F487536

General Info

Members Datasets Scaffolds Average Seq Length
986 464 1972 238

Family's Representative Sequence

Representative Sequence 3300050496|nmdc:mga07m45_960_c1|nmdc:mga07m45_960_c1_8142_8942
Length 266
Sequence LRRAVDDTAFDRPPRDGRGAPLNLSPGATMYTAKGRLDLDSQLKQHSTLVRRLAHQMIAKLPANVEIDDLIQVGMIGLADALSRFDASQGVQFETFATQRIRGAMLDELRGNDYLSRGTRKQQRSIESAVHKLEQKLGRAPVESEIAKEMGVTLIEYQELLGKVRGTQLVYLEDMSGDEGDNDFLDRHVADEDSNPLAQLQDQRMREALIEAIKVLPEREQYVMSMYYEHDMNLKEIAAVLKVTESRVCQLHSQSIARLRVKLRAY

Samples

Sample ID Description Type Environment
1 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
94 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
95 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
108 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
126 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
131 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
132 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
133 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
135 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
136 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
141 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
202 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
212 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
213 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
214 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
215 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
216 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
217 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
218 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
219 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
220 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
221 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
222 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
223 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
224 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
225 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
226 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
227 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
228 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
229 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
230 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
231 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
232 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
233 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
234 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
235 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
236 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
237 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
238 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
239 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
240 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
241 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
242 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
243 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
244 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
245 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
246 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
247 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
248 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
249 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
250 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
251 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
252 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
253 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
254 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
255 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
256 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
257 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
258 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
259 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
260 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
261 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
262 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
263 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
264 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
265 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
266 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
267 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
268 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
269 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
270 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
271 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
272 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
273 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
274 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
275 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
276 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
277 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
278 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
279 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
280 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
281 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
282 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
283 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
284 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
285 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
286 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
287 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
288 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
289 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
290 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
291 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
292 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
293 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
294 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
295 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
296 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
297 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
298 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
299 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
300 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
301 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
302 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
303 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
304 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
305 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
306 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
307 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
308 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
309 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
310 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
311 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
312 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
313 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
314 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
315 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
316 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
317 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
318 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
319 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
320 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
321 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
322 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
323 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
324 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
325 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
326 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
327 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
328 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
329 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
330 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
331 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
332 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
333 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
334 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
335 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
336 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
337 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
338 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
339 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
340 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
341 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
342 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
343 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
344 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
345 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
346 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
347 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
348 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
349 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
350 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
351 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
352 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
353 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
354 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
355 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
356 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
357 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
358 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
359 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
360 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
361 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
362 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
363 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
368 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
369 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
380 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
381 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
382 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
383 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
384 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
385 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
386 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
387 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
388 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
389 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
