F487536
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 986 | 464 | 1972 | 238 |
Family's Representative Sequence
| Representative Sequence | 3300050496|nmdc:mga07m45_960_c1|nmdc:mga07m45_960_c1_8142_8942 |
| Length | 266 |
| Sequence | LRRAVDDTAFDRPPRDGRGAPLNLSPGATMYTAKGRLDLDSQLKQHSTLVRRLAHQMIAKLPANVEIDDLIQVGMIGLADALSRFDASQGVQFETFATQRIRGAMLDELRGNDYLSRGTRKQQRSIESAVHKLEQKLGRAPVESEIAKEMGVTLIEYQELLGKVRGTQLVYLEDMSGDEGDNDFLDRHVADEDSNPLAQLQDQRMREALIEAIKVLPEREQYVMSMYYEHDMNLKEIAAVLKVTESRVCQLHSQSIARLRVKLRAY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 15 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 26 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 80 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 83 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 84 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 85 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 94 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 95 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Metagenome | Rhizosphere |
| 108 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 126 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 132 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 133 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 135 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 202 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 212 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 213 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 214 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 215 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 216 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 217 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 218 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 220 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 221 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 222 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 223 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 224 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 225 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 226 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 227 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 228 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 229 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 230 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 231 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 232 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 233 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 234 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 235 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 236 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 237 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 238 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 239 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 240 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 241 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 242 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 243 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 244 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 245 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 246 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 247 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 248 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 249 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 251 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 253 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 254 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 255 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 256 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 257 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 260 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 261 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 262 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 263 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 264 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 265 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 266 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 267 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 268 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 269 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 270 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 271 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 272 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 273 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 274 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 275 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 276 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 277 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 278 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 279 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 280 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 281 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 282 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 283 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 284 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 285 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 286 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 287 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 288 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 289 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 290 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 291 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 292 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 293 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 294 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 295 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 296 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 297 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 298 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 299 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 300 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 301 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 302 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 348 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 349 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 350 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 351 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 352 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 353 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 356 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 357 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 358 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 359 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 360 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 361 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 362 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 363 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 365 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 369 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 384 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 385 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 386 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 387 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 388 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 389 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 390 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 391 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 392 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 393 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 394 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 395 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 396 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 397 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 398 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 399 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 400 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 401 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 402 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 403 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 405 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 406 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 407 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 408 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 409 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 410 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 411 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 412 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 417 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 419 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 422 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 423 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 424 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 425 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 426 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 427 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 428 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 429 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 430 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 431 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 432 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 433 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 434 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 435 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 436 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 437 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 438 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 439 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 440 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 441 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 442 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 444 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 446 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 447 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 448 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 449 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 450 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 451 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 452 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 453 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 454 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 455 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 456 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 457 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 458 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 459 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 460 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 461 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 462 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 463 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 464 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.06 |
| Metatranscriptomes | 1.01 |
| Isolates | 1.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.52 |
| Nodule | 0.61 |
| Rhizoplane | 2.94 |
| Rhizosphere | 72.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | nmdc:mga07m45_960_c1 | 3300050496 | Bacteria | 12674 |
| 2 | SwRhRL2b_contig_1230578 | 2162886007 | Bacteria | 822 |
| 3 | SwRhRL2b_contig_3945145 | 2162886007 | Bacteria | 822 |
| 4 | JGI24740J21852_10052921 | 3300001979 | Bacteria | 1154 |
| 5 | JGI24744J21845_10014524 | 3300002077 | Bacteria | 1580 |
| 6 | JGI25154J39366_1001409 | 3300002738 | Bacteria | 8636 |
| 7 | JGI25157J39369_1000027 | 3300002741 | Bacteria | 147448 |
| 8 | JGI25164J39214_1005229 | 3300002772 | Bacteria | 1421 |
| 9 | JGI25152J39213_1002504 | 3300002773 | Bacteria | 6949 |
| 10 | JGI25153J46596_10004012 | 3300003215 | Bacteria | 8030 |
| 11 | JGI25153J46596_10008556 | 3300003215 | Bacteria | 4876 |
| 12 | rootH1_10001428 | 3300003316 | Bacteria | 5388 |
| 13 | rootH2_10031478 | 3300003320 | Bacteria | 5629 |
| 14 | rootL2_10003861 | 3300003322 | Bacteria | 52646 |
| 15 | rootH1_10005727 | 3300003323 | Bacteria | 11133 |
| 16 | rootH1_10065205 | 3300003323 | Bacteria | 2935 |
| 17 | JGI26145J50221_1002941 | 3300003371 | Bacteria | 1347 |
| 18 | Ga0055533_1000073 | 3300003756 | Bacteria | 142476 |
| 19 | Ga0055525_1000038 | 3300003759 | Bacteria | 297540 |
| 20 | Ga0055525_1001631 | 3300003759 | Bacteria | 3488 |
| 21 | Ga0055535_1003758 | 3300003761 | Bacteria | 4068 |
| 22 | Ga0055529_1000385 | 3300003763 | Bacteria | 47717 |
