101 | Ga0163161_10004584 | |||
| 1102 | Ga0214544_1002289 | |||
| 1103 | Ga0214542_1001074 | |||
| 1104 | Ga0214543_1000027 | |||
| 1105 | Ga0214543_1000897 | |||
| 1106 | Ga0209435_100026 | |||
| 1107 | Ga0209436_100006 | |||
| 1108 | Ga0209436_102572 | |||
| 1109 | Ga0209672_102569 | |||
| 1110 | Ga0209437_100056 | |||
| 1111 | Ga0209437_100196 | |||
| 1112 | Ga0207425_1004008 | |||
| 1113 | Ga0207425_1004857 | |||
| 1114 | Ga0209646_1000084 | |||
| 1115 | Ga0209646_1008073 | |||
| 1116 | Ga0209026_1000013 | |||
| 1117 | Ga0209026_1000080 | |||
| 1118 | Ga0209148_1000210 | |||
| 1119 | Ga0209759_1000061 | |||
| 1120 | Ga0209759_1000884 | |||
| 1121 | Ga0209129_1000206 | |||
| 1122 | Ga0209129_1001939 | |||
| 1123 | Ga0209129_1002038 | |||
| 1124 | Ga0209129_1005657 | |||
| 1125 | Ga0209129_1005918 | |||
| 1126 | Ga0209129_1013196 | |||
| 1127 | Ga0209233_1000034 | |||
| 1128 | Ga0209233_1000037 | |||
| 1129 | Ga0209233_1000071 | |||
| 1130 | Ga0209233_1002951 | |||
| 1131 | Ga0209455_1000098 | |||
| 1132 | Ga0209455_1007024 | |||
| 1133 | Ga0209673_1000063 | |||
| 1134 | Ga0209673_1002616 | |||
| 1135 | Ga0209673_1002642 | |||
| 1136 | Ga0209673_1003517 | |||
| 1137 | Ga0209130_1000002 | |||
| 1138 | Ga0209130_1000005 | |||
| 1139 | Ga0209130_1000028 | |||
| 1140 | Ga0209676_1003399 | |||
| 1141 | Ga0209676_1013859 | |||
| 1142 | Ga0209025_1000479 | |||
| 1143 | Ga0209025_1001859 | |||
| 1144 | Ga0209025_1009455 | |||
| 1145 | Ga0209025_1011580 | |||
| 1146 | Ga0209025_1054526 | |||
| 1147 | Ga0209564_1000093 | |||
| 1148 | Ga0209564_1000316 | |||
| 1149 | Ga0209564_1001013 | |||
| 1150 | Ga0209564_1004973 | |||
| 1151 | Ga0209564_1019227 | |||
| 1152 | Ga0209758_1000361 | |||
| 1153 | Ga0209758_1000441 | |||
| 1154 | Ga0209758_1000499 | |||
| 1155 | Ga0209758_1001467 | |||
| 1156 | Ga0209758_1011078 | |||
| 1157 | Ga0209758_1013517 | |||
| 1158 | Ga0209758_1035978 | |||
| 1159 | Ga0209050_1002860 | |||
| 1160 | Ga0209256_1000027 | |||
| 1161 | Ga0209256_1000880 | |||
| 1162 | Ga0209256_1000996 | |||
| 1163 | Ga0209256_1001570 | |||
| 1164 | Ga0209256_1012062 | |||
| 1165 | Ga0209256_1020034 | |||
| 1166 | Ga0207426_1000012 | |||
| 1167 | Ga0207426_1000013 | |||
| 1168 | Ga0207426_1000015 | |||
| 1169 | Ga0207426_1000070 | |||
| 1170 | Ga0207426_1013206 | |||
| 1171 | Ga0209051_1004813 | |||
| 1172 | Ga0209051_1004984 | |||
| 1173 | Ga0209051_1009423 | |||
| 1174 | Ga0209051_1012648 | |||
| 1175 | Ga0209051_1014436 | |||
| 1176 | Ga0209051_1017369 | |||
| 1177 | Ga0209051_1064052 | |||
| 1178 | Ga0209257_1008097 | |||
| 1179 | Ga0209257_1011029 | |||
| 1180 | Ga0209257_1012026 | |||
| 1181 | Ga0207713_1034733 | |||
| 1182 | Ga0207647_10016047 | |||
| 1183 | Ga0207695_10230515 | |||
| 1184 | Ga0207671_10009356 | |||
| 1185 | Ga0207671_10111158 | |||
| 1186 | Ga0207681_10075906 | |||
| 1187 | Ga0207694_10350759 | |||
| 1188 | Ga0207650_10466205 | |||
| 1189 | Ga0207659_10087207 | |||
| 1190 | Ga0207706_10082611 | |||
| 1191 | Ga0207669_10003568 | |||
| 1192 | Ga0207704_10159443 | |||
| 1193 | Ga0207704_10254827 | |||
| 1194 | Ga0207667_10288615 | |||
| 1195 | Ga0207668_10137274 | |||
| 1196 | Ga0207668_10345281 | |||
| 1197 | Ga0207658_10283605 | |||
| 1198 | Ga0207703_10154447 | |||
| 1199 | Ga0207639_10011429 | |||
| 1200 | Ga0207678_10030176 | |||
| 1201 | Ga0207678_10047528 | |||
| 1202 | Ga0207708_10289112 | |||