390 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
391 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
392 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
393 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
394 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
395 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
396 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
397 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
398 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
399 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
400 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
401 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
402 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
403 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
404 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
405 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
406 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
407 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
408 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
409 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
410 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
411 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
412 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
413 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
414 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
415 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
416 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
417 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
418 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
419 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
420 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
421 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
422 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
423 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
424 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
425 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
426 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
427 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
428 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
429 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
430 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
431 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
432 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
433 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
434 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
435 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
436 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
437 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
438 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
439 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
440 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
441 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
442 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
443 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
444 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
445 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
446 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
447 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
448 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
449 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
450 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
451 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
452 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
453 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
454 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
455 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
456 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
457 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
458 2643221656 Pelomonas sp. Root405 Isolate Unclassified
459 2643221660 Methylibium sp. Root1272 Isolate Unclassified
460 2721755523 Delftia sp. HK171 Isolate Unclassified
461 2738541337 Pelomonas sp. BT06 Isolate Unclassified
462 2831864461 Roseateles noduli HZ7 Isolate Nodule
463 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
464 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.06
Metatranscriptomes 1.01
Isolates 1.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.52
Nodule 0.61
Rhizoplane 2.94
Rhizosphere 72.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga07m45_960_c1 3300050496 Bacteria 12674
2 SwRhRL2b_contig_1230578 2162886007 Bacteria 822
3 SwRhRL2b_contig_3945145 2162886007 Bacteria 822
4 JGI24740J21852_10052921 3300001979 Bacteria 1154
5 JGI24744J21845_10014524 3300002077 Bacteria 1580
6 JGI25154J39366_1001409 3300002738 Bacteria 8636
7 JGI25157J39369_1000027 3300002741 Bacteria 147448
8 JGI25164J39214_1005229 3300002772 Bacteria 1421
9 JGI25152J39213_1002504 3300002773 Bacteria 6949
10 JGI25153J46596_10004012 3300003215 Bacteria 8030
11 JGI25153J46596_10008556 3300003215 Bacteria 4876
12 rootH1_10001428 3300003316 Bacteria 5388
13 rootH2_10031478 3300003320 Bacteria 5629
14 rootL2_10003861 3300003322 Bacteria 52646
15 rootH1_10005727 3300003323 Bacteria 11133
16 rootH1_10065205 3300003323 Bacteria 2935
17 JGI26145J50221_1002941 3300003371 Bacteria 1347
18 Ga0055533_1000073 3300003756 Bacteria 142476
19 Ga0055525_1000038 3300003759 Bacteria 297540
20 Ga0055525_1001631 3300003759 Bacteria 3488
21 Ga0055535_1003758 3300003761 Bacteria 4068
22 Ga0055529_1000385 3300003763 Bacteria 47717
23 Ga0055526_1009433 3300003771 Bacteria 4690
24 Ga0055524_1000242 3300003775 Bacteria 57160
25 Ga0055524_1001332 3300003775 Bacteria 14393
26 Ga0055524_1007381 3300003775 Bacteria 4674
27 Ga0055530_10004226 3300003791 Bacteria 7540
28 Ga0055530_10005683 3300003791 Bacteria 5830
29 Ga0055530_10032056 3300003791 Bacteria 1371
30 Ga0055540_1000015 3300003792 Bacteria 232986
31 Ga0055531_10000043 3300003794 Bacteria 133906
32 Ga0055531_10008158 3300003794 Bacteria 5578
33 Ga0055531_10017077 3300003794 Bacteria 3086
34 Ga0055531_10019016 3300003794 Bacteria 2805
35 Ga0055543_1002176 3300004625 Bacteria 6739
36 Ga0055543_1007063 3300004625 Bacteria 2637
37 Ga0065165_1000283 3300005262 Bacteria 86141
38 Ga0065165_1000732 3300005262 Bacteria 45731
39 Ga0065165_1005192 3300005262 Bacteria 7508
40 Ga0065704_10325887 3300005289 Bacteria 845
41 Ga0065715_10336276 3300005293 Bacteria 962
42 Ga0065707_10237321 3300005295 Bacteria 1168
43 Ga0070676_10001230 3300005328 Bacteria 12876
44 Ga0070676_10274495 3300005328 Bacteria 1133
45 Ga0070690_100011544 3300005330 Bacteria 5169
46 Ga0070690_100012917 3300005330 Bacteria 4924
47 Ga0070670_100002549 3300005331 Bacteria 15038
48 Ga0070670_100021319 3300005331 Bacteria 5574
49 Ga0070670_100038937 3300005331 Bacteria 4088
50 Ga0070670_100154794 3300005331 Bacteria 1985
51 Ga0070677_10003169 3300005333 Bacteria 5292
52 Ga0070677_10004158 3300005333 Bacteria 4706
53 Ga0070677_10020378 3300005333 Bacteria 2415
54 Ga0068869_100035286 3300005334 Bacteria 3544
55 Ga0068869_100079511 3300005334 Bacteria 2444
56 Ga0070680_100009256 3300005336 Bacteria 7556
57 Ga0070682_100086284 3300005337 Bacteria 2044
58 Ga0068868_100007055 3300005338 Bacteria 7986
59 Ga0068868_100065272 3300005338 Bacteria 2891
60 Ga0070660_100086354 3300005339 Bacteria 2468
61 Ga0070660_100109700 3300005339 Bacteria 2194
62 Ga0070689_100050074 3300005340 Bacteria 3226
63 Ga0070661_100081275 3300005344 Bacteria 2392
64 Ga0070661_100131844 3300005344 Bacteria 1878
65 Ga0070668_100028598 3300005347 Bacteria 4231
66 Ga0070668_100120560 3300005347 Bacteria 2096
67 Ga0070669_100002315 3300005353 Bacteria 13787
68 Ga0070669_100062840 3300005353 Bacteria 2731
69 Ga0070669_100236590 3300005353 Bacteria 1449
70 Ga0070669_100238908 3300005353 Bacteria 1442
71 Ga0070675_100015429 3300005354 Bacteria 6039
72 Ga0070675_100051441 3300005354 Bacteria 3385
73 Ga0070675_100057267 3300005354 Bacteria 3212
74 Ga0070675_100147197 3300005354 Bacteria 2017
75 Ga0070675_100434515 3300005354 Bacteria 1175
76 Ga0070671_100018406 3300005355 Bacteria 5673
77 Ga0070671_100034187 3300005355 Bacteria 4208
78 Ga0070671_100057393 3300005355 Bacteria 3240
79 Ga0070671_100063761 3300005355 Bacteria 3069
80 Ga0070671_100080833 3300005355 Bacteria 2718
81 Ga0070671_100127555 3300005355 Bacteria 2142
82 Ga0070674_100088546 3300005356 Bacteria 2228
83 Ga0070673_100002831 3300005364 Bacteria 10677
84 Ga0070673_100143779 3300005364 Bacteria 2014
85 Ga0070673_100480446 3300005364 Bacteria 1121
86 Ga0070659_100002606 3300005366 Bacteria 12819
87 Ga0070659_100048346 3300005366 Bacteria 3341
88 Ga0070659_100102453 3300005366 Bacteria 2305
89 Ga0070667_100003888 3300005367 Bacteria 12682
90 Ga0070667_100013392 3300005367 Bacteria 6779
91 Ga0070667_100039447 3300005367 Bacteria 3958
92 Ga0070667_100146474 3300005367 Bacteria 2071
93 Ga0070667_100508456 3300005367 Bacteria 1105
94 Ga0070700_100057256 3300005441 Bacteria 2446
95 Ga0070700_100118124 3300005441 Bacteria 1773
96 Ga0070663_100001718 3300005455 Bacteria 12149
97 Ga0070663_100028656 3300005455 Bacteria 3794
98 Ga0070663_100256217 3300005455 Bacteria 1386
99 Ga0070678_100011117 3300005456 Bacteria 5538
100 Ga0070678_100032599 3300005456 Bacteria 3607
101 Ga0070678_100128550 3300005456 Bacteria 2009
102 Ga0070678_100604324 3300005456 Bacteria 979
103 Ga0070662_100001001 3300005457 Bacteria 17282
104 Ga0070662_100017955 3300005457 Bacteria 4777
105 Ga0070662_100020424 3300005457 Bacteria 4509
106 Ga0070681_10027720 3300005458 Bacteria 5695
107 Ga0068867_100000118 3300005459 Bacteria 50315
108 Ga0068867_100022580 3300005459 Bacteria 4498
109 Ga0068867_100093859 3300005459 Bacteria 2281
110 Ga0068867_100123370 3300005459 Bacteria 2004
111 Ga0068867_100197593 3300005459 Bacteria 1608
112 Ga0068867_100298773 3300005459 Bacteria 1327
113 Ga0070685_10031202 3300005466 Bacteria 2975
114 Ga0070706_100000965 3300005467 Bacteria 31374
115 Ga0070707_100028547 3300005468 Bacteria 5311
116 Ga0070698_100056763 3300005471 Bacteria 3965
117 Ga0070684_100158905 3300005535 Bacteria 2050
118 Ga0070684_100351681 3300005535 Bacteria 1355
119 Ga0070684_100691494 3300005535 Bacteria 951
120 Ga0068853_100000531 3300005539 Bacteria 25891
121 Ga0068853_100186423 3300005539 Bacteria 1883
122 Ga0070672_100006693 3300005543 Bacteria 7767
123 Ga0070672_100008379 3300005543 Bacteria 7067
124 Ga0070672_100046804 3300005543 Bacteria 3353
125 Ga0070672_100057494 3300005543 Bacteria 3053
126 Ga0070672_100078741 3300005543 Bacteria 2637
127 Ga0070672_100095161 3300005543 Bacteria 2408
128 Ga0070672_100121856 3300005543 Bacteria 2135
129 Ga0070672_100254614 3300005543 Bacteria 1479
130 Ga0070686_100065221 3300005544 Bacteria 2365