| 23 | Ga0055526_1009433 | 3300003771 | Bacteria | 4690 |
| 24 | Ga0055524_1000242 | 3300003775 | Bacteria | 57160 |
| 25 | Ga0055524_1001332 | 3300003775 | Bacteria | 14393 |
| 26 | Ga0055524_1007381 | 3300003775 | Bacteria | 4674 |
| 27 | Ga0055530_10004226 | 3300003791 | Bacteria | 7540 |
| 28 | Ga0055530_10005683 | 3300003791 | Bacteria | 5830 |
| 29 | Ga0055530_10032056 | 3300003791 | Bacteria | 1371 |
| 30 | Ga0055540_1000015 | 3300003792 | Bacteria | 232986 |
| 31 | Ga0055531_10000043 | 3300003794 | Bacteria | 133906 |
| 32 | Ga0055531_10008158 | 3300003794 | Bacteria | 5578 |
| 33 | Ga0055531_10017077 | 3300003794 | Bacteria | 3086 |
| 34 | Ga0055531_10019016 | 3300003794 | Bacteria | 2805 |
| 35 | Ga0055543_1002176 | 3300004625 | Bacteria | 6739 |
| 36 | Ga0055543_1007063 | 3300004625 | Bacteria | 2637 |
| 37 | Ga0065165_1000283 | 3300005262 | Bacteria | 86141 |
| 38 | Ga0065165_1000732 | 3300005262 | Bacteria | 45731 |
| 39 | Ga0065165_1005192 | 3300005262 | Bacteria | 7508 |
| 40 | Ga0065704_10325887 | 3300005289 | Bacteria | 845 |
| 41 | Ga0065715_10336276 | 3300005293 | Bacteria | 962 |
| 42 | Ga0065707_10237321 | 3300005295 | Bacteria | 1168 |
| 43 | Ga0070676_10001230 | 3300005328 | Bacteria | 12876 |
| 44 | Ga0070676_10274495 | 3300005328 | Bacteria | 1133 |
| 45 | Ga0070690_100011544 | 3300005330 | Bacteria | 5169 |
| 46 | Ga0070690_100012917 | 3300005330 | Bacteria | 4924 |
| 47 | Ga0070670_100002549 | 3300005331 | Bacteria | 15038 |
| 48 | Ga0070670_100021319 | 3300005331 | Bacteria | 5574 |
| 49 | Ga0070670_100038937 | 3300005331 | Bacteria | 4088 |
| 50 | Ga0070670_100154794 | 3300005331 | Bacteria | 1985 |
| 51 | Ga0070677_10003169 | 3300005333 | Bacteria | 5292 |
| 52 | Ga0070677_10004158 | 3300005333 | Bacteria | 4706 |
| 53 | Ga0070677_10020378 | 3300005333 | Bacteria | 2415 |
| 54 | Ga0068869_100035286 | 3300005334 | Bacteria | 3544 |
| 55 | Ga0068869_100079511 | 3300005334 | Bacteria | 2444 |
| 56 | Ga0070680_100009256 | 3300005336 | Bacteria | 7556 |
| 57 | Ga0070682_100086284 | 3300005337 | Bacteria | 2044 |
| 58 | Ga0068868_100007055 | 3300005338 | Bacteria | 7986 |
| 59 | Ga0068868_100065272 | 3300005338 | Bacteria | 2891 |
| 60 | Ga0070660_100086354 | 3300005339 | Bacteria | 2468 |
| 61 | Ga0070660_100109700 | 3300005339 | Bacteria | 2194 |
| 62 | Ga0070689_100050074 | 3300005340 | Bacteria | 3226 |
| 63 | Ga0070661_100081275 | 3300005344 | Bacteria | 2392 |
| 64 | Ga0070661_100131844 | 3300005344 | Bacteria | 1878 |
| 65 | Ga0070668_100028598 | 3300005347 | Bacteria | 4231 |
| 66 | Ga0070668_100120560 | 3300005347 | Bacteria | 2096 |
| 67 | Ga0070669_100002315 | 3300005353 | Bacteria | 13787 |
| 68 | Ga0070669_100062840 | 3300005353 | Bacteria | 2731 |
| 69 | Ga0070669_100236590 | 3300005353 | Bacteria | 1449 |
| 70 | Ga0070669_100238908 | 3300005353 | Bacteria | 1442 |
| 71 | Ga0070675_100015429 | 3300005354 | Bacteria | 6039 |
| 72 | Ga0070675_100051441 | 3300005354 | Bacteria | 3385 |
| 73 | Ga0070675_100057267 | 3300005354 | Bacteria | 3212 |
| 74 | Ga0070675_100147197 | 3300005354 | Bacteria | 2017 |
| 75 | Ga0070675_100434515 | 3300005354 | Bacteria | 1175 |
| 76 | Ga0070671_100018406 | 3300005355 | Bacteria | 5673 |
| 77 | Ga0070671_100034187 | 3300005355 | Bacteria | 4208 |
| 78 | Ga0070671_100057393 | 3300005355 | Bacteria | 3240 |
| 79 | Ga0070671_100063761 | 3300005355 | Bacteria | 3069 |
| 80 | Ga0070671_100080833 | 3300005355 | Bacteria | 2718 |
| 81 | Ga0070671_100127555 | 3300005355 | Bacteria | 2142 |
| 82 | Ga0070674_100088546 | 3300005356 | Bacteria | 2228 |
| 83 | Ga0070673_100002831 | 3300005364 | Bacteria | 10677 |
| 84 | Ga0070673_100143779 | 3300005364 | Bacteria | 2014 |
| 85 | Ga0070673_100480446 | 3300005364 | Bacteria | 1121 |
| 86 | Ga0070659_100002606 | 3300005366 | Bacteria | 12819 |
| 87 | Ga0070659_100048346 | 3300005366 | Bacteria | 3341 |
| 88 | Ga0070659_100102453 | 3300005366 | Bacteria | 2305 |
| 89 | Ga0070667_100003888 | 3300005367 | Bacteria | 12682 |
| 90 | Ga0070667_100013392 | 3300005367 | Bacteria | 6779 |
| 91 | Ga0070667_100039447 | 3300005367 | Bacteria | 3958 |
| 92 | Ga0070667_100146474 | 3300005367 | Bacteria | 2071 |
| 93 | Ga0070667_100508456 | 3300005367 | Bacteria | 1105 |
| 94 | Ga0070700_100057256 | 3300005441 | Bacteria | 2446 |
| 95 | Ga0070700_100118124 | 3300005441 | Bacteria | 1773 |
| 96 | Ga0070663_100001718 | 3300005455 | Bacteria | 12149 |
| 97 | Ga0070663_100028656 | 3300005455 | Bacteria | 3794 |
| 98 | Ga0070663_100256217 | 3300005455 | Bacteria | 1386 |
| 99 | Ga0070678_100011117 | 3300005456 | Bacteria | 5538 |
| 100 | Ga0070678_100032599 | 3300005456 | Bacteria | 3607 |
| 101 | Ga0070678_100128550 | 3300005456 | Bacteria | 2009 |
| 102 | Ga0070678_100604324 | 3300005456 | Bacteria | 979 |
| 103 | Ga0070662_100001001 | 3300005457 | Bacteria | 17282 |
| 104 | Ga0070662_100017955 | 3300005457 | Bacteria | 4777 |
| 105 | Ga0070662_100020424 | 3300005457 | Bacteria | 4509 |
| 106 | Ga0070681_10027720 | 3300005458 | Bacteria | 5695 |
| 107 | Ga0068867_100000118 | 3300005459 | Bacteria | 50315 |
| 108 | Ga0068867_100022580 | 3300005459 | Bacteria | 4498 |
| 109 | Ga0068867_100093859 | 3300005459 | Bacteria | 2281 |
| 110 | Ga0068867_100123370 | 3300005459 | Bacteria | 2004 |
| 111 | Ga0068867_100197593 | 3300005459 | Bacteria | 1608 |
| 112 | Ga0068867_100298773 | 3300005459 | Bacteria | 1327 |
| 113 | Ga0070685_10031202 | 3300005466 | Bacteria | 2975 |
| 114 | Ga0070706_100000965 | 3300005467 | Bacteria | 31374 |
| 115 | Ga0070707_100028547 | 3300005468 | Bacteria | 5311 |
| 116 | Ga0070698_100056763 | 3300005471 | Bacteria | 3965 |
| 117 | Ga0070684_100158905 | 3300005535 | Bacteria | 2050 |
| 118 | Ga0070684_100351681 | 3300005535 | Bacteria | 1355 |
| 119 | Ga0070684_100691494 | 3300005535 | Bacteria | 951 |
| 120 | Ga0068853_100000531 | 3300005539 | Bacteria | 25891 |
| 121 | Ga0068853_100186423 | 3300005539 | Bacteria | 1883 |
| 122 | Ga0070672_100006693 | 3300005543 | Bacteria | 7767 |
| 123 | Ga0070672_100008379 | 3300005543 | Bacteria | 7067 |
| 124 | Ga0070672_100046804 | 3300005543 | Bacteria | 3353 |
| 125 | Ga0070672_100057494 | 3300005543 | Bacteria | 3053 |
| 126 | Ga0070672_100078741 | 3300005543 | Bacteria | 2637 |
| 127 | Ga0070672_100095161 | 3300005543 | Bacteria | 2408 |
| 128 | Ga0070672_100121856 | 3300005543 | Bacteria | 2135 |
| 129 | Ga0070672_100254614 | 3300005543 | Bacteria | 1479 |
| 130 | Ga0070686_100065221 | 3300005544 | Bacteria | 2365 |
| 131 | Ga0070665_100098483 | 3300005548 | Bacteria | 2928 |
| 132 | Ga0070665_100154019 | 3300005548 | Bacteria | 2300 |
| 133 | Ga0068855_100009023 | 3300005563 | Bacteria | 12049 |
| 134 | Ga0068855_100084890 | 3300005563 | Bacteria | 3664 |
| 135 | Ga0068855_100538168 | 3300005563 | Bacteria | 1266 |
| 136 | Ga0070664_100028601 | 3300005564 | Bacteria | 4638 |
| 137 | Ga0070664_100064225 | 3300005564 | Bacteria | 3131 |
| 138 | Ga0068857_100086072 | 3300005577 | Bacteria | 2809 |
| 139 | Ga0068854_100070338 | 3300005578 | Bacteria | 2558 |
| 140 | Ga0068854_100152457 | 3300005578 | Bacteria | 1783 |
| 141 | Ga0068854_100171067 | 3300005578 | Bacteria | 1690 |
| 142 | Ga0068854_100188364 | 3300005578 | Bacteria | 1615 |
| 143 | Ga0068856_100019359 | 3300005614 | Bacteria | 6608 |
| 144 | Ga0068856_100025775 | 3300005614 | Bacteria | 5734 |
| 145 | Ga0068852_100073693 | 3300005616 | Bacteria | 3004 |
| 146 | Ga0068852_100077216 | 3300005616 | Bacteria | 2943 |
| 147 | Ga0068852_100119604 | 3300005616 | Bacteria | 2408 |
| 148 | Ga0068852_100619570 | 3300005616 | Bacteria | 1088 |
| 149 | Ga0068852_100645561 | 3300005616 | Bacteria | 1065 |
| 150 | Ga0068859_100012494 | 3300005617 | Bacteria | 8542 |
| 151 | Ga0068859_100077548 | 3300005617 | Bacteria | 3363 |
| 152 | Ga0068859_100086979 | 3300005617 | Bacteria | 3172 |
| 153 | Ga0068859_101281275 | 3300005617 | Bacteria | 808 |
| 154 | Ga0068864_100009897 | 3300005618 | Bacteria | 7863 |
| 155 | Ga0068864_100011232 | 3300005618 | Bacteria | 7401 |
| 156 | Ga0068864_100015484 | 3300005618 | Bacteria | 6340 |
| 157 | Ga0068864_100042843 | 3300005618 | Bacteria | 3874 |
| 158 | Ga0068864_100485456 | 3300005618 | Bacteria | 1186 |
| 159 | Ga0068864_100722176 | 3300005618 | Bacteria | 975 |
| 160 | Ga0068866_10008904 | 3300005718 | Bacteria | 4247 |
| 161 | Ga0068866_10078971 | 3300005718 | Bacteria | 1762 |
| 162 | Ga0068861_100002963 | 3300005719 | Bacteria | 11201 |
| 163 | Ga0068861_100012125 | 3300005719 | Bacteria | 6007 |
| 164 | Ga0068861_100016485 | 3300005719 | Bacteria | 5229 |
| 165 | Ga0068861_100020535 | 3300005719 | Bacteria | 4734 |
| 166 | Ga0068861_100073836 | 3300005719 | Bacteria | 2651 |
| 167 | Ga0068861_100102900 | 3300005719 | Bacteria | 2275 |
| 168 | Ga0068851_10031320 | 3300005834 | Bacteria | 2641 |
| 169 | Ga0068851_10075496 | 3300005834 | Bacteria | 1752 |
| 170 | Ga0068851_10097806 | 3300005834 | Bacteria | 1553 |
| 171 | Ga0068870_10067885 | 3300005840 | Bacteria | 1936 |
| 172 | Ga0068870_10168954 | 3300005840 | Bacteria | 1303 |
| 173 | Ga0068863_100005044 | 3300005841 | Bacteria | 13017 |
| 174 | Ga0068863_100016273 | 3300005841 | Bacteria | 7136 |
| 175 | Ga0068863_100026617 | 3300005841 | Bacteria | 5516 |
| 176 | Ga0068863_100081785 | 3300005841 | Bacteria | 3060 |
| 177 | Ga0068863_100265043 | 3300005841 | Bacteria | 1662 |
| 178 | Ga0068858_100003535 | 3300005842 | Bacteria | 15479 |
| 179 | Ga0068858_100020363 | 3300005842 | Bacteria | 6204 |
| 180 | Ga0068858_100031405 | 3300005842 | Bacteria | 4933 |
| 181 | Ga0068860_100022185 | 3300005843 | Bacteria | 6146 |
| 182 | Ga0068860_100037149 | 3300005843 | Bacteria | 4662 |
| 183 | Ga0068860_100064591 | 3300005843 | Bacteria | 3476 |
| 184 | Ga0068860_100124585 | 3300005843 | Bacteria | 2470 |
| 185 | Ga0068860_100149613 | 3300005843 | Bacteria | 2248 |
| 186 | Ga0068860_100184950 | 3300005843 | Bacteria | 2015 |
| 187 | Ga0068860_100294881 | 3300005843 | Bacteria | 1587 |
| 188 | Ga0068862_100005039 | 3300005844 | Bacteria | 11116 |
| 189 | Ga0068862_100014167 | 3300005844 | Bacteria | 6610 |
| 190 | Ga0068862_100186189 | 3300005844 | Bacteria | 1866 |
| 191 | Ga0068862_100202946 | 3300005844 | Bacteria | 1788 |
| 192 | Ga0081455_10127724 | 3300005937 | Bacteria | 1992 |
| 193 | Ga0075365_10029275 | 3300006038 | Bacteria | 3518 |
| 194 | Ga0075363_100020269 | 3300006048 | Bacteria | 3333 |
| 195 | Ga0075363_100044822 | 3300006048 | Bacteria | 2344 |
| 196 | Ga0075362_10005519 | 3300006177 | Bacteria | 4636 |
| 197 | Ga0075362_10034342 | 3300006177 | Bacteria | 2210 |
| 198 | Ga0075362_10124993 | 3300006177 | Bacteria | 1220 |
| 199 | Ga0075367_10008638 | 3300006178 | Bacteria | 5285 |
| 200 | Ga0075367_10011101 | 3300006178 | Bacteria | 4752 |
| 201 | Ga0075367_10036535 | 3300006178 | Bacteria | 2850 |
| 202 | Ga0075367_10066862 | 3300006178 | Bacteria | 2154 |
| 203 | Ga0075369_10102269 | 3300006186 | Bacteria | 1286 |
| 204 | Ga0075369_10239386 | 3300006186 | Bacteria | 842 |
| 205 | Ga0075366_10005622 | 3300006195 | Bacteria | 6797 |
| 206 | Ga0075366_10006143 | 3300006195 | Bacteria | 6551 |
| 207 | Ga0075366_10007241 | 3300006195 | Bacteria | 6114 |
| 208 | Ga0075366_10009655 | 3300006195 | Bacteria | 5394 |
| 209 | Ga0075366_10013728 | 3300006195 | Bacteria | 4616 |
| 210 | Ga0075366_10022545 | 3300006195 | Bacteria | 3664 |
| 211 | Ga0075366_10027031 | 3300006195 | Bacteria | 3365 |
| 212 | Ga0075366_10044385 | 3300006195 | Bacteria | 2634 |
| 213 | Ga0075366_10086869 | 3300006195 | Bacteria | 1871 |
| 214 | Ga0075366_10192772 | 3300006195 | Bacteria | 1239 |
| 215 | Ga0097621_100030138 | 3300006237 | Bacteria | 4293 |
| 216 | Ga0097621_100043267 | 3300006237 | Bacteria | 3630 |
| 217 | Ga0097621_100104548 | 3300006237 | Bacteria | 2386 |
| 218 | Ga0075370_10000130 | 3300006353 | Bacteria | 25186 |
| 219 | Ga0075370_10001345 | 3300006353 | Bacteria | 10583 |
| 220 | Ga0075370_10002588 | 3300006353 | Bacteria | 8433 |
| 221 | Ga0075370_10003017 | 3300006353 | Bacteria | 7932 |
| 222 | Ga0075370_10009309 | 3300006353 | Bacteria | 5096 |
| 223 | Ga0075370_10012654 | 3300006353 | Bacteria | 4466 |
| 224 | Ga0075370_10062644 | 3300006353 | Bacteria | 2119 |
| 225 | Ga0075370_10064608 | 3300006353 | Bacteria | 2087 |
| 226 | Ga0075370_10113352 | 3300006353 | Bacteria | 1575 |
| 227 | Ga0068871_100109875 | 3300006358 | Bacteria | 2318 |
| 228 | Ga0075434_100537458 | 3300006871 | Bacteria | 1189 |
| 229 | Ga0075429_100001726 | 3300006880 | Bacteria | 18078 |
| 230 | Ga0068865_100005096 | 3300006881 | Bacteria | 7955 |
| 231 | Ga0097620_100012494 | 3300006931 | Bacteria | 8542 |
| 232 | Ga0097620_100077545 | 3300006931 | Bacteria | 3363 |
| 233 | Ga0097620_100086975 | 3300006931 | Bacteria | 3172 |
| 234 | Ga0097620_101281293 | 3300006931 | Bacteria | 808 |
| 235 | Ga0099823_1031990 | 3300006944 | Bacteria | 4307 |
| 236 | Ga0079104_1000040 | 3300006946 | Bacteria | 187962 |
| 237 | Ga0079104_1000427 | 3300006946 | Bacteria | 47886 |