| 1203 | Ga0207675_100112509 | |||
| 1204 | Ga0209281_1000043 | |||
| 1205 | Ga0207428_10055125 | |||
| 1206 | Ga0268266_10042461 | |||
| 1207 | Ga0268266_10281037 | |||
| 1208 | Ga0268264_10148674 | |||
| 1209 | Ga0265318_10013013 | |||
| 1210 | Ga0307515_10000029 | |||
| 1211 | Ga0265330_10121657 | |||
| 1212 | Ga0265340_10033570 | |||
| 1213 | Ga0265339_10048410 | |||
| 1214 | Ga0265339_10059055 | |||
| 1215 | Ga0265316_10014953 | |||
| 1216 | Ga0307513_10077823 | |||
| 1217 | Ga0265313_10037440 | |||
| 1218 | Ga0316575_10055441 | |||
| 1219 | Ga0316579_10000691 | |||
| 1220 | Ga0316579_10104134 | |||
| 1221 | Ga0265314_10008035 | |||
| 1222 | Ga0265342_10005385 | |||
| 1223 | Ga0316576_10030168 | |||
| 1224 | Ga0316578_10077237 | |||
| 1225 | Ga0316577_10004501 | |||
| 1226 | Ga0307412_10015975 | |||
| 1227 | Ga0307416_100113679 | |||
| 1228 | Ga0307414_10108571 | |||
| 1229 | Ga0316585_10020147 | |||
| 1230 | Ga0316580_10000591 | |||
| 1231 | Ga0316593_10032241 | |||
| 1232 | Ga0373932_0011103 | |||
| 1233 | Ga0316574_0010281 | |||
| 1234 | Ga0373931_0211494 | |||
| 1235 | Ga0316584_0003285 | |||
| 1236 | Ga0316584_0133733 | |||
| 1237 | Ga0395899_0000014 | |||
| 1238 | Ga0395900_0000007 | |||
| 1239 | Ga0395900_0077780 | |||
| 1240 | Ga0395900_0234212 | |||
| 1241 | Ga0395900_0296292 | |||
| 1242 | Ga0395898_0000011 | |||
| 1243 | Ga0395905_0000008 | |||
| 1244 | Ga0395905_0117976 | |||
| 1245 | Ga0395901_0000020 | |||
| 1246 | Ga0395901_0019029 | |||
| 1247 | Ga0400483_092583 | |||
| 1248 | Ga0400483_271870 | |||
| 1249 | Ga0439436_0003581 | |||
| 1250 | Ga0439465_0058412 | |||
| 1251 | Ga0439449_0032697 | |||
| 1252 | Ga0439449_0095654 | |||
| 1253 | Ga0450910_004115 | |||
| 1254 | Ga0439440_0006427 | |||
| 1255 | Ga0466972_0018944 | |||
| 1256 | Ga0466963_0120449 | |||
| 1257 | Ga0466968_0049060 | |||
| 1258 | Ga0466970_0130788 | |||
| 1259 | Ga0466970_0166427 | |||
| 1260 | Ga0466957_0124803 | |||
| 1261 | Ga0466960_0049247 | |||
| 1262 | Ga0466967_0300753 | |||
| 1263 | Ga0495650_0038058 | |||
| 1264 | Ga0495584_0032541 | |||
| 1265 | Ga0495583_0014293 | |||
| 1266 | Ga0495606_0016089 | |||
| 1267 | Ga0495606_0054400 | |||
| 1268 | Ga0495606_0112742 | |||
| 1269 | Ga0495608_0102088 | |||
| 1270 | Ga0495610_0092901 | |||
| 1271 | Ga0495631_0058744 | |||
| 1272 | Ga0495632_0056429 | |||
| 1273 | Ga0495632_0093396 | |||
| 1274 | Ga0495643_0012892 | |||
| 1275 | Ga0495643_0045533 | |||
| 1276 | Ga0495648_0100372 | |||
| 1277 | Ga0495652_0250731 | |||
| 1278 | Ga0495654_0001320 | |||
| 1279 | Ga0495654_0086587 | |||
| 1280 | Ga0495587_0084163 | |||
| 1281 | Ga0495633_0043713 | |||
| 1282 | Ga0495668_0055056 | |||
| 1283 | Ga0495625_0236122 | |||
| 1284 | Ga0495670_0152810 | |||
| 1285 | Ga0495649_0186431 | |||
| 1286 | Ga0495604_0120220 | |||
| 1287 | Ga0495686_0023921 | |||
| 1288 | Ga0495686_0034123 | |||
| 1289 | Ga0495686_0128532 | |||
| 1290 | Ga0495686_0228855 | |||
| 1291 | Ga0495626_0078187 | |||
| 1292 | Ga0496100_0029288 | |||
| 1293 | Ga0496102_0013134 | |||
| 1294 | Ga0496103_0034601 | |||
| 1295 | Ga0496104_0127081 | |||
| 1296 | Ga0496105_0053588 | |||
| 1297 | Ga0496106_0048515 | |||
| 1298 | Ga0496106_0071357 | |||
| 1299 | Ga0496106_0606942 | |||
| 1300 | Ga0496107_0018512 | |||
| 1301 | Ga0496107_0102663 | |||
| 1302 | Ga0496107_0119267 | |||
| 1303 | Ga0496109_0056052 | |||
| 1304 | Ga0496110_0092977 | |||