131 Ga0070665_100098483 3300005548 Bacteria 2928
132 Ga0070665_100154019 3300005548 Bacteria 2300
133 Ga0068855_100009023 3300005563 Bacteria 12049
134 Ga0068855_100084890 3300005563 Bacteria 3664
135 Ga0068855_100538168 3300005563 Bacteria 1266
136 Ga0070664_100028601 3300005564 Bacteria 4638
137 Ga0070664_100064225 3300005564 Bacteria 3131
138 Ga0068857_100086072 3300005577 Bacteria 2809
139 Ga0068854_100070338 3300005578 Bacteria 2558
140 Ga0068854_100152457 3300005578 Bacteria 1783
141 Ga0068854_100171067 3300005578 Bacteria 1690
142 Ga0068854_100188364 3300005578 Bacteria 1615
143 Ga0068856_100019359 3300005614 Bacteria 6608
144 Ga0068856_100025775 3300005614 Bacteria 5734
145 Ga0068852_100073693 3300005616 Bacteria 3004
146 Ga0068852_100077216 3300005616 Bacteria 2943
147 Ga0068852_100119604 3300005616 Bacteria 2408
148 Ga0068852_100619570 3300005616 Bacteria 1088
149 Ga0068852_100645561 3300005616 Bacteria 1065
150 Ga0068859_100012494 3300005617 Bacteria 8542
151 Ga0068859_100077548 3300005617 Bacteria 3363
152 Ga0068859_100086979 3300005617 Bacteria 3172
153 Ga0068859_101281275 3300005617 Bacteria 808
154 Ga0068864_100009897 3300005618 Bacteria 7863
155 Ga0068864_100011232 3300005618 Bacteria 7401
156 Ga0068864_100015484 3300005618 Bacteria 6340
157 Ga0068864_100042843 3300005618 Bacteria 3874
158 Ga0068864_100485456 3300005618 Bacteria 1186
159 Ga0068864_100722176 3300005618 Bacteria 975
160 Ga0068866_10008904 3300005718 Bacteria 4247
161 Ga0068866_10078971 3300005718 Bacteria 1762
162 Ga0068861_100002963 3300005719 Bacteria 11201
163 Ga0068861_100012125 3300005719 Bacteria 6007
164 Ga0068861_100016485 3300005719 Bacteria 5229
165 Ga0068861_100020535 3300005719 Bacteria 4734
166 Ga0068861_100073836 3300005719 Bacteria 2651
167 Ga0068861_100102900 3300005719 Bacteria 2275
168 Ga0068851_10031320 3300005834 Bacteria 2641
169 Ga0068851_10075496 3300005834 Bacteria 1752
170 Ga0068851_10097806 3300005834 Bacteria 1553
171 Ga0068870_10067885 3300005840 Bacteria 1936
172 Ga0068870_10168954 3300005840 Bacteria 1303
173 Ga0068863_100005044 3300005841 Bacteria 13017
174 Ga0068863_100016273 3300005841 Bacteria 7136
175 Ga0068863_100026617 3300005841 Bacteria 5516
176 Ga0068863_100081785 3300005841 Bacteria 3060
177 Ga0068863_100265043 3300005841 Bacteria 1662
178 Ga0068858_100003535 3300005842 Bacteria 15479
179 Ga0068858_100020363 3300005842 Bacteria 6204
180 Ga0068858_100031405 3300005842 Bacteria 4933
181 Ga0068860_100022185 3300005843 Bacteria 6146
182 Ga0068860_100037149 3300005843 Bacteria 4662
183 Ga0068860_100064591 3300005843 Bacteria 3476
184 Ga0068860_100124585 3300005843 Bacteria 2470
185 Ga0068860_100149613 3300005843 Bacteria 2248
186 Ga0068860_100184950 3300005843 Bacteria 2015
187 Ga0068860_100294881 3300005843 Bacteria 1587
188 Ga0068862_100005039 3300005844 Bacteria 11116
189 Ga0068862_100014167 3300005844 Bacteria 6610
190 Ga0068862_100186189 3300005844 Bacteria 1866
191 Ga0068862_100202946 3300005844 Bacteria 1788
192 Ga0081455_10127724 3300005937 Bacteria 1992
193 Ga0075365_10029275 3300006038 Bacteria 3518
194 Ga0075363_100020269 3300006048 Bacteria 3333
195 Ga0075363_100044822 3300006048 Bacteria 2344
196 Ga0075362_10005519 3300006177 Bacteria 4636
197 Ga0075362_10034342 3300006177 Bacteria 2210
198 Ga0075362_10124993 3300006177 Bacteria 1220
199 Ga0075367_10008638 3300006178 Bacteria 5285
200 Ga0075367_10011101 3300006178 Bacteria 4752
201 Ga0075367_10036535 3300006178 Bacteria 2850
202 Ga0075367_10066862 3300006178 Bacteria 2154
203 Ga0075369_10102269 3300006186 Bacteria 1286
204 Ga0075369_10239386 3300006186 Bacteria 842
205 Ga0075366_10005622 3300006195 Bacteria 6797
206 Ga0075366_10006143 3300006195 Bacteria 6551
207 Ga0075366_10007241 3300006195 Bacteria 6114
208 Ga0075366_10009655 3300006195 Bacteria 5394
209 Ga0075366_10013728 3300006195 Bacteria 4616
210 Ga0075366_10022545 3300006195 Bacteria 3664
211 Ga0075366_10027031 3300006195 Bacteria 3365
212 Ga0075366_10044385 3300006195 Bacteria 2634
213 Ga0075366_10086869 3300006195 Bacteria 1871
214 Ga0075366_10192772 3300006195 Bacteria 1239
215 Ga0097621_100030138 3300006237 Bacteria 4293
216 Ga0097621_100043267 3300006237 Bacteria 3630
217 Ga0097621_100104548 3300006237 Bacteria 2386
218 Ga0075370_10000130 3300006353 Bacteria 25186
219 Ga0075370_10001345 3300006353 Bacteria 10583
220 Ga0075370_10002588 3300006353 Bacteria 8433
221 Ga0075370_10003017 3300006353 Bacteria 7932
222 Ga0075370_10009309 3300006353 Bacteria 5096
223 Ga0075370_10012654 3300006353 Bacteria 4466
224 Ga0075370_10062644 3300006353 Bacteria 2119
225 Ga0075370_10064608 3300006353 Bacteria 2087
226 Ga0075370_10113352 3300006353 Bacteria 1575
227 Ga0068871_100109875 3300006358 Bacteria 2318
228 Ga0075434_100537458 3300006871 Bacteria 1189
229 Ga0075429_100001726 3300006880 Bacteria 18078
230 Ga0068865_100005096 3300006881 Bacteria 7955
231 Ga0097620_100012494 3300006931 Bacteria 8542
232 Ga0097620_100077545 3300006931 Bacteria 3363
233 Ga0097620_100086975 3300006931 Bacteria 3172
234 Ga0097620_101281293 3300006931 Bacteria 808
235 Ga0099823_1031990 3300006944 Bacteria 4307
236 Ga0079104_1000040 3300006946 Bacteria 187962
237 Ga0079104_1000427 3300006946 Bacteria 47886
238 Ga0105250_10000379 3300009092 Bacteria 33227
239 Ga0105240_10003000 3300009093 Bacteria 26554
240 Ga0105240_10054403 3300009093 Bacteria 5016
241 Ga0105240_10076067 3300009093 Bacteria 4140
242 Ga0105240_10149156 3300009093 Bacteria 2787
243 Ga0105245_10110625 3300009098 Bacteria 2554
244 Ga0105245_10168037 3300009098 Bacteria 2087
245 Ga0105245_10233345 3300009098 Bacteria 1780
246 Ga0105245_10520946 3300009098 Bacteria 1207
247 Ga0114129_10099876 3300009147 Bacteria 4016
248 Ga0114129_10327459 3300009147 Bacteria 2035
249 Ga0105243_10000516 3300009148 Bacteria 39400
250 Ga0105243_10002920 3300009148 Bacteria 14153
251 Ga0105243_10024728 3300009148 Bacteria 4583
252 Ga0105243_10047577 3300009148 Bacteria 3378
253 Ga0105243_10065560 3300009148 Bacteria 2918
254 Ga0105241_10046653 3300009174 Bacteria 3291
255 Ga0105241_10083114 3300009174 Bacteria 2512
256 Ga0105241_10449135 3300009174 Bacteria 1140
257 Ga0105248_10002030 3300009177 Bacteria 22461
258 Ga0105248_10016482 3300009177 Bacteria 8134
259 Ga0105248_10047705 3300009177 Bacteria 4803
260 Ga0105248_10106584 3300009177 Bacteria 3160
261 Ga0105248_10582908 3300009177 Bacteria 1262
262 Ga0105237_10000870 3300009545 Bacteria 41025
263 Ga0105237_10016422 3300009545 Bacteria 7691
264 Ga0105237_10062994 3300009545 Bacteria 3707
265 Ga0105238_10023445 3300009551 Bacteria 6291
266 Ga0105238_10030130 3300009551 Bacteria 5522
267 Ga0105249_10213889 3300009553 Bacteria 1893
268 Ga0105249_10246534 3300009553 Bacteria 1769
269 Ga0105239_10000417 3300010375 Bacteria 62040
270 Ga0105239_10067508 3300010375 Bacteria 3928
271 Ga0105239_10098468 3300010375 Bacteria 3232
272 Ga0105239_10738632 3300010375 Bacteria 1126
273 Ga0105246_10463218 3300011119 Bacteria 1068
274 Ga0157340_1003658 3300012473 Bacteria 854
275 Ga0157319_1000037 3300012497 Bacteria 39883
276 Ga0157373_10061037 3300013100 Bacteria 2670
277 Ga0157371_10023164 3300013102 Bacteria 4540
278 Ga0157371_10176371 3300013102 Bacteria 1528
279 Ga0157369_10028287 3300013105 Bacteria 6206
280 Ga0157369_10172625 3300013105 Bacteria 2277
281 Ga0157374_10060226 3300013296 Bacteria 3552
282 Ga0157374_10124123 3300013296 Bacteria 2494
283 Ga0157378_10009166 3300013297 Bacteria 8614
284 Ga0157378_10171671 3300013297 Bacteria 2034
285 Ga0163162_10018593 3300013306 Bacteria 6809
286 Ga0163162_10020440 3300013306 Bacteria 6507
287 Ga0163162_10161823 3300013306 Bacteria 2360
288 Ga0157372_10009475 3300013307 Bacteria 10356
289 Ga0157372_10179122 3300013307 Bacteria 2453
290 Ga0157375_10011743 3300013308 Bacteria 7744
291 Ga0157375_10027025 3300013308 Bacteria 5358
292 Ga0157375_10064221 3300013308 Bacteria 3654
293 Ga0157375_10079252 3300013308 Bacteria 3320
294 Ga0157375_10173076 3300013308 Bacteria 2307
295 Ga0157375_10418749 3300013308 Bacteria 1506
296 Ga0163163_10012204 3300014325 Bacteria 7820
297 Ga0163163_10038201 3300014325 Bacteria 4677
298 Ga0163163_10060230 3300014325 Bacteria 3758
299 Ga0157380_10015491 3300014326 Bacteria 5605
300 Ga0157380_10024058 3300014326 Bacteria 4604
301 Ga0157380_10031157 3300014326 Bacteria 4092
302 Ga0157380_10126284 3300014326 Bacteria 2175
303 Ga0157380_10223715 3300014326 Bacteria 1685
304 Ga0182008_10001330 3300014497 Bacteria 16858
305 Ga0157377_10000313 3300014745 Bacteria 22234
306 Ga0157377_10045731 3300014745 Bacteria 2446
307 Ga0157379_10003100 3300014968 Bacteria 14056
308 Ga0157379_10004439 3300014968 Bacteria 12028
309 Ga0157379_10069785 3300014968 Bacteria 3143
310 Ga0157376_10027225 3300014969 Bacteria 4529
311 Ga0157376_10200220 3300014969 Bacteria 1837
312 Ga0157376_10393116 3300014969 Bacteria 1339
313 Ga0182007_10045992 3300015262 Bacteria 1446
314 Ga0163161_10023832 3300017792 Bacteria 4319
315 Ga0163161_10288696 3300017792 Bacteria 1289
316 Ga0213872_10000018 3300021361 Bacteria 175951
317 Ga0213872_10000070 3300021361 Bacteria 91519
318 Ga0213872_10138690 3300021361 Bacteria 1068
319 Ga0209674_100039 3300025226 Bacteria 402292
320 Ga0209563_100005 3300025230 Bacteria 1774893
321 Ga0209563_100110 3300025230 Bacteria 142518
322 Ga0207427_104198 3300025231 Bacteria 2547
323 Ga0209258_100305 3300025242 Bacteria 78801
324 Ga0209258_100692 3300025242 Bacteria 23256
325 Ga0207425_1005493 3300025245 Bacteria 3604
326 Ga0209646_1000196 3300025246 Bacteria 72959
327 Ga0209026_1000011 3300025250 Bacteria 507291
328 Ga0209677_100151 3300025253 Bacteria 63642
329 Ga0209677_100621 3300025253 Bacteria 19036
330 Ga0209677_102310 3300025253 Bacteria 7333
331 Ga0209759_1000107 3300025256 Bacteria 147025
332 Ga0209759_1004962 3300025256 Bacteria 4809
333 Ga0209759_1008572 3300025256 Bacteria 3172
334 Ga0209129_1000027 3300025258 Bacteria 409587
335 Ga0209455_1000053 3300025272 Bacteria 365949
336 Ga0209673_1009495 3300025273 Bacteria 4202
337 Ga0209673_1016350 3300025273 Bacteria 2779
338 Ga0209673_1029509 3300025273 Bacteria 1745
339 Ga0209675_1009087 3300025291 Bacteria 3551
340 Ga0209564_1000014 3300025295 Bacteria 621501
341 Ga0209564_1000051 3300025295 Bacteria 357748
342 Ga0209758_1000193 3300025297 Bacteria 134744
343 Ga0209758_1000208 3300025297 Bacteria 128596
344 Ga0209050_1000416 3300025298 Bacteria 78976
345 Ga0209050_1001233 3300025298 Bacteria 29602
346 Ga0209050_1001932 3300025298 Bacteria 19736
347 Ga0209050_1015631 3300025298 Bacteria 3169
348 Ga0209050_1015668 3300025298 Bacteria 3162
349 Ga0209256_1000092 3300025299 Bacteria 210547
350 Ga0209256_1000471 3300025299 Bacteria 60530
351 Ga0209256_1000967 3300025299 Bacteria 34624
352 Ga0209051_1000020 3300025303 Bacteria 508628