| 238 | Ga0105250_10000379 | 3300009092 | Bacteria | 33227 |
| 239 | Ga0105240_10003000 | 3300009093 | Bacteria | 26554 |
| 240 | Ga0105240_10054403 | 3300009093 | Bacteria | 5016 |
| 241 | Ga0105240_10076067 | 3300009093 | Bacteria | 4140 |
| 242 | Ga0105240_10149156 | 3300009093 | Bacteria | 2787 |
| 243 | Ga0105245_10110625 | 3300009098 | Bacteria | 2554 |
| 244 | Ga0105245_10168037 | 3300009098 | Bacteria | 2087 |
| 245 | Ga0105245_10233345 | 3300009098 | Bacteria | 1780 |
| 246 | Ga0105245_10520946 | 3300009098 | Bacteria | 1207 |
| 247 | Ga0114129_10099876 | 3300009147 | Bacteria | 4016 |
| 248 | Ga0114129_10327459 | 3300009147 | Bacteria | 2035 |
| 249 | Ga0105243_10000516 | 3300009148 | Bacteria | 39400 |
| 250 | Ga0105243_10002920 | 3300009148 | Bacteria | 14153 |
| 251 | Ga0105243_10024728 | 3300009148 | Bacteria | 4583 |
| 252 | Ga0105243_10047577 | 3300009148 | Bacteria | 3378 |
| 253 | Ga0105243_10065560 | 3300009148 | Bacteria | 2918 |
| 254 | Ga0105241_10046653 | 3300009174 | Bacteria | 3291 |
| 255 | Ga0105241_10083114 | 3300009174 | Bacteria | 2512 |
| 256 | Ga0105241_10449135 | 3300009174 | Bacteria | 1140 |
| 257 | Ga0105248_10002030 | 3300009177 | Bacteria | 22461 |
| 258 | Ga0105248_10016482 | 3300009177 | Bacteria | 8134 |
| 259 | Ga0105248_10047705 | 3300009177 | Bacteria | 4803 |
| 260 | Ga0105248_10106584 | 3300009177 | Bacteria | 3160 |
| 261 | Ga0105248_10582908 | 3300009177 | Bacteria | 1262 |
| 262 | Ga0105237_10000870 | 3300009545 | Bacteria | 41025 |
| 263 | Ga0105237_10016422 | 3300009545 | Bacteria | 7691 |
| 264 | Ga0105237_10062994 | 3300009545 | Bacteria | 3707 |
| 265 | Ga0105238_10023445 | 3300009551 | Bacteria | 6291 |
| 266 | Ga0105238_10030130 | 3300009551 | Bacteria | 5522 |
| 267 | Ga0105249_10213889 | 3300009553 | Bacteria | 1893 |
| 268 | Ga0105249_10246534 | 3300009553 | Bacteria | 1769 |
| 269 | Ga0105239_10000417 | 3300010375 | Bacteria | 62040 |
| 270 | Ga0105239_10067508 | 3300010375 | Bacteria | 3928 |
| 271 | Ga0105239_10098468 | 3300010375 | Bacteria | 3232 |
| 272 | Ga0105239_10738632 | 3300010375 | Bacteria | 1126 |
| 273 | Ga0105246_10463218 | 3300011119 | Bacteria | 1068 |
| 274 | Ga0157340_1003658 | 3300012473 | Bacteria | 854 |
| 275 | Ga0157319_1000037 | 3300012497 | Bacteria | 39883 |
| 276 | Ga0157373_10061037 | 3300013100 | Bacteria | 2670 |
| 277 | Ga0157371_10023164 | 3300013102 | Bacteria | 4540 |
| 278 | Ga0157371_10176371 | 3300013102 | Bacteria | 1528 |
| 279 | Ga0157369_10028287 | 3300013105 | Bacteria | 6206 |
| 280 | Ga0157369_10172625 | 3300013105 | Bacteria | 2277 |
| 281 | Ga0157374_10060226 | 3300013296 | Bacteria | 3552 |
| 282 | Ga0157374_10124123 | 3300013296 | Bacteria | 2494 |
| 283 | Ga0157378_10009166 | 3300013297 | Bacteria | 8614 |
| 284 | Ga0157378_10171671 | 3300013297 | Bacteria | 2034 |
| 285 | Ga0163162_10018593 | 3300013306 | Bacteria | 6809 |
| 286 | Ga0163162_10020440 | 3300013306 | Bacteria | 6507 |
| 287 | Ga0163162_10161823 | 3300013306 | Bacteria | 2360 |
| 288 | Ga0157372_10009475 | 3300013307 | Bacteria | 10356 |
| 289 | Ga0157372_10179122 | 3300013307 | Bacteria | 2453 |
| 290 | Ga0157375_10011743 | 3300013308 | Bacteria | 7744 |
| 291 | Ga0157375_10027025 | 3300013308 | Bacteria | 5358 |
| 292 | Ga0157375_10064221 | 3300013308 | Bacteria | 3654 |
| 293 | Ga0157375_10079252 | 3300013308 | Bacteria | 3320 |
| 294 | Ga0157375_10173076 | 3300013308 | Bacteria | 2307 |
| 295 | Ga0157375_10418749 | 3300013308 | Bacteria | 1506 |
| 296 | Ga0163163_10012204 | 3300014325 | Bacteria | 7820 |
| 297 | Ga0163163_10038201 | 3300014325 | Bacteria | 4677 |
| 298 | Ga0163163_10060230 | 3300014325 | Bacteria | 3758 |
| 299 | Ga0157380_10015491 | 3300014326 | Bacteria | 5605 |
| 300 | Ga0157380_10024058 | 3300014326 | Bacteria | 4604 |
| 301 | Ga0157380_10031157 | 3300014326 | Bacteria | 4092 |
| 302 | Ga0157380_10126284 | 3300014326 | Bacteria | 2175 |
| 303 | Ga0157380_10223715 | 3300014326 | Bacteria | 1685 |
| 304 | Ga0182008_10001330 | 3300014497 | Bacteria | 16858 |
| 305 | Ga0157377_10000313 | 3300014745 | Bacteria | 22234 |
| 306 | Ga0157377_10045731 | 3300014745 | Bacteria | 2446 |
| 307 | Ga0157379_10003100 | 3300014968 | Bacteria | 14056 |
| 308 | Ga0157379_10004439 | 3300014968 | Bacteria | 12028 |
| 309 | Ga0157379_10069785 | 3300014968 | Bacteria | 3143 |
| 310 | Ga0157376_10027225 | 3300014969 | Bacteria | 4529 |
| 311 | Ga0157376_10200220 | 3300014969 | Bacteria | 1837 |
| 312 | Ga0157376_10393116 | 3300014969 | Bacteria | 1339 |
| 313 | Ga0182007_10045992 | 3300015262 | Bacteria | 1446 |
| 314 | Ga0163161_10023832 | 3300017792 | Bacteria | 4319 |
| 315 | Ga0163161_10288696 | 3300017792 | Bacteria | 1289 |
| 316 | Ga0213872_10000018 | 3300021361 | Bacteria | 175951 |
| 317 | Ga0213872_10000070 | 3300021361 | Bacteria | 91519 |
| 318 | Ga0213872_10138690 | 3300021361 | Bacteria | 1068 |
| 319 | Ga0209674_100039 | 3300025226 | Bacteria | 402292 |
| 320 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 321 | Ga0209563_100110 | 3300025230 | Bacteria | 142518 |
| 322 | Ga0207427_104198 | 3300025231 | Bacteria | 2547 |
| 323 | Ga0209258_100305 | 3300025242 | Bacteria | 78801 |
| 324 | Ga0209258_100692 | 3300025242 | Bacteria | 23256 |
| 325 | Ga0207425_1005493 | 3300025245 | Bacteria | 3604 |
| 326 | Ga0209646_1000196 | 3300025246 | Bacteria | 72959 |
| 327 | Ga0209026_1000011 | 3300025250 | Bacteria | 507291 |
| 328 | Ga0209677_100151 | 3300025253 | Bacteria | 63642 |
| 329 | Ga0209677_100621 | 3300025253 | Bacteria | 19036 |
| 330 | Ga0209677_102310 | 3300025253 | Bacteria | 7333 |
| 331 | Ga0209759_1000107 | 3300025256 | Bacteria | 147025 |
| 332 | Ga0209759_1004962 | 3300025256 | Bacteria | 4809 |
| 333 | Ga0209759_1008572 | 3300025256 | Bacteria | 3172 |
| 334 | Ga0209129_1000027 | 3300025258 | Bacteria | 409587 |
| 335 | Ga0209455_1000053 | 3300025272 | Bacteria | 365949 |
| 336 | Ga0209673_1009495 | 3300025273 | Bacteria | 4202 |
| 337 | Ga0209673_1016350 | 3300025273 | Bacteria | 2779 |
| 338 | Ga0209673_1029509 | 3300025273 | Bacteria | 1745 |
| 339 | Ga0209675_1009087 | 3300025291 | Bacteria | 3551 |
| 340 | Ga0209564_1000014 | 3300025295 | Bacteria | 621501 |
| 341 | Ga0209564_1000051 | 3300025295 | Bacteria | 357748 |
| 342 | Ga0209758_1000193 | 3300025297 | Bacteria | 134744 |
| 343 | Ga0209758_1000208 | 3300025297 | Bacteria | 128596 |
| 344 | Ga0209050_1000416 | 3300025298 | Bacteria | 78976 |
| 345 | Ga0209050_1001233 | 3300025298 | Bacteria | 29602 |
| 346 | Ga0209050_1001932 | 3300025298 | Bacteria | 19736 |
| 347 | Ga0209050_1015631 | 3300025298 | Bacteria | 3169 |
| 348 | Ga0209050_1015668 | 3300025298 | Bacteria | 3162 |
| 349 | Ga0209256_1000092 | 3300025299 | Bacteria | 210547 |
| 350 | Ga0209256_1000471 | 3300025299 | Bacteria | 60530 |
| 351 | Ga0209256_1000967 | 3300025299 | Bacteria | 34624 |
| 352 | Ga0209051_1000020 | 3300025303 | Bacteria | 508628 |
| 353 | Ga0209051_1003495 | 3300025303 | Bacteria | 10276 |
| 354 | Ga0209051_1005666 | 3300025303 | Bacteria | 7224 |
| 355 | Ga0209051_1007685 | 3300025303 | Bacteria | 5852 |
| 356 | Ga0209051_1008472 | 3300025303 | Bacteria | 5436 |
| 357 | Ga0209051_1040661 | 3300025303 | Bacteria | 1664 |
| 358 | Ga0209257_1000182 | 3300025304 | Bacteria | 156672 |
| 359 | Ga0209257_1000189 | 3300025304 | Bacteria | 153917 |
| 360 | Ga0209257_1001013 | 3300025304 | Bacteria | 37837 |
| 361 | Ga0209257_1009108 | 3300025304 | Bacteria | 5422 |
| 362 | Ga0209257_1013728 | 3300025304 | Bacteria | 3561 |
| 363 | Ga0207697_10139621 | 3300025315 | Bacteria | 1050 |
| 364 | Ga0207656_10044902 | 3300025321 | Bacteria | 1889 |
| 365 | Ga0207682_10014444 | 3300025893 | Bacteria | 3076 |
| 366 | Ga0207682_10074528 | 3300025893 | Bacteria | 1443 |
| 367 | Ga0207642_10012161 | 3300025899 | Bacteria | 3098 |
| 368 | Ga0207688_10273792 | 3300025901 | Bacteria | 1027 |
| 369 | Ga0207680_10082238 | 3300025903 | Bacteria | 2026 |
| 370 | Ga0207647_10180009 | 3300025904 | Bacteria | 1228 |
| 371 | Ga0207645_10083578 | 3300025907 | Bacteria | 2048 |
| 372 | Ga0207643_10009117 | 3300025908 | Bacteria | 5330 |
| 373 | Ga0207643_10240030 | 3300025908 | Bacteria | 1114 |
| 374 | Ga0207705_10278848 | 3300025909 | Bacteria | 1279 |
| 375 | Ga0207684_10004494 | 3300025910 | Bacteria | 13113 |
| 376 | Ga0207695_10004036 | 3300025913 | Bacteria | 20195 |
| 377 | Ga0207695_10005546 | 3300025913 | Bacteria | 16683 |
| 378 | Ga0207695_10047193 | 3300025913 | Bacteria | 4560 |
| 379 | Ga0207695_10194890 | 3300025913 | Bacteria | 1942 |
| 380 | Ga0207695_10251548 | 3300025913 | Bacteria | 1666 |
| 381 | Ga0207671_10005322 | 3300025914 | Bacteria | 11916 |
| 382 | Ga0207671_10060127 | 3300025914 | Bacteria | 2819 |
| 383 | Ga0207660_10113049 | 3300025917 | Bacteria | 2046 |
| 384 | Ga0207662_10275784 | 3300025918 | Bacteria | 1111 |
| 385 | Ga0207657_10046620 | 3300025919 | Bacteria | 3796 |
| 386 | Ga0207649_10002166 | 3300025920 | Bacteria | 11109 |
| 387 | Ga0207649_10051621 | 3300025920 | Bacteria | 2548 |
| 388 | Ga0207652_10006446 | 3300025921 | Bacteria | 9466 |
| 389 | Ga0207646_10030388 | 3300025922 | Bacteria | 4897 |
| 390 | Ga0207681_10008786 | 3300025923 | Bacteria | 6172 |
| 391 | Ga0207681_10040654 | 3300025923 | Bacteria | 3096 |
| 392 | Ga0207694_10017172 | 3300025924 | Bacteria | 5468 |
| 393 | Ga0207694_10051794 | 3300025924 | Bacteria | 3181 |
| 394 | Ga0207694_10319491 | 3300025924 | Bacteria | 1281 |
| 395 | Ga0207650_10000904 | 3300025925 | Bacteria | 22371 |
| 396 | Ga0207650_10009335 | 3300025925 | Bacteria | 6705 |
| 397 | Ga0207650_10010853 | 3300025925 | Bacteria | 6260 |
| 398 | Ga0207650_10171363 | 3300025925 | Bacteria | 1725 |
| 399 | Ga0207659_10004951 | 3300025926 | Bacteria | 8077 |
| 400 | Ga0207659_10006933 | 3300025926 | Bacteria | 6962 |
| 401 | Ga0207659_10148487 | 3300025926 | Bacteria | 1828 |
| 402 | Ga0207659_10383426 | 3300025926 | Bacteria | 1172 |
| 403 | Ga0207687_10013305 | 3300025927 | Bacteria | 5372 |
| 404 | Ga0207687_10085684 | 3300025927 | Bacteria | 2286 |
| 405 | Ga0207687_10727047 | 3300025927 | Bacteria | 844 |
| 406 | Ga0207644_10001787 | 3300025931 | Bacteria | 13923 |
| 407 | Ga0207644_10006315 | 3300025931 | Bacteria | 7715 |
| 408 | Ga0207644_10037525 | 3300025931 | Bacteria | 3409 |
| 409 | Ga0207644_10083387 | 3300025931 | Bacteria | 2367 |
| 410 | Ga0207644_10179303 | 3300025931 | Bacteria | 1659 |
| 411 | Ga0207644_10513448 | 3300025931 | Bacteria | 989 |
| 412 | Ga0207690_10004334 | 3300025932 | Bacteria | 8380 |
| 413 | Ga0207706_10001749 | 3300025933 | Bacteria | 21310 |
| 414 | Ga0207706_10031078 | 3300025933 | Bacteria | 4759 |
| 415 | Ga0207706_10303429 | 3300025933 | Bacteria | 1391 |
| 416 | Ga0207686_10085030 | 3300025934 | Bacteria | 2074 |
| 417 | Ga0207709_10000382 | 3300025935 | Bacteria | 44040 |
| 418 | Ga0207709_10037497 | 3300025935 | Bacteria | 2881 |
| 419 | Ga0207709_10048858 | 3300025935 | Bacteria | 2579 |
| 420 | Ga0207709_10578059 | 3300025935 | Bacteria | 887 |
| 421 | Ga0207670_10718974 | 3300025936 | Bacteria | 828 |
| 422 | Ga0207669_10007483 | 3300025937 | Bacteria | 5055 |
| 423 | Ga0207704_10009164 | 3300025938 | Bacteria | 4765 |
| 424 | Ga0207704_10778040 | 3300025938 | Bacteria | 798 |
| 425 | Ga0207691_10005307 | 3300025940 | Bacteria | 12438 |
| 426 | Ga0207691_10011899 | 3300025940 | Bacteria | 8350 |
| 427 | Ga0207691_10017763 | 3300025940 | Bacteria | 6743 |
| 428 | Ga0207691_10030742 | 3300025940 | Bacteria | 5016 |
| 429 | Ga0207691_10103674 | 3300025940 | Bacteria | 2536 |
| 430 | Ga0207711_10009050 | 3300025941 | Bacteria | 8320 |
| 431 | Ga0207711_10079588 | 3300025941 | Bacteria | 2861 |
| 432 | Ga0207711_10127355 | 3300025941 | Bacteria | 2279 |
| 433 | Ga0207711_10538336 | 3300025941 | Bacteria | 1089 |
| 434 | Ga0207689_10043887 | 3300025942 | Bacteria | 3696 |
| 435 | Ga0207689_10072292 | 3300025942 | Bacteria | 2834 |
| 436 | Ga0207661_10152171 | 3300025944 | Bacteria | 2000 |
| 437 | Ga0207661_10362973 | 3300025944 | Bacteria | 1308 |
| 438 | Ga0207679_10000154 | 3300025945 | Bacteria | 56628 |
| 439 | Ga0207679_10168056 | 3300025945 | Bacteria | 1803 |
| 440 | Ga0207679_10175328 | 3300025945 | Bacteria | 1769 |
| 441 | Ga0207667_10014452 | 3300025949 | Bacteria | 9000 |
| 442 | Ga0207667_10070368 | 3300025949 | Bacteria | 3641 |
| 443 | Ga0207667_10814856 | 3300025949 | Bacteria | 929 |
| 444 | Ga0207651_10000726 | 3300025960 | Bacteria | 14099 |
| 445 | Ga0207651_10023579 | 3300025960 | Bacteria | 3789 |
| 446 | Ga0207651_10040992 | 3300025960 | Bacteria | 3069 |
| 447 | Ga0207651_10407075 | 3300025960 | Bacteria | 1158 |
| 448 | Ga0207712_10079843 | 3300025961 | Bacteria | 2378 |
| 449 | Ga0207712_10159397 | 3300025961 | Bacteria | 1752 |
| 450 | Ga0207712_10237152 | 3300025961 | Bacteria | 1467 |
| 451 | Ga0207712_10239044 | 3300025961 | Bacteria | 1462 |
| 452 | Ga0207712_10781651 | 3300025961 | Bacteria | 838 |
| 453 | Ga0207668_10172325 | 3300025972 | Bacteria | 1698 |
| 454 | Ga0207640_10006815 | 3300025981 | Bacteria | 6282 |