| 1305 | Ga0496110_0231354 | |||
| 1306 | Ga0496111_0007743 | |||
| 1307 | Ga0496111_0208067 | |||
| 1308 | Ga0496113_0188069 | |||
| 1309 | Ga0496114_0264368 | |||
| 1310 | Ga0496115_0184709 | |||
| 1311 | Ga0496116_0114002 | |||
| 1312 | Ga0496117_0061719 | |||
| 1313 | Ga0496117_0064374 | |||
| 1314 | Ga0496117_0088886 | |||
| 1315 | Ga0496118_0125828 | |||
| 1316 | Ga0496119_0010822 | |||
| 1317 | Ga0496119_0029723 | |||
| 1318 | Ga0496120_0002411 | |||
| 1319 | Ga0496121_0000897 | |||
| 1320 | Ga0496121_0009130 | |||
| 1321 | Ga0496121_0090466 | |||
| 1322 | Ga0496121_0122316 | |||
| 1323 | Ga0496121_0176103 | |||
| 1324 | Ga0496122_0001480 | |||
| 1325 | Ga0496122_0042450 | |||
| 1326 | Ga0496122_0091633 | |||
| 1327 | Ga0496122_0121105 | |||
| 1328 | Ga0496122_0178034 | |||
| 1329 | Ga0496123_0000238 | |||
| 1330 | Ga0496123_0045841 | |||
| 1331 | Ga0496123_0053294 | |||
| 1332 | Ga0496123_0060351 | |||
| 1333 | Ga0496123_0074481 | |||
| 1334 | Ga0496124_0045806 | |||
| 1335 | Ga0496124_0091196 | |||
| 1336 | Ga0496124_0117498 | |||
| 1337 | Ga0496124_0161759 | |||
| 1338 | Ga0496124_0190433 | |||
| 1339 | Ga0496124_0230812 | |||
| 1340 | Ga0496125_0059637 | |||
| 1341 | Ga0496125_0104159 | |||
| 1342 | Ga0496125_0219797 | |||
| 1343 | Ga0496126_0007048 | |||
| 1344 | Ga0501032_0097143 | |||
| 1345 | Ga0501033_0000230 | |||
| 1346 | Ga0501033_0211351 | |||
| 1347 | Ga0501034_0004622 | |||
| 1348 | Ga0501034_0070434 | |||
| 1349 | Ga0501034_0070998 | |||
| 1350 | Ga0501034_0075278 | |||
| 1351 | Ga0501034_0144598 | |||
| 1352 | Ga0501034_0170929 | |||
| 1353 | Ga0501034_0175220 | |||
| 1354 | Ga0501036_0140606 | |||
| 1355 | Ga0501037_0000168 | |||
| 1356 | Ga0501038_0115121 | |||
| 1357 | Ga0501038_0147589 | |||
| 1358 | Ga0501038_0254124 | |||
| 1359 | Ga0501039_0043737 | |||
| 1360 | Ga0501039_0101405 | |||
| 1361 | Ga0501039_0132202 | |||
| 1362 | Ga0501040_0062748 | |||
| 1363 | Ga0501041_0038368 | |||
| 1364 | Ga0501041_0040076 | |||
| 1365 | Ga0501042_0039797 | |||
| 1366 | Ga0501043_0000005 | |||
| 1367 | Ga0501043_0134348 | |||
| 1368 | Ga0501043_0320673 | |||
| 1369 | Ga0501046_0046525 | |||
| 1370 | Ga0501047_0079985 | |||
| 1371 | Ga0501047_0086492 | |||
| 1372 | Ga0501047_0181292 | |||
| 1373 | Ga0501047_0235932 | |||
| 1374 | Ga0501047_0420830 | |||
| 1375 | Ga0501047_0477004 | |||
| 1376 | Ga0501048_0017659 | |||
| 1377 | Ga0501048_0070175 | |||
| 1378 | Ga0501048_0161329 | |||
| 1379 | Ga0501048_0244463 | |||
| 1380 | Ga0501048_0277090 | |||
| 1381 | Ga0501067_0077644 | |||
| 1382 | Ga0501068_0042829 | |||
| 1383 | Ga0501068_0215368 | |||
| 1384 | Ga0501069_0000011 | |||
| 1385 | Ga0501069_0018803 | |||
| 1386 | Ga0501070_0000055 | |||
| 1387 | Ga0501070_0002216 | |||
| 1388 | Ga0501070_0039582 | |||
| 1389 | Ga0501070_0155291 | |||
| 1390 | Ga0501070_0310881 | |||
| 1391 | Ga0501071_0048975 | |||
| 1392 | Ga0501071_0353498 | |||
| 1393 | Ga0501072_0040508 | |||
| 1394 | Ga0501073_0013583 | |||
| 1395 | Ga0501073_0014419 | |||
| 1396 | Ga0501073_0020706 | |||
| 1397 | Ga0501073_0169723 | |||
| 1398 | Ga0501074_0000039 | |||
| 1399 | Ga0501075_0134219 | |||
| 1400 | Ga0501075_0157217 | |||
| 1401 | Ga0501077_0057239 | |||
| 1402 | Ga0501079_0127909 | |||
| 1403 | Ga0501080_0000217 | |||
| 1404 | Ga0501080_0019895 | |||
| 1405 | Ga0501080_0031716 | |||
| 1406 | Ga0501081_0019053 | |||
| 1407 | Ga0501081_0050183 | |||