353 Ga0209051_1003495 3300025303 Bacteria 10276
354 Ga0209051_1005666 3300025303 Bacteria 7224
355 Ga0209051_1007685 3300025303 Bacteria 5852
356 Ga0209051_1008472 3300025303 Bacteria 5436
357 Ga0209051_1040661 3300025303 Bacteria 1664
358 Ga0209257_1000182 3300025304 Bacteria 156672
359 Ga0209257_1000189 3300025304 Bacteria 153917
360 Ga0209257_1001013 3300025304 Bacteria 37837
361 Ga0209257_1009108 3300025304 Bacteria 5422
362 Ga0209257_1013728 3300025304 Bacteria 3561
363 Ga0207697_10139621 3300025315 Bacteria 1050
364 Ga0207656_10044902 3300025321 Bacteria 1889
365 Ga0207682_10014444 3300025893 Bacteria 3076
366 Ga0207682_10074528 3300025893 Bacteria 1443
367 Ga0207642_10012161 3300025899 Bacteria 3098
368 Ga0207688_10273792 3300025901 Bacteria 1027
369 Ga0207680_10082238 3300025903 Bacteria 2026
370 Ga0207647_10180009 3300025904 Bacteria 1228
371 Ga0207645_10083578 3300025907 Bacteria 2048
372 Ga0207643_10009117 3300025908 Bacteria 5330
373 Ga0207643_10240030 3300025908 Bacteria 1114
374 Ga0207705_10278848 3300025909 Bacteria 1279
375 Ga0207684_10004494 3300025910 Bacteria 13113
376 Ga0207695_10004036 3300025913 Bacteria 20195
377 Ga0207695_10005546 3300025913 Bacteria 16683
378 Ga0207695_10047193 3300025913 Bacteria 4560
379 Ga0207695_10194890 3300025913 Bacteria 1942
380 Ga0207695_10251548 3300025913 Bacteria 1666
381 Ga0207671_10005322 3300025914 Bacteria 11916
382 Ga0207671_10060127 3300025914 Bacteria 2819
383 Ga0207660_10113049 3300025917 Bacteria 2046
384 Ga0207662_10275784 3300025918 Bacteria 1111
385 Ga0207657_10046620 3300025919 Bacteria 3796
386 Ga0207649_10002166 3300025920 Bacteria 11109
387 Ga0207649_10051621 3300025920 Bacteria 2548
388 Ga0207652_10006446 3300025921 Bacteria 9466
389 Ga0207646_10030388 3300025922 Bacteria 4897
390 Ga0207681_10008786 3300025923 Bacteria 6172
391 Ga0207681_10040654 3300025923 Bacteria 3096
392 Ga0207694_10017172 3300025924 Bacteria 5468
393 Ga0207694_10051794 3300025924 Bacteria 3181
394 Ga0207694_10319491 3300025924 Bacteria 1281
395 Ga0207650_10000904 3300025925 Bacteria 22371
396 Ga0207650_10009335 3300025925 Bacteria 6705
397 Ga0207650_10010853 3300025925 Bacteria 6260
398 Ga0207650_10171363 3300025925 Bacteria 1725
399 Ga0207659_10004951 3300025926 Bacteria 8077
400 Ga0207659_10006933 3300025926 Bacteria 6962
401 Ga0207659_10148487 3300025926 Bacteria 1828
402 Ga0207659_10383426 3300025926 Bacteria 1172
403 Ga0207687_10013305 3300025927 Bacteria 5372
404 Ga0207687_10085684 3300025927 Bacteria 2286
405 Ga0207687_10727047 3300025927 Bacteria 844
406 Ga0207644_10001787 3300025931 Bacteria 13923
407 Ga0207644_10006315 3300025931 Bacteria 7715
408 Ga0207644_10037525 3300025931 Bacteria 3409
409 Ga0207644_10083387 3300025931 Bacteria 2367
410 Ga0207644_10179303 3300025931 Bacteria 1659
411 Ga0207644_10513448 3300025931 Bacteria 989
412 Ga0207690_10004334 3300025932 Bacteria 8380
413 Ga0207706_10001749 3300025933 Bacteria 21310
414 Ga0207706_10031078 3300025933 Bacteria 4759
415 Ga0207706_10303429 3300025933 Bacteria 1391
416 Ga0207686_10085030 3300025934 Bacteria 2074
417 Ga0207709_10000382 3300025935 Bacteria 44040
418 Ga0207709_10037497 3300025935 Bacteria 2881
419 Ga0207709_10048858 3300025935 Bacteria 2579
420 Ga0207709_10578059 3300025935 Bacteria 887
421 Ga0207670_10718974 3300025936 Bacteria 828
422 Ga0207669_10007483 3300025937 Bacteria 5055
423 Ga0207704_10009164 3300025938 Bacteria 4765
424 Ga0207704_10778040 3300025938 Bacteria 798
425 Ga0207691_10005307 3300025940 Bacteria 12438
426 Ga0207691_10011899 3300025940 Bacteria 8350
427 Ga0207691_10017763 3300025940 Bacteria 6743
428 Ga0207691_10030742 3300025940 Bacteria 5016
429 Ga0207691_10103674 3300025940 Bacteria 2536
430 Ga0207711_10009050 3300025941 Bacteria 8320
431 Ga0207711_10079588 3300025941 Bacteria 2861
432 Ga0207711_10127355 3300025941 Bacteria 2279
433 Ga0207711_10538336 3300025941 Bacteria 1089
434 Ga0207689_10043887 3300025942 Bacteria 3696
435 Ga0207689_10072292 3300025942 Bacteria 2834
436 Ga0207661_10152171 3300025944 Bacteria 2000
437 Ga0207661_10362973 3300025944 Bacteria 1308
438 Ga0207679_10000154 3300025945 Bacteria 56628
439 Ga0207679_10168056 3300025945 Bacteria 1803
440 Ga0207679_10175328 3300025945 Bacteria 1769
441 Ga0207667_10014452 3300025949 Bacteria 9000
442 Ga0207667_10070368 3300025949 Bacteria 3641
443 Ga0207667_10814856 3300025949 Bacteria 929
444 Ga0207651_10000726 3300025960 Bacteria 14099
445 Ga0207651_10023579 3300025960 Bacteria 3789
446 Ga0207651_10040992 3300025960 Bacteria 3069
447 Ga0207651_10407075 3300025960 Bacteria 1158
448 Ga0207712_10079843 3300025961 Bacteria 2378
449 Ga0207712_10159397 3300025961 Bacteria 1752
450 Ga0207712_10237152 3300025961 Bacteria 1467
451 Ga0207712_10239044 3300025961 Bacteria 1462
452 Ga0207712_10781651 3300025961 Bacteria 838
453 Ga0207668_10172325 3300025972 Bacteria 1698
454 Ga0207640_10006815 3300025981 Bacteria 6282
455 Ga0207640_10104626 3300025981 Bacteria 1993
456 Ga0207658_10006325 3300025986 Bacteria 8088
457 Ga0207658_10008867 3300025986 Bacteria 6826
458 Ga0207658_10022179 3300025986 Bacteria 4418
459 Ga0207677_10017241 3300026023 Bacteria 4299
460 Ga0207677_10096180 3300026023 Bacteria 2166
461 Ga0207703_10007292 3300026035 Bacteria 8790
462 Ga0207703_10019578 3300026035 Bacteria 5289
463 Ga0207703_10033069 3300026035 Bacteria 4097
464 Ga0207703_11048342 3300026035 Bacteria 783
465 Ga0207639_10003410 3300026041 Bacteria 10691
466 Ga0207639_10321337 3300026041 Bacteria 1374
467 Ga0207639_10741068 3300026041 Bacteria 913
468 Ga0207678_10001164 3300026067 Bacteria 24067
469 Ga0207678_10061645 3300026067 Bacteria 3226
470 Ga0207678_10165640 3300026067 Bacteria 1887
471 Ga0207708_10008693 3300026075 Bacteria 7518
472 Ga0207708_10035380 3300026075 Bacteria 3800
473 Ga0207708_10481162 3300026075 Bacteria 1038
474 Ga0207702_10000270 3300026078 Bacteria 59607
475 Ga0207702_10023323 3300026078 Bacteria 5131
476 Ga0207702_10685732 3300026078 Bacteria 1009
477 Ga0207641_10010569 3300026088 Bacteria 7573
478 Ga0207641_10016789 3300026088 Bacteria 5995
479 Ga0207648_10000264 3300026089 Bacteria 56766
480 Ga0207648_10002564 3300026089 Bacteria 19471
481 Ga0207648_10054352 3300026089 Bacteria 3498
482 Ga0207648_10119130 3300026089 Bacteria 2320
483 Ga0207648_10274947 3300026089 Bacteria 1505
484 Ga0207648_10600044 3300026089 Bacteria 1015
485 Ga0207648_10659617 3300026089 Bacteria 967
486 Ga0207676_10002431 3300026095 Bacteria 13264
487 Ga0207676_10003185 3300026095 Bacteria 11690
488 Ga0207676_10003375 3300026095 Bacteria 11290
489 Ga0207676_10065216 3300026095 Bacteria 2899
490 Ga0207674_10007035 3300026116 Bacteria 13155
491 Ga0207675_100004520 3300026118 Bacteria 13431
492 Ga0207675_100020594 3300026118 Bacteria 6147
493 Ga0207675_100045818 3300026118 Bacteria 4085
494 Ga0207675_100048921 3300026118 Bacteria 3947
495 Ga0207675_100236286 3300026118 Bacteria 1765
496 Ga0207675_100297352 3300026118 Bacteria 1572
497 Ga0207675_100956634 3300026118 Bacteria 874
498 Ga0207683_10004615 3300026121 Bacteria 11873
499 Ga0207683_10008759 3300026121 Bacteria 8638
500 Ga0207683_10111270 3300026121 Bacteria 2452
501 Ga0207683_10163755 3300026121 Bacteria 2012
502 Ga0207683_10896549 3300026121 Bacteria 823
503 Ga0207698_10067256 3300026142 Bacteria 2825
504 Ga0207698_10160315 3300026142 Bacteria 1966
505 Ga0209281_1000072 3300027111 Bacteria 273114
506 Ga0209281_1000074 3300027111 Bacteria 267848
507 Ga0209984_1015402 3300027424 Bacteria 1016
508 Ga0209995_1013728 3300027471 Bacteria 1328
509 Ga0209968_1000344 3300027526 Bacteria 7775
510 Ga0209970_1026864 3300027614 Bacteria 990
511 Ga0209983_1046768 3300027665 Bacteria 943
512 Ga0209966_1000136 3300027695 Bacteria 30875
513 Ga0268266_10577983 3300028379 Bacteria 1078
514 Ga0268265_10022062 3300028380 Bacteria 4469
515 Ga0268265_10034984 3300028380 Bacteria 3666
516 Ga0268265_10152302 3300028380 Bacteria 1952
517 Ga0268265_10276860 3300028380 Bacteria 1499
518 Ga0268264_10005811 3300028381 Bacteria 10457
519 Ga0268264_10062092 3300028381 Bacteria 3136
520 Ga0268264_10327008 3300028381 Bacteria 1452
521 Ga0265336_10000022 3300028666 Bacteria 192716
522 Ga0307517_10072121 3300028786 Bacteria 3083
523 Ga0307515_10000131 3300028794 Bacteria 178919
524 Ga0307515_10000165 3300028794 Bacteria 162589
525 Ga0307515_10000232 3300028794 Bacteria 137778
526 Ga0307515_10006463 3300028794 Bacteria 23455
527 Ga0307515_10015871 3300028794 Bacteria 13842
528 Ga0307515_10018948 3300028794 Bacteria 12421
529 Ga0307515_10022118 3300028794 Bacteria 11226
530 Ga0307515_10254187 3300028794 Bacteria 1504
531 Ga0307515_10298322 3300028794 Bacteria 1299
532 Ga0265324_10002429 3300029957 Bacteria 9560
533 Ga0265324_10006622 3300029957 Bacteria 4797
534 Ga0268256_1026772 3300030500 Bacteria 1445
535 Ga0307512_10056946 3300030522 Bacteria 3063
536 Ga0307512_10165008 3300030522 Bacteria 1286
537 Ga0265330_10014977 3300031235 Bacteria 3590
538 Ga0265332_10000220 3300031238 Bacteria 45756
539 Ga0265332_10009151 3300031238 Bacteria 4429
540 Ga0265328_10038901 3300031239 Bacteria 1755
541 Ga0265331_10001142 3300031250 Bacteria 20259
542 Ga0265331_10018516 3300031250 Bacteria 3609
543 Ga0265327_10000028 3300031251 Bacteria 361066
544 Ga0265327_10000320 3300031251 Bacteria 91776
545 Ga0265316_10000129 3300031344 Bacteria 82815
546 Ga0265316_10246408 3300031344 Bacteria 1313
547 Ga0307513_10017844 3300031456 Bacteria 8500
548 Ga0307513_10047058 3300031456 Bacteria 4695
549 Ga0307513_10094334 3300031456 Bacteria 3038
550 Ga0307513_10161720 3300031456 Bacteria 2131
551 Ga0307513_10226430 3300031456 Bacteria 1686
552 Ga0307509_10003013 3300031507 Bacteria 26337
553 Ga0307509_10037746 3300031507 Bacteria 5278
554 Ga0307509_10060799 3300031507 Bacteria 3991
555 Ga0307509_10102672 3300031507 Bacteria 2890
556 Ga0307509_10130164 3300031507 Bacteria 2474
557 Ga0307408_100000160 3300031548 Bacteria 74342
558 Ga0307408_100091181 3300031548 Bacteria 2301
559 Ga0307408_100189788 3300031548 Bacteria 1655
560 Ga0307408_100512133 3300031548 Bacteria 1052
561 Ga0307508_10001328 3300031616 Bacteria 27985
562 Ga0307508_10002994 3300031616 Bacteria 17413
563 Ga0307508_10027467 3300031616 Bacteria 5150
564 Ga0307508_10287745 3300031616 Bacteria 1237
565 Ga0307514_10004809 3300031649 Bacteria 12314
566 Ga0307514_10008878 3300031649 Bacteria 8498
567 Ga0307514_10015639 3300031649 Bacteria 6253
568 Ga0307514_10149698 3300031649 Bacteria 1569
569 Ga0307514_10162233 3300031649 Bacteria 1477
570 Ga0265314_10005103 3300031711 Bacteria 11953
571 Ga0265314_10056149 3300031711 Bacteria 2712
572 Ga0265342_10014208 3300031712 Bacteria 5295
573 Ga0307516_10000595 3300031730 Bacteria 49018
574 Ga0307516_10002134 3300031730 Bacteria 26788
575 Ga0307516_10002726 3300031730 Bacteria 23277
576 Ga0307516_10009114 3300031730 Bacteria 11114
577 Ga0307516_10027292 3300031730 Bacteria 5789
578 Ga0307516_10131016 3300031730 Bacteria 2287
579 Ga0307516_10132085 3300031730 Bacteria 2275
580 Ga0307516_10134630 3300031730 Bacteria 2247
581 Ga0307516_10178034 3300031730 Bacteria 1861
582 Ga0307516_10205607 3300031730 Bacteria 1686
583 Ga0307516_10222853 3300031730 Bacteria 1594
584 Ga0307516_10473855 3300031730 Bacteria 907
585 Ga0307405_10094402 3300031731 Bacteria 1989
586 Ga0307405_10358469 3300031731 Bacteria 1127
587 Ga0307405_10506154 3300031731 Bacteria 969
588 Ga0307413_10087139 3300031824 Bacteria 2021
589 Ga0307413_10382522 3300031824 Bacteria 1097
590 Ga0307410_10223506 3300031852 Bacteria 1450
591 Ga0307410_10379960 3300031852 Bacteria 1136
592 Ga0307406_10032124 3300031901 Bacteria 3202
593 Ga0307406_10320605 3300031901 Bacteria 1199
594 Ga0307407_10379756 3300031903 Bacteria 1008
595 Ga0307407_10447327 3300031903 Bacteria 937
596 Ga0307412_10125124 3300031911 Bacteria 1858
597 Ga0307412_10253185 3300031911 Bacteria 1368
598 Ga0307412_10533047 3300031911 Bacteria 983
599 Ga0307409_100042552 3300031995 Bacteria 3403
600 Ga0307409_100768097 3300031995 Bacteria 969
601 Ga0307416_100110201 3300032002 Bacteria 2423
602 Ga0307416_100115953 3300032002 Bacteria 2373
603 Ga0307416_100728004 3300032002 Bacteria 1083
604 Ga0307414_10008432 3300032004 Bacteria 5845
605 Ga0307414_10355119 3300032004 Bacteria 1259
606 Ga0307411_10001451 3300032005 Bacteria 9701
607 Ga0307411_10082030 3300032005 Bacteria 2222
608 Ga0307415_100063783 3300032126 Bacteria 2561
609 Ga0307507_10098286 3300033179 Bacteria 2465
610 Ga0307510_10047623 3300033180 Bacteria 4590
611 Ga0307510_10142350 3300033180 Bacteria 2038
612 Ga0307510_10159811 3300033180 Bacteria 1852
613 Ga0373944_0033579 3300035089 Bacteria 1555
614 Ga0373944_0049567 3300035089 Bacteria 1320
615 Ga0373949_0097553 3300035090 Bacteria 802
616 Ga0373923_0051893 3300035111 Bacteria 1722
617 Ga0373923_0253089 3300035111 Bacteria 825
618 Ga0373939_0000180 3300035114 Bacteria 17482
619 Ga0373954_0120803 3300035118 Bacteria 1272
620 Ga0373960_0009161 3300035121 Bacteria 2390
621 Ga0373943_0151449 3300035170 Bacteria 1257
622 Ga0373946_0227991 3300035171 Bacteria 902
623 Ga0373955_0205403 3300035172 Bacteria 1173
624 Ga0373924_0017561 3300035410 Bacteria 2747
625 Ga0373924_0023164 3300035410 Bacteria 2433
626 Ga0373931_0000454 3300035691 Bacteria 16732
627 Ga0373931_0001260 3300035691 Bacteria 10813
628 Ga0373931_0006658 3300035691 Bacteria 5412
629 Ga0373931_0071250 3300035691 Bacteria 1898
630 Ga0373933_0066134 3300035724 Bacteria 2190
631 Ga0373947_0258046 3300035725 Bacteria 1154
632 Ga0373937_0036873 3300036401 Bacteria 4455
633 Ga0373937_0092056 3300036401 Bacteria 2810
634 Ga0373937_0470802 3300036401 Bacteria 1193
635 Ga0373925_0003189 3300037068 Bacteria 12824
636 Ga0373925_0017322 3300037068 Bacteria 5221
637 Ga0373925_0413510 3300037068 Bacteria 1101
638 Ga0395900_0000025 3300037418 Bacteria 321217
639 Ga0395900_0267865 3300037418 Bacteria 1704
640 Ga0395898_0007948 3300037466 Bacteria 11251
641 Ga0395898_0040143 3300037466 Bacteria 4630
642 Ga0395905_0000071 3300037471 Bacteria 174580
643 Ga0395905_0002690 3300037471 Bacteria 19490
644 Ga0395905_0013413 3300037471 Bacteria 7852
645 Ga0395905_0013482 3300037471 Bacteria 7831
646 Ga0395905_0043043 3300037471 Bacteria 4236
647 Ga0395905_0140233 3300037471 Bacteria 2274
648 Ga0395905_0240803 3300037471 Bacteria 1690
649 Ga0395905_0351375 3300037471 Bacteria 1366
650 Ga0395901_0006003 3300038443 Bacteria 12303
651 Ga0395901_0745176 3300038443 Bacteria 973
652 Ga0436365_1542390 3300039437 Bacteria 1559
653 Ga0436361_0054890 3300039447 Bacteria 6582
654 Ga0436361_0104381 3300039447 Bacteria 43863
655 Ga0436361_0175665 3300039447 Bacteria 16430
656 Ga0436361_0459306 3300039447 Bacteria 1302
657 Ga0436361_0592172 3300039447 Bacteria 4121
658 Ga0436361_0677882 3300039447 Bacteria 228834
659 Ga0436361_0716769 3300039447 Bacteria 4009
660 Ga0436361_0804529 3300039447 Bacteria 2395
661 Ga0436361_0812713 3300039447 Bacteria 39089
662 Ga0436361_1197672 3300039447 Bacteria 1351
663 Ga0436363_1550768 3300039450 Bacteria 1515
664 Ga0451789_0480314 3300041443 Bacteria 3329
665 Ga0451798_0529553 3300041458 Bacteria 1052
666 Ga0451802_1671124 3300041460 Bacteria 1061
667 Ga0451802_1748927 3300041460 Bacteria 1656
668 Ga0451802_1879611 3300041460 Bacteria 2147
669 Ga0451802_1995623 3300041460 Bacteria 962
670 Ga0451839_0036937 3300041496 Bacteria 2018
671 Ga0451855_1603730 3300041511 Bacteria 872
672 Ga0439433_0017719 3300041999 Bacteria 1582
673 Ga0439437_001281 3300042000 Bacteria 2641
674 Ga0439454_019896 3300042011 Bacteria 980
675 Ga0450911_019502 3300042115 Bacteria 889
676 Ga0450919_002454 3300042121 Bacteria 2402
677 Ga0450890_000381 3300042127 Bacteria 6485
678 Ga0450891_000049 3300042129 Bacteria 9196
679 Ga0450892_001246 3300042130 Bacteria 2590
680 Ga0450889_000650 3300042144 Bacteria 3838
681 Ga0439446_0062097 3300042156 Bacteria 1131
682 Ga0439434_0097932 3300042435 Bacteria 943
683 Ga0439459_0001561 3300042438 Bacteria 3403
684 Ga0439464_0072190 3300042439 Bacteria 1022
685 Ga0450918_000091 3300042531 Bacteria 19069
686 Ga0451577_0000747 3300042876 Bacteria 49907
687 Ga0451577_0000906 3300042876 Bacteria 43738
688 Ga0451577_0001077 3300042876 Bacteria 39123
689 Ga0451577_0001271 3300042876 Bacteria 34780
690 Ga0451577_0001943 3300042876 Bacteria 26044
691 Ga0451577_0015312 3300042876 Bacteria 7136
692 Ga0451577_0191389 3300042876 Bacteria 1845
693 Ga0451577_0265292 3300042876 Bacteria 1555
694 Ga0466969_0000097 3300044656 Bacteria 45819
695 Ga0466969_0003731 3300044656 Bacteria 8095
696 Ga0466969_0134256 3300044656 Bacteria 1146
697 Ga0466972_0000265 3300044658 Bacteria 33659
698 Ga0466972_0015715 3300044658 Bacteria 3785
699 Ga0466972_0071030 3300044658 Bacteria 1661
700 Ga0453683_0071466 3300044673 Bacteria 2171
701 Ga0466965_0004580 3300044683 Bacteria 6157
702 Ga0466965_0030122 3300044683 Bacteria 2642
703 Ga0466966_0080445 3300044684 Bacteria 2029
704 Ga0466966_0110839 3300044684 Bacteria 1691
705 Ga0466961_0008576 3300044693 Bacteria 6513
706 Ga0466961_0012564 3300044693 Bacteria 5420
707 Ga0466961_0031151 3300044693 Bacteria 3428
708 Ga0466961_0146097 3300044693 Bacteria 1478
709 Ga0466963_0040444 3300044694 Bacteria 3056
710 Ga0466963_0054563 3300044694 Bacteria 2656
711 Ga0466963_0080763 3300044694 Bacteria 2202
712 Ga0466964_0002497 3300044706 Bacteria 6540
713 Ga0466964_0039714 3300044706 Bacteria 1897
714 Ga0453684_0002172 3300044712 Bacteria 49008
715 Ga0453684_0031038 3300044712 Bacteria 7525
716 Ga0453684_0054230 3300044712 Bacteria 5225
717 Ga0453684_0073965 3300044712 Bacteria 4293
718 Ga0453684_0077328 3300044712 Bacteria 4173
719 Ga0453684_0087988 3300044712 Bacteria 3847
720 Ga0453684_0168215 3300044712 Bacteria 2586
721 Ga0453684_0210084 3300044712 Bacteria 2263
722 Ga0453684_0470208 3300044712 Bacteria 1396
723 Ga0453684_0482478 3300044712 Bacteria 1375
724 Ga0466971_0004543 3300044719 Bacteria 6002
725 Ga0466971_0058783 3300044719 Bacteria 1735
726 Ga0466971_0075933 3300044719 Bacteria 1528
727 Ga0466970_0105462 3300044765 Bacteria 1537
728 Ga0466970_0138742 3300044765 Bacteria 1338
729 Ga0466970_0145428 3300044765 Bacteria 1307
730 Ga0466957_0009965 3300044842 Bacteria 5436
731 Ga0466957_0016788 3300044842 Bacteria 4282
732 Ga0466959_0001171 3300045049 Bacteria 15784
733 Ga0466959_0032335 3300045049 Bacteria 3872
734 Ga0466959_0065097 3300045049 Bacteria 2645
735 Ga0466959_0086899 3300045049 Bacteria 2249
736 Ga0451576_0001319 3300045051 Bacteria 42949
737 Ga0451576_0003466 3300045051 Bacteria 21625
738 Ga0451576_0005936 3300045051 Bacteria 15129
739 Ga0451576_0006498 3300045051 Bacteria 14312
740 Ga0451576_0046370 3300045051 Bacteria 4577
741 Ga0451576_0072274 3300045051 Bacteria 3590
742 Ga0451576_0368678 3300045051 Bacteria 1504
743 Ga0451576_0465292 3300045051 Bacteria 1328
744 Ga0466958_0011815 3300045836 Bacteria 4929
745 Ga0466958_0083862 3300045836 Bacteria 1964
746 Ga0466967_0009150 3300045976 Bacteria 7328
747 Ga0466967_0041054 3300045976 Bacteria 3986
748 Ga0466967_0267142 3300045976 Bacteria 1638
749 Ga0466967_0712959 3300045976 Bacteria 994
750 Ga0495592_0000120 3300046454 Bacteria 69531
751 Ga0495592_0063647 3300046454 Bacteria 2705
752 Ga0495590_0019151 3300046457 Bacteria 2442
753 Ga0495638_0041159 3300046460 Bacteria 2925
754 Ga0495641_0069240 3300046461 Bacteria 1586
755 Ga0495651_0241985 3300046462 Bacteria 1237
756 Ga0495653_0225610 3300046463 Bacteria 1257
757 Ga0495650_0008953 3300046471 Bacteria 5760
758 Ga0495650_0029923 3300046471 Bacteria 2474
759 Ga0495580_0076761 3300046472 Bacteria 2330
760 Ga0495580_0175610 3300046472 Bacteria 1480
761 Ga0495639_0021209 3300046475 Bacteria 2842
762 Ga0495664_0184113 3300046477 Bacteria 1266
763 Ga0495583_0000164 3300046506 Bacteria 112062
764 Ga0495606_0304516 3300046507 Bacteria 862
765 Ga0495610_0067613 3300046512 Bacteria 1678
766 Ga0495616_0105697 3300046513 Bacteria 1314
767 Ga0495620_0055412 3300046515 Bacteria 1671
768 Ga0495630_0259002 3300046517 Bacteria 1329
769 Ga0495630_0376441 3300046517 Bacteria 1087
770 Ga0495632_0009067 3300046519 Bacteria 6025
771 Ga0495632_0030437 3300046519 Bacteria 2801
772 Ga0495632_0031606 3300046519 Bacteria 2734
773 Ga0495632_0066875 3300046519 Bacteria 1733
774 Ga0495643_0004877 3300046522 Bacteria 9239
775 Ga0495648_0066748 3300046524 Bacteria 2108
776 Ga0495648_0168531 3300046524 Bacteria 1125
777 Ga0495642_0039291 3300046528 Bacteria 1920
778 Ga0495642_0178532 3300046528 Bacteria 924
779 Ga0495652_0113259 3300046529 Bacteria 2178
780 Ga0495654_0000516 3300046530 Bacteria 31438
781 Ga0495665_0169263 3300046531 Bacteria 1138
782 Ga0495640_0112594 3300046533 Bacteria 1777
783 Ga0495586_0023994 3300046535 Bacteria 3257
784 Ga0495598_0048374 3300046537 Bacteria 1271
785 Ga0495621_0054808 3300046539 Bacteria 1434
786 Ga0495597_0000077 3300046542 Bacteria 85280
787 Ga0495597_0004233 3300046542 Bacteria 7938
788 Ga0495645_0059650 3300046543 Bacteria 2766
789 Ga0495645_0213292 3300046543 Bacteria 1302
790 Ga0495668_0133472 3300046616 Bacteria 1359
791 Ga0495668_0205660 3300046616 Bacteria 1078
792 Ga0495611_0068732 3300046648 Bacteria 1617
793 Ga0495625_0010774 3300046660 Bacteria 7524
794 Ga0495625_0046871 3300046660 Bacteria 3117
795 Ga0495625_0111812 3300046660 Bacteria 1866
796 Ga0495625_0152879 3300046660 Bacteria 1550
797 Ga0495635_0171131 3300046663 Bacteria 1477
798 Ga0495635_0226379 3300046663 Bacteria 1264
799 Ga0495588_0309928 3300046674 Bacteria 831
800 Ga0495658_0008480 3300046683 Bacteria 5093
801 Ga0495658_0009047 3300046683 Bacteria 4952
802 Ga0495658_0028198 3300046683 Bacteria 3028
803 Ga0495613_0350179 3300046689 Bacteria 1014
804 Ga0495613_0459160 3300046689 Bacteria 862
805 Ga0495671_0182488 3300046692 Bacteria 1019
806 Ga0495649_0005279 3300046694 Bacteria 8254
807 Ga0495649_0010343 3300046694 Bacteria 5510
808 Ga0495589_0027305 3300046794 Bacteria 2886
809 Ga0495676_0080963 3300047321 Bacteria 2463
810 Ga0495683_0175335 3300047323 Bacteria 983
811 Ga0495687_004388 3300047443 Bacteria 9571
812 Ga0495687_016971 3300047443 Bacteria 3645
813 Ga0495684_0063581 3300047471 Bacteria 2805
814 Ga0495684_0105145 3300047471 Bacteria 2133
815 Ga0495686_0000404 3300047472 Bacteria 68315
816 Ga0495686_0052132 3300047472 Bacteria 2566
817 Ga0495686_0060008 3300047472 Bacteria 2365
818 Ga0495686_0363153 3300047472 Bacteria 784
819 Ga0495602_0196764 3300048088 Bacteria 1541
820 Ga0496102_0009017 3300048905 Bacteria 8562
821 Ga0496102_0024974 3300048905 Bacteria 5316
822 Ga0496102_0034587 3300048905 Bacteria 4545
823 Ga0496103_0154589 3300048906 Bacteria 1470
824 Ga0496104_0010216 3300048907 Bacteria 8381
825 Ga0496104_0318816 3300048907 Bacteria 1467
826 Ga0496105_0005943 3300048908 Bacteria 9313
827 Ga0496106_0093220 3300048909 Bacteria 2327
828 Ga0496106_0118111 3300048909 Bacteria 2070
829 Ga0496106_0334145 3300048909 Bacteria 1217
830 Ga0496107_0013802 3300048910 Bacteria 5648
831 Ga0496108_0058880 3300048911 Bacteria 3230
832 Ga0496109_0017559 3300048912 Bacteria 6274
833 Ga0496109_0119690 3300048912 Bacteria 2452
834 Ga0496109_0597807 3300048912 Bacteria 1039
835 Ga0496109_0723367 3300048912 Bacteria 933
836 Ga0496110_0020719 3300048913 Bacteria 5553
837 Ga0496110_0108177 3300048913 Bacteria 2496
838 Ga0496111_0391069 3300048914 Bacteria 1028
839 Ga0496112_0472217 3300048915 Bacteria 1191
840 Ga0496113_0446944 3300048916 Bacteria 1038
841 Ga0496114_0013196 3300048917 Bacteria 6622
842 Ga0496114_0019310 3300048917 Bacteria 5523
843 Ga0496121_0004723 3300048924 Bacteria 17997
844 Ga0496121_0102757 3300048924 Bacteria 2201
845 Ga0496124_0000786 3300048927 Bacteria 51804
846 Ga0496124_0014829 3300048927 Bacteria 7513
847 Ga0496124_0075562 3300048927 Bacteria 2783
848 Ga0496124_0079351 3300048927 Bacteria 2703
849 Ga0496125_0145406 3300048928 Bacteria 1639
850 Ga0501306_007246 3300049127 Bacteria 1323
851 Ga0501309_000025 3300049129 Bacteria 7550
852 Ga0501309_008388 3300049129 Bacteria 1300
853 Ga0501310_000148 3300049130 Bacteria 6990
854 Ga0501310_003053 3300049130 Bacteria 1624
855 Ga0501310_010949 3300049130 Bacteria 1020
856 Ga0501305_000406 3300049161 Bacteria 3471
857 Ga0495678_052980 3300049459 Bacteria 1560
858 Ga0501292_004010 3300049515 Bacteria 1994
859 Ga0501312_000202 3300049528 Bacteria 4075
860 Ga0501312_016510 3300049528 Bacteria 1057
861 Ga0501312_037487 3300049528 Bacteria 782
862 Ga0501031_0012469 3300049568 Bacteria 5545
863 Ga0501034_0214881 3300049571 Bacteria 1877
864 Ga0501039_0263426 3300049575 Bacteria 1355
865 Ga0501041_0045728 3300049577 Bacteria 2662
866 Ga0501042_0208528 3300049578 Bacteria 1409
867 Ga0501043_0000439 3300049579 Bacteria 37482
868 Ga0501046_0001371 3300049580 Bacteria 23462
869 Ga0501047_0000069 3300049581 Bacteria 129231
870 Ga0501048_0001073 3300049582 Bacteria 20497
871 Ga0501071_0132017 3300049587 Bacteria 1856
872 Ga0501072_0089355 3300049588 Bacteria 2445
873 Ga0501075_0102944 3300049591 Bacteria 2169
874 Ga0501075_0326332 3300049591 Bacteria 1169
875 Ga0501076_0356136 3300049592 Bacteria 1202
876 Ga0501198_000025 3300049649 Bacteria 66985
877 Ga0501206_023797 3300049653 Bacteria 884
878 Ga0501217_023230 3300049661 Bacteria 1476
879 Ga0501222_000033 3300049662 Bacteria 55105
880 Ga0501236_004440 3300049670 Bacteria 1664
881 Ga0501249_018171 3300049679 Bacteria 1519
882 Ga0501255_001587 3300049684 Bacteria 1862
883 Ga0501257_020132 3300049686 Bacteria 1565
884 Ga0501258_005799 3300049687 Bacteria 1208
885 Ga0501221_001733 3300049704 Bacteria 3629
886 Ga0501225_0045324 3300049705 Bacteria 1218
887 Ga0501229_000244 3300049706 Bacteria 6111
888 Ga0501262_001485 3300049759 Bacteria 2636
889 Ga0501265_000973 3300049762 Bacteria 3223
890 Ga0501266_000336 3300049763 Bacteria 6229
891 Ga0501267_000971 3300049764 Bacteria 2359
892 Ga0501268_013544 3300049765 Bacteria 1318
893 Ga0501269_007210 3300049766 Bacteria 1342
894 Ga0501270_014238 3300049767 Bacteria 1116
895 Ga0501282_000064 3300049778 Bacteria 12905
896 Ga0501045_0005472 3300049824 Bacteria 8789
897 Ga0501226_003873 3300049853 Bacteria 1755
898 nmdc:mga03683_10004_c1 3300050489 Bacteria 3390
899 nmdc:mga03683_155164_c1 3300050489 Bacteria 1035
900 nmdc:mga03n38_4511_c1 3300050490 Bacteria 4629
901 nmdc:mga00v17_228725_c1 3300050491 Bacteria 1205
902 nmdc:mga00v17_305870_c1 3300050491 Bacteria 1033
903 nmdc:mga0yw44_33899_c1 3300050492 Bacteria 2987
904 nmdc:mga0k408_106671_c1 3300050493 Bacteria 1655
905 nmdc:mga0k408_12634_c1 3300050493 Bacteria 4616
906 nmdc:mga0k408_1934_c1 3300050493 Bacteria 11085
907 nmdc:mga0k408_204130_c1 3300050493 Bacteria 1180
908 nmdc:mga0k408_215236_c1 3300050493 Bacteria 1147
909 nmdc:mga0k408_21725_c1 3300050493 Bacteria 3607
910 nmdc:mga0k408_27545_c1 3300050493 Bacteria 3228
911 nmdc:mga0k408_27789_c1 3300050493 Bacteria 3214
912 nmdc:mga0k408_3284_c1 3300050493 Bacteria 8560
913 nmdc:mga0k408_47090_c1 3300050493 Bacteria 2492
914 nmdc:mga0k408_62543_c1 3300050493 Bacteria 2165
915 nmdc:mga0k408_67217_c1 3300050493 Bacteria 2089
916 nmdc:mga0k408_8880_c1 3300050493 Bacteria 5406
917 nmdc:mga06z11_14982_c1 3300050494 Bacteria 3450
918 nmdc:mga06z11_15471_c1 3300050494 Bacteria 3406
919 nmdc:mga06z11_22757_c1 3300050494 Bacteria 2932
920 nmdc:mga04h51_189000_c1 3300050495 Bacteria 805
921 nmdc:mga07m45_1266_c1 3300050496 Bacteria 11496
922 nmdc:mga07m45_13746_c1 3300050496 Bacteria 4299
923 nmdc:mga07m45_34480_c1 3300050496 Bacteria 2813
924 nmdc:mga07m45_7481_c1 3300050496 Bacteria 5583
925 nmdc:mga07m45_85675_c1 3300050496 Bacteria 1802
926 nmdc:mga05p37_110216_c1 3300050507 Bacteria 3386
927 nmdc:mga09592_1763_c1 3300050508 Bacteria 17376
928 nmdc:mga0qj67_270383_c1 3300050509 Bacteria 1378
929 nmdc:mga08y16_152329_c1 3300050511 Bacteria 2403
930 nmdc:mga08y16_782340_c1 3300050511 Bacteria 948
931 nmdc:mga0sz30_56800_c1 3300050516 Bacteria 1668
932 Ga0495601_0166020 3300053077 Bacteria 1443
933 Ga0500635_0000215 3300053080 Bacteria 27205
934 Ga0500635_0070413 3300053080 Bacteria 1239
935 Ga0495595_0018669 3300053084 Bacteria 3000
936 Ga0495619_0046643 3300053085 Bacteria 2850
937 Ga0500578_0000006 3300053086 Bacteria 234598
938 Ga0500578_0035695 3300053086 Bacteria 3194
939 Ga0500644_0003987 3300053088 Bacteria 3674
940 Ga0500651_0006999 3300053093 Bacteria 6547
941 Ga0500651_0215640 3300053093 Bacteria 1127
942 Ga0500650_0107296 3300053098 Bacteria 1304
943 Ga0500562_048068 3300053108 Bacteria 1139
944 Ga0500593_001218 3300053117 Bacteria 9301
945 Ga0500594_0033972 3300053118 Bacteria 1359
946 Ga0500607_032062 3300053121 Bacteria 2887
947 Ga0500623_045564 3300053127 Bacteria 2226
948 Ga0500628_001683 3300053129 Bacteria 3741
949 Ga0500642_0005701 3300053130 Bacteria 4043
950 Ga0500652_000158 3300053131 Bacteria 26062
951 Ga0500652_027113 3300053131 Bacteria 2212
952 Ga0500655_002668 3300053133 Bacteria 3233
953 Ga0500559_0000138 3300053136 Bacteria 56620
954 Ga0500590_126164 3300053148 Bacteria 1191
955 Ga0500619_000010 3300053154 Bacteria 61024
956 Ga0500622_0001738 3300053156 Bacteria 16832
957 Ga0500622_0015365 3300053156 Bacteria 4100
958 Ga0500634_0070370 3300053161 Bacteria 1832
959 Ga0500636_0059931 3300053177 Bacteria 2223
960 Ga0500645_006609 3300053730 Bacteria 4114
961 Ga0500587_018500 3300053739 Bacteria 897
962 Ga0501084_0308281 3300054114 Bacteria 1337
963 Ga0590075_039815 3300059424 Bacteria 1199
964 Ga0501082_0209540 3300060353 Bacteria 1696
965 Ga0466962_0004427 3300061719 Bacteria 6728
966 Ga0466962_0099306 3300061719 Bacteria 1397
967 Ga0466962_0177697 3300061719 Bacteria 1037
968 2587725119 2585428057 Bacteria 6737412
969 2587731521 2585428058 Bacteria 6853932
970 2587756202 2585428062 Bacteria 6842168
971 2588295167 2588253510 Bacteria 6901809
972 2643746421 2643221544 Bacteria 5886209
973 2643966990 2643221592 Bacteria 6608788
974 2644142641 2643221625 Bacteria 6512927
975 2644217245 2643221639 Bacteria 6649903
976 2644248406 2643221644 Bacteria 6865017
977 2644258987 2643221646 Bacteria 6433402
978 2644273684 2643221648 Bacteria 6521465
979 2644301630 2643221654 Bacteria 5273570
980 2644314350 2643221656 Bacteria 5809961
981 2644338717 2643221660 Bacteria 4208257
982 2722881364 2721755523 Bacteria 6430384
983 2739055723 2738541337 Bacteria 6183410
984 2831866137 2831864461 Bacteria 6502356
985 2839140615 2839138175 Bacteria 6549354
986 2886850731 2886848708 Bacteria 5632523
987 nmdc:mga07m45_960_c1
988 SwRhRL2b_contig_1230578
989 SwRhRL2b_contig_3945145
990 JGI24740J21852_10052921
991 JGI24744J21845_10014524
992 JGI25154J39366_1001409
993 JGI25157J39369_1000027
994 JGI25164J39214_1005229
995 JGI25152J39213_1002504
996 JGI25153J46596_10004012
997 JGI25153J46596_10008556
998 rootH1_10001428
999 rootH2_10031478
1000 rootL2_10003861
1001 rootH1_10005727
1002 rootH1_10065205
1003 JGI26145J50221_1002941
1004 Ga0055533_1000073
1005 Ga0055525_1000038
1006 Ga0055525_1001631
1007 Ga0055535_1003758
1008 Ga0055529_1000385
1009 Ga0055526_1009433
1010 Ga0055524_1000242
1011 Ga0055524_1001332
1012 Ga0055524_1007381
1013 Ga0055530_10004226
1014 Ga0055530_10005683
1015 Ga0055530_10032056
1016 Ga0055540_1000015
1017 Ga0055531_10000043
1018 Ga0055531_10008158
1019 Ga0055531_10017077
1020 Ga0055531_10019016
1021 Ga0055543_1002176
1022 Ga0055543_1007063
1023 Ga0065165_1000283
1024 Ga0065165_1000732
1025 Ga0065165_1005192
1026 Ga0065704_10325887
1027 Ga0065715_10336276
1028 Ga0065707_10237321
1029 Ga0070676_10001230
1030 Ga0070676_10274495
1031 Ga0070690_100011544
1032 Ga0070690_100012917
1033 Ga0070670_100002549
1034 Ga0070670_100021319
1035 Ga0070670_100038937
1036 Ga0070670_100154794
1037 Ga0070677_10003169
1038 Ga0070677_10004158
1039 Ga0070677_10020378
1040 Ga0068869_100035286
1041 Ga0068869_100079511
1042 Ga0070680_100009256
1043 Ga0070682_100086284
1044 Ga0068868_100007055
1045 Ga0068868_100065272
1046 Ga0070660_100086354
1047 Ga0070660_100109700
1048 Ga0070689_100050074
1049 Ga0070661_100081275
1050 Ga0070661_100131844
1051 Ga0070668_100028598
1052 Ga0070668_100120560
1053 Ga0070669_100002315
1054 Ga0070669_100062840
1055 Ga0070669_100236590
1056 Ga0070669_100238908
1057 Ga0070675_100015429
1058 Ga0070675_100051441
1059 Ga0070675_100057267
1060 Ga0070675_100147197
1061 Ga0070675_100434515
1062 Ga0070671_100018406
1063 Ga0070671_100034187
1064 Ga0070671_100057393
1065 Ga0070671_100063761
1066 Ga0070671_100080833
1067 Ga0070671_100127555
1068 Ga0070674_100088546
1069 Ga0070673_100002831
1070 Ga0070673_100143779
1071 Ga0070673_100480446
1072 Ga0070659_100002606
1073 Ga0070659_100048346
1074 Ga0070659_100102453
1075 Ga0070667_100003888
1076 Ga0070667_100013392
1077 Ga0070667_100039447
1078 Ga0070667_100146474
1079 Ga0070667_100508456
1080 Ga0070700_100057256
1081 Ga0070700_100118124
1082 Ga0070663_100001718
1083 Ga0070663_100028656
1084 Ga0070663_100256217
1085 Ga0070678_100011117
1086 Ga0070678_100032599
1087 Ga0070678_100128550
1088 Ga0070678_100604324
1089 Ga0070662_100001001
1090 Ga0070662_100017955
1091 Ga0070662_100020424
1092 Ga0070681_10027720
1093 Ga0068867_100000118
1094 Ga0068867_100022580
1095 Ga0068867_100093859
1096 Ga0068867_100123370
1097 Ga0068867_100197593
1098 Ga0068867_100298773
1099 Ga0070685_10031202
1100 Ga0070706_100000965
1101 Ga0070707_100028547
1102 Ga0070698_100056763
1103 Ga0070684_100158905
1104 Ga0070684_100351681
1105 Ga0070684_100691494
1106 Ga0068853_100000531
1107 Ga0068853_100186423
1108 Ga0070672_100006693
1109 Ga0070672_100008379
1110 Ga0070672_100046804
1111 Ga0070672_100057494
1112 Ga0070672_100078741
1113 Ga0070672_100095161
1114 Ga0070672_100121856
1115 Ga0070672_100254614
1116 Ga0070686_100065221
1117 Ga0070665_100098483
1118 Ga0070665_100154019
1119 Ga0068855_100009023
1120 Ga0068855_100084890
1121 Ga0068855_100538168
1122 Ga0070664_100028601
1123 Ga0070664_100064225
1124 Ga0068857_100086072
1125 Ga0068854_100070338
1126 Ga0068854_100152457
1127 Ga0068854_100171067
1128 Ga0068854_100188364
1129 Ga0068856_100019359
1130 Ga0068856_100025775
1131 Ga0068852_100073693
1132 Ga0068852_100077216
1133 Ga0068852_100119604
1134 Ga0068852_100619570
1135 Ga0068852_100645561
1136 Ga0068859_100012494
1137 Ga0068859_100077548
1138 Ga0068859_100086979
1139 Ga0068859_101281275
1140 Ga0068864_100009897
1141 Ga0068864_100011232
1142 Ga0068864_100015484
1143 Ga0068864_100042843
1144 Ga0068864_100485456
1145 Ga0068864_100722176
1146 Ga0068866_10008904
1147 Ga0068866_10078971
1148 Ga0068861_100002963
1149 Ga0068861_100012125
1150 Ga0068861_100016485
1151 Ga0068861_100020535
1152 Ga0068861_100073836
1153 Ga0068861_100102900
1154 Ga0068851_10031320
1155 Ga0068851_10075496
1156 Ga0068851_10097806
1157 Ga0068870_10067885
1158 Ga0068870_10168954
1159 Ga0068863_100005044
1160 Ga0068863_100016273
1161 Ga0068863_100026617
1162 Ga0068863_100081785
1163 Ga0068863_100265043
1164 Ga0068858_100003535
1165 Ga0068858_100020363
1166 Ga0068858_100031405
1167 Ga0068860_100022185
1168 Ga0068860_100037149
1169 Ga0068860_100064591
1170 Ga0068860_100124585
1171 Ga0068860_100149613
1172 Ga0068860_100184950
1173 Ga0068860_100294881
1174 Ga0068862_100005039
1175 Ga0068862_100014167
1176 Ga0068862_100186189
1177 Ga0068862_100202946
1178 Ga0081455_10127724
1179 Ga0075365_10029275
1180 Ga0075363_100020269
1181 Ga0075363_100044822
1182 Ga0075362_10005519
1183 Ga0075362_10034342
1184 Ga0075362_10124993
1185 Ga0075367_10008638
1186 Ga0075367_10011101
1187 Ga0075367_10036535
1188 Ga0075367_10066862
1189 Ga0075369_10102269
1190 Ga0075369_10239386
1191 Ga0075366_10005622
1192 Ga0075366_10006143
1193 Ga0075366_10007241
1194 Ga0075366_10009655
1195 Ga0075366_10013728
1196 Ga0075366_10022545
1197 Ga0075366_10027031
1198 Ga0075366_10044385
1199 Ga0075366_10086869
1200 Ga0075366_10192772
1201 Ga0097621_100030138
1202 Ga0097621_100043267
1203 Ga0097621_100104548
1204 Ga0075370_10000130
1205 Ga0075370_10001345
1206 Ga0075370_10002588
1207 Ga0075370_10003017
1208 Ga0075370_10009309
1209 Ga0075370_10012654
1210 Ga0075370_10062644
1211 Ga0075370_10064608
1212 Ga0075370_10113352
1213 Ga0068871_100109875
1214 Ga0075434_100537458
1215 Ga0075429_100001726
1216 Ga0068865_100005096
1217 Ga0097620_100012494
1218 Ga0097620_100077545
1219 Ga0097620_100086975
1220 Ga0097620_101281293
1221 Ga0099823_1031990
1222 Ga0079104_1000040
1223 Ga0079104_1000427
1224 Ga0105250_10000379
1225 Ga0105240_10003000
1226 Ga0105240_10054403
1227 Ga0105240_10076067
1228 Ga0105240_10149156
1229 Ga0105245_10110625
1230 Ga0105245_10168037
1231 Ga0105245_10233345
1232 Ga0105245_10520946
1233 Ga0114129_10099876
1234 Ga0114129_10327459
1235 Ga0105243_10000516
1236 Ga0105243_10002920
1237 Ga0105243_10024728
1238 Ga0105243_10047577
1239 Ga0105243_10065560
1240 Ga0105241_10046653
1241 Ga0105241_10083114
1242 Ga0105241_10449135
1243 Ga0105248_10002030
1244 Ga0105248_10016482
1245 Ga0105248_10047705
1246 Ga0105248_10106584
1247 Ga0105248_10582908
1248 Ga0105237_10000870
1249 Ga0105237_10016422
1250 Ga0105237_10062994
1251 Ga0105238_10023445
1252 Ga0105238_10030130
1253 Ga0105249_10213889
1254 Ga0105249_10246534
1255 Ga0105239_10000417
1256 Ga0105239_10067508
1257 Ga0105239_10098468
1258 Ga0105239_10738632
1259 Ga0105246_10463218
1260 Ga0157340_1003658
1261 Ga0157319_1000037
1262 Ga0157373_10061037
1263 Ga0157371_10023164
1264 Ga0157371_10176371
1265 Ga0157369_10028287
1266 Ga0157369_10172625
1267 Ga0157374_10060226
1268 Ga0157374_10124123
1269 Ga0157378_10009166
1270 Ga0157378_10171671
1271 Ga0163162_10018593
1272 Ga0163162_10020440
1273 Ga0163162_10161823
1274 Ga0157372_10009475
1275 Ga0157372_10179122
1276 Ga0157375_10011743
1277 Ga0157375_10027025
1278 Ga0157375_10064221
1279 Ga0157375_10079252
1280 Ga0157375_10173076
1281 Ga0157375_10418749
1282 Ga0163163_10012204
1283 Ga0163163_10038201
1284 Ga0163163_10060230
1285 Ga0157380_10015491
1286 Ga0157380_10024058
1287 Ga0157380_10031157
1288 Ga0157380_10126284
1289 Ga0157380_10223715
1290 Ga0182008_10001330
1291 Ga0157377_10000313
1292 Ga0157377_10045731
1293 Ga0157379_10003100
1294 Ga0157379_10004439
1295 Ga0157379_10069785
1296 Ga0157376_10027225
1297 Ga0157376_10200220
1298 Ga0157376_10393116
1299 Ga0182007_10045992
1300 Ga0163161_10023832
1301 Ga0163161_10288696
1302 Ga0213872_10000018
1303 Ga0213872_10000070
1304 Ga0213872_10138690
1305 Ga0209674_100039
1306 Ga0209563_100005
1307 Ga0209563_100110
1308 Ga0207427_104198
1309 Ga0209258_100305
1310 Ga0209258_100692
1311 Ga0207425_1005493
1312 Ga0209646_1000196
1313 Ga0209026_1000011
1314 Ga0209677_100151
1315 Ga0209677_100621
1316 Ga0209677_102310
1317 Ga0209759_1000107
1318 Ga0209759_1004962
1319 Ga0209759_1008572
1320 Ga0209129_1000027
1321 Ga0209455_1000053
1322 Ga0209673_1009495
1323 Ga0209673_1016350
1324 Ga0209673_1029509
1325 Ga0209675_1009087
1326 Ga0209564_1000014
1327 Ga0209564_1000051
1328 Ga0209758_1000193
1329 Ga0209758_1000208
1330 Ga0209050_1000416
1331 Ga0209050_1001233
1332 Ga0209050_1001932
1333 Ga0209050_1015631
1334 Ga0209050_1015668
1335 Ga0209256_1000092
1336 Ga0209256_1000471
1337 Ga0209256_1000967
1338 Ga0209051_1000020
1339 Ga0209051_1003495
1340 Ga0209051_1005666
1341 Ga0209051_1007685
1342 Ga0209051_1008472
1343 Ga0209051_1040661
1344 Ga0209257_1000182
1345 Ga0209257_1000189
1346 Ga0209257_1001013
1347 Ga0209257_1009108
1348 Ga0209257_1013728
1349 Ga0207697_10139621
1350 Ga0207656_10044902
1351 Ga0207682_10014444
1352 Ga0207682_10074528
1353 Ga0207642_10012161
1354 Ga0207688_10273792
1355 Ga0207680_10082238
1356 Ga0207647_10180009
1357 Ga0207645_10083578
1358 Ga0207643_10009117
1359 Ga0207643_10240030
1360 Ga0207705_10278848
1361 Ga0207684_10004494
1362 Ga0207695_10004036
1363 Ga0207695_10005546
1364 Ga0207695_10047193
1365 Ga0207695_10194890
1366 Ga0207695_10251548
1367 Ga0207671_10005322
1368 Ga0207671_10060127
1369 Ga0207660_10113049
1370 Ga0207662_10275784
1371 Ga0207657_10046620
1372 Ga0207649_10002166
1373 Ga0207649_10051621
1374 Ga0207652_10006446
1375 Ga0207646_10030388
1376 Ga0207681_10008786
1377 Ga0207681_10040654
1378 Ga0207694_10017172
1379 Ga0207694_10051794
1380 Ga0207694_10319491
1381 Ga0207650_10000904
1382 Ga0207650_10009335
1383 Ga0207650_10010853
1384 Ga0207650_10171363
1385 Ga0207659_10004951
1386 Ga0207659_10006933
1387 Ga0207659_10148487
1388 Ga0207659_10383426
1389 Ga0207687_10013305
1390 Ga0207687_10085684
1391 Ga0207687_10727047
1392 Ga0207644_10001787
1393 Ga0207644_10006315
1394 Ga0207644_10037525
1395 Ga0207644_10083387
1396 Ga0207644_10179303
1397 Ga0207644_10513448
1398 Ga0207690_10004334
1399 Ga0207706_10001749
1400 Ga0207706_10031078
1401 Ga0207706_10303429
1402 Ga0207686_10085030
1403 Ga0207709_10000382
1404 Ga0207709_10037497
1405 Ga0207709_10048858
1406 Ga0207709_10578059
1407 Ga0207670_10718974
1408 Ga0207669_10007483
1409 Ga0207704_10009164
1410 Ga0207704_10778040
1411 Ga0207691_10005307
1412 Ga0207691_10011899
1413 Ga0207691_10017763
1414 Ga0207691_10030742
1415 Ga0207691_10103674
1416 Ga0207711_10009050
1417 Ga0207711_10079588
1418 Ga0207711_10127355
1419 Ga0207711_10538336
1420 Ga0207689_10043887
1421 Ga0207689_10072292
1422 Ga0207661_10152171
1423 Ga0207661_10362973
1424 Ga0207679_10000154
1425 Ga0207679_10168056
1426 Ga0207679_10175328
1427 Ga0207667_10014452
1428 Ga0207667_10070368
1429 Ga0207667_10814856
1430 Ga0207651_10000726
1431 Ga0207651_10023579
1432 Ga0207651_10040992
1433 Ga0207651_10407075
1434 Ga0207712_10079843
1435 Ga0207712_10159397
1436 Ga0207712_10237152
1437 Ga0207712_10239044
1438 Ga0207712_10781651
1439 Ga0207668_10172325
1440 Ga0207640_10006815
1441 Ga0207640_10104626
1442 Ga0207658_10006325
1443 Ga0207658_10008867
1444 Ga0207658_10022179
1445 Ga0207677_10017241
1446 Ga0207677_10096180
1447 Ga0207703_10007292
1448 Ga0207703_10019578
1449 Ga0207703_10033069
1450 Ga0207703_11048342
1451 Ga0207639_10003410
1452 Ga0207639_10321337
1453 Ga0207639_10741068
1454 Ga0207678_10001164
1455 Ga0207678_10061645
1456 Ga0207678_10165640
1457 Ga0207708_10008693
1458 Ga0207708_10035380
1459 Ga0207708_10481162
1460 Ga0207702_10000270
1461 Ga0207702_10023323
1462 Ga0207702_10685732
1463 Ga0207641_10010569
1464 Ga0207641_10016789
1465 Ga0207648_10000264
1466 Ga0207648_10002564
1467 Ga0207648_10054352
1468 Ga0207648_10119130
1469 Ga0207648_10274947
1470 Ga0207648_10600044
1471 Ga0207648_10659617
1472 Ga0207676_10002431
1473 Ga0207676_10003185
1474 Ga0207676_10003375
1475 Ga0207676_10065216
1476 Ga0207674_10007035
1477 Ga0207675_100004520
1478 Ga0207675_100020594
1479 Ga0207675_100045818
1480 Ga0207675_100048921
1481 Ga0207675_100236286
1482 Ga0207675_100297352
1483 Ga0207675_100956634
1484 Ga0207683_10004615
1485 Ga0207683_10008759
1486 Ga0207683_10111270
1487 Ga0207683_10163755
1488 Ga0207683_10896549
1489 Ga0207698_10067256
1490 Ga0207698_10160315
1491 Ga0209281_1000072
1492 Ga0209281_1000074
1493 Ga0209984_1015402
1494 Ga0209995_1013728
1495 Ga0209968_1000344
1496 Ga0209970_1026864
1497 Ga0209983_1046768
1498 Ga0209966_1000136
1499 Ga0268266_10577983
1500 Ga0268265_10022062
1501 Ga0268265_10034984
1502 Ga0268265_10152302
1503 Ga0268265_10276860
1504 Ga0268264_10005811
1505 Ga0268264_10062092
1506 Ga0268264_10327008
1507 Ga0265336_10000022
1508 Ga0307517_10072121
1509 Ga0307515_10000131
1510 Ga0307515_10000165
1511 Ga0307515_10000232
1512 Ga0307515_10006463
1513 Ga0307515_10015871
1514 Ga0307515_10018948
1515 Ga0307515_10022118
1516 Ga0307515_10254187
1517 Ga0307515_10298322
1518 Ga0265324_10002429
1519 Ga0265324_10006622
1520 Ga0268256_1026772
1521 Ga0307512_10056946
1522 Ga0307512_10165008
1523 Ga0265330_10014977
1524 Ga0265332_10000220
1525 Ga0265332_10009151
1526 Ga0265328_10038901
1527 Ga0265331_10001142
1528 Ga0265331_10018516
1529 Ga0265327_10000028
1530 Ga0265327_10000320
1531 Ga0265316_10000129
1532 Ga0265316_10246408
1533 Ga0307513_10017844
1534 Ga0307513_10047058
1535 Ga0307513_10094334
1536 Ga0307513_10161720
1537 Ga0307513_10226430
1538 Ga0307509_10003013
1539 Ga0307509_10037746
1540 Ga0307509_10060799
1541 Ga0307509_10102672
1542 Ga0307509_10130164
1543 Ga0307408_100000160
1544 Ga0307408_100091181
1545 Ga0307408_100189788
1546 Ga0307408_100512133
1547 Ga0307508_10001328
1548 Ga0307508_10002994
1549 Ga0307508_10027467
1550 Ga0307508_10287745
1551 Ga0307514_10004809
1552 Ga0307514_10008878
1553 Ga0307514_10015639
1554 Ga0307514_10149698
1555 Ga0307514_10162233
1556 Ga0265314_10005103
1557 Ga0265314_10056149
1558 Ga0265342_10014208
1559 Ga0307516_10000595
1560 Ga0307516_10002134
1561 Ga0307516_10002726
1562 Ga0307516_10009114
1563 Ga0307516_10027292
1564 Ga0307516_10131016
1565 Ga0307516_10132085
1566 Ga0307516_10134630
1567 Ga0307516_10178034
1568 Ga0307516_10205607
1569 Ga0307516_10222853
1570 Ga0307516_10473855
1571 Ga0307405_10094402
1572 Ga0307405_10358469
1573 Ga0307405_10506154
1574 Ga0307413_10087139
1575 Ga0307413_10382522
1576 Ga0307410_10223506
1577 Ga0307410_10379960
1578 Ga0307406_10032124
1579 Ga0307406_10320605
1580 Ga0307407_10379756
1581 Ga0307407_10447327
1582 Ga0307412_10125124
1583 Ga0307412_10253185
1584 Ga0307412_10533047
1585 Ga0307409_100042552
1586 Ga0307409_100768097
1587 Ga0307416_100110201
1588 Ga0307416_100115953
1589 Ga0307416_100728004
1590 Ga0307414_10008432
1591 Ga0307414_10355119
1592 Ga0307411_10001451
1593 Ga0307411_10082030
1594 Ga0307415_100063783
1595 Ga0307507_10098286
1596 Ga0307510_10047623
1597 Ga0307510_10142350
1598 Ga0307510_10159811
1599 Ga0373944_0033579
1600 Ga0373944_0049567
1601 Ga0373949_0097553
1602 Ga0373923_0051893
1603 Ga0373923_0253089
1604 Ga0373939_0000180
1605 Ga0373954_0120803
1606 Ga0373960_0009161
1607 Ga0373943_0151449
1608 Ga0373946_0227991
1609 Ga0373955_0205403
1610 Ga0373924_0017561
1611 Ga0373924_0023164
1612 Ga0373931_0000454
1613 Ga0373931_0001260
1614 Ga0373931_0006658
1615 Ga0373931_0071250
1616 Ga0373933_0066134
1617 Ga0373947_0258046
1618 Ga0373937_0036873
1619 Ga0373937_0092056
1620 Ga0373937_0470802
1621 Ga0373925_0003189
1622 Ga0373925_0017322
1623 Ga0373925_0413510
1624 Ga0395900_0000025
1625 Ga0395900_0267865
1626 Ga0395898_0007948
1627 Ga0395898_0040143
1628 Ga0395905_0000071
1629 Ga0395905_0002690
1630 Ga0395905_0013413
1631 Ga0395905_0013482
1632 Ga0395905_0043043
1633 Ga0395905_0140233
1634 Ga0395905_0240803
1635 Ga0395905_0351375
1636 Ga0395901_0006003
1637 Ga0395901_0745176
1638 Ga0436365_1542390
1639 Ga0436361_0054890
1640 Ga0436361_0104381
1641 Ga0436361_0175665
1642 Ga0436361_0459306
1643 Ga0436361_0592172
1644 Ga0436361_0677882
1645 Ga0436361_0716769
1646 Ga0436361_0804529
1647 Ga0436361_0812713
1648 Ga0436361_1197672
1649 Ga0436363_1550768
1650 Ga0451789_0480314
1651 Ga0451798_0529553
1652 Ga0451802_1671124
1653 Ga0451802_1748927
1654 Ga0451802_1879611
1655 Ga0451802_1995623
1656 Ga0451839_0036937
1657 Ga0451855_1603730
1658 Ga0439433_0017719
1659 Ga0439437_001281
1660 Ga0439454_019896
1661 Ga0450911_019502
1662 Ga0450919_002454
1663 Ga0450890_000381
1664 Ga0450891_000049
1665 Ga0450892_001246
1666 Ga0450889_000650
1667 Ga0439446_0062097
1668 Ga0439434_0097932
1669 Ga0439459_0001561
1670 Ga0439464_0072190
1671 Ga0450918_000091
1672 Ga0451577_0000747
1673 Ga0451577_0000906
1674 Ga0451577_0001077
1675 Ga0451577_0001271
1676 Ga0451577_0001943
1677 Ga0451577_0015312
1678 Ga0451577_0191389
1679 Ga0451577_0265292
1680 Ga0466969_0000097
1681 Ga0466969_0003731
1682 Ga0466969_0134256
1683 Ga0466972_0000265
1684 Ga0466972_0015715
1685 Ga0466972_0071030
1686 Ga0453683_0071466
1687 Ga0466965_0004580
1688 Ga0466965_0030122
1689 Ga0466966_0080445
1690 Ga0466966_0110839
1691 Ga0466961_0008576
1692 Ga0466961_0012564
1693 Ga0466961_0031151
1694 Ga0466961_0146097
1695 Ga0466963_0040444
1696 Ga0466963_0054563
1697 Ga0466963_0080763
1698 Ga0466964_0002497
1699 Ga0466964_0039714
1700 Ga0453684_0002172
1701 Ga0453684_0031038
1702 Ga0453684_0054230
1703 Ga0453684_0073965
1704 Ga0453684_0077328
1705 Ga0453684_0087988
1706 Ga0453684_0168215
1707 Ga0453684_0210084
1708 Ga0453684_0470208
1709 Ga0453684_0482478
1710 Ga0466971_0004543
1711 Ga0466971_0058783
1712 Ga0466971_0075933
1713 Ga0466970_0105462
1714 Ga0466970_0138742
1715 Ga0466970_0145428
1716 Ga0466957_0009965
1717 Ga0466957_0016788
1718 Ga0466959_0001171
1719 Ga0466959_0032335
1720 Ga0466959_0065097
1721 Ga0466959_0086899
1722 Ga0451576_0001319
1723 Ga0451576_0003466
1724 Ga0451576_0005936
1725 Ga0451576_0006498
1726 Ga0451576_0046370
1727 Ga0451576_0072274
1728 Ga0451576_0368678
1729 Ga0451576_0465292
1730 Ga0466958_0011815
1731 Ga0466958_0083862
1732 Ga0466967_0009150
1733 Ga0466967_0041054
1734 Ga0466967_0267142
1735 Ga0466967_0712959
1736 Ga0495592_0000120
1737 Ga0495592_0063647
1738 Ga0495590_0019151
1739 Ga0495638_0041159
1740 Ga0495641_0069240
1741 Ga0495651_0241985
1742 Ga0495653_0225610
1743 Ga0495650_0008953
1744 Ga0495650_0029923
1745 Ga0495580_0076761
1746 Ga0495580_0175610
1747 Ga0495639_0021209
1748 Ga0495664_0184113
1749 Ga0495583_0000164
1750 Ga0495606_0304516
1751 Ga0495610_0067613
1752 Ga0495616_0105697
1753 Ga0495620_0055412
1754 Ga0495630_0259002
1755 Ga0495630_0376441
1756 Ga0495632_0009067
1757 Ga0495632_0030437
1758 Ga0495632_0031606
1759 Ga0495632_0066875
1760 Ga0495643_0004877
1761 Ga0495648_0066748
1762 Ga0495648_0168531
1763 Ga0495642_0039291
1764 Ga0495642_0178532
1765 Ga0495652_0113259
1766 Ga0495654_0000516
1767 Ga0495665_0169263
1768 Ga0495640_0112594
1769 Ga0495586_0023994
1770 Ga0495598_0048374
1771 Ga0495621_0054808
1772 Ga0495597_0000077
1773 Ga0495597_0004233
1774 Ga0495645_0059650
1775 Ga0495645_0213292
1776 Ga0495668_0133472
1777 Ga0495668_0205660
1778 Ga0495611_0068732
1779 Ga0495625_0010774
1780 Ga0495625_0046871
1781 Ga0495625_0111812
1782 Ga0495625_0152879
1783 Ga0495635_0171131
1784 Ga0495635_0226379
1785 Ga0495588_0309928
1786 Ga0495658_0008480
1787 Ga0495658_0009047
1788 Ga0495658_0028198
1789 Ga0495613_0350179
1790 Ga0495613_0459160
1791 Ga0495671_0182488
1792 Ga0495649_0005279
1793 Ga0495649_0010343
1794 Ga0495589_0027305
1795 Ga0495676_0080963
1796 Ga0495683_0175335
1797 Ga0495687_004388
1798 Ga0495687_016971
1799 Ga0495684_0063581
1800 Ga0495684_0105145
1801 Ga0495686_0000404
1802 Ga0495686_0052132
1803 Ga0495686_0060008
1804 Ga0495686_0363153
1805 Ga0495602_0196764
1806 Ga0496102_0009017
1807 Ga0496102_0024974
1808 Ga0496102_0034587
1809 Ga0496103_0154589
1810 Ga0496104_0010216
1811 Ga0496104_0318816
1812 Ga0496105_0005943
1813 Ga0496106_0093220
1814 Ga0496106_0118111
1815 Ga0496106_0334145
1816 Ga0496107_0013802
1817 Ga0496108_0058880
1818 Ga0496109_0017559
1819 Ga0496109_0119690
1820 Ga0496109_0597807
1821 Ga0496109_0723367
1822 Ga0496110_0020719
1823 Ga0496110_0108177
1824 Ga0496111_0391069
1825 Ga0496112_0472217
1826 Ga0496113_0446944
1827 Ga0496114_0013196
1828 Ga0496114_0019310
1829 Ga0496121_0004723
1830 Ga0496121_0102757
1831 Ga0496124_0000786
1832 Ga0496124_0014829
1833 Ga0496124_0075562
1834 Ga0496124_0079351
1835 Ga0496125_0145406
1836 Ga0501306_007246
1837 Ga0501309_000025
1838 Ga0501309_008388
1839 Ga0501310_000148
1840 Ga0501310_003053
1841 Ga0501310_010949
1842 Ga0501305_000406
1843 Ga0495678_052980
1844 Ga0501292_004010
1845 Ga0501312_000202
1846 Ga0501312_016510
1847 Ga0501312_037487
1848 Ga0501031_0012469
1849 Ga0501034_0214881
1850 Ga0501039_0263426
1851 Ga0501041_0045728
1852 Ga0501042_0208528
1853 Ga0501043_0000439
1854 Ga0501046_0001371
1855 Ga0501047_0000069
1856 Ga0501048_0001073
1857 Ga0501071_0132017
1858 Ga0501072_0089355
1859 Ga0501075_0102944
1860 Ga0501075_0326332
1861 Ga0501076_0356136
1862 Ga0501198_000025
1863 Ga0501206_023797
1864 Ga0501217_023230
1865 Ga0501222_000033
1866 Ga0501236_004440
1867 Ga0501249_018171
1868 Ga0501255_001587
1869 Ga0501257_020132
1870 Ga0501258_005799
1871 Ga0501221_001733
1872 Ga0501225_0045324
1873 Ga0501229_000244
1874 Ga0501262_001485
1875 Ga0501265_000973
1876 Ga0501266_000336
1877 Ga0501267_000971
1878 Ga0501268_013544
1879 Ga0501269_007210
1880 Ga0501270_014238
1881 Ga0501282_000064
1882 Ga0501045_0005472
1883 Ga0501226_003873
1884 nmdc:mga03683_10004_c1
1885 nmdc:mga03683_155164_c1
1886 nmdc:mga03n38_4511_c1
1887 nmdc:mga00v17_228725_c1
1888 nmdc:mga00v17_305870_c1
1889 nmdc:mga0yw44_33899_c1
1890 nmdc:mga0k408_106671_c1
1891 nmdc:mga0k408_12634_c1
1892 nmdc:mga0k408_1934_c1
1893 nmdc:mga0k408_204130_c1
1894 nmdc:mga0k408_215236_c1
1895 nmdc:mga0k408_21725_c1
1896 nmdc:mga0k408_27545_c1
1897 nmdc:mga0k408_27789_c1
1898 nmdc:mga0k408_3284_c1
1899 nmdc:mga0k408_47090_c1
1900 nmdc:mga0k408_62543_c1
1901 nmdc:mga0k408_67217_c1
1902 nmdc:mga0k408_8880_c1
1903 nmdc:mga06z11_14982_c1
1904 nmdc:mga06z11_15471_c1
1905 nmdc:mga06z11_22757_c1
1906 nmdc:mga04h51_189000_c1
1907 nmdc:mga07m45_1266_c1
1908 nmdc:mga07m45_13746_c1
1909 nmdc:mga07m45_34480_c1
1910 nmdc:mga07m45_7481_c1
1911 nmdc:mga07m45_85675_c1
1912 nmdc:mga05p37_110216_c1
1913 nmdc:mga09592_1763_c1
1914 nmdc:mga0qj67_270383_c1
1915 nmdc:mga08y16_152329_c1
1916 nmdc:mga08y16_782340_c1
1917 nmdc:mga0sz30_56800_c1
1918 Ga0495601_0166020
1919 Ga0500635_0000215
1920 Ga0500635_0070413
1921 Ga0495595_0018669
1922 Ga0495619_0046643
1923 Ga0500578_0000006
1924 Ga0500578_0035695
1925 Ga0500644_0003987
1926 Ga0500651_0006999
1927 Ga0500651_0215640
1928 Ga0500650_0107296
1929 Ga0500562_048068
1930 Ga0500593_001218
1931 Ga0500594_0033972
1932 Ga0500607_032062
1933 Ga0500623_045564
1934 Ga0500628_001683
1935 Ga0500642_0005701
1936 Ga0500652_000158
1937 Ga0500652_027113
1938 Ga0500655_002668
1939 Ga0500559_0000138
1940 Ga0500590_126164
1941 Ga0500619_000010
1942 Ga0500622_0001738
1943 Ga0500622_0015365
1944 Ga0500634_0070370
1945 Ga0500636_0059931
1946 Ga0500645_006609
1947 Ga0500587_018500
1948 Ga0501084_0308281
1949 Ga0590075_039815
1950 Ga0501082_0209540
1951 Ga0466962_0004427
1952 Ga0466962_0099306
1953 Ga0466962_0177697
1954 2587725119
1955 2587731521
1956 2587756202
1957 2588295167
1958 2643746421
1959 2643966990
1960 2644142641
1961 2644217245
1962 2644248406
1963 2644258987
1964 2644273684
1965 2644301630
1966 2644314350
1967 2644338717
1968 2722881364
1969 2739055723
1970 2831866137
1971 2839140615
1972 2886850731

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

212

261

0.98

PF04542

Sigma70_r2

Sigma-70 region 2

43

114

0.96

PF08281

Sigma70_r4_2

Sigma-70, region 4

206

259

0.89

PF04539

Sigma70_r3

Sigma-70 region 3

121

199

0.79

Map