| 455 | Ga0207640_10104626 | 3300025981 | Bacteria | 1993 |
| 456 | Ga0207658_10006325 | 3300025986 | Bacteria | 8088 |
| 457 | Ga0207658_10008867 | 3300025986 | Bacteria | 6826 |
| 458 | Ga0207658_10022179 | 3300025986 | Bacteria | 4418 |
| 459 | Ga0207677_10017241 | 3300026023 | Bacteria | 4299 |
| 460 | Ga0207677_10096180 | 3300026023 | Bacteria | 2166 |
| 461 | Ga0207703_10007292 | 3300026035 | Bacteria | 8790 |
| 462 | Ga0207703_10019578 | 3300026035 | Bacteria | 5289 |
| 463 | Ga0207703_10033069 | 3300026035 | Bacteria | 4097 |
| 464 | Ga0207703_11048342 | 3300026035 | Bacteria | 783 |
| 465 | Ga0207639_10003410 | 3300026041 | Bacteria | 10691 |
| 466 | Ga0207639_10321337 | 3300026041 | Bacteria | 1374 |
| 467 | Ga0207639_10741068 | 3300026041 | Bacteria | 913 |
| 468 | Ga0207678_10001164 | 3300026067 | Bacteria | 24067 |
| 469 | Ga0207678_10061645 | 3300026067 | Bacteria | 3226 |
| 470 | Ga0207678_10165640 | 3300026067 | Bacteria | 1887 |
| 471 | Ga0207708_10008693 | 3300026075 | Bacteria | 7518 |
| 472 | Ga0207708_10035380 | 3300026075 | Bacteria | 3800 |
| 473 | Ga0207708_10481162 | 3300026075 | Bacteria | 1038 |
| 474 | Ga0207702_10000270 | 3300026078 | Bacteria | 59607 |
| 475 | Ga0207702_10023323 | 3300026078 | Bacteria | 5131 |
| 476 | Ga0207702_10685732 | 3300026078 | Bacteria | 1009 |
| 477 | Ga0207641_10010569 | 3300026088 | Bacteria | 7573 |
| 478 | Ga0207641_10016789 | 3300026088 | Bacteria | 5995 |
| 479 | Ga0207648_10000264 | 3300026089 | Bacteria | 56766 |
| 480 | Ga0207648_10002564 | 3300026089 | Bacteria | 19471 |
| 481 | Ga0207648_10054352 | 3300026089 | Bacteria | 3498 |
| 482 | Ga0207648_10119130 | 3300026089 | Bacteria | 2320 |
| 483 | Ga0207648_10274947 | 3300026089 | Bacteria | 1505 |
| 484 | Ga0207648_10600044 | 3300026089 | Bacteria | 1015 |
| 485 | Ga0207648_10659617 | 3300026089 | Bacteria | 967 |
| 486 | Ga0207676_10002431 | 3300026095 | Bacteria | 13264 |
| 487 | Ga0207676_10003185 | 3300026095 | Bacteria | 11690 |
| 488 | Ga0207676_10003375 | 3300026095 | Bacteria | 11290 |
| 489 | Ga0207676_10065216 | 3300026095 | Bacteria | 2899 |
| 490 | Ga0207674_10007035 | 3300026116 | Bacteria | 13155 |
| 491 | Ga0207675_100004520 | 3300026118 | Bacteria | 13431 |
| 492 | Ga0207675_100020594 | 3300026118 | Bacteria | 6147 |
| 493 | Ga0207675_100045818 | 3300026118 | Bacteria | 4085 |
| 494 | Ga0207675_100048921 | 3300026118 | Bacteria | 3947 |
| 495 | Ga0207675_100236286 | 3300026118 | Bacteria | 1765 |
| 496 | Ga0207675_100297352 | 3300026118 | Bacteria | 1572 |
| 497 | Ga0207675_100956634 | 3300026118 | Bacteria | 874 |
| 498 | Ga0207683_10004615 | 3300026121 | Bacteria | 11873 |
| 499 | Ga0207683_10008759 | 3300026121 | Bacteria | 8638 |
| 500 | Ga0207683_10111270 | 3300026121 | Bacteria | 2452 |
| 501 | Ga0207683_10163755 | 3300026121 | Bacteria | 2012 |
| 502 | Ga0207683_10896549 | 3300026121 | Bacteria | 823 |
| 503 | Ga0207698_10067256 | 3300026142 | Bacteria | 2825 |
| 504 | Ga0207698_10160315 | 3300026142 | Bacteria | 1966 |
| 505 | Ga0209281_1000072 | 3300027111 | Bacteria | 273114 |
| 506 | Ga0209281_1000074 | 3300027111 | Bacteria | 267848 |
| 507 | Ga0209984_1015402 | 3300027424 | Bacteria | 1016 |
| 508 | Ga0209995_1013728 | 3300027471 | Bacteria | 1328 |
| 509 | Ga0209968_1000344 | 3300027526 | Bacteria | 7775 |
| 510 | Ga0209970_1026864 | 3300027614 | Bacteria | 990 |
| 511 | Ga0209983_1046768 | 3300027665 | Bacteria | 943 |
| 512 | Ga0209966_1000136 | 3300027695 | Bacteria | 30875 |
| 513 | Ga0268266_10577983 | 3300028379 | Bacteria | 1078 |
| 514 | Ga0268265_10022062 | 3300028380 | Bacteria | 4469 |
| 515 | Ga0268265_10034984 | 3300028380 | Bacteria | 3666 |
| 516 | Ga0268265_10152302 | 3300028380 | Bacteria | 1952 |
| 517 | Ga0268265_10276860 | 3300028380 | Bacteria | 1499 |
| 518 | Ga0268264_10005811 | 3300028381 | Bacteria | 10457 |
| 519 | Ga0268264_10062092 | 3300028381 | Bacteria | 3136 |
| 520 | Ga0268264_10327008 | 3300028381 | Bacteria | 1452 |
| 521 | Ga0265336_10000022 | 3300028666 | Bacteria | 192716 |
| 522 | Ga0307517_10072121 | 3300028786 | Bacteria | 3083 |
| 523 | Ga0307515_10000131 | 3300028794 | Bacteria | 178919 |
| 524 | Ga0307515_10000165 | 3300028794 | Bacteria | 162589 |
| 525 | Ga0307515_10000232 | 3300028794 | Bacteria | 137778 |
| 526 | Ga0307515_10006463 | 3300028794 | Bacteria | 23455 |
| 527 | Ga0307515_10015871 | 3300028794 | Bacteria | 13842 |
| 528 | Ga0307515_10018948 | 3300028794 | Bacteria | 12421 |
| 529 | Ga0307515_10022118 | 3300028794 | Bacteria | 11226 |
| 530 | Ga0307515_10254187 | 3300028794 | Bacteria | 1504 |
| 531 | Ga0307515_10298322 | 3300028794 | Bacteria | 1299 |
| 532 | Ga0265324_10002429 | 3300029957 | Bacteria | 9560 |
| 533 | Ga0265324_10006622 | 3300029957 | Bacteria | 4797 |
| 534 | Ga0268256_1026772 | 3300030500 | Bacteria | 1445 |
| 535 | Ga0307512_10056946 | 3300030522 | Bacteria | 3063 |
| 536 | Ga0307512_10165008 | 3300030522 | Bacteria | 1286 |
| 537 | Ga0265330_10014977 | 3300031235 | Bacteria | 3590 |
| 538 | Ga0265332_10000220 | 3300031238 | Bacteria | 45756 |
| 539 | Ga0265332_10009151 | 3300031238 | Bacteria | 4429 |
| 540 | Ga0265328_10038901 | 3300031239 | Bacteria | 1755 |
| 541 | Ga0265331_10001142 | 3300031250 | Bacteria | 20259 |
| 542 | Ga0265331_10018516 | 3300031250 | Bacteria | 3609 |
| 543 | Ga0265327_10000028 | 3300031251 | Bacteria | 361066 |
| 544 | Ga0265327_10000320 | 3300031251 | Bacteria | 91776 |
| 545 | Ga0265316_10000129 | 3300031344 | Bacteria | 82815 |
| 546 | Ga0265316_10246408 | 3300031344 | Bacteria | 1313 |
| 547 | Ga0307513_10017844 | 3300031456 | Bacteria | 8500 |
| 548 | Ga0307513_10047058 | 3300031456 | Bacteria | 4695 |
| 549 | Ga0307513_10094334 | 3300031456 | Bacteria | 3038 |
| 550 | Ga0307513_10161720 | 3300031456 | Bacteria | 2131 |
| 551 | Ga0307513_10226430 | 3300031456 | Bacteria | 1686 |
| 552 | Ga0307509_10003013 | 3300031507 | Bacteria | 26337 |
| 553 | Ga0307509_10037746 | 3300031507 | Bacteria | 5278 |
| 554 | Ga0307509_10060799 | 3300031507 | Bacteria | 3991 |
| 555 | Ga0307509_10102672 | 3300031507 | Bacteria | 2890 |
| 556 | Ga0307509_10130164 | 3300031507 | Bacteria | 2474 |
| 557 | Ga0307408_100000160 | 3300031548 | Bacteria | 74342 |
| 558 | Ga0307408_100091181 | 3300031548 | Bacteria | 2301 |
| 559 | Ga0307408_100189788 | 3300031548 | Bacteria | 1655 |
| 560 | Ga0307408_100512133 | 3300031548 | Bacteria | 1052 |
| 561 | Ga0307508_10001328 | 3300031616 | Bacteria | 27985 |
| 562 | Ga0307508_10002994 | 3300031616 | Bacteria | 17413 |
| 563 | Ga0307508_10027467 | 3300031616 | Bacteria | 5150 |
| 564 | Ga0307508_10287745 | 3300031616 | Bacteria | 1237 |
| 565 | Ga0307514_10004809 | 3300031649 | Bacteria | 12314 |
| 566 | Ga0307514_10008878 | 3300031649 | Bacteria | 8498 |
| 567 | Ga0307514_10015639 | 3300031649 | Bacteria | 6253 |
| 568 | Ga0307514_10149698 | 3300031649 | Bacteria | 1569 |
| 569 | Ga0307514_10162233 | 3300031649 | Bacteria | 1477 |
| 570 | Ga0265314_10005103 | 3300031711 | Bacteria | 11953 |
| 571 | Ga0265314_10056149 | 3300031711 | Bacteria | 2712 |
| 572 | Ga0265342_10014208 | 3300031712 | Bacteria | 5295 |
| 573 | Ga0307516_10000595 | 3300031730 | Bacteria | 49018 |
| 574 | Ga0307516_10002134 | 3300031730 | Bacteria | 26788 |
| 575 | Ga0307516_10002726 | 3300031730 | Bacteria | 23277 |
| 576 | Ga0307516_10009114 | 3300031730 | Bacteria | 11114 |
| 577 | Ga0307516_10027292 | 3300031730 | Bacteria | 5789 |
| 578 | Ga0307516_10131016 | 3300031730 | Bacteria | 2287 |
| 579 | Ga0307516_10132085 | 3300031730 | Bacteria | 2275 |
| 580 | Ga0307516_10134630 | 3300031730 | Bacteria | 2247 |
| 581 | Ga0307516_10178034 | 3300031730 | Bacteria | 1861 |
| 582 | Ga0307516_10205607 | 3300031730 | Bacteria | 1686 |
| 583 | Ga0307516_10222853 | 3300031730 | Bacteria | 1594 |
| 584 | Ga0307516_10473855 | 3300031730 | Bacteria | 907 |
| 585 | Ga0307405_10094402 | 3300031731 | Bacteria | 1989 |
| 586 | Ga0307405_10358469 | 3300031731 | Bacteria | 1127 |
| 587 | Ga0307405_10506154 | 3300031731 | Bacteria | 969 |
| 588 | Ga0307413_10087139 | 3300031824 | Bacteria | 2021 |
| 589 | Ga0307413_10382522 | 3300031824 | Bacteria | 1097 |
| 590 | Ga0307410_10223506 | 3300031852 | Bacteria | 1450 |
| 591 | Ga0307410_10379960 | 3300031852 | Bacteria | 1136 |
| 592 | Ga0307406_10032124 | 3300031901 | Bacteria | 3202 |
| 593 | Ga0307406_10320605 | 3300031901 | Bacteria | 1199 |
| 594 | Ga0307407_10379756 | 3300031903 | Bacteria | 1008 |
| 595 | Ga0307407_10447327 | 3300031903 | Bacteria | 937 |
| 596 | Ga0307412_10125124 | 3300031911 | Bacteria | 1858 |
| 597 | Ga0307412_10253185 | 3300031911 | Bacteria | 1368 |
| 598 | Ga0307412_10533047 | 3300031911 | Bacteria | 983 |
| 599 | Ga0307409_100042552 | 3300031995 | Bacteria | 3403 |
| 600 | Ga0307409_100768097 | 3300031995 | Bacteria | 969 |
| 601 | Ga0307416_100110201 | 3300032002 | Bacteria | 2423 |
| 602 | Ga0307416_100115953 | 3300032002 | Bacteria | 2373 |
| 603 | Ga0307416_100728004 | 3300032002 | Bacteria | 1083 |
| 604 | Ga0307414_10008432 | 3300032004 | Bacteria | 5845 |
| 605 | Ga0307414_10355119 | 3300032004 | Bacteria | 1259 |
| 606 | Ga0307411_10001451 | 3300032005 | Bacteria | 9701 |
| 607 | Ga0307411_10082030 | 3300032005 | Bacteria | 2222 |
| 608 | Ga0307415_100063783 | 3300032126 | Bacteria | 2561 |
| 609 | Ga0307507_10098286 | 3300033179 | Bacteria | 2465 |
| 610 | Ga0307510_10047623 | 3300033180 | Bacteria | 4590 |
| 611 | Ga0307510_10142350 | 3300033180 | Bacteria | 2038 |
| 612 | Ga0307510_10159811 | 3300033180 | Bacteria | 1852 |
| 613 | Ga0373944_0033579 | 3300035089 | Bacteria | 1555 |
| 614 | Ga0373944_0049567 | 3300035089 | Bacteria | 1320 |
| 615 | Ga0373949_0097553 | 3300035090 | Bacteria | 802 |
| 616 | Ga0373923_0051893 | 3300035111 | Bacteria | 1722 |
| 617 | Ga0373923_0253089 | 3300035111 | Bacteria | 825 |
| 618 | Ga0373939_0000180 | 3300035114 | Bacteria | 17482 |
| 619 | Ga0373954_0120803 | 3300035118 | Bacteria | 1272 |
| 620 | Ga0373960_0009161 | 3300035121 | Bacteria | 2390 |
| 621 | Ga0373943_0151449 | 3300035170 | Bacteria | 1257 |
| 622 | Ga0373946_0227991 | 3300035171 | Bacteria | 902 |
| 623 | Ga0373955_0205403 | 3300035172 | Bacteria | 1173 |
| 624 | Ga0373924_0017561 | 3300035410 | Bacteria | 2747 |
| 625 | Ga0373924_0023164 | 3300035410 | Bacteria | 2433 |
| 626 | Ga0373931_0000454 | 3300035691 | Bacteria | 16732 |
| 627 | Ga0373931_0001260 | 3300035691 | Bacteria | 10813 |
| 628 | Ga0373931_0006658 | 3300035691 | Bacteria | 5412 |
| 629 | Ga0373931_0071250 | 3300035691 | Bacteria | 1898 |
| 630 | Ga0373933_0066134 | 3300035724 | Bacteria | 2190 |
| 631 | Ga0373947_0258046 | 3300035725 | Bacteria | 1154 |
| 632 | Ga0373937_0036873 | 3300036401 | Bacteria | 4455 |
| 633 | Ga0373937_0092056 | 3300036401 | Bacteria | 2810 |
| 634 | Ga0373937_0470802 | 3300036401 | Bacteria | 1193 |
| 635 | Ga0373925_0003189 | 3300037068 | Bacteria | 12824 |
| 636 | Ga0373925_0017322 | 3300037068 | Bacteria | 5221 |
| 637 | Ga0373925_0413510 | 3300037068 | Bacteria | 1101 |
| 638 | Ga0395900_0000025 | 3300037418 | Bacteria | 321217 |
| 639 | Ga0395900_0267865 | 3300037418 | Bacteria | 1704 |
| 640 | Ga0395898_0007948 | 3300037466 | Bacteria | 11251 |
| 641 | Ga0395898_0040143 | 3300037466 | Bacteria | 4630 |
| 642 | Ga0395905_0000071 | 3300037471 | Bacteria | 174580 |
| 643 | Ga0395905_0002690 | 3300037471 | Bacteria | 19490 |
| 644 | Ga0395905_0013413 | 3300037471 | Bacteria | 7852 |
| 645 | Ga0395905_0013482 | 3300037471 | Bacteria | 7831 |
| 646 | Ga0395905_0043043 | 3300037471 | Bacteria | 4236 |
| 647 | Ga0395905_0140233 | 3300037471 | Bacteria | 2274 |
| 648 | Ga0395905_0240803 | 3300037471 | Bacteria | 1690 |
| 649 | Ga0395905_0351375 | 3300037471 | Bacteria | 1366 |
| 650 | Ga0395901_0006003 | 3300038443 | Bacteria | 12303 |
| 651 | Ga0395901_0745176 | 3300038443 | Bacteria | 973 |
| 652 | Ga0436365_1542390 | 3300039437 | Bacteria | 1559 |
| 653 | Ga0436361_0054890 | 3300039447 | Bacteria | 6582 |
| 654 | Ga0436361_0104381 | 3300039447 | Bacteria | 43863 |
| 655 | Ga0436361_0175665 | 3300039447 | Bacteria | 16430 |
| 656 | Ga0436361_0459306 | 3300039447 | Bacteria | 1302 |
| 657 | Ga0436361_0592172 | 3300039447 | Bacteria | 4121 |
| 658 | Ga0436361_0677882 | 3300039447 | Bacteria | 228834 |
| 659 | Ga0436361_0716769 | 3300039447 | Bacteria | 4009 |
| 660 | Ga0436361_0804529 | 3300039447 | Bacteria | 2395 |
| 661 | Ga0436361_0812713 | 3300039447 | Bacteria | 39089 |
| 662 | Ga0436361_1197672 | 3300039447 | Bacteria | 1351 |
| 663 | Ga0436363_1550768 | 3300039450 | Bacteria | 1515 |
| 664 | Ga0451789_0480314 | 3300041443 | Bacteria | 3329 |
| 665 | Ga0451798_0529553 | 3300041458 | Bacteria | 1052 |
| 666 | Ga0451802_1671124 | 3300041460 | Bacteria | 1061 |
| 667 | Ga0451802_1748927 | 3300041460 | Bacteria | 1656 |
| 668 | Ga0451802_1879611 | 3300041460 | Bacteria | 2147 |
| 669 | Ga0451802_1995623 | 3300041460 | Bacteria | 962 |
| 670 | Ga0451839_0036937 | 3300041496 | Bacteria | 2018 |
| 671 | Ga0451855_1603730 | 3300041511 | Bacteria | 872 |