| 1408 | Ga0501081_0224180 | |||
| 1409 | Ga0501083_0000063 | |||
| 1410 | Ga0501083_0175208 | |||
| 1411 | Ga0501083_0189321 | |||
| 1412 | Ga0501035_0000086 | |||
| 1413 | Ga0501035_0002112 | |||
| 1414 | Ga0501035_0003189 | |||
| 1415 | Ga0501035_0035579 | |||
| 1416 | Ga0501035_0187199 | |||
| 1417 | Ga0501035_0280496 | |||
| 1418 | Ga0501044_0000242 | |||
| 1419 | Ga0501044_0021180 | |||
| 1420 | Ga0501044_0067968 | |||
| 1421 | Ga0501044_0071341 | |||
| 1422 | Ga0501044_0088669 | |||
| 1423 | Ga0501044_0143247 | |||
| 1424 | Ga0501044_0145817 | |||
| 1425 | Ga0501044_0184803 | |||
| 1426 | Ga0501044_0253372 | |||
| 1427 | Ga0501044_0331954 | |||
| 1428 | nmdc:mga00v17_47549_c1 | |||
| 1429 | nmdc:mga0yw44_1652_c1 | |||
| 1430 | nmdc:mga0yw44_28299_c1 | |||
| 1431 | nmdc:mga06z11_192206_c1 | |||
| 1432 | nmdc:mga06z11_49753_c1 | |||
| 1433 | nmdc:mga06z11_50337_c1 | |||
| 1434 | nmdc:mga06r32_111936_c1 | |||
| 1435 | nmdc:mga0sz30_33645_c1 | |||
| 1436 | Ga0495601_0090979 | |||
| 1437 | Ga0500610_0042845 | |||
| 1438 | Ga0500578_0045718 | |||
| 1439 | Ga0500618_006337 | |||
| 1440 | Ga0500568_0019857 | |||
| 1441 | Ga0500604_0007549 | |||
| 1442 | Ga0500616_0001322 | |||
| 1443 | Ga0500620_000168 | |||
| 1444 | Ga0500622_0001167 | |||
| 1445 | Ga0500627_0142835 | |||
| 1446 | Ga0501082_0017789 | |||
| 1447 | Ga0501082_0087868 | |||
| 1448 | Ga0501082_0099129 | |||
| 1449 | Ga0501082_0329509 | |||
| 1450 | Ga0530510_0093161 | |||
| 1451 | Ga0530510_0175422 | |||
| 1452 | 2503204693 | |||
| 1453 | 2509109089 | |||
| 1454 | 2509113535 | |||
| 1455 | 2509145086 | |||
| 1456 | 2509370221 | |||
| 1457 | 2509375179 | |||
| 1458 | 2509398952 | |||
| 1459 | 2510131206 | |||
| 1460 | 2510314292 | |||
| 1461 | 2511134733 | |||
| 1462 | 2511184593 | |||
| 1463 | 2511197740 | |||
| 1464 | 2512934572 | |||
| 1465 | 2512962918 | |||
| 1466 | 2513570410 | |||
| 1467 | 2513574581 | |||
| 1468 | 2513597294 | |||
| 1469 | 2513613544 | |||
| 1470 | 2513707220 | |||
| 1471 | 2513865059 | |||
| 1472 | 2513911196 | |||
| 1473 | 2513924602 | |||
| 1474 | 2513996563 | |||
| 1475 | 2514416940 | |||
| 1476 | 2515110144 | |||
| 1477 | 2515643580 | |||
| 1478 | 2515740783 | |||
| 1479 | 2516204514 | |||
| 1480 | 2517038828 | |||
| 1481 | 2517079083 | |||
| 1482 | 2520379014 | |||
| 1483 | 2530648020 | |||
| 1484 | 2535484080 | |||
| 1485 | 2535514892 | |||
| 1486 | 2558866281 | |||
| 1487 | 2585164717 | |||
| 1488 | 2585205629 | |||
| 1489 | 2585223582 | |||
| 1490 | 2585229643 | |||
| 1491 | 2585265062 | |||
| 1492 | 2585273800 | |||
| 1493 | 2585385878 | |||
| 1494 | 2585392114 | |||
| 1495 | 2585398765 | |||
| 1496 | 2585541997 | |||
| 1497 | 2585545822 | |||
| 1498 | 2585559976 | |||
| 1499 | 2585819113 | |||
| 1500 | 2585840355 | |||
| 1501 | 2585844028 | |||
| 1502 | 2585900651 | |||
| 1503 | 2585905844 | |||
| 1504 | 2585994223 | |||
| 1505 | 2585998741 | |||
| 1506 | 2587979040 | |||
| 1507 | 2588514179 | |||
| 1508 | 2597816537 | |||
| 1509 | 2599332839 | |||
| 1510 | 2599419434 | |||
| 1511 | 2599719052 | |||
| 1512 | 2599935858 | |||
| 1513 | 2600191214 | |||
| 1514 | 2600376511 | |||
| 1515 | 2616553264 | |||
| 1516 | 2617380401 | |||
| 1517 | 2643806101 | |||
| 1518 | 2643984905 | |||
| 1519 | 2644004716 | |||
| 1520 | 2644047413 | |||
| 1521 | 2644070345 | |||
| 1522 | 2644103482 | |||
| 1523 | 2644130008 | |||
| 1524 | 2644144361 | |||
| 1525 | 2644155518 | |||
| 1526 | 2644199831 | |||
| 1527 | 2644207044 | |||
| 1528 | 2644237356 | |||
| 1529 | 2644297813 | |||
| 1530 | 2644306412 | |||
| 1531 | 2644330602 | |||
| 1532 | 2644377362 | |||
| 1533 | 2644421107 | |||
| 1534 | 2644454630 | |||
| 1535 | 2644480202 | |||
| 1536 | 2644495653 | |||
| 1537 | 2644542594 | |||
| 1538 | 2644612023 | |||
| 1539 | 2644650692 | |||
| 1540 | 2644656066 | |||
| 1541 | 2644671788 | |||
| 1542 | 2644692569 | |||
| 1543 | 2671113805 | |||
| 1544 | 2688601322 | |||
| 1545 | 2692317471 | |||
| 1546 | 2694630448 | |||
| 1547 | 2694637767 | |||
| 1548 | 2719383919 | |||
| 1549 | 2719663708 | |||
| 1550 | 2720490127 | |||
| 1551 | 2720611507 | |||
| 1552 | 2720618357 | |||
| 1553 | 2720629763 | |||
| 1554 | 2720773459 | |||
| 1555 | 2721397689 | |||
| 1556 | 2723025129 | |||
| 1557 | 2723558714 | |||
| 1558 | 2723565285 | |||
| 1559 | 2723578487 | |||
| 1560 | 2724036499 | |||
| 1561 | 2724088066 | |||
| 1562 | 2724102550 | |||
| 1563 | 2724108447 | |||
| 1564 | 2730106065 | |||
| 1565 | 2738801415 | |||
| 1566 | 2739036774 | |||
| 1567 | 2739309995 | |||
| 1568 | 2753462632 | |||
| 1569 | 2756674670 | |||
| 1570 | 2758640879 | |||
| 1571 | 2766063523 | |||
| 1572 | 2776911827 | |||
| 1573 | 2778179573 | |||
| 1574 | 2792583095 | |||
| 1575 | 2792621233 | |||
| 1576 | 2792625448 | |||
| 1577 | 2792637882 | |||
| 1578 | 2792746457 | |||
| 1579 | 2793282201 | |||
| 1580 | 2793299827 | |||
| 1581 | 2793325451 | |||
| 1582 | 2793330004 | |||
| 1583 | 2793338285 | |||
| 1584 | 2793344197 | |||
| 1585 | 2793352814 | |||
| 1586 | 2805931699 | |||
| 1587 | 2805932562 | |||
| 1588 | 2806048474 | |||
| 1589 | 2806055947 | |||
| 1590 | 2806062725 | |||
| 1591 | 2806066467 | |||
| 1592 | 2806073530 | |||
| 1593 | 2819245057 | |||
| 1594 | 2819686079 | |||
| 1595 | 2821123473 | |||
| 1596 | 2837681505 | |||
| 1597 | 2838022611 | |||
| 1598 | 2838027691 | |||
| 1599 | 2838029434 | |||
| 1600 | 2838040034 | |||
| 1601 | 2838048646 | |||
| 1602 | 2838054604 | |||
| 1603 | 2838064277 | |||
| 1604 | 2838070901 | |||
| 1605 | 2838075164 | |||
| 1606 | 2838666060 | |||
| 1607 | 2838673337 | |||
| 1608 | 2838693685 | |||
| 1609 | 2838706084 | |||
| 1610 | 2838736361 | |||
| 1611 | 2838739504 | |||
| 1612 | 2838749180 | |||
| 1613 | 2841735723 | |||
| 1614 | 2841844372 | |||
| 1615 | 2841858477 | |||
| 1616 | 2842111975 | |||
| 1617 | 2842144093 | |||
| 1618 | 2842150573 | |||
| 1619 | 2842163313 | |||
| 1620 | 2842165385 | |||
| 1621 | 2842186922 | |||
| 1622 | 2842198028 | |||
| 1623 | 2842204248 | |||
| 1624 | 2842207150 | |||
| 1625 | 2842236500 | |||
| 1626 | 2842250079 | |||
| 1627 | 2842255548 | |||
| 1628 | 2842264108 | |||
| 1629 | 2842270691 | |||
| 1630 | 2842278241 | |||
| 1631 | 2842280157 | |||
| 1632 | 2842286616 | |||
| 1633 | 2842310471 | |||
| 1634 | 2842317659 | |||
| 1635 | 2842323922 | |||
| 1636 | 2842403831 | |||
| 1637 | 2842410467 | |||
| 1638 | 2842417114 | |||
| 1639 | 2842424516 | |||
| 1640 | 2842434575 | |||
| 1641 | 2842440965 | |||
| 1642 | 2842447563 | |||
| 1643 | 2842454301 | |||
| 1644 | 2842468936 | |||
| 1645 | 2842475529 | |||
| 1646 | 2842476136 | |||
| 1647 | 2842486223 | |||
| 1648 | 2842492656 | |||
| 1649 | 2842500245 | |||
| 1650 | 2842502962 | |||
| 1651 | 2842521490 | |||
| 1652 | 2842923128 | |||
| 1653 | 2844004228 | |||
| 1654 | 2844009982 | |||