| 672 | Ga0439433_0017719 | 3300041999 | Bacteria | 1582 |
| 673 | Ga0439437_001281 | 3300042000 | Bacteria | 2641 |
| 674 | Ga0439454_019896 | 3300042011 | Bacteria | 980 |
| 675 | Ga0450911_019502 | 3300042115 | Bacteria | 889 |
| 676 | Ga0450919_002454 | 3300042121 | Bacteria | 2402 |
| 677 | Ga0450890_000381 | 3300042127 | Bacteria | 6485 |
| 678 | Ga0450891_000049 | 3300042129 | Bacteria | 9196 |
| 679 | Ga0450892_001246 | 3300042130 | Bacteria | 2590 |
| 680 | Ga0450889_000650 | 3300042144 | Bacteria | 3838 |
| 681 | Ga0439446_0062097 | 3300042156 | Bacteria | 1131 |
| 682 | Ga0439434_0097932 | 3300042435 | Bacteria | 943 |
| 683 | Ga0439459_0001561 | 3300042438 | Bacteria | 3403 |
| 684 | Ga0439464_0072190 | 3300042439 | Bacteria | 1022 |
| 685 | Ga0450918_000091 | 3300042531 | Bacteria | 19069 |
| 686 | Ga0451577_0000747 | 3300042876 | Bacteria | 49907 |
| 687 | Ga0451577_0000906 | 3300042876 | Bacteria | 43738 |
| 688 | Ga0451577_0001077 | 3300042876 | Bacteria | 39123 |
| 689 | Ga0451577_0001271 | 3300042876 | Bacteria | 34780 |
| 690 | Ga0451577_0001943 | 3300042876 | Bacteria | 26044 |
| 691 | Ga0451577_0015312 | 3300042876 | Bacteria | 7136 |
| 692 | Ga0451577_0191389 | 3300042876 | Bacteria | 1845 |
| 693 | Ga0451577_0265292 | 3300042876 | Bacteria | 1555 |
| 694 | Ga0466969_0000097 | 3300044656 | Bacteria | 45819 |
| 695 | Ga0466969_0003731 | 3300044656 | Bacteria | 8095 |
| 696 | Ga0466969_0134256 | 3300044656 | Bacteria | 1146 |
| 697 | Ga0466972_0000265 | 3300044658 | Bacteria | 33659 |
| 698 | Ga0466972_0015715 | 3300044658 | Bacteria | 3785 |
| 699 | Ga0466972_0071030 | 3300044658 | Bacteria | 1661 |
| 700 | Ga0453683_0071466 | 3300044673 | Bacteria | 2171 |
| 701 | Ga0466965_0004580 | 3300044683 | Bacteria | 6157 |
| 702 | Ga0466965_0030122 | 3300044683 | Bacteria | 2642 |
| 703 | Ga0466966_0080445 | 3300044684 | Bacteria | 2029 |
| 704 | Ga0466966_0110839 | 3300044684 | Bacteria | 1691 |
| 705 | Ga0466961_0008576 | 3300044693 | Bacteria | 6513 |
| 706 | Ga0466961_0012564 | 3300044693 | Bacteria | 5420 |
| 707 | Ga0466961_0031151 | 3300044693 | Bacteria | 3428 |
| 708 | Ga0466961_0146097 | 3300044693 | Bacteria | 1478 |
| 709 | Ga0466963_0040444 | 3300044694 | Bacteria | 3056 |
| 710 | Ga0466963_0054563 | 3300044694 | Bacteria | 2656 |
| 711 | Ga0466963_0080763 | 3300044694 | Bacteria | 2202 |
| 712 | Ga0466964_0002497 | 3300044706 | Bacteria | 6540 |
| 713 | Ga0466964_0039714 | 3300044706 | Bacteria | 1897 |
| 714 | Ga0453684_0002172 | 3300044712 | Bacteria | 49008 |
| 715 | Ga0453684_0031038 | 3300044712 | Bacteria | 7525 |
| 716 | Ga0453684_0054230 | 3300044712 | Bacteria | 5225 |
| 717 | Ga0453684_0073965 | 3300044712 | Bacteria | 4293 |
| 718 | Ga0453684_0077328 | 3300044712 | Bacteria | 4173 |
| 719 | Ga0453684_0087988 | 3300044712 | Bacteria | 3847 |
| 720 | Ga0453684_0168215 | 3300044712 | Bacteria | 2586 |
| 721 | Ga0453684_0210084 | 3300044712 | Bacteria | 2263 |
| 722 | Ga0453684_0470208 | 3300044712 | Bacteria | 1396 |
| 723 | Ga0453684_0482478 | 3300044712 | Bacteria | 1375 |
| 724 | Ga0466971_0004543 | 3300044719 | Bacteria | 6002 |
| 725 | Ga0466971_0058783 | 3300044719 | Bacteria | 1735 |
| 726 | Ga0466971_0075933 | 3300044719 | Bacteria | 1528 |
| 727 | Ga0466970_0105462 | 3300044765 | Bacteria | 1537 |
| 728 | Ga0466970_0138742 | 3300044765 | Bacteria | 1338 |
| 729 | Ga0466970_0145428 | 3300044765 | Bacteria | 1307 |
| 730 | Ga0466957_0009965 | 3300044842 | Bacteria | 5436 |
| 731 | Ga0466957_0016788 | 3300044842 | Bacteria | 4282 |
| 732 | Ga0466959_0001171 | 3300045049 | Bacteria | 15784 |
| 733 | Ga0466959_0032335 | 3300045049 | Bacteria | 3872 |
| 734 | Ga0466959_0065097 | 3300045049 | Bacteria | 2645 |
| 735 | Ga0466959_0086899 | 3300045049 | Bacteria | 2249 |
| 736 | Ga0451576_0001319 | 3300045051 | Bacteria | 42949 |
| 737 | Ga0451576_0003466 | 3300045051 | Bacteria | 21625 |
| 738 | Ga0451576_0005936 | 3300045051 | Bacteria | 15129 |
| 739 | Ga0451576_0006498 | 3300045051 | Bacteria | 14312 |
| 740 | Ga0451576_0046370 | 3300045051 | Bacteria | 4577 |
| 741 | Ga0451576_0072274 | 3300045051 | Bacteria | 3590 |
| 742 | Ga0451576_0368678 | 3300045051 | Bacteria | 1504 |
| 743 | Ga0451576_0465292 | 3300045051 | Bacteria | 1328 |
| 744 | Ga0466958_0011815 | 3300045836 | Bacteria | 4929 |
| 745 | Ga0466958_0083862 | 3300045836 | Bacteria | 1964 |
| 746 | Ga0466967_0009150 | 3300045976 | Bacteria | 7328 |
| 747 | Ga0466967_0041054 | 3300045976 | Bacteria | 3986 |
| 748 | Ga0466967_0267142 | 3300045976 | Bacteria | 1638 |
| 749 | Ga0466967_0712959 | 3300045976 | Bacteria | 994 |
| 750 | Ga0495592_0000120 | 3300046454 | Bacteria | 69531 |
| 751 | Ga0495592_0063647 | 3300046454 | Bacteria | 2705 |
| 752 | Ga0495590_0019151 | 3300046457 | Bacteria | 2442 |
| 753 | Ga0495638_0041159 | 3300046460 | Bacteria | 2925 |
| 754 | Ga0495641_0069240 | 3300046461 | Bacteria | 1586 |
| 755 | Ga0495651_0241985 | 3300046462 | Bacteria | 1237 |
| 756 | Ga0495653_0225610 | 3300046463 | Bacteria | 1257 |
| 757 | Ga0495650_0008953 | 3300046471 | Bacteria | 5760 |
| 758 | Ga0495650_0029923 | 3300046471 | Bacteria | 2474 |
| 759 | Ga0495580_0076761 | 3300046472 | Bacteria | 2330 |
| 760 | Ga0495580_0175610 | 3300046472 | Bacteria | 1480 |
| 761 | Ga0495639_0021209 | 3300046475 | Bacteria | 2842 |
| 762 | Ga0495664_0184113 | 3300046477 | Bacteria | 1266 |
| 763 | Ga0495583_0000164 | 3300046506 | Bacteria | 112062 |
| 764 | Ga0495606_0304516 | 3300046507 | Bacteria | 862 |
| 765 | Ga0495610_0067613 | 3300046512 | Bacteria | 1678 |
| 766 | Ga0495616_0105697 | 3300046513 | Bacteria | 1314 |
| 767 | Ga0495620_0055412 | 3300046515 | Bacteria | 1671 |
| 768 | Ga0495630_0259002 | 3300046517 | Bacteria | 1329 |
| 769 | Ga0495630_0376441 | 3300046517 | Bacteria | 1087 |
| 770 | Ga0495632_0009067 | 3300046519 | Bacteria | 6025 |
| 771 | Ga0495632_0030437 | 3300046519 | Bacteria | 2801 |
| 772 | Ga0495632_0031606 | 3300046519 | Bacteria | 2734 |
| 773 | Ga0495632_0066875 | 3300046519 | Bacteria | 1733 |
| 774 | Ga0495643_0004877 | 3300046522 | Bacteria | 9239 |
| 775 | Ga0495648_0066748 | 3300046524 | Bacteria | 2108 |
| 776 | Ga0495648_0168531 | 3300046524 | Bacteria | 1125 |
| 777 | Ga0495642_0039291 | 3300046528 | Bacteria | 1920 |
| 778 | Ga0495642_0178532 | 3300046528 | Bacteria | 924 |
| 779 | Ga0495652_0113259 | 3300046529 | Bacteria | 2178 |
| 780 | Ga0495654_0000516 | 3300046530 | Bacteria | 31438 |
| 781 | Ga0495665_0169263 | 3300046531 | Bacteria | 1138 |
| 782 | Ga0495640_0112594 | 3300046533 | Bacteria | 1777 |
| 783 | Ga0495586_0023994 | 3300046535 | Bacteria | 3257 |
| 784 | Ga0495598_0048374 | 3300046537 | Bacteria | 1271 |
| 785 | Ga0495621_0054808 | 3300046539 | Bacteria | 1434 |
| 786 | Ga0495597_0000077 | 3300046542 | Bacteria | 85280 |
| 787 | Ga0495597_0004233 | 3300046542 | Bacteria | 7938 |
| 788 | Ga0495645_0059650 | 3300046543 | Bacteria | 2766 |
| 789 | Ga0495645_0213292 | 3300046543 | Bacteria | 1302 |
| 790 | Ga0495668_0133472 | 3300046616 | Bacteria | 1359 |
| 791 | Ga0495668_0205660 | 3300046616 | Bacteria | 1078 |
| 792 | Ga0495611_0068732 | 3300046648 | Bacteria | 1617 |
| 793 | Ga0495625_0010774 | 3300046660 | Bacteria | 7524 |
| 794 | Ga0495625_0046871 | 3300046660 | Bacteria | 3117 |
| 795 | Ga0495625_0111812 | 3300046660 | Bacteria | 1866 |
| 796 | Ga0495625_0152879 | 3300046660 | Bacteria | 1550 |
| 797 | Ga0495635_0171131 | 3300046663 | Bacteria | 1477 |
| 798 | Ga0495635_0226379 | 3300046663 | Bacteria | 1264 |
| 799 | Ga0495588_0309928 | 3300046674 | Bacteria | 831 |
| 800 | Ga0495658_0008480 | 3300046683 | Bacteria | 5093 |
| 801 | Ga0495658_0009047 | 3300046683 | Bacteria | 4952 |
| 802 | Ga0495658_0028198 | 3300046683 | Bacteria | 3028 |
| 803 | Ga0495613_0350179 | 3300046689 | Bacteria | 1014 |
| 804 | Ga0495613_0459160 | 3300046689 | Bacteria | 862 |
| 805 | Ga0495671_0182488 | 3300046692 | Bacteria | 1019 |
| 806 | Ga0495649_0005279 | 3300046694 | Bacteria | 8254 |
| 807 | Ga0495649_0010343 | 3300046694 | Bacteria | 5510 |
| 808 | Ga0495589_0027305 | 3300046794 | Bacteria | 2886 |
| 809 | Ga0495676_0080963 | 3300047321 | Bacteria | 2463 |
| 810 | Ga0495683_0175335 | 3300047323 | Bacteria | 983 |
| 811 | Ga0495687_004388 | 3300047443 | Bacteria | 9571 |
| 812 | Ga0495687_016971 | 3300047443 | Bacteria | 3645 |
| 813 | Ga0495684_0063581 | 3300047471 | Bacteria | 2805 |
| 814 | Ga0495684_0105145 | 3300047471 | Bacteria | 2133 |
| 815 | Ga0495686_0000404 | 3300047472 | Bacteria | 68315 |
| 816 | Ga0495686_0052132 | 3300047472 | Bacteria | 2566 |
| 817 | Ga0495686_0060008 | 3300047472 | Bacteria | 2365 |
| 818 | Ga0495686_0363153 | 3300047472 | Bacteria | 784 |
| 819 | Ga0495602_0196764 | 3300048088 | Bacteria | 1541 |
| 820 | Ga0496102_0009017 | 3300048905 | Bacteria | 8562 |
| 821 | Ga0496102_0024974 | 3300048905 | Bacteria | 5316 |
| 822 | Ga0496102_0034587 | 3300048905 | Bacteria | 4545 |
| 823 | Ga0496103_0154589 | 3300048906 | Bacteria | 1470 |
| 824 | Ga0496104_0010216 | 3300048907 | Bacteria | 8381 |
| 825 | Ga0496104_0318816 | 3300048907 | Bacteria | 1467 |
| 826 | Ga0496105_0005943 | 3300048908 | Bacteria | 9313 |
| 827 | Ga0496106_0093220 | 3300048909 | Bacteria | 2327 |
| 828 | Ga0496106_0118111 | 3300048909 | Bacteria | 2070 |
| 829 | Ga0496106_0334145 | 3300048909 | Bacteria | 1217 |
| 830 | Ga0496107_0013802 | 3300048910 | Bacteria | 5648 |
| 831 | Ga0496108_0058880 | 3300048911 | Bacteria | 3230 |
| 832 | Ga0496109_0017559 | 3300048912 | Bacteria | 6274 |
| 833 | Ga0496109_0119690 | 3300048912 | Bacteria | 2452 |
| 834 | Ga0496109_0597807 | 3300048912 | Bacteria | 1039 |
| 835 | Ga0496109_0723367 | 3300048912 | Bacteria | 933 |
| 836 | Ga0496110_0020719 | 3300048913 | Bacteria | 5553 |
| 837 | Ga0496110_0108177 | 3300048913 | Bacteria | 2496 |
| 838 | Ga0496111_0391069 | 3300048914 | Bacteria | 1028 |
| 839 | Ga0496112_0472217 | 3300048915 | Bacteria | 1191 |
| 840 | Ga0496113_0446944 | 3300048916 | Bacteria | 1038 |
| 841 | Ga0496114_0013196 | 3300048917 | Bacteria | 6622 |
| 842 | Ga0496114_0019310 | 3300048917 | Bacteria | 5523 |
| 843 | Ga0496121_0004723 | 3300048924 | Bacteria | 17997 |
| 844 | Ga0496121_0102757 | 3300048924 | Bacteria | 2201 |
| 845 | Ga0496124_0000786 | 3300048927 | Bacteria | 51804 |
| 846 | Ga0496124_0014829 | 3300048927 | Bacteria | 7513 |
| 847 | Ga0496124_0075562 | 3300048927 | Bacteria | 2783 |
| 848 | Ga0496124_0079351 | 3300048927 | Bacteria | 2703 |
| 849 | Ga0496125_0145406 | 3300048928 | Bacteria | 1639 |
| 850 | Ga0501306_007246 | 3300049127 | Bacteria | 1323 |
| 851 | Ga0501309_000025 | 3300049129 | Bacteria | 7550 |
| 852 | Ga0501309_008388 | 3300049129 | Bacteria | 1300 |
| 853 | Ga0501310_000148 | 3300049130 | Bacteria | 6990 |
| 854 | Ga0501310_003053 | 3300049130 | Bacteria | 1624 |
| 855 | Ga0501310_010949 | 3300049130 | Bacteria | 1020 |
| 856 | Ga0501305_000406 | 3300049161 | Bacteria | 3471 |
| 857 | Ga0495678_052980 | 3300049459 | Bacteria | 1560 |
| 858 | Ga0501292_004010 | 3300049515 | Bacteria | 1994 |
| 859 | Ga0501312_000202 | 3300049528 | Bacteria | 4075 |
| 860 | Ga0501312_016510 | 3300049528 | Bacteria | 1057 |
| 861 | Ga0501312_037487 | 3300049528 | Bacteria | 782 |
| 862 | Ga0501031_0012469 | 3300049568 | Bacteria | 5545 |
| 863 | Ga0501034_0214881 | 3300049571 | Bacteria | 1877 |
| 864 | Ga0501039_0263426 | 3300049575 | Bacteria | 1355 |
| 865 | Ga0501041_0045728 | 3300049577 | Bacteria | 2662 |
| 866 | Ga0501042_0208528 | 3300049578 | Bacteria | 1409 |
| 867 | Ga0501043_0000439 | 3300049579 | Bacteria | 37482 |
| 868 | Ga0501046_0001371 | 3300049580 | Bacteria | 23462 |
| 869 | Ga0501047_0000069 | 3300049581 | Bacteria | 129231 |
| 870 | Ga0501048_0001073 | 3300049582 | Bacteria | 20497 |
| 871 | Ga0501071_0132017 | 3300049587 | Bacteria | 1856 |
| 872 | Ga0501072_0089355 | 3300049588 | Bacteria | 2445 |
| 873 | Ga0501075_0102944 | 3300049591 | Bacteria | 2169 |
| 874 | Ga0501075_0326332 | 3300049591 | Bacteria | 1169 |
| 875 | Ga0501076_0356136 | 3300049592 | Bacteria | 1202 |
| 876 | Ga0501198_000025 | 3300049649 | Bacteria | 66985 |
| 877 | Ga0501206_023797 | 3300049653 | Bacteria | 884 |
| 878 | Ga0501217_023230 | 3300049661 | Bacteria | 1476 |
| 879 | Ga0501222_000033 | 3300049662 | Bacteria | 55105 |
| 880 | Ga0501236_004440 | 3300049670 | Bacteria | 1664 |
| 881 | Ga0501249_018171 | 3300049679 | Bacteria | 1519 |
| 882 | Ga0501255_001587 | 3300049684 | Bacteria | 1862 |
| 883 | Ga0501257_020132 | 3300049686 | Bacteria | 1565 |
| 884 | Ga0501258_005799 | 3300049687 | Bacteria | 1208 |
| 885 | Ga0501221_001733 | 3300049704 | Bacteria | 3629 |
| 886 | Ga0501225_0045324 | 3300049705 | Bacteria | 1218 |
| 887 | Ga0501229_000244 | 3300049706 | Bacteria | 6111 |
| 888 | Ga0501262_001485 | 3300049759 | Bacteria | 2636 |
| 889 | Ga0501265_000973 | 3300049762 | Bacteria | 3223 |
| 890 | Ga0501266_000336 | 3300049763 | Bacteria | 6229 |
| 891 | Ga0501267_000971 | 3300049764 | Bacteria | 2359 |