| 1655 | 2844165066 | |||
| 1656 | 2844456229 | |||
| 1657 | 2847417460 | |||
| 1658 | 2847672852 | |||
| 1659 | 2847689326 | |||
| 1660 | 2848992295 | |||
| 1661 | 2850079798 | |||
| 1662 | 2855873565 | |||
| 1663 | 2856314802 | |||
| 1664 | 2856327974 | |||
| 1665 | 2856332149 | |||
| 1666 | 2856335137 | |||
| 1667 | 2856346689 | |||
| 1668 | 2856354799 | |||
| 1669 | 2856360698 | |||
| 1670 | 2856371133 | |||
| 1671 | 2857354225 | |||
| 1672 | 2857370346 | |||
| 1673 | 2857521907 | |||
| 1674 | 2857533577 | |||
| 1675 | 2869164636 | |||
| 1676 | 2869174869 | |||
| 1677 | 2869242108 | |||
| 1678 | 2869248364 | |||
| 1679 | 2869253918 | |||
| 1680 | 2869263681 | |||
| 1681 | 2869270309 | |||
| 1682 | 2869275905 | |||
| 1683 | 2869279925 | |||
| 1684 | 2869292356 | |||
| 1685 | 2871429171 | |||
| 1686 | 2871443861 | |||
| 1687 | 2871445374 | |||
| 1688 | 2871455305 | |||
| 1689 | 2871460785 | |||
| 1690 | 2871470950 | |||
| 1691 | 2871480293 | |||
| 1692 | 2871485427 | |||
| 1693 | 2871490694 | |||
| 1694 | 2871499269 | |||
| 1695 | 2874108923 | |||
| 1696 | 2874114363 | |||
| 1697 | 2874121849 | |||
| 1698 | 2874129623 | |||
| 1699 | 2874145581 | |||
| 1700 | 2874154077 | |||
| 1701 | 2874161579 | |||
| 1702 | 2874162675 | |||
| 1703 | 2874171647 | |||
| 1704 | 2876363166 | |||
| 1705 | 2876385075 | |||
| 1706 | 2876388495 | |||
| 1707 | 2876393038 | |||
| 1708 | 2876404323 | |||
| 1709 | 2876411951 | |||
| 1710 | 2876419761 | |||
| 1711 | 2876427612 | |||
| 1712 | 2878036117 | |||
| 1713 | 2878738261 | |||
| 1714 | 2878740233 | |||
| 1715 | 2878752699 | |||
| 1716 | 2878755097 | |||
| 1717 | 2878763459 | |||
| 1718 | 2878770457 | |||
| 1719 | 2878776577 | |||
| 1720 | 2878784420 | |||
| 1721 | 2878793666 | |||
| 1722 | 2881147502 | |||
| 1723 | 2881158606 | |||
| 1724 | 2881164278 | |||
| 1725 | 2881853066 | |||
| 1726 | 2881854969 | |||
| 1727 | 2881868863 | |||
| 1728 | 2882632879 | |||
| 1729 | 2882917594 | |||
| 1730 | 2885306142 | |||
| 1731 | 2885314802 | |||
| 1732 | 2885320301 | |||
| 1733 | 2885331221 | |||
| 1734 | 2885337709 | |||
| 1735 | 2885346796 | |||
| 1736 | 2885353849 | |||
| 1737 | 2888342593 | |||
| 1738 | 2888350297 | |||
| 1739 | 2888352159 | |||
| 1740 | 2889014149 | |||
| 1741 | 2889021145 | |||
| 1742 | 2889793363 | |||
| 1743 | 2889916305 | |||
| 1744 | 2891049527 | |||
| 1745 | 2896388581 | |||
| 1746 | 2899794629 | |||
| 1747 | 2899805495 | |||
| 1748 | 2903454760 | |||
| 1749 | 2903494798 | |||
| 1750 | 2903499421 | |||
| 1751 | 2903521517 | |||
| 1752 | 2903525116 | |||
| 1753 | 2903532140 | |||
| 1754 | 2903544074 | |||
| 1755 | 2904659744 | |||
| 1756 | 2906315090 | |||
| 1757 | 2906321346 | |||
| 1758 | 2906334663 | |||
| 1759 | 2906366210 | |||
| 1760 | 2906370953 | |||
| 1761 | 2906396934 | |||
| 1762 | 2906407553 | |||
| 1763 | 2906411519 | |||
| 1764 | 2906414991 | |||
| 1765 | 2906433187 | |||
| 1766 | 2913298165 | |||
| 1767 | 2915651090 | |||
| 1768 | 2919101532 | |||
| 1769 | 2919172212 | |||
| 1770 | 2919408656 | |||
| 1771 | 2920763582 | |||
| 1772 | 2920823194 | |||
| 1773 | 2922133934 | |||
| 1774 | 2922154222 | |||
| 1775 | 2922164387 | |||
| 1776 | 2922174068 | |||
| 1777 | 2922179151 | |||
| 1778 | 2922192974 | |||
| 1779 | 2923556514 | |||
| 1780 | 2924715143 | |||
| 1781 | 2924723440 | |||
| 1782 | 2924729890 | |||
| 1783 | 2924735771 | |||
| 1784 | 2924746526 | |||
| 1785 | 2924750234 | |||