| 892 | Ga0501268_013544 | 3300049765 | Bacteria | 1318 |
| 893 | Ga0501269_007210 | 3300049766 | Bacteria | 1342 |
| 894 | Ga0501270_014238 | 3300049767 | Bacteria | 1116 |
| 895 | Ga0501282_000064 | 3300049778 | Bacteria | 12905 |
| 896 | Ga0501045_0005472 | 3300049824 | Bacteria | 8789 |
| 897 | Ga0501226_003873 | 3300049853 | Bacteria | 1755 |
| 898 | nmdc:mga03683_10004_c1 | 3300050489 | Bacteria | 3390 |
| 899 | nmdc:mga03683_155164_c1 | 3300050489 | Bacteria | 1035 |
| 900 | nmdc:mga03n38_4511_c1 | 3300050490 | Bacteria | 4629 |
| 901 | nmdc:mga00v17_228725_c1 | 3300050491 | Bacteria | 1205 |
| 902 | nmdc:mga00v17_305870_c1 | 3300050491 | Bacteria | 1033 |
| 903 | nmdc:mga0yw44_33899_c1 | 3300050492 | Bacteria | 2987 |
| 904 | nmdc:mga0k408_106671_c1 | 3300050493 | Bacteria | 1655 |
| 905 | nmdc:mga0k408_12634_c1 | 3300050493 | Bacteria | 4616 |
| 906 | nmdc:mga0k408_1934_c1 | 3300050493 | Bacteria | 11085 |
| 907 | nmdc:mga0k408_204130_c1 | 3300050493 | Bacteria | 1180 |
| 908 | nmdc:mga0k408_215236_c1 | 3300050493 | Bacteria | 1147 |
| 909 | nmdc:mga0k408_21725_c1 | 3300050493 | Bacteria | 3607 |
| 910 | nmdc:mga0k408_27545_c1 | 3300050493 | Bacteria | 3228 |
| 911 | nmdc:mga0k408_27789_c1 | 3300050493 | Bacteria | 3214 |
| 912 | nmdc:mga0k408_3284_c1 | 3300050493 | Bacteria | 8560 |
| 913 | nmdc:mga0k408_47090_c1 | 3300050493 | Bacteria | 2492 |
| 914 | nmdc:mga0k408_62543_c1 | 3300050493 | Bacteria | 2165 |
| 915 | nmdc:mga0k408_67217_c1 | 3300050493 | Bacteria | 2089 |
| 916 | nmdc:mga0k408_8880_c1 | 3300050493 | Bacteria | 5406 |
| 917 | nmdc:mga06z11_14982_c1 | 3300050494 | Bacteria | 3450 |
| 918 | nmdc:mga06z11_15471_c1 | 3300050494 | Bacteria | 3406 |
| 919 | nmdc:mga06z11_22757_c1 | 3300050494 | Bacteria | 2932 |
| 920 | nmdc:mga04h51_189000_c1 | 3300050495 | Bacteria | 805 |
| 921 | nmdc:mga07m45_1266_c1 | 3300050496 | Bacteria | 11496 |
| 922 | nmdc:mga07m45_13746_c1 | 3300050496 | Bacteria | 4299 |
| 923 | nmdc:mga07m45_34480_c1 | 3300050496 | Bacteria | 2813 |
| 924 | nmdc:mga07m45_7481_c1 | 3300050496 | Bacteria | 5583 |
| 925 | nmdc:mga07m45_85675_c1 | 3300050496 | Bacteria | 1802 |
| 926 | nmdc:mga05p37_110216_c1 | 3300050507 | Bacteria | 3386 |
| 927 | nmdc:mga09592_1763_c1 | 3300050508 | Bacteria | 17376 |
| 928 | nmdc:mga0qj67_270383_c1 | 3300050509 | Bacteria | 1378 |
| 929 | nmdc:mga08y16_152329_c1 | 3300050511 | Bacteria | 2403 |
| 930 | nmdc:mga08y16_782340_c1 | 3300050511 | Bacteria | 948 |
| 931 | nmdc:mga0sz30_56800_c1 | 3300050516 | Bacteria | 1668 |
| 932 | Ga0495601_0166020 | 3300053077 | Bacteria | 1443 |
| 933 | Ga0500635_0000215 | 3300053080 | Bacteria | 27205 |
| 934 | Ga0500635_0070413 | 3300053080 | Bacteria | 1239 |
| 935 | Ga0495595_0018669 | 3300053084 | Bacteria | 3000 |
| 936 | Ga0495619_0046643 | 3300053085 | Bacteria | 2850 |
| 937 | Ga0500578_0000006 | 3300053086 | Bacteria | 234598 |
| 938 | Ga0500578_0035695 | 3300053086 | Bacteria | 3194 |
| 939 | Ga0500644_0003987 | 3300053088 | Bacteria | 3674 |
| 940 | Ga0500651_0006999 | 3300053093 | Bacteria | 6547 |
| 941 | Ga0500651_0215640 | 3300053093 | Bacteria | 1127 |
| 942 | Ga0500650_0107296 | 3300053098 | Bacteria | 1304 |
| 943 | Ga0500562_048068 | 3300053108 | Bacteria | 1139 |
| 944 | Ga0500593_001218 | 3300053117 | Bacteria | 9301 |
| 945 | Ga0500594_0033972 | 3300053118 | Bacteria | 1359 |
| 946 | Ga0500607_032062 | 3300053121 | Bacteria | 2887 |
| 947 | Ga0500623_045564 | 3300053127 | Bacteria | 2226 |
| 948 | Ga0500628_001683 | 3300053129 | Bacteria | 3741 |
| 949 | Ga0500642_0005701 | 3300053130 | Bacteria | 4043 |
| 950 | Ga0500652_000158 | 3300053131 | Bacteria | 26062 |
| 951 | Ga0500652_027113 | 3300053131 | Bacteria | 2212 |
| 952 | Ga0500655_002668 | 3300053133 | Bacteria | 3233 |
| 953 | Ga0500559_0000138 | 3300053136 | Bacteria | 56620 |
| 954 | Ga0500590_126164 | 3300053148 | Bacteria | 1191 |
| 955 | Ga0500619_000010 | 3300053154 | Bacteria | 61024 |
| 956 | Ga0500622_0001738 | 3300053156 | Bacteria | 16832 |
| 957 | Ga0500622_0015365 | 3300053156 | Bacteria | 4100 |
| 958 | Ga0500634_0070370 | 3300053161 | Bacteria | 1832 |
| 959 | Ga0500636_0059931 | 3300053177 | Bacteria | 2223 |
| 960 | Ga0500645_006609 | 3300053730 | Bacteria | 4114 |
| 961 | Ga0500587_018500 | 3300053739 | Bacteria | 897 |
| 962 | Ga0501084_0308281 | 3300054114 | Bacteria | 1337 |
| 963 | Ga0590075_039815 | 3300059424 | Bacteria | 1199 |
| 964 | Ga0501082_0209540 | 3300060353 | Bacteria | 1696 |
| 965 | Ga0466962_0004427 | 3300061719 | Bacteria | 6728 |
| 966 | Ga0466962_0099306 | 3300061719 | Bacteria | 1397 |
| 967 | Ga0466962_0177697 | 3300061719 | Bacteria | 1037 |
| 968 | 2587725119 | 2585428057 | Bacteria | 6737412 |
| 969 | 2587731521 | 2585428058 | Bacteria | 6853932 |
| 970 | 2587756202 | 2585428062 | Bacteria | 6842168 |
| 971 | 2588295167 | 2588253510 | Bacteria | 6901809 |
| 972 | 2643746421 | 2643221544 | Bacteria | 5886209 |
| 973 | 2643966990 | 2643221592 | Bacteria | 6608788 |
| 974 | 2644142641 | 2643221625 | Bacteria | 6512927 |
| 975 | 2644217245 | 2643221639 | Bacteria | 6649903 |
| 976 | 2644248406 | 2643221644 | Bacteria | 6865017 |
| 977 | 2644258987 | 2643221646 | Bacteria | 6433402 |
| 978 | 2644273684 | 2643221648 | Bacteria | 6521465 |
| 979 | 2644301630 | 2643221654 | Bacteria | 5273570 |
| 980 | 2644314350 | 2643221656 | Bacteria | 5809961 |
| 981 | 2644338717 | 2643221660 | Bacteria | 4208257 |
| 982 | 2722881364 | 2721755523 | Bacteria | 6430384 |
| 983 | 2739055723 | 2738541337 | Bacteria | 6183410 |
| 984 | 2831866137 | 2831864461 | Bacteria | 6502356 |
| 985 | 2839140615 | 2839138175 | Bacteria | 6549354 |
| 986 | 2886850731 | 2886848708 | Bacteria | 5632523 |
| 987 | nmdc:mga07m45_960_c1 | |||
| 988 | SwRhRL2b_contig_1230578 | |||
| 989 | SwRhRL2b_contig_3945145 | |||
| 990 | JGI24740J21852_10052921 | |||
| 991 | JGI24744J21845_10014524 | |||
| 992 | JGI25154J39366_1001409 | |||
| 993 | JGI25157J39369_1000027 | |||
| 994 | JGI25164J39214_1005229 | |||
| 995 | JGI25152J39213_1002504 | |||
| 996 | JGI25153J46596_10004012 | |||
| 997 | JGI25153J46596_10008556 | |||
| 998 | rootH1_10001428 | |||
| 999 | rootH2_10031478 | |||
| 1000 | rootL2_10003861 | |||
| 1001 | rootH1_10005727 | |||
| 1002 | rootH1_10065205 | |||
| 1003 | JGI26145J50221_1002941 | |||
| 1004 | Ga0055533_1000073 | |||
| 1005 | Ga0055525_1000038 | |||
| 1006 | Ga0055525_1001631 | |||
| 1007 | Ga0055535_1003758 | |||
| 1008 | Ga0055529_1000385 | |||
| 1009 | Ga0055526_1009433 | |||
| 1010 | Ga0055524_1000242 | |||
| 1011 | Ga0055524_1001332 | |||
| 1012 | Ga0055524_1007381 | |||
| 1013 | Ga0055530_10004226 | |||
| 1014 | Ga0055530_10005683 | |||
| 1015 | Ga0055530_10032056 | |||
| 1016 | Ga0055540_1000015 | |||
| 1017 | Ga0055531_10000043 | |||
| 1018 | Ga0055531_10008158 | |||
| 1019 | Ga0055531_10017077 | |||
| 1020 | Ga0055531_10019016 | |||
| 1021 | Ga0055543_1002176 | |||
| 1022 | Ga0055543_1007063 | |||
| 1023 | Ga0065165_1000283 | |||
| 1024 | Ga0065165_1000732 | |||
| 1025 | Ga0065165_1005192 | |||
| 1026 | Ga0065704_10325887 | |||
| 1027 | Ga0065715_10336276 | |||
| 1028 | Ga0065707_10237321 | |||
| 1029 | Ga0070676_10001230 | |||
| 1030 | Ga0070676_10274495 | |||
| 1031 | Ga0070690_100011544 | |||
| 1032 | Ga0070690_100012917 | |||
| 1033 | Ga0070670_100002549 | |||
| 1034 | Ga0070670_100021319 | |||
| 1035 | Ga0070670_100038937 | |||
| 1036 | Ga0070670_100154794 | |||
| 1037 | Ga0070677_10003169 | |||
| 1038 | Ga0070677_10004158 | |||
| 1039 | Ga0070677_10020378 | |||
| 1040 | Ga0068869_100035286 | |||
| 1041 | Ga0068869_100079511 | |||
| 1042 | Ga0070680_100009256 | |||
| 1043 | Ga0070682_100086284 | |||
| 1044 | Ga0068868_100007055 | |||
| 1045 | Ga0068868_100065272 | |||
| 1046 | Ga0070660_100086354 | |||
| 1047 | Ga0070660_100109700 | |||
| 1048 | Ga0070689_100050074 | |||
| 1049 | Ga0070661_100081275 | |||
| 1050 | Ga0070661_100131844 | |||
| 1051 | Ga0070668_100028598 | |||
| 1052 | Ga0070668_100120560 | |||
| 1053 | Ga0070669_100002315 | |||
| 1054 | Ga0070669_100062840 | |||
| 1055 | Ga0070669_100236590 | |||
| 1056 | Ga0070669_100238908 | |||
| 1057 | Ga0070675_100015429 | |||
| 1058 | Ga0070675_100051441 | |||
| 1059 | Ga0070675_100057267 | |||
| 1060 | Ga0070675_100147197 | |||
| 1061 | Ga0070675_100434515 | |||
| 1062 | Ga0070671_100018406 | |||
| 1063 | Ga0070671_100034187 | |||
| 1064 | Ga0070671_100057393 | |||
| 1065 | Ga0070671_100063761 | |||
| 1066 | Ga0070671_100080833 | |||
| 1067 | Ga0070671_100127555 | |||
| 1068 | Ga0070674_100088546 | |||
| 1069 | Ga0070673_100002831 | |||
| 1070 | Ga0070673_100143779 | |||
| 1071 | Ga0070673_100480446 | |||
| 1072 | Ga0070659_100002606 | |||
| 1073 | Ga0070659_100048346 | |||
| 1074 | Ga0070659_100102453 | |||
| 1075 | Ga0070667_100003888 | |||
| 1076 | Ga0070667_100013392 | |||
| 1077 | Ga0070667_100039447 | |||
| 1078 | Ga0070667_100146474 | |||
| 1079 | Ga0070667_100508456 | |||
| 1080 | Ga0070700_100057256 | |||
| 1081 | Ga0070700_100118124 | |||
| 1082 | Ga0070663_100001718 | |||
| 1083 | Ga0070663_100028656 | |||
| 1084 | Ga0070663_100256217 | |||
| 1085 | Ga0070678_100011117 | |||
| 1086 | Ga0070678_100032599 | |||
| 1087 | Ga0070678_100128550 | |||
| 1088 | Ga0070678_100604324 | |||
| 1089 | Ga0070662_100001001 | |||
| 1090 | Ga0070662_100017955 | |||
| 1091 | Ga0070662_100020424 | |||
| 1092 | Ga0070681_10027720 | |||
| 1093 | Ga0068867_100000118 | |||
| 1094 | Ga0068867_100022580 | |||
| 1095 | Ga0068867_100093859 | |||
| 1096 | Ga0068867_100123370 | |||
| 1097 | Ga0068867_100197593 | |||
| 1098 | Ga0068867_100298773 | |||
| 1099 | Ga0070685_10031202 | |||
| 1100 | Ga0070706_100000965 | |||
| 1101 | Ga0070707_100028547 | |||
| 1102 | Ga0070698_100056763 | |||
| 1103 | Ga0070684_100158905 | |||
| 1104 | Ga0070684_100351681 | |||
| 1105 | Ga0070684_100691494 | |||
| 1106 | Ga0068853_100000531 | |||
| 1107 | Ga0068853_100186423 | |||
| 1108 | Ga0070672_100006693 | |||
| 1109 | Ga0070672_100008379 | |||
| 1110 | Ga0070672_100046804 | |||
| 1111 | Ga0070672_100057494 | |||
| 1112 | Ga0070672_100078741 | |||
| 1113 | Ga0070672_100095161 | |||
| 1114 | Ga0070672_100121856 | |||
| 1115 | Ga0070672_100254614 | |||
| 1116 | Ga0070686_100065221 | |||
| 1117 | Ga0070665_100098483 | |||
| 1118 | Ga0070665_100154019 | |||
| 1119 | Ga0068855_100009023 | |||
| 1120 | Ga0068855_100084890 | |||
| 1121 | Ga0068855_100538168 | |||
| 1122 | Ga0070664_100028601 | |||
| 1123 | Ga0070664_100064225 | |||
| 1124 | Ga0068857_100086072 | |||
| 1125 | Ga0068854_100070338 | |||
| 1126 | Ga0068854_100152457 | |||
| 1127 | Ga0068854_100171067 | |||
| 1128 | Ga0068854_100188364 | |||
| 1129 | Ga0068856_100019359 | |||
| 1130 | Ga0068856_100025775 | |||
| 1131 | Ga0068852_100073693 | |||
| 1132 | Ga0068852_100077216 | |||
| 1133 | Ga0068852_100119604 | |||
| 1134 | Ga0068852_100619570 | |||
| 1135 | Ga0068852_100645561 | |||
| 1136 | Ga0068859_100012494 | |||
| 1137 | Ga0068859_100077548 | |||
| 1138 | Ga0068859_100086979 | |||
| 1139 | Ga0068859_101281275 | |||
| 1140 | Ga0068864_100009897 | |||
| 1141 | Ga0068864_100011232 | |||
| 1142 | Ga0068864_100015484 | |||
| 1143 | Ga0068864_100042843 | |||
| 1144 | Ga0068864_100485456 | |||
| 1145 | Ga0068864_100722176 | |||
| 1146 | Ga0068866_10008904 | |||
| 1147 | Ga0068866_10078971 | |||
| 1148 | Ga0068861_100002963 | |||
| 1149 | Ga0068861_100012125 | |||
| 1150 | Ga0068861_100016485 | |||
| 1151 | Ga0068861_100020535 | |||
| 1152 | Ga0068861_100073836 | |||
| 1153 | Ga0068861_100102900 | |||
| 1154 | Ga0068851_10031320 | |||
| 1155 | Ga0068851_10075496 | |||
| 1156 | Ga0068851_10097806 | |||
| 1157 | Ga0068870_10067885 | |||
| 1158 | Ga0068870_10168954 | |||
| 1159 | Ga0068863_100005044 | |||
| 1160 | Ga0068863_100016273 | |||
| 1161 | Ga0068863_100026617 | |||
| 1162 | Ga0068863_100081785 | |||
| 1163 | Ga0068863_100265043 | |||
| 1164 | Ga0068858_100003535 | |||
| 1165 | Ga0068858_100020363 | |||
| 1166 | Ga0068858_100031405 | |||
| 1167 | Ga0068860_100022185 | |||
| 1168 | Ga0068860_100037149 | |||
| 1169 | Ga0068860_100064591 | |||
| 1170 | Ga0068860_100124585 | |||
| 1171 | Ga0068860_100149613 | |||
| 1172 | Ga0068860_100184950 | |||
| 1173 | Ga0068860_100294881 | |||
| 1174 | Ga0068862_100005039 | |||
| 1175 | Ga0068862_100014167 | |||
| 1176 | Ga0068862_100186189 | |||
| 1177 | Ga0068862_100202946 | |||
| 1178 | Ga0081455_10127724 | |||
| 1179 | Ga0075365_10029275 | |||
| 1180 | Ga0075363_100020269 | |||
| 1181 | Ga0075363_100044822 | |||
| 1182 | Ga0075362_10005519 | |||
| 1183 | Ga0075362_10034342 | |||
| 1184 | Ga0075362_10124993 | |||
| 1185 | Ga0075367_10008638 | |||
| 1186 | Ga0075367_10011101 | |||
| 1187 | Ga0075367_10036535 | |||
| 1188 | Ga0075367_10066862 | |||
| 1189 | Ga0075369_10102269 | |||
| 1190 | Ga0075369_10239386 | |||
| 1191 | Ga0075366_10005622 | |||
| 1192 | Ga0075366_10006143 | |||
| 1193 | Ga0075366_10007241 | |||
| 1194 | Ga0075366_10009655 | |||
| 1195 | Ga0075366_10013728 | |||
| 1196 | Ga0075366_10022545 | |||
| 1197 | Ga0075366_10027031 | |||