| 1786 | 2924758934 | |||
| 1787 | 2924767584 | |||
| 1788 | 2924777833 | |||
| 1789 | 2924791316 | |||
| 1790 | 2933020805 | |||
| 1791 | 2933576909 | |||
| 1792 | 2933587305 | |||
| 1793 | 2933601702 | |||
| 1794 | 2935902695 | |||
| 1795 | 2936369162 | |||
| 1796 | 2936387213 | |||
| 1797 | 2937821631 | |||
| 1798 | 2937825902 | |||
| 1799 | 2937837152 | |||
| 1800 | 2937844766 | |||
| 1801 | 2937853362 | |||
| 1802 | 2937865386 | |||
| 1803 | 2937877071 | |||
| 1804 | 2937884395 | |||
| 1805 | 2937892359 | |||
| 1806 | 2937980418 | |||
| 1807 | 2937981536 | |||
| 1808 | 2937997919 | |||
| 1809 | 2938017254 | |||
| 1810 | 2939672579 | |||
| 1811 | 2941500907 | |||
| 1812 | 2958035792 | |||
| 1813 | 2958044823 | |||
| 1814 | 2958048038 | |||
| 1815 | 2958066622 | |||
| 1816 | 2958076411 | |||
| 1817 | 2958091706 | |||
| 1818 | 2958098040 | |||
| 1819 | 2958101401 | |||
| 1820 | 2958112132 | |||
| 1821 | 2958119784 | |||
| 1822 | 2958125221 | |||
| 1823 | 2958136756 | |||
| 1824 | 2958144033 | |||
| 1825 | 2958145657 | |||
| 1826 | 2958161629 | |||
| 1827 | 2958168394 | |||
| 1828 | 2958179456 | |||
| 1829 | 2958186639 | |||
| 1830 | 2961085140 | |||
| 1831 | 2961115068 | |||
| 1832 | 2961128277 | |||
| 1833 | 2961137043 | |||
| 1834 | 2961166858 | |||
| 1835 | 2961176861 | |||
| 1836 | 2961190605 | |||
| 1837 | 2963651045 | |||
| 1838 | 2965021682 | |||
| 1839 | 2965028956 | |||
| 1840 | 2965033869 | |||
| 1841 | 2965044165 | |||
| 1842 | 2965055052 | |||
| 1843 | 2965068115 | |||
| 1844 | 2965090090 | |||
| 1845 | 2965103139 | |||
| 1846 | 2965116898 | |||
| 1847 | 2965121619 | |||
| 1848 | 2968001032 | |||
| 1849 | 2968007085 | |||
| 1850 | 2968021518 | |||
| 1851 | 2968089099 | |||
| 1852 | 2968093039 | |||
| 1853 | 2968102677 | |||
| 1854 | 2968110796 | |||
| 1855 | 2968121477 | |||
| 1856 | 2968131490 | |||
| 1857 | 2968143411 | |||
| 1858 | 2968175264 | |||
| 1859 | 2970476803 | |||
| 1860 | 2970494261 | |||
| 1861 | 2970509533 | |||
| 1862 | 2970515059 | |||
| 1863 | 2970525409 | |||
| 1864 | 2970537567 | |||
| 1865 | 2970543269 | |||
| 1866 | 2970552257 | |||
| 1867 | 2970558302 | |||
| 1868 | 2970594524 | |||
| 1869 | 2970623717 | |||
| 1870 | 2977824237 | |||
| 1871 | 2977834641 | |||
| 1872 | 2977850143 | |||
| 1873 | 2977852385 | |||
| 1874 | 2977860878 | |||
| 1875 | 2977868434 | |||
| 1876 | 2977875268 | |||
| 1877 | 2977904138 | |||
| 1878 | 2977914488 | |||
| 1879 | 2977915920 | |||
| 1880 | 2977927277 | |||
| 1881 | 2977940013 | |||
| 1882 | 2977949614 | |||
| 1883 | 2977952982 | |||
| 1884 | 2977957819 | |||
| 1885 | 2977979144 | |||
| 1886 | 2977991393 | |||
| 1887 | 2979715157 | |||
| 1888 | 2979766287 | |||
| 1889 | 2979774414 | |||
| 1890 | 2979785711 | |||
| 1891 | 2979800512 | |||
| 1892 | 2979814321 | |||
| 1893 | 2987642365 | |||
| 1894 | 2987646702 | |||
| 1895 | 2987662870 | |||
| 1896 | 2987668056 | |||
| 1897 | 2987677399 | |||
| 1898 | 2989772602 | |||
| 1899 | 2996312750 | |||
| 1900 | 2996346388 | |||
| 1901 | 2996356228 | |||
| 1902 | 2996393606 | |||
| 1903 | 2996888308 | |||
| 1904 | 2996893240 | |||
| 1905 | 3000135827 | |||
| 1906 | 3003931732 | |||
| 1907 | 3004172429 | |||
| 1908 | 3004191922 | |||
| 1909 | 3004201026 | |||
| 1910 | 3004210446 | |||
| 1911 | 3004216802 | |||
| 1912 | 3004219835 | |||
| 1913 | 3004235203 | |||
| 1914 | 3004244939 | |||
| 1915 | 3004269625 | |||