| 1198 | Ga0075366_10044385 | |||
| 1199 | Ga0075366_10086869 | |||
| 1200 | Ga0075366_10192772 | |||
| 1201 | Ga0097621_100030138 | |||
| 1202 | Ga0097621_100043267 | |||
| 1203 | Ga0097621_100104548 | |||
| 1204 | Ga0075370_10000130 | |||
| 1205 | Ga0075370_10001345 | |||
| 1206 | Ga0075370_10002588 | |||
| 1207 | Ga0075370_10003017 | |||
| 1208 | Ga0075370_10009309 | |||
| 1209 | Ga0075370_10012654 | |||
| 1210 | Ga0075370_10062644 | |||
| 1211 | Ga0075370_10064608 | |||
| 1212 | Ga0075370_10113352 | |||
| 1213 | Ga0068871_100109875 | |||
| 1214 | Ga0075434_100537458 | |||
| 1215 | Ga0075429_100001726 | |||
| 1216 | Ga0068865_100005096 | |||
| 1217 | Ga0097620_100012494 | |||
| 1218 | Ga0097620_100077545 | |||
| 1219 | Ga0097620_100086975 | |||
| 1220 | Ga0097620_101281293 | |||
| 1221 | Ga0099823_1031990 | |||
| 1222 | Ga0079104_1000040 | |||
| 1223 | Ga0079104_1000427 | |||
| 1224 | Ga0105250_10000379 | |||
| 1225 | Ga0105240_10003000 | |||
| 1226 | Ga0105240_10054403 | |||
| 1227 | Ga0105240_10076067 | |||
| 1228 | Ga0105240_10149156 | |||
| 1229 | Ga0105245_10110625 | |||
| 1230 | Ga0105245_10168037 | |||
| 1231 | Ga0105245_10233345 | |||
| 1232 | Ga0105245_10520946 | |||
| 1233 | Ga0114129_10099876 | |||
| 1234 | Ga0114129_10327459 | |||
| 1235 | Ga0105243_10000516 | |||
| 1236 | Ga0105243_10002920 | |||
| 1237 | Ga0105243_10024728 | |||
| 1238 | Ga0105243_10047577 | |||
| 1239 | Ga0105243_10065560 | |||
| 1240 | Ga0105241_10046653 | |||
| 1241 | Ga0105241_10083114 | |||
| 1242 | Ga0105241_10449135 | |||
| 1243 | Ga0105248_10002030 | |||
| 1244 | Ga0105248_10016482 | |||
| 1245 | Ga0105248_10047705 | |||
| 1246 | Ga0105248_10106584 | |||
| 1247 | Ga0105248_10582908 | |||
| 1248 | Ga0105237_10000870 | |||
| 1249 | Ga0105237_10016422 | |||
| 1250 | Ga0105237_10062994 | |||
| 1251 | Ga0105238_10023445 | |||
| 1252 | Ga0105238_10030130 | |||
| 1253 | Ga0105249_10213889 | |||
| 1254 | Ga0105249_10246534 | |||
| 1255 | Ga0105239_10000417 | |||
| 1256 | Ga0105239_10067508 | |||
| 1257 | Ga0105239_10098468 | |||
| 1258 | Ga0105239_10738632 | |||
| 1259 | Ga0105246_10463218 | |||
| 1260 | Ga0157340_1003658 | |||
| 1261 | Ga0157319_1000037 | |||
| 1262 | Ga0157373_10061037 | |||
| 1263 | Ga0157371_10023164 | |||
| 1264 | Ga0157371_10176371 | |||
| 1265 | Ga0157369_10028287 | |||
| 1266 | Ga0157369_10172625 | |||
| 1267 | Ga0157374_10060226 | |||
| 1268 | Ga0157374_10124123 | |||
| 1269 | Ga0157378_10009166 | |||
| 1270 | Ga0157378_10171671 | |||
| 1271 | Ga0163162_10018593 | |||
| 1272 | Ga0163162_10020440 | |||
| 1273 | Ga0163162_10161823 | |||
| 1274 | Ga0157372_10009475 | |||
| 1275 | Ga0157372_10179122 | |||
| 1276 | Ga0157375_10011743 | |||
| 1277 | Ga0157375_10027025 | |||
| 1278 | Ga0157375_10064221 | |||
| 1279 | Ga0157375_10079252 | |||
| 1280 | Ga0157375_10173076 | |||
| 1281 | Ga0157375_10418749 | |||
| 1282 | Ga0163163_10012204 | |||
| 1283 | Ga0163163_10038201 | |||
| 1284 | Ga0163163_10060230 | |||
| 1285 | Ga0157380_10015491 | |||
| 1286 | Ga0157380_10024058 | |||
| 1287 | Ga0157380_10031157 | |||
| 1288 | Ga0157380_10126284 | |||
| 1289 | Ga0157380_10223715 | |||
| 1290 | Ga0182008_10001330 | |||
| 1291 | Ga0157377_10000313 | |||
| 1292 | Ga0157377_10045731 | |||
| 1293 | Ga0157379_10003100 | |||
| 1294 | Ga0157379_10004439 | |||
| 1295 | Ga0157379_10069785 | |||
| 1296 | Ga0157376_10027225 | |||
| 1297 | Ga0157376_10200220 | |||
| 1298 | Ga0157376_10393116 | |||
| 1299 | Ga0182007_10045992 | |||
| 1300 | Ga0163161_10023832 | |||
| 1301 | Ga0163161_10288696 | |||
| 1302 | Ga0213872_10000018 | |||
| 1303 | Ga0213872_10000070 | |||
| 1304 | Ga0213872_10138690 | |||
| 1305 | Ga0209674_100039 | |||
| 1306 | Ga0209563_100005 | |||
| 1307 | Ga0209563_100110 | |||
| 1308 | Ga0207427_104198 | |||
| 1309 | Ga0209258_100305 | |||
| 1310 | Ga0209258_100692 | |||
| 1311 | Ga0207425_1005493 | |||
| 1312 | Ga0209646_1000196 | |||
| 1313 | Ga0209026_1000011 | |||
| 1314 | Ga0209677_100151 | |||
| 1315 | Ga0209677_100621 | |||
| 1316 | Ga0209677_102310 | |||
| 1317 | Ga0209759_1000107 | |||
| 1318 | Ga0209759_1004962 | |||
| 1319 | Ga0209759_1008572 | |||
| 1320 | Ga0209129_1000027 | |||
| 1321 | Ga0209455_1000053 | |||
| 1322 | Ga0209673_1009495 | |||
| 1323 | Ga0209673_1016350 | |||
| 1324 | Ga0209673_1029509 | |||
| 1325 | Ga0209675_1009087 | |||
| 1326 | Ga0209564_1000014 | |||
| 1327 | Ga0209564_1000051 | |||
| 1328 | Ga0209758_1000193 | |||
| 1329 | Ga0209758_1000208 | |||
| 1330 | Ga0209050_1000416 | |||
| 1331 | Ga0209050_1001233 | |||
| 1332 | Ga0209050_1001932 | |||
| 1333 | Ga0209050_1015631 | |||
| 1334 | Ga0209050_1015668 | |||
| 1335 | Ga0209256_1000092 | |||
| 1336 | Ga0209256_1000471 | |||
| 1337 | Ga0209256_1000967 | |||
| 1338 | Ga0209051_1000020 | |||
| 1339 | Ga0209051_1003495 | |||
| 1340 | Ga0209051_1005666 | |||
| 1341 | Ga0209051_1007685 | |||
| 1342 | Ga0209051_1008472 | |||
| 1343 | Ga0209051_1040661 | |||
| 1344 | Ga0209257_1000182 | |||
| 1345 | Ga0209257_1000189 | |||
| 1346 | Ga0209257_1001013 | |||
| 1347 | Ga0209257_1009108 | |||
| 1348 | Ga0209257_1013728 | |||
| 1349 | Ga0207697_10139621 | |||
| 1350 | Ga0207656_10044902 | |||
| 1351 | Ga0207682_10014444 | |||
| 1352 | Ga0207682_10074528 | |||
| 1353 | Ga0207642_10012161 | |||
| 1354 | Ga0207688_10273792 | |||
| 1355 | Ga0207680_10082238 | |||
| 1356 | Ga0207647_10180009 | |||
| 1357 | Ga0207645_10083578 | |||
| 1358 | Ga0207643_10009117 | |||
| 1359 | Ga0207643_10240030 | |||
| 1360 | Ga0207705_10278848 | |||
| 1361 | Ga0207684_10004494 | |||
| 1362 | Ga0207695_10004036 | |||
| 1363 | Ga0207695_10005546 | |||
| 1364 | Ga0207695_10047193 | |||
| 1365 | Ga0207695_10194890 | |||
| 1366 | Ga0207695_10251548 | |||
| 1367 | Ga0207671_10005322 | |||
| 1368 | Ga0207671_10060127 | |||
| 1369 | Ga0207660_10113049 | |||
| 1370 | Ga0207662_10275784 | |||
| 1371 | Ga0207657_10046620 | |||
| 1372 | Ga0207649_10002166 | |||
| 1373 | Ga0207649_10051621 | |||
| 1374 | Ga0207652_10006446 | |||
| 1375 | Ga0207646_10030388 | |||
| 1376 | Ga0207681_10008786 | |||
| 1377 | Ga0207681_10040654 | |||
| 1378 | Ga0207694_10017172 | |||
| 1379 | Ga0207694_10051794 | |||
| 1380 | Ga0207694_10319491 | |||
| 1381 | Ga0207650_10000904 | |||
| 1382 | Ga0207650_10009335 | |||
| 1383 | Ga0207650_10010853 | |||
| 1384 | Ga0207650_10171363 | |||
| 1385 | Ga0207659_10004951 | |||
| 1386 | Ga0207659_10006933 | |||
| 1387 | Ga0207659_10148487 | |||
| 1388 | Ga0207659_10383426 | |||
| 1389 | Ga0207687_10013305 | |||
| 1390 | Ga0207687_10085684 | |||
| 1391 | Ga0207687_10727047 | |||
| 1392 | Ga0207644_10001787 | |||
| 1393 | Ga0207644_10006315 | |||
| 1394 | Ga0207644_10037525 | |||
| 1395 | Ga0207644_10083387 | |||
| 1396 | Ga0207644_10179303 | |||
| 1397 | Ga0207644_10513448 | |||
| 1398 | Ga0207690_10004334 | |||
| 1399 | Ga0207706_10001749 | |||
| 1400 | Ga0207706_10031078 | |||
| 1401 | Ga0207706_10303429 | |||
| 1402 | Ga0207686_10085030 | |||
| 1403 | Ga0207709_10000382 | |||
| 1404 | Ga0207709_10037497 | |||
| 1405 | Ga0207709_10048858 | |||
| 1406 | Ga0207709_10578059 | |||
| 1407 | Ga0207670_10718974 | |||
| 1408 | Ga0207669_10007483 | |||
| 1409 | Ga0207704_10009164 | |||
| 1410 | Ga0207704_10778040 | |||
| 1411 | Ga0207691_10005307 | |||
| 1412 | Ga0207691_10011899 | |||
| 1413 | Ga0207691_10017763 | |||
| 1414 | Ga0207691_10030742 | |||
| 1415 | Ga0207691_10103674 | |||
| 1416 | Ga0207711_10009050 | |||
| 1417 | Ga0207711_10079588 | |||
| 1418 | Ga0207711_10127355 | |||
| 1419 | Ga0207711_10538336 | |||
| 1420 | Ga0207689_10043887 | |||
| 1421 | Ga0207689_10072292 | |||
| 1422 | Ga0207661_10152171 | |||
| 1423 | Ga0207661_10362973 | |||
| 1424 | Ga0207679_10000154 | |||
| 1425 | Ga0207679_10168056 | |||
| 1426 | Ga0207679_10175328 | |||
| 1427 | Ga0207667_10014452 | |||
| 1428 | Ga0207667_10070368 | |||
| 1429 | Ga0207667_10814856 | |||
| 1430 | Ga0207651_10000726 | |||
| 1431 | Ga0207651_10023579 | |||
| 1432 | Ga0207651_10040992 | |||
| 1433 | Ga0207651_10407075 | |||
| 1434 | Ga0207712_10079843 | |||
| 1435 | Ga0207712_10159397 | |||
| 1436 | Ga0207712_10237152 | |||
| 1437 | Ga0207712_10239044 | |||
| 1438 | Ga0207712_10781651 | |||
| 1439 | Ga0207668_10172325 | |||
| 1440 | Ga0207640_10006815 | |||
| 1441 | Ga0207640_10104626 | |||
| 1442 | Ga0207658_10006325 | |||
| 1443 | Ga0207658_10008867 | |||
| 1444 | Ga0207658_10022179 | |||
| 1445 | Ga0207677_10017241 | |||
| 1446 | Ga0207677_10096180 | |||
| 1447 | Ga0207703_10007292 | |||
| 1448 | Ga0207703_10019578 | |||
| 1449 | Ga0207703_10033069 | |||
| 1450 | Ga0207703_11048342 | |||
| 1451 | Ga0207639_10003410 | |||
| 1452 | Ga0207639_10321337 | |||
| 1453 | Ga0207639_10741068 | |||
| 1454 | Ga0207678_10001164 | |||
| 1455 | Ga0207678_10061645 | |||
| 1456 | Ga0207678_10165640 | |||
| 1457 | Ga0207708_10008693 | |||
| 1458 | Ga0207708_10035380 | |||
| 1459 | Ga0207708_10481162 | |||
| 1460 | Ga0207702_10000270 | |||
| 1461 | Ga0207702_10023323 | |||
| 1462 | Ga0207702_10685732 | |||
| 1463 | Ga0207641_10010569 | |||
| 1464 | Ga0207641_10016789 | |||
| 1465 | Ga0207648_10000264 | |||
| 1466 | Ga0207648_10002564 | |||
| 1467 | Ga0207648_10054352 | |||
| 1468 | Ga0207648_10119130 | |||
| 1469 | Ga0207648_10274947 | |||
| 1470 | Ga0207648_10600044 | |||
| 1471 | Ga0207648_10659617 | |||
| 1472 | Ga0207676_10002431 | |||
| 1473 | Ga0207676_10003185 | |||
| 1474 | Ga0207676_10003375 | |||
| 1475 | Ga0207676_10065216 | |||
| 1476 | Ga0207674_10007035 | |||
| 1477 | Ga0207675_100004520 | |||
| 1478 | Ga0207675_100020594 | |||
| 1479 | Ga0207675_100045818 | |||
| 1480 | Ga0207675_100048921 | |||
| 1481 | Ga0207675_100236286 | |||
| 1482 | Ga0207675_100297352 | |||
| 1483 | Ga0207675_100956634 | |||
| 1484 | Ga0207683_10004615 | |||
| 1485 | Ga0207683_10008759 | |||
| 1486 | Ga0207683_10111270 | |||
| 1487 | Ga0207683_10163755 | |||
| 1488 | Ga0207683_10896549 | |||
| 1489 | Ga0207698_10067256 | |||
| 1490 | Ga0207698_10160315 | |||
| 1491 | Ga0209281_1000072 | |||
| 1492 | Ga0209281_1000074 | |||
| 1493 | Ga0209984_1015402 | |||
| 1494 | Ga0209995_1013728 | |||
| 1495 | Ga0209968_1000344 | |||
| 1496 | Ga0209970_1026864 | |||
| 1497 | Ga0209983_1046768 | |||
| 1498 | Ga0209966_1000136 | |||
| 1499 | Ga0268266_10577983 | |||
| 1500 | Ga0268265_10022062 | |||
| 1501 | Ga0268265_10034984 | |||
| 1502 | Ga0268265_10152302 | |||
| 1503 | Ga0268265_10276860 | |||
| 1504 | Ga0268264_10005811 | |||
| 1505 | Ga0268264_10062092 | |||
| 1506 | Ga0268264_10327008 | |||
| 1507 | Ga0265336_10000022 | |||
| 1508 | Ga0307517_10072121 | |||
| 1509 | Ga0307515_10000131 | |||
| 1510 | Ga0307515_10000165 | |||
| 1511 | Ga0307515_10000232 | |||
| 1512 | Ga0307515_10006463 | |||
| 1513 | Ga0307515_10015871 | |||
| 1514 | Ga0307515_10018948 | |||
| 1515 | Ga0307515_10022118 | |||
| 1516 | Ga0307515_10254187 | |||
| 1517 | Ga0307515_10298322 | |||
| 1518 | Ga0265324_10002429 | |||
| 1519 | Ga0265324_10006622 | |||
| 1520 | Ga0268256_1026772 | |||
| 1521 | Ga0307512_10056946 | |||
| 1522 | Ga0307512_10165008 | |||
| 1523 | Ga0265330_10014977 | |||
| 1524 | Ga0265332_10000220 | |||
| 1525 | Ga0265332_10009151 | |||
| 1526 | Ga0265328_10038901 | |||
| 1527 | Ga0265331_10001142 | |||
| 1528 | Ga0265331_10018516 | |||
| 1529 | Ga0265327_10000028 | |||
| 1530 | Ga0265327_10000320 | |||
| 1531 | Ga0265316_10000129 | |||
| 1532 | Ga0265316_10246408 | |||
| 1533 | Ga0307513_10017844 | |||
| 1534 | Ga0307513_10047058 | |||
| 1535 | Ga0307513_10094334 | |||
| 1536 | Ga0307513_10161720 | |||
| 1537 | Ga0307513_10226430 | |||
| 1538 | Ga0307509_10003013 | |||
| 1539 | Ga0307509_10037746 | |||
| 1540 | Ga0307509_10060799 | |||
| 1541 | Ga0307509_10102672 | |||
| 1542 | Ga0307509_10130164 | |||
| 1543 | Ga0307408_100000160 | |||
| 1544 | Ga0307408_100091181 | |||
| 1545 | Ga0307408_100189788 | |||
| 1546 | Ga0307408_100512133 | |||
| 1547 | Ga0307508_10001328 | |||
| 1548 | Ga0307508_10002994 | |||
| 1549 | Ga0307508_10027467 | |||
| 1550 | Ga0307508_10287745 | |||
| 1551 | Ga0307514_10004809 | |||
| 1552 | Ga0307514_10008878 | |||
| 1553 | Ga0307514_10015639 | |||
| 1554 | Ga0307514_10149698 | |||
| 1555 | Ga0307514_10162233 | |||
| 1556 | Ga0265314_10005103 | |||
| 1557 | Ga0265314_10056149 | |||
| 1558 | Ga0265342_10014208 | |||
| 1559 | Ga0307516_10000595 | |||
| 1560 | Ga0307516_10002134 | |||
| 1561 | Ga0307516_10002726 | |||
| 1562 | Ga0307516_10009114 | |||
| 1563 | Ga0307516_10027292 | |||
| 1564 | Ga0307516_10131016 | |||
| 1565 | Ga0307516_10132085 | |||
| 1566 | Ga0307516_10134630 | |||
| 1567 | Ga0307516_10178034 | |||
| 1568 | Ga0307516_10205607 | |||
| 1569 | Ga0307516_10222853 | |||
| 1570 | Ga0307516_10473855 | |||
| 1571 | Ga0307405_10094402 | |||
| 1572 | Ga0307405_10358469 | |||
| 1573 | Ga0307405_10506154 | |||
| 1574 | Ga0307413_10087139 | |||
| 1575 | Ga0307413_10382522 | |||
| 1576 | Ga0307410_10223506 | |||
| 1577 | Ga0307410_10379960 | |||
| 1578 | Ga0307406_10032124 | |||
| 1579 | Ga0307406_10320605 | |||
| 1580 | Ga0307407_10379756 | |||