| 1916 | 3004282542 | |||
| 1917 | 3004296848 | |||
| 1918 | 3004338177 | |||
| 1919 | 3005410968 | |||
| 1920 | 3005446004 | |||
| 1921 | 3005456677 | |||
| 1922 | 637077743 | |||
| 1923 | 643824362 | |||
| 1924 | 649875751 | |||
| 1925 | 8002288477 | |||
| 1926 | 8004306327 | |||
| 1927 | 8004315954 | |||
| 1928 | 8004364512 | |||
| 1929 | 8004376676 | |||
| 1930 | 8004395030 | |||
| 1931 | 8004400874 | |||
| 1932 | 8004447749 | |||
| 1933 | 8004635646 | |||
| 1934 | 8004647028 | |||
| 1935 | 8004695631 | |||
| 1936 | 8004707368 | |||
| 1937 | 8004721351 | |||
| 1938 | 8004734166 | |||
| 1939 | 8005261135 | |||
| 1940 | 8005278628 | |||
| 1941 | 8005288468 | |||
| 1942 | 8005291294 | |||
| 1943 | 8005301338 | |||
| 1944 | 8005310621 | |||
| 1945 | 8005322835 | |||
| 1946 | 8005377655 | |||
| 1947 | 8005387521 | |||
| 1948 | 8005399924 | |||
| 1949 | 8005432720 | |||
| 1950 | 8005460780 | |||
| 1951 | 8005498450 | |||
| 1952 | 8005543564 | |||
| 1953 | 8005573722 | |||
| 1954 | 8005619643 | |||
| 1955 | 8005628212 | |||
| 1956 | 8005660142 | |||
| 1957 | 8005669859 | |||
| 1958 | 8005685259 | |||
| 1959 | 8005692455 | |||
| 1960 | 8018154452 | |||
| 1961 | 8023684464 | |||
| 1962 | 8024480069 | |||
| 1963 | 8024491559 | |||
| 1964 | 8024502325 | |||
| 1965 | 8046770848 | |||
| 1966 | 8049293298 | |||
| 1967 | 8054562643 | |||
| 1968 | 8055624719 | |||
| 1969 | 8056385565 | |||
| 1970 | 8056878024 | |||
| 1971 | 8057580543 | |||
| 1972 | 8057879676 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3m7m-assembly1.cif.gz_X | crystal structure of monomeric hsp33 | 0.894 | 16 | 280 |
| 3m7m-assembly1.cif.gz_X | crystal structure of monomeric hsp33 | 0.8758 | 16 | 280 |
| 1vq0-assembly1.cif.gz_B | crystal structure of 33 kda chaperonin (heat shock protein 33 homolog) (hsp33) (tm1394) from thermotoga maritima at 2.20 a resolution | 0.8126 | 17 | 327 |
| 1vq0-assembly1.cif.gz_B | crystal structure of 33 kda chaperonin (heat shock protein 33 homolog) (hsp33) (tm1394) from thermotoga maritima at 2.20 a resolution | 0.784 | 17 | 327 |
| 1vzy-assembly1.cif.gz_A | crystal structure of the bacillus subtilis hsp33 | 0.7604 | 17 | 327 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1i7fA01 | Alpha Beta;3-Layer(bab) Sandwich;Hsp33 domain;Hsp33 domain | 0.8993 | 19 | 203 | 3.55.30.10 |
| 1i7fA01 | Alpha Beta;3-Layer(bab) Sandwich;Hsp33 domain;Hsp33 domain | 0.8791 | 19 | 203 | 3.55.30.10 |
| af_P0A6Y5_226_285_3.90.1280.10 | Alpha Beta;Alpha-Beta Complex;CBS domain Like;HSP33 redox switch-like | 0.8621 | 276 | 326 | 3.90.1280.10 |
| 1vq0B02 | Alpha Beta;Alpha-Beta Complex;CBS domain Like;HSP33 redox switch-like | 0.7967 | 280 | 327 | 3.90.1280.10 |
| 1vq0B01 | Alpha Beta;3-Layer(bab) Sandwich;Hsp33 domain;Hsp33 domain | 0.7911 | 17 | 279 | 3.55.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A529SKM0-F1-model_v4 | Hsp33 family molecular chaperone | 0.9759 | 34 | 194 |
GO:0005737
GO:0042026 GO:0044183 GO:0051082 |
| AF-A0A529I961-F1-model_v4 | deleted | 0.9604 | 1 | 199 |
|
| AF-F7QIK8-F1-model_v4 | Chaperone protein Hsp33 | 0.9581 | 16 | 329 |
GO:0005737
GO:0042026 GO:0044183 GO:0051082 |
| AF-B9JQS2-F1-model_v4 | Chaperonin heat shock protein 33 | 0.9578 | 40 | 329 |
GO:0005737
GO:0042026 GO:0044183 GO:0051082 |
| AF-A0A847ZUN3-F1-model_v4 | Hsp33 family molecular chaperone | 0.9567 | 19 | 155 |
GO:0005737
GO:0042026 GO:0044183 GO:0051082 |