| 1581 | Ga0307407_10447327 | |||
| 1582 | Ga0307412_10125124 | |||
| 1583 | Ga0307412_10253185 | |||
| 1584 | Ga0307412_10533047 | |||
| 1585 | Ga0307409_100042552 | |||
| 1586 | Ga0307409_100768097 | |||
| 1587 | Ga0307416_100110201 | |||
| 1588 | Ga0307416_100115953 | |||
| 1589 | Ga0307416_100728004 | |||
| 1590 | Ga0307414_10008432 | |||
| 1591 | Ga0307414_10355119 | |||
| 1592 | Ga0307411_10001451 | |||
| 1593 | Ga0307411_10082030 | |||
| 1594 | Ga0307415_100063783 | |||
| 1595 | Ga0307507_10098286 | |||
| 1596 | Ga0307510_10047623 | |||
| 1597 | Ga0307510_10142350 | |||
| 1598 | Ga0307510_10159811 | |||
| 1599 | Ga0373944_0033579 | |||
| 1600 | Ga0373944_0049567 | |||
| 1601 | Ga0373949_0097553 | |||
| 1602 | Ga0373923_0051893 | |||
| 1603 | Ga0373923_0253089 | |||
| 1604 | Ga0373939_0000180 | |||
| 1605 | Ga0373954_0120803 | |||
| 1606 | Ga0373960_0009161 | |||
| 1607 | Ga0373943_0151449 | |||
| 1608 | Ga0373946_0227991 | |||
| 1609 | Ga0373955_0205403 | |||
| 1610 | Ga0373924_0017561 | |||
| 1611 | Ga0373924_0023164 | |||
| 1612 | Ga0373931_0000454 | |||
| 1613 | Ga0373931_0001260 | |||
| 1614 | Ga0373931_0006658 | |||
| 1615 | Ga0373931_0071250 | |||
| 1616 | Ga0373933_0066134 | |||
| 1617 | Ga0373947_0258046 | |||
| 1618 | Ga0373937_0036873 | |||
| 1619 | Ga0373937_0092056 | |||
| 1620 | Ga0373937_0470802 | |||
| 1621 | Ga0373925_0003189 | |||
| 1622 | Ga0373925_0017322 | |||
| 1623 | Ga0373925_0413510 | |||
| 1624 | Ga0395900_0000025 | |||
| 1625 | Ga0395900_0267865 | |||
| 1626 | Ga0395898_0007948 | |||
| 1627 | Ga0395898_0040143 | |||
| 1628 | Ga0395905_0000071 | |||
| 1629 | Ga0395905_0002690 | |||
| 1630 | Ga0395905_0013413 | |||
| 1631 | Ga0395905_0013482 | |||
| 1632 | Ga0395905_0043043 | |||
| 1633 | Ga0395905_0140233 | |||
| 1634 | Ga0395905_0240803 | |||
| 1635 | Ga0395905_0351375 | |||
| 1636 | Ga0395901_0006003 | |||
| 1637 | Ga0395901_0745176 | |||
| 1638 | Ga0436365_1542390 | |||
| 1639 | Ga0436361_0054890 | |||
| 1640 | Ga0436361_0104381 | |||
| 1641 | Ga0436361_0175665 | |||
| 1642 | Ga0436361_0459306 | |||
| 1643 | Ga0436361_0592172 | |||
| 1644 | Ga0436361_0677882 | |||
| 1645 | Ga0436361_0716769 | |||
| 1646 | Ga0436361_0804529 | |||
| 1647 | Ga0436361_0812713 | |||
| 1648 | Ga0436361_1197672 | |||
| 1649 | Ga0436363_1550768 | |||
| 1650 | Ga0451789_0480314 | |||
| 1651 | Ga0451798_0529553 | |||
| 1652 | Ga0451802_1671124 | |||
| 1653 | Ga0451802_1748927 | |||
| 1654 | Ga0451802_1879611 | |||
| 1655 | Ga0451802_1995623 | |||
| 1656 | Ga0451839_0036937 | |||
| 1657 | Ga0451855_1603730 | |||
| 1658 | Ga0439433_0017719 | |||
| 1659 | Ga0439437_001281 | |||
| 1660 | Ga0439454_019896 | |||
| 1661 | Ga0450911_019502 | |||
| 1662 | Ga0450919_002454 | |||
| 1663 | Ga0450890_000381 | |||
| 1664 | Ga0450891_000049 | |||
| 1665 | Ga0450892_001246 | |||
| 1666 | Ga0450889_000650 | |||
| 1667 | Ga0439446_0062097 | |||
| 1668 | Ga0439434_0097932 | |||
| 1669 | Ga0439459_0001561 | |||
| 1670 | Ga0439464_0072190 | |||
| 1671 | Ga0450918_000091 | |||
| 1672 | Ga0451577_0000747 | |||
| 1673 | Ga0451577_0000906 | |||
| 1674 | Ga0451577_0001077 | |||
| 1675 | Ga0451577_0001271 | |||
| 1676 | Ga0451577_0001943 | |||
| 1677 | Ga0451577_0015312 | |||
| 1678 | Ga0451577_0191389 | |||
| 1679 | Ga0451577_0265292 | |||
| 1680 | Ga0466969_0000097 | |||
| 1681 | Ga0466969_0003731 | |||
| 1682 | Ga0466969_0134256 | |||
| 1683 | Ga0466972_0000265 | |||
| 1684 | Ga0466972_0015715 | |||
| 1685 | Ga0466972_0071030 | |||
| 1686 | Ga0453683_0071466 | |||
| 1687 | Ga0466965_0004580 | |||
| 1688 | Ga0466965_0030122 | |||
| 1689 | Ga0466966_0080445 | |||
| 1690 | Ga0466966_0110839 | |||
| 1691 | Ga0466961_0008576 | |||
| 1692 | Ga0466961_0012564 | |||
| 1693 | Ga0466961_0031151 | |||
| 1694 | Ga0466961_0146097 | |||
| 1695 | Ga0466963_0040444 | |||
| 1696 | Ga0466963_0054563 | |||
| 1697 | Ga0466963_0080763 | |||
| 1698 | Ga0466964_0002497 | |||
| 1699 | Ga0466964_0039714 | |||
| 1700 | Ga0453684_0002172 | |||
| 1701 | Ga0453684_0031038 | |||
| 1702 | Ga0453684_0054230 | |||
| 1703 | Ga0453684_0073965 | |||
| 1704 | Ga0453684_0077328 | |||
| 1705 | Ga0453684_0087988 | |||
| 1706 | Ga0453684_0168215 | |||
| 1707 | Ga0453684_0210084 | |||
| 1708 | Ga0453684_0470208 | |||
| 1709 | Ga0453684_0482478 | |||
| 1710 | Ga0466971_0004543 | |||
| 1711 | Ga0466971_0058783 | |||
| 1712 | Ga0466971_0075933 | |||
| 1713 | Ga0466970_0105462 | |||
| 1714 | Ga0466970_0138742 | |||
| 1715 | Ga0466970_0145428 | |||
| 1716 | Ga0466957_0009965 | |||
| 1717 | Ga0466957_0016788 | |||
| 1718 | Ga0466959_0001171 | |||
| 1719 | Ga0466959_0032335 | |||
| 1720 | Ga0466959_0065097 | |||
| 1721 | Ga0466959_0086899 | |||
| 1722 | Ga0451576_0001319 | |||
| 1723 | Ga0451576_0003466 | |||
| 1724 | Ga0451576_0005936 | |||
| 1725 | Ga0451576_0006498 | |||
| 1726 | Ga0451576_0046370 | |||
| 1727 | Ga0451576_0072274 | |||
| 1728 | Ga0451576_0368678 | |||
| 1729 | Ga0451576_0465292 | |||
| 1730 | Ga0466958_0011815 | |||
| 1731 | Ga0466958_0083862 | |||
| 1732 | Ga0466967_0009150 | |||
| 1733 | Ga0466967_0041054 | |||
| 1734 | Ga0466967_0267142 | |||
| 1735 | Ga0466967_0712959 | |||
| 1736 | Ga0495592_0000120 | |||
| 1737 | Ga0495592_0063647 | |||
| 1738 | Ga0495590_0019151 | |||
| 1739 | Ga0495638_0041159 | |||
| 1740 | Ga0495641_0069240 | |||
| 1741 | Ga0495651_0241985 | |||
| 1742 | Ga0495653_0225610 | |||
| 1743 | Ga0495650_0008953 | |||
| 1744 | Ga0495650_0029923 | |||
| 1745 | Ga0495580_0076761 | |||
| 1746 | Ga0495580_0175610 | |||
| 1747 | Ga0495639_0021209 | |||
| 1748 | Ga0495664_0184113 | |||
| 1749 | Ga0495583_0000164 | |||
| 1750 | Ga0495606_0304516 | |||
| 1751 | Ga0495610_0067613 | |||
| 1752 | Ga0495616_0105697 | |||
| 1753 | Ga0495620_0055412 | |||
| 1754 | Ga0495630_0259002 | |||
| 1755 | Ga0495630_0376441 | |||
| 1756 | Ga0495632_0009067 | |||
| 1757 | Ga0495632_0030437 | |||
| 1758 | Ga0495632_0031606 | |||
| 1759 | Ga0495632_0066875 | |||
| 1760 | Ga0495643_0004877 | |||
| 1761 | Ga0495648_0066748 | |||
| 1762 | Ga0495648_0168531 | |||
| 1763 | Ga0495642_0039291 | |||
| 1764 | Ga0495642_0178532 | |||
| 1765 | Ga0495652_0113259 | |||
| 1766 | Ga0495654_0000516 | |||
| 1767 | Ga0495665_0169263 | |||
| 1768 | Ga0495640_0112594 | |||
| 1769 | Ga0495586_0023994 | |||
| 1770 | Ga0495598_0048374 | |||
| 1771 | Ga0495621_0054808 | |||
| 1772 | Ga0495597_0000077 | |||
| 1773 | Ga0495597_0004233 | |||
| 1774 | Ga0495645_0059650 | |||
| 1775 | Ga0495645_0213292 | |||
| 1776 | Ga0495668_0133472 | |||
| 1777 | Ga0495668_0205660 | |||
| 1778 | Ga0495611_0068732 | |||
| 1779 | Ga0495625_0010774 | |||
| 1780 | Ga0495625_0046871 | |||
| 1781 | Ga0495625_0111812 | |||
| 1782 | Ga0495625_0152879 | |||
| 1783 | Ga0495635_0171131 | |||
| 1784 | Ga0495635_0226379 | |||
| 1785 | Ga0495588_0309928 | |||
| 1786 | Ga0495658_0008480 | |||
| 1787 | Ga0495658_0009047 | |||
| 1788 | Ga0495658_0028198 | |||
| 1789 | Ga0495613_0350179 | |||
| 1790 | Ga0495613_0459160 | |||
| 1791 | Ga0495671_0182488 | |||
| 1792 | Ga0495649_0005279 | |||
| 1793 | Ga0495649_0010343 | |||
| 1794 | Ga0495589_0027305 | |||
| 1795 | Ga0495676_0080963 | |||
| 1796 | Ga0495683_0175335 | |||
| 1797 | Ga0495687_004388 | |||
| 1798 | Ga0495687_016971 | |||
| 1799 | Ga0495684_0063581 | |||
| 1800 | Ga0495684_0105145 | |||
| 1801 | Ga0495686_0000404 | |||
| 1802 | Ga0495686_0052132 | |||
| 1803 | Ga0495686_0060008 | |||
| 1804 | Ga0495686_0363153 | |||
| 1805 | Ga0495602_0196764 | |||
| 1806 | Ga0496102_0009017 | |||
| 1807 | Ga0496102_0024974 | |||
| 1808 | Ga0496102_0034587 | |||
| 1809 | Ga0496103_0154589 | |||
| 1810 | Ga0496104_0010216 | |||
| 1811 | Ga0496104_0318816 | |||
| 1812 | Ga0496105_0005943 | |||
| 1813 | Ga0496106_0093220 | |||
| 1814 | Ga0496106_0118111 | |||
| 1815 | Ga0496106_0334145 | |||
| 1816 | Ga0496107_0013802 | |||
| 1817 | Ga0496108_0058880 | |||
| 1818 | Ga0496109_0017559 | |||
| 1819 | Ga0496109_0119690 | |||
| 1820 | Ga0496109_0597807 | |||
| 1821 | Ga0496109_0723367 | |||
| 1822 | Ga0496110_0020719 | |||
| 1823 | Ga0496110_0108177 | |||
| 1824 | Ga0496111_0391069 | |||
| 1825 | Ga0496112_0472217 | |||
| 1826 | Ga0496113_0446944 | |||
| 1827 | Ga0496114_0013196 | |||
| 1828 | Ga0496114_0019310 | |||
| 1829 | Ga0496121_0004723 | |||
| 1830 | Ga0496121_0102757 | |||
| 1831 | Ga0496124_0000786 | |||
| 1832 | Ga0496124_0014829 | |||
| 1833 | Ga0496124_0075562 | |||
| 1834 | Ga0496124_0079351 | |||
| 1835 | Ga0496125_0145406 | |||
| 1836 | Ga0501306_007246 | |||
| 1837 | Ga0501309_000025 | |||
| 1838 | Ga0501309_008388 | |||
| 1839 | Ga0501310_000148 | |||
| 1840 | Ga0501310_003053 | |||
| 1841 | Ga0501310_010949 | |||
| 1842 | Ga0501305_000406 | |||
| 1843 | Ga0495678_052980 | |||
| 1844 | Ga0501292_004010 | |||
| 1845 | Ga0501312_000202 | |||
| 1846 | Ga0501312_016510 | |||
| 1847 | Ga0501312_037487 | |||
| 1848 | Ga0501031_0012469 | |||
| 1849 | Ga0501034_0214881 | |||
| 1850 | Ga0501039_0263426 | |||
| 1851 | Ga0501041_0045728 | |||
| 1852 | Ga0501042_0208528 | |||
| 1853 | Ga0501043_0000439 | |||
| 1854 | Ga0501046_0001371 | |||
| 1855 | Ga0501047_0000069 | |||
| 1856 | Ga0501048_0001073 | |||
| 1857 | Ga0501071_0132017 | |||
| 1858 | Ga0501072_0089355 | |||
| 1859 | Ga0501075_0102944 | |||
| 1860 | Ga0501075_0326332 | |||
| 1861 | Ga0501076_0356136 | |||
| 1862 | Ga0501198_000025 | |||
| 1863 | Ga0501206_023797 | |||
| 1864 | Ga0501217_023230 | |||
| 1865 | Ga0501222_000033 | |||
| 1866 | Ga0501236_004440 | |||
| 1867 | Ga0501249_018171 | |||
| 1868 | Ga0501255_001587 | |||
| 1869 | Ga0501257_020132 | |||
| 1870 | Ga0501258_005799 | |||
| 1871 | Ga0501221_001733 | |||
| 1872 | Ga0501225_0045324 | |||
| 1873 | Ga0501229_000244 | |||
| 1874 | Ga0501262_001485 | |||
| 1875 | Ga0501265_000973 | |||
| 1876 | Ga0501266_000336 | |||
| 1877 | Ga0501267_000971 | |||
| 1878 | Ga0501268_013544 | |||
| 1879 | Ga0501269_007210 | |||
| 1880 | Ga0501270_014238 | |||
| 1881 | Ga0501282_000064 | |||
| 1882 | Ga0501045_0005472 | |||
| 1883 | Ga0501226_003873 | |||
| 1884 | nmdc:mga03683_10004_c1 | |||
| 1885 | nmdc:mga03683_155164_c1 | |||
| 1886 | nmdc:mga03n38_4511_c1 | |||
| 1887 | nmdc:mga00v17_228725_c1 | |||
| 1888 | nmdc:mga00v17_305870_c1 | |||
| 1889 | nmdc:mga0yw44_33899_c1 | |||
| 1890 | nmdc:mga0k408_106671_c1 | |||
| 1891 | nmdc:mga0k408_12634_c1 | |||
| 1892 | nmdc:mga0k408_1934_c1 | |||
| 1893 | nmdc:mga0k408_204130_c1 | |||
| 1894 | nmdc:mga0k408_215236_c1 | |||
| 1895 | nmdc:mga0k408_21725_c1 | |||
| 1896 | nmdc:mga0k408_27545_c1 | |||
| 1897 | nmdc:mga0k408_27789_c1 | |||
| 1898 | nmdc:mga0k408_3284_c1 | |||
| 1899 | nmdc:mga0k408_47090_c1 | |||
| 1900 | nmdc:mga0k408_62543_c1 | |||
| 1901 | nmdc:mga0k408_67217_c1 | |||
| 1902 | nmdc:mga0k408_8880_c1 | |||
| 1903 | nmdc:mga06z11_14982_c1 | |||
| 1904 | nmdc:mga06z11_15471_c1 | |||
| 1905 | nmdc:mga06z11_22757_c1 | |||
| 1906 | nmdc:mga04h51_189000_c1 | |||
| 1907 | nmdc:mga07m45_1266_c1 | |||
| 1908 | nmdc:mga07m45_13746_c1 | |||
| 1909 | nmdc:mga07m45_34480_c1 | |||
| 1910 | nmdc:mga07m45_7481_c1 | |||
| 1911 | nmdc:mga07m45_85675_c1 | |||
| 1912 | nmdc:mga05p37_110216_c1 | |||
| 1913 | nmdc:mga09592_1763_c1 | |||
| 1914 | nmdc:mga0qj67_270383_c1 | |||
| 1915 | nmdc:mga08y16_152329_c1 | |||
| 1916 | nmdc:mga08y16_782340_c1 | |||
| 1917 | nmdc:mga0sz30_56800_c1 | |||
| 1918 | Ga0495601_0166020 | |||
| 1919 | Ga0500635_0000215 | |||
| 1920 | Ga0500635_0070413 | |||
| 1921 | Ga0495595_0018669 | |||
| 1922 | Ga0495619_0046643 | |||
| 1923 | Ga0500578_0000006 | |||
| 1924 | Ga0500578_0035695 | |||
| 1925 | Ga0500644_0003987 | |||
| 1926 | Ga0500651_0006999 | |||
| 1927 | Ga0500651_0215640 | |||
| 1928 | Ga0500650_0107296 | |||
| 1929 | Ga0500562_048068 | |||
| 1930 | Ga0500593_001218 | |||
| 1931 | Ga0500594_0033972 | |||
| 1932 | Ga0500607_032062 | |||
| 1933 | Ga0500623_045564 | |||
| 1934 | Ga0500628_001683 | |||
| 1935 | Ga0500642_0005701 | |||
| 1936 | Ga0500652_000158 | |||
| 1937 | Ga0500652_027113 | |||
| 1938 | Ga0500655_002668 | |||
| 1939 | Ga0500559_0000138 | |||
| 1940 | Ga0500590_126164 | |||
| 1941 | Ga0500619_000010 | |||
| 1942 | Ga0500622_0001738 | |||
| 1943 | Ga0500622_0015365 | |||
| 1944 | Ga0500634_0070370 | |||
| 1945 | Ga0500636_0059931 | |||
| 1946 | Ga0500645_006609 | |||
| 1947 | Ga0500587_018500 | |||
| 1948 | Ga0501084_0308281 | |||
| 1949 | Ga0590075_039815 | |||
| 1950 | Ga0501082_0209540 | |||
| 1951 | Ga0466962_0004427 | |||
| 1952 | Ga0466962_0099306 | |||
| 1953 | Ga0466962_0177697 | |||
| 1954 | 2587725119 | |||
| 1955 | 2587731521 | |||
| 1956 | 2587756202 | |||
| 1957 | 2588295167 | |||
| 1958 | 2643746421 | |||
| 1959 | 2643966990 | |||
| 1960 | 2644142641 | |||
| 1961 | 2644217245 | |||
| 1962 | 2644248406 | |||
| 1963 | 2644258987 | |||
| 1964 | 2644273684 | |||
| 1965 | 2644301630 | |||
| 1966 | 2644314350 | |||
| 1967 | 2644338717 | |||
| 1968 | 2722881364 | |||
| 1969 | 2739055723 | |||
| 1970 | 2831866137 | |||
| 1971 | 2839140615 | |||
| 1972 | 2886850731 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy