F487537

General Info

Members Datasets Scaffolds Average Seq Length
986 591 1972 337

Family's Representative Sequence

Representative Sequence 3300053730|Ga0500645_024708|Ga0500645_024708_190_1209
Length 314
Sequence MIPLSVLDLSVVTTGTKPAQSLRNSIDLAKHADQLGYTRYWLAEHHSLLSVASPAPEIMIGQIAAATQRIRVGSGGVMLPNHAPLMVAERFKMLEALFPGRIDLGLGRAPGTDQTTMHALRQRFDPRGGDDFIERLIELTLWETREFPEGHPYNKVVAMPDDTPLPPIWLLGSSDYSMIHYRAHFKPSRWRENPHAILAIAVIMAETDEEADKLASSADLNRLLRDRGQYRPLPSVEEAQAYPYTDAERASIARNRSRLFVGSKQTVMEKVTPLIETSKPDEVMVITATYDHDARKRSYSLLADAFGIGRQAAA

Samples

Sample ID Description Type Environment
1 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
81 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
82 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
83 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
84 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
85 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
140 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
141 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
142 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
143 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
148 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
156 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
157 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
158 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
159 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
164 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
165 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
168 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
169 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
170 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
188 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
189 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
190 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
191 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
192 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
193 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
201 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
202 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
203 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
204 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
205 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
206 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
207 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
210 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
211 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
212 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
213 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
214 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
215 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
216 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
217 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
218 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
219 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
220 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
221 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
222 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
225 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
226 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
227 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
228 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
229 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
230 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
231 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
232 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
233 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
234 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
235 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
236 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
237 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
238 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
239 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
240 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
241 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
242 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
243 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
244 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
245 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
246 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
247 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
248 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
249 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
250 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
251 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
252 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
253 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
254 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
255 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
256 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
257 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
258 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
259 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
260 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
261 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
262 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
263 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
264 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
265 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
266 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
267 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
268 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
269 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
270 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
275 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
276 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
277 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
278 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
279 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
280 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
281 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
282 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
283 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
284 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
285 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
286 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
287 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
288 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
289 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
290 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
291 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
292 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
293 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
294 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
309 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
310 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
311 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
312 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
313 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
314 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
315 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
316 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
317 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
318 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
319 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
322 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
323 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
324 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
325 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
326 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
327 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
328 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
329 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
330 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
331 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
332 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
333 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
334 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
335 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
336 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
337 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
338 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
339 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
340 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
341 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
342 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
343 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
344 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
345 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
346 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
347 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
348 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
349 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
350 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
351 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
352 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
353 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
354 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
355 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
356 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
357 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
358 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
359 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
360 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
361 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
362 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
363 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
364 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
365 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
366 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
367 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
368 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
369 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
370 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
371 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
372 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
373 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
374 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
375 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
376 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
377 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
378 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
379 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
380 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
381 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
382 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
383 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
384 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
385 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
386 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
387 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
388 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
389 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
390 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
391 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
392 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
393 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
394 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
395 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
396 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
397 2643221651 Afipia sp. Root123D2 Isolate Unclassified
398 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
399 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
400 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
401 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
402 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
403 2791355199
404 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
405 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
406 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
407 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
408 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
409 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
410 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
411 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
412 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
413 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
414 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
415 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
416 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
417 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
418 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
419 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
420 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
421 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
422 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
423 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
424 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
425 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
426 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
427 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
428 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
429 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
430 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
431 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
432 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
433 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
434 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
435 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
436 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
437 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
438 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
439 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
440 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
441 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
442 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
443 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
444 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
445 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
446 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
447 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
448 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
449 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
450 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
451 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
452 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
453 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
454 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
455 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
456 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
457 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
458 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
459 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
460 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
461 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
462 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
463 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
464 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
465 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
466 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
467 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
468 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
469 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
470 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
471 2904699407
472 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
473 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
474 2906610324
475 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
476 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
477 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
478 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
479 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
480 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
481 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
482 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
483 2922368715
484 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
485 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
486 2922425934
487 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
488 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
489 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
490 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
491 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
492 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
493 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
494 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
495 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
496 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
497 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
498 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
499 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
500 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
501 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
502 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
503 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
504 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
505 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
506 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
507 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
508 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
509 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
510 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
511 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
512 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
513 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
514 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
515 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
516 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
517 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
518 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
519 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
520 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
521 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
522 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
523 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
524 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
525 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
526 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
527 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
528 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
529 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
530 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
531 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
532 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
533 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
534 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
535 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
536 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
537 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
538 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
539 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
540 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
541 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
542 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
543 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
544 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
545 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
546 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
547 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
548 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
549 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
550 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
551 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
552 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
553 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
554 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
555 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
556 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
557 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
558 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
559 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
560 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
561 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
562 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
563 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
564 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
565 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
566 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
567 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
568 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
569 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
570 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
571 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
572 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
573 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
574 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
575 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
576 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
577 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
578 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
579 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
580 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
581 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
582 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
583 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
584 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
585 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
586 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
587 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
588 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
589 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
590 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
591 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.78
Metatranscriptomes 0.2
Isolates 22.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.46
Nodule 16.94
Rhizoplane 4.67
Rhizosphere 54.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500645_024708 3300053730 Bacteria 1836
2 JGI24740J21852_10005937 3300001979 Bacteria 5113
3 JGI25406J46586_10000012 3300003203 Bacteria 102438
4 JGI25406J46586_10038146 3300003203 Bacteria 1725
5 JGI25153J46596_10008046 3300003215 Bacteria 5094
6 JGI25153J46596_10019332 3300003215 Bacteria 2615
7 JGI25160J50197_1005561 3300003354 Bacteria 5227
8 JGI25160J50197_1007198 3300003354 Bacteria 4383
9 JGI25160J50197_1015110 3300003354 Bacteria 2548
10 JGI25404J52841_10006703 3300003659 Bacteria 2417
11 JGI25404J52841_10010612 3300003659 Bacteria 1979
12 Ga0055539_1002997 3300003752 Bacteria 2435
13 Ga0055543_1005993 3300004625 Bacteria 3016
14 Ga0065165_1000982 3300005262 Bacteria 35331
15 Ga0065165_1007672 3300005262 Bacteria 5235
16 Ga0065165_1008445 3300005262 Bacteria 4816
17 Ga0070670_100068271 3300005331 Bacteria 3051
18 Ga0068869_100023869 3300005334 Bacteria 4232
19 Ga0070680_100016577 3300005336 Bacteria 5798
20 Ga0070680_100064099 3300005336 Bacteria 3011
21 Ga0070680_100367073 3300005336 Bacteria 1225
22 Ga0068868_100071269 3300005338 Bacteria 2771
23 Ga0070660_100238356 3300005339 Bacteria 1481
24 Ga0070660_100280343 3300005339 Bacteria 1364
25 Ga0070661_100310121 3300005344 Bacteria 1230
26 Ga0070668_100041152 3300005347 Bacteria 3540
27 Ga0070668_100087155 3300005347 Bacteria 2456
28 Ga0070668_100137630 3300005347 Bacteria 1965
29 Ga0070671_100044664 3300005355 Bacteria 3682
30 Ga0070674_100096396 3300005356 Bacteria 2146
31 Ga0070688_100166279 3300005365 Bacteria 1519
32 Ga0070709_10002283 3300005434 Bacteria 10401
33 Ga0070714_100022105 3300005435 Bacteria 5212
34 Ga0070714_100039738 3300005435 Bacteria 3962
35 Ga0070713_100022749 3300005436 Bacteria 4849
36 Ga0070713_100060987 3300005436 Bacteria 3155
37 Ga0070713_100129624 3300005436 Bacteria 2223
38 Ga0070713_100162662 3300005436 Bacteria 1993
39 Ga0070710_10018697 3300005437 Bacteria 3569
40 Ga0070708_100387090 3300005445 Bacteria 1319
41 Ga0070663_100028428 3300005455 Bacteria 3806
42 Ga0070663_100169745 3300005455 Bacteria 1685
43 Ga0070678_100178156 3300005456 Bacteria 1738
44 Ga0070678_100279634 3300005456 Bacteria 1411
45 Ga0070662_100185930 3300005457 Bacteria 1640
46 Ga0070662_100367923 3300005457 Bacteria 1181
47 Ga0070681_10187131 3300005458 Bacteria 1991
48 Ga0070681_10419787 3300005458 Bacteria 1250
49 Ga0070706_100133515 3300005467 Bacteria 2317
50 Ga0070707_100054763 3300005468 Bacteria 3825
51 Ga0070707_100433063 3300005468 Bacteria 1275
52 Ga0070698_100047957 3300005471 Bacteria 4366
53 Ga0070679_100270231 3300005530 Bacteria 1654
54 Ga0070684_100065197 3300005535 Bacteria 3196
55 Ga0070684_100115278 3300005535 Bacteria 2413
56 Ga0070684_100213839 3300005535 Bacteria 1757
57 Ga0068853_100032830 3300005539 Bacteria 4400
58 Ga0068853_100040910 3300005539 Bacteria 3957
59 Ga0068853_100109745 3300005539 Bacteria 2449
60 Ga0070672_100185134 3300005543 Bacteria 1736
61 Ga0070686_100183444 3300005544 Bacteria 1488
62 Ga0070665_100012864 3300005548 Bacteria 8426
63 Ga0070665_100058353 3300005548 Bacteria 3870
64 Ga0068855_100080478 3300005563 Bacteria 3777
65 Ga0068855_100117639 3300005563 Bacteria 3044
66 Ga0068855_100154127 3300005563 Bacteria 2611
67 Ga0068855_100218105 3300005563 Bacteria 2141
68 Ga0068855_100358675 3300005563 Bacteria 1604
69 Ga0068857_100023618 3300005577 Bacteria 5413
70 Ga0068854_100072638 3300005578 Bacteria 2519
71 Ga0068856_100000137 3300005614 Bacteria 73762
72 Ga0068856_100063543 3300005614 Bacteria 3647
73 Ga0068856_100118565 3300005614 Bacteria 2647
74 Ga0068856_100540575 3300005614 Bacteria 1186
75 Ga0068852_100006606 3300005616 Bacteria 8399
76 Ga0068852_100010212 3300005616 Bacteria 6998
77 Ga0068852_100448392 3300005616 Bacteria 1277
78 Ga0068851_10003838 3300005834 Bacteria 6727
79 Ga0068851_10061017 3300005834 Bacteria 1932
80 Ga0068860_100000837 3300005843 Bacteria 34452
81 Ga0068860_100274052 3300005843 Bacteria 1647
82 Ga0068860_100468621 3300005843 Bacteria 1254
83 Ga0068862_100137583 3300005844 Bacteria 2166
84 Ga0068862_100249676 3300005844 Bacteria 1616
85 Ga0068862_100315305 3300005844 Bacteria 1442
86 Ga0081455_10008940 3300005937 Bacteria 10353
87 Ga0081455_10011276 3300005937 Bacteria 8994
88 Ga0081455_10013423 3300005937 Bacteria 8097
89 Ga0081455_10032605 3300005937 Bacteria 4692
90 Ga0081538_10037995 3300005981 Bacteria 3113
91 Ga0081540_1002034 3300005983 Bacteria 16870
92 Ga0081540_1007800 3300005983 Bacteria 7574
93 Ga0081540_1008423 3300005983 Bacteria 7210
94 Ga0081540_1012078 3300005983 Bacteria 5714
95 Ga0081540_1020975 3300005983 Bacteria 3910
96 Ga0081540_1023647 3300005983 Bacteria 3588
97 Ga0081540_1051055 3300005983 Bacteria 2048
98 Ga0081540_1065713 3300005983 Bacteria 1704
99 Ga0081540_1068142 3300005983 Bacteria 1659
100 Ga0081539_10000040 3300005985 Bacteria 292753
101 Ga0081539_10000157 3300005985 Bacteria 158278
102 Ga0081539_10006006 3300005985 Bacteria 11928
103 Ga0081539_10063904 3300005985 Bacteria 2006
104 Ga0081539_10105346 3300005985 Bacteria 1430
105 Ga0070717_10017655 3300006028 Bacteria 5555
106 Ga0075365_10043977 3300006038 Bacteria 2925
107 Ga0075365_10110776 3300006038 Bacteria 1886
108 Ga0075368_10016127 3300006042 Bacteria 2781
109 Ga0075363_100115619 3300006048 Bacteria 1494
110 Ga0075363_100125154 3300006048 Bacteria 1438
111 Ga0070716_100014843 3300006173 Bacteria 3996
112 Ga0070716_100021483 3300006173 Bacteria 3402
113 Ga0070716_100114369 3300006173 Bacteria 1678
114 Ga0070712_100152298 3300006175 Bacteria 1777
115 Ga0075367_10061551 3300006178 Bacteria 2240
116 Ga0075367_10121060 3300006178 Bacteria 1612
117 Ga0075369_10010149 3300006186 Bacteria 3680
118 Ga0075369_10132724 3300006186 Bacteria 1132
119 Ga0075366_10023825 3300006195 Bacteria 3567
120 Ga0099794_10005590 3300007265 Bacteria 5052
121 Ga0105240_10012243 3300009093 Bacteria 11853
122 Ga0105240_10015437 3300009093 Bacteria 10386
123 Ga0105240_10069358 3300009093 Bacteria 4364
124 Ga0105240_10135717 3300009093 Bacteria 2947
125 Ga0111539_10347138 3300009094 Bacteria 1727
126 Ga0111539_10351823 3300009094 Bacteria 1714
127 Ga0105245_10148468 3300009098 Bacteria 2214
128 Ga0105243_10224948 3300009148 Bacteria 1661
129 Ga0105241_10001280 3300009174 Bacteria 19200
130 Ga0105241_10043926 3300009174 Bacteria 3385
131 Ga0105241_10070526 3300009174 Bacteria 2711
132 Ga0105241_10081915 3300009174 Bacteria 2529
133 Ga0105248_10036476 3300009177 Bacteria 5498
134 Ga0105248_10497588 3300009177 Bacteria 1374
135 Ga0105237_10044776 3300009545 Bacteria 4455
136 Ga0105237_10140850 3300009545 Bacteria 2406
137 Ga0105238_10044002 3300009551 Bacteria 4517
138 Ga0105238_10079710 3300009551 Bacteria 3264
139 Ga0099796_10019249 3300010159 Bacteria 2067
140 Ga0105239_10054114 3300010375 Bacteria 4401
141 Ga0105239_10187359 3300010375 Bacteria 2316
142 Ga0105239_10211117 3300010375 Bacteria 2176
143 Ga0105239_10267778 3300010375 Bacteria 1921
144 Ga0105246_10111990 3300011119 Bacteria 2006
145 Ga0157370_10040880 3300013104 Bacteria 4475
146 Ga0157370_10532625 3300013104 Bacteria 1077
147 Ga0157369_10151451 3300013105 Bacteria 2451
148 Ga0157374_10134006 3300013296 Bacteria 2400
149 Ga0157378_10074226 3300013297 Bacteria 3060
150 Ga0157378_10078348 3300013297 Bacteria 2981
151 Ga0157378_10544548 3300013297 Bacteria 1165
152 Ga0163162_10654083 3300013306 Bacteria 1174
153 Ga0157372_10100045 3300013307 Bacteria 3308
154 Ga0157375_10055890 3300013308 Bacteria 3893
155 Ga0157375_10190888 3300013308 Bacteria 2203
156 Ga0163163_10150156 3300014325 Bacteria 2374
157 Ga0163163_10222436 3300014325 Bacteria 1936
158 Ga0163163_10268407 3300014325 Bacteria 1757
159 Ga0157376_10022471 3300014969 Bacteria 4919
160 Ga0157376_10240448 3300014969 Bacteria 1687
161 Ga0214544_1000011 3300021320 Bacteria 262952
162 Ga0214542_1000009 3300021321 Bacteria 262861
163 Ga0214545_1000007 3300021324 Bacteria 262984
164 Ga0214543_1000020 3300021327 Bacteria 262861
165 Ga0213871_10033779 3300021441 Bacteria 1346
166 Ga0209677_102183 3300025253 Bacteria 7623
167 Ga0209148_1000321 3300025254 Bacteria 66604
168 Ga0209233_1004336 3300025261 Bacteria 4843
169 Ga0209233_1008907 3300025261 Bacteria 3075
170 Ga0209455_1000807 3300025272 Bacteria 17148
171 Ga0209455_1023034 3300025272 Bacteria 1176
172 Ga0209564_1000477 3300025295 Bacteria 66843
173 Ga0209758_1000206 3300025297 Bacteria 130177
174 Ga0209758_1000536 3300025297 Bacteria 60374
175 Ga0209758_1001539 3300025297 Bacteria 26507
176 Ga0209758_1001550 3300025297 Bacteria 26398
177 Ga0209758_1002309 3300025297 Bacteria 19718
178 Ga0209758_1004564 3300025297 Bacteria 11423
179 Ga0209256_1011364 3300025299 Bacteria 3571
180 Ga0207426_1000773 3300025302 Bacteria 35199
181 Ga0207426_1000990 3300025302 Bacteria 27830
182 Ga0207426_1003444 3300025302 Bacteria 8596
183 Ga0209051_1048370 3300025303 Bacteria 1442
184 Ga0209257_1000394 3300025304 Bacteria 86654
185 Ga0209257_1011695 3300025304 Bacteria 4183
186 Ga0209257_1034598 3300025304 Bacteria 1573
187 Ga0207656_10005846 3300025321 Bacteria 4382
188 Ga0207692_10000138 3300025898 Bacteria 22336
189 Ga0207692_10008172 3300025898 Bacteria 4323
190 Ga0207692_10010497 3300025898 Bacteria 3906
191 Ga0207710_10035205 3300025900 Bacteria 2202
192 Ga0207647_10005671 3300025904 Bacteria 9117
193 Ga0207699_10000122 3300025906 Bacteria 55116
194 Ga0207699_10003146 3300025906 Bacteria 7851
195 Ga0207699_10221479 3300025906 Bacteria 1292
196 Ga0207643_10008642 3300025908 Bacteria 5462
197 Ga0207705_10124422 3300025909 Bacteria 1915
198 Ga0207684_10037662 3300025910 Bacteria 4104
199 Ga0207654_10000153 3300025911 Bacteria 43627
200 Ga0207654_10039326 3300025911 Bacteria 2660
201 Ga0207654_10048569 3300025911 Bacteria 2429
202 Ga0207707_10002207 3300025912 Bacteria 17632
203 Ga0207695_10000006 3300025913 Bacteria 1135309
204 Ga0207695_10000506 3300025913 Bacteria 82904
205 Ga0207695_10051564 3300025913 Bacteria 4318
206 Ga0207695_10402539 3300025913 Bacteria 1253
207 Ga0207671_10021063 3300025914 Bacteria 4952
208 Ga0207671_10110521 3300025914 Bacteria 2091
209 Ga0207671_10313295 3300025914 Bacteria 1241
210 Ga0207693_10004906 3300025915 Bacteria 11244
211 Ga0207693_10009351 3300025915 Bacteria 7991
212 Ga0207693_10068086 3300025915 Bacteria 2787
213 Ga0207663_10000161 3300025916 Bacteria 30665
214 Ga0207663_10000623 3300025916 Bacteria 15689
215 Ga0207663_10209013 3300025916 Bacteria 1413
216 Ga0207660_10227703 3300025917 Bacteria 1465
217 Ga0207660_10243940 3300025917 Bacteria 1416
218 Ga0207662_10099985 3300025918 Bacteria 1796
219 Ga0207657_10033356 3300025919 Bacteria 4642
220 Ga0207657_10242711 3300025919 Bacteria 1438
221 Ga0207652_10047975 3300025921 Bacteria 3649
222 Ga0207652_10373220 3300025921 Bacteria 1288
223 Ga0207646_10050177 3300025922 Bacteria 3735
224 Ga0207681_10275586 3300025923 Bacteria 1322
225 Ga0207694_10003910 3300025924 Bacteria 11770
226 Ga0207694_10034184 3300025924 Bacteria 3898
227 Ga0207694_10038204 3300025924 Bacteria 3691
228 Ga0207694_10081906 3300025924 Bacteria 2536
229 Ga0207694_10219491 3300025924 Bacteria 1550
230 Ga0207687_10009895 3300025927 Bacteria 6243
231 Ga0207687_10029818 3300025927 Bacteria 3672
232 Ga0207687_10274318 3300025927 Bacteria 1349
233 Ga0207700_10045317 3300025928 Bacteria 3244
234 Ga0207700_10053147 3300025928 Bacteria 3033
235 Ga0207700_10057556 3300025928 Bacteria 2932
236 Ga0207664_10021734 3300025929 Bacteria 4779
237 Ga0207664_10120275 3300025929 Bacteria 2196
238 Ga0207706_10065562 3300025933 Bacteria 3198
239 Ga0207706_10312768 3300025933 Bacteria 1367
240 Ga0207669_10029132 3300025937 Bacteria 3048
241 Ga0207665_10000183 3300025939 Bacteria 41938
242 Ga0207665_10171674 3300025939 Bacteria 1566
243 Ga0207665_10175312 3300025939 Bacteria 1550
244 Ga0207691_10049861 3300025940 Bacteria 3835
245 Ga0207691_10274416 3300025940 Bacteria 1451
246 Ga0207711_10033479 3300025941 Bacteria 4348
247 Ga0207689_10046436 3300025942 Bacteria 3589
248 Ga0207689_10093199 3300025942 Bacteria 2474
249 Ga0207689_10104918 3300025942 Bacteria 2322
250 Ga0207661_10000828 3300025944 Bacteria 20288
251 Ga0207667_10072942 3300025949 Bacteria 3568
252 Ga0207667_10087422 3300025949 Bacteria 3224
253 Ga0207667_10114421 3300025949 Bacteria 2781
254 Ga0207667_10119463 3300025949 Bacteria 2716
255 Ga0207667_10244025 3300025949 Bacteria 1838
256 Ga0207667_10271534 3300025949 Bacteria 1733
257 Ga0207712_10128647 3300025961 Bacteria 1927
258 Ga0207668_10104398 3300025972 Bacteria 2112
259 Ga0207668_10118457 3300025972 Bacteria 2000
260 Ga0207668_10366631 3300025972 Bacteria 1208
261 Ga0207677_10175196 3300026023 Bacteria 1682
262 Ga0207639_10007981 3300026041 Bacteria 7230
263 Ga0207639_10042056 3300026041 Bacteria 3423
264 Ga0207639_10346164 3300026041 Bacteria 1326
265 Ga0207678_10038686 3300026067 Bacteria 4143
266 Ga0207678_10065333 3300026067 Bacteria 3124
267 Ga0207678_10086765 3300026067 Bacteria 2674
268 Ga0207678_10174584 3300026067 Bacteria 1835
269 Ga0207678_10426764 3300026067 Bacteria 1150
270 Ga0207702_10000006 3300026078 Bacteria 346370
271 Ga0207702_10000063 3300026078 Bacteria 123034
272 Ga0207702_10063018 3300026078 Bacteria 3169
273 Ga0207702_10610005 3300026078 Bacteria 1071
274 Ga0207648_10285701 3300026089 Bacteria 1476
275 Ga0207676_10089134 3300026095 Bacteria 2527
276 Ga0207674_10048571 3300026116 Bacteria 4343
277 Ga0207674_10048718 3300026116 Bacteria 4336
278 Ga0207674_10130837 3300026116 Bacteria 2473
279 Ga0207675_100236199 3300026118 Bacteria 1765
280 Ga0207683_10121878 3300026121 Bacteria 2342
281 Ga0207683_10174513 3300026121 Bacteria 1947
282 Ga0207683_10308371 3300026121 Bacteria 1448
283 Ga0207683_10375902 3300026121 Bacteria 1306
284 Ga0207698_10045959 3300026142 Bacteria 3293
285 Ga0207698_10057730 3300026142 Bacteria 3004
286 Ga0207698_10420215 3300026142 Bacteria 1283
287 Ga0207698_10427495 3300026142 Bacteria 1273
288 Ga0209389_1000034 3300027296 Bacteria 127289
289 Ga0209389_1000039 3300027296 Bacteria 124545
290 Ga0209589_1000038 3300027357 Bacteria 127285
291 Ga0209489_100023 3300027361 Bacteria 198829
292 Ga0209489_100087 3300027361 Bacteria 124545
293 Ga0209700_100090 3300027363 Bacteria 124545
294 Ga0209588_1005208 3300027671 Bacteria 3711
295 Ga0268266_10034894 3300028379 Bacteria 4278
296 Ga0268266_10053634 3300028379 Bacteria 3464
297 Ga0268266_10163006 3300028379 Bacteria 2018
298 Ga0268266_10187728 3300028379 Bacteria 1886
299 Ga0268266_10497615 3300028379 Bacteria 1163
300 Ga0268265_10277711 3300028380 Bacteria 1497
301 Ga0268265_10461022 3300028380 Bacteria 1189
302 Ga0268264_10000537 3300028381 Bacteria 48029
303 Ga0268264_10066486 3300028381 Bacteria 3040
304 Ga0307517_10050575 3300028786 Bacteria 4220
305 Ga0307515_10046793 3300028794 Bacteria 6600
306 Ga0307515_10063600 3300028794 Bacteria 5178
307 Ga0265338_10063970 3300028800 Bacteria 3203
308 Ga0265763_1002954 3300030763 Bacteria 1326
309 Ga0265330_10072948 3300031235 Bacteria 1484
310 Ga0265340_10052128 3300031247 Bacteria 1979
311 Ga0265339_10000281 3300031249 Bacteria 41044
312 Ga0265339_10026845 3300031249 Bacteria 3294
313 Ga0307513_10139543 3300031456 Bacteria 2353
314 Ga0307509_10053131 3300031507 Bacteria 4322
315 Ga0307509_10106470 3300031507 Bacteria 2823
316 Ga0307508_10000012 3300031616 Bacteria 243167
317 Ga0307508_10033210 3300031616 Bacteria 4657
318 Ga0307508_10078988 3300031616 Bacteria 2871
319 Ga0307508_10210862 3300031616 Bacteria 1543
320 Ga0307508_10217175 3300031616 Bacteria 1512
321 Ga0265314_10011033 3300031711 Bacteria 7493
322 Ga0265314_10063614 3300031711 Bacteria 2502
323 Ga0265342_10014904 3300031712 Bacteria 5138
324 Ga0265342_10049510 3300031712 Bacteria 2514
325 Ga0307516_10014001 3300031730 Bacteria 8506
326 Ga0307516_10068943 3300031730 Bacteria 3403
327 Ga0307516_10290305 3300031730 Bacteria 1314
328 Ga0307405_10223239 3300031731 Bacteria 1384
329 Ga0307412_10029996 3300031911 Bacteria 3419
330 Ga0307411_10210904 3300032005 Bacteria 1500
331 Ga0307510_10022874 3300033180 Bacteria 7250
332 Ga0307510_10037361 3300033180 Bacteria 5388
333 Ga0373944_0021553 3300035089 Bacteria 1866
334 Ga0373944_0026026 3300035089 Bacteria 1726
335 Ga0373923_0065718 3300035111 Bacteria 1549
336 Ga0373936_0114188 3300035113 Bacteria 1149
337 Ga0373953_0001704 3300035117 Bacteria 6467
338 Ga0373953_0002691 3300035117 Bacteria 5390
339 Ga0373954_0007407 3300035118 Bacteria 4802
340 Ga0373954_0037173 3300035118 Bacteria 2262
341 Ga0373956_0012937 3300035119 Bacteria 3467
342 Ga0373957_0012302 3300035120 Bacteria 2878
343 Ga0373957_0013220 3300035120 Bacteria 2796
344 Ga0373943_0002235 3300035170 Bacteria 8797
345 Ga0373946_0126793 3300035171 Bacteria 1170
346 Ga0373955_0027684 3300035172 Bacteria 2933
347 Ga0373955_0154980 3300035172 Bacteria 1349
348 Ga0373924_0069573 3300035410 Bacteria 1483
349 Ga0373935_0003730 3300035692 Bacteria 8891
350 Ga0373935_0048374 3300035692 Bacteria 2692
351 Ga0373927_0001492 3300035695 Bacteria 17635
352 Ga0373927_0001793 3300035695 Bacteria 16018
353 Ga0373927_0033848 3300035695 Bacteria 3325
354 Ga0373927_0140989 3300035695 Bacteria 1577
355 Ga0373933_0000267 3300035724 Bacteria 34008
356 Ga0373947_0001861 3300035725 Bacteria 12857
357 Ga0373947_0133714 3300035725 Bacteria 1585
358 Ga0373937_0034261 3300036401 Bacteria 4618
359 Ga0373937_0051137 3300036401 Bacteria 3787
360 Ga0373937_0057297 3300036401 Bacteria 3579
361 Ga0372808_013234 3300036459 Bacteria 1175
362 Ga0373925_0013546 3300037068 Bacteria 5904
363 Ga0373925_0058364 3300037068 Bacteria 2894
364 Ga0373925_0114613 3300037068 Bacteria 2086
365 Ga0395900_0001496 3300037418 Bacteria 27775
366 Ga0395898_0019947 3300037466 Bacteria 6816
367 Ga0395898_0070389 3300037466 Bacteria 3382
368 Ga0395905_0004165 3300037471 Bacteria 15125
369 Ga0395905_0032236 3300037471 Bacteria 4928
370 Ga0395905_0083368 3300037471 Bacteria 2995
371 Ga0395905_0124402 3300037471 Bacteria 2425
372 Ga0395901_0064055 3300038443 Bacteria 3826
373 Ga0395901_0231437 3300038443 Bacteria 1929
374 Ga0436365_0344664 3300039437 Bacteria 1367
375 Ga0436365_0389593 3300039437 Bacteria 1415
376 Ga0436360_0441680 3300039438 Bacteria 2202
377 Ga0436360_0560055 3300039438 Bacteria 1418
378 Ga0436360_0600621 3300039438 Bacteria 4286
379 Ga0436361_0686082 3300039447 Bacteria 8872
380 Ga0436361_1065603 3300039447 Bacteria 2482
381 Ga0436363_0135082 3300039450 Bacteria 2969
382 Ga0436363_0460586 3300039450 Bacteria 3703
383 Ga0436362_1080726 3300039453 Bacteria 1041
384 Ga0466965_0022945 3300044683 Bacteria 3011
385 Ga0466966_0003788 3300044684 Bacteria 9975
386 Ga0466961_0000227 3300044693 Bacteria 38175
387 Ga0466961_0059356 3300044693 Bacteria 2433
388 Ga0466963_0018798 3300044694 Bacteria 4326
389 Ga0466970_0169879 3300044765 Bacteria 1208
390 Ga0466957_0148709 3300044842 Bacteria 1513
391 Ga0466960_0009796 3300044901 Bacteria 3961
392 Ga0466960_0041081 3300044901 Bacteria 2190
393 Ga0466960_0113129 3300044901 Bacteria 1413
394 Ga0466959_0000605 3300045049 Bacteria 20930
395 Ga0466959_0024944 3300045049 Bacteria 4429
396 Ga0466959_0061469 3300045049 Bacteria 2731
397 Ga0466959_0181687 3300045049 Bacteria 1471
398 Ga0466967_0157884 3300045976 Bacteria 2126
399 Ga0495617_013424 3300046452 Bacteria 2788
400 Ga0495592_0002227 3300046454 Bacteria 13684
401 Ga0495592_0041547 3300046454 Bacteria 3446
402 Ga0495592_0060638 3300046454 Bacteria 2782
403 Ga0495603_0000036 3300046455 Bacteria 57443
404 Ga0495603_0008447 3300046455 Bacteria 6220
405 Ga0495603_0015690 3300046455 Bacteria 4583
406 Ga0495629_0000148 3300046459 Bacteria 61440
407 Ga0495629_0000331 3300046459 Bacteria 40528
408 Ga0495629_0049085 3300046459 Bacteria 2959
409 Ga0495629_0242116 3300046459 Bacteria 1242
410 Ga0495638_0022001 3300046460 Bacteria 4191
411 Ga0495638_0032248 3300046460 Bacteria 3360
412 Ga0495638_0033836 3300046460 Bacteria 3265
413 Ga0495641_0008477 3300046461 Bacteria 6258
414 Ga0495641_0121183 3300046461 Bacteria 1167
415 Ga0495651_0015094 3300046462 Bacteria 5970
416 Ga0495651_0016761 3300046462 Bacteria 5675
417 Ga0495651_0032670 3300046462 Bacteria 4058
418 Ga0495653_0000697 3300046463 Bacteria 25621
419 Ga0495653_0033411 3300046463 Bacteria 4076
420 Ga0495653_0080356 3300046463 Bacteria 2412
421 Ga0495653_0228582 3300046463 Bacteria 1246
422 Ga0495580_0000705 3300046472 Bacteria 28569
423 Ga0495582_0002450 3300046473 Bacteria 10340
424 Ga0495639_0000135 3300046475 Bacteria 38122
425 Ga0495639_0004541 3300046475 Bacteria 5951
426 Ga0495639_0055478 3300046475 Bacteria 1807
427 Ga0495662_0000811 3300046476 Bacteria 15187
428 Ga0495664_0015540 3300046477 Bacteria 4328
429 Ga0495584_0137167 3300046491 Bacteria 1242
430 Ga0495585_0049604 3300046492 Bacteria 2330
431 Ga0495594_0001252 3300046499 Bacteria 13306
432 Ga0495594_0016885 3300046499 Bacteria 3851
433 Ga0495607_0035604 3300046501 Bacteria 3009
434 Ga0495606_0001350 3300046507 Bacteria 33317
435 Ga0495608_0038216 3300046511 Bacteria 3224
436 Ga0495608_0130635 3300046511 Bacteria 1607
437 Ga0495608_0139318 3300046511 Bacteria 1549
438 Ga0495608_0183184 3300046511 Bacteria 1324
439 Ga0495610_0039906 3300046512 Bacteria 2370
440 Ga0495616_0132872 3300046513 Bacteria 1139
441 Ga0495618_0081584 3300046514 Bacteria 2065
442 Ga0495618_0149881 3300046514 Bacteria 1490
443 Ga0495618_0184896 3300046514 Bacteria 1323
444 Ga0495620_0013412 3300046515 Bacteria 4195
445 Ga0495628_0028014 3300046516 Bacteria 4582
446 Ga0495628_0032806 3300046516 Bacteria 4189
447 Ga0495628_0037061 3300046516 Bacteria 3910
448 Ga0495628_0211900 3300046516 Bacteria 1457
449 Ga0495631_0070222 3300046518 Bacteria 1514
450 Ga0495643_0037685 3300046522 Bacteria 2650
451 Ga0495643_0121212 3300046522 Bacteria 1321
452 Ga0495648_0000310 3300046524 Bacteria 53884
453 Ga0495648_0004337 3300046524 Bacteria 12150
454 Ga0495648_0130331 3300046524 Bacteria 1338
455 Ga0495666_0118010 3300046526 Bacteria 1243
456 Ga0495652_0025648 3300046529 Bacteria 5210
457 Ga0495652_0033885 3300046529 Bacteria 4454
458 Ga0495652_0076325 3300046529 Bacteria 2780
459 Ga0495652_0103067 3300046529 Bacteria 2310
460 Ga0495652_0174301 3300046529 Bacteria 1657
461 Ga0495665_0000118 3300046531 Bacteria 37731
462 Ga0495640_0032839 3300046533 Bacteria 3693
463 Ga0495640_0045231 3300046533 Bacteria 3056
464 Ga0495640_0058195 3300046533 Bacteria 2636
465 Ga0495587_0021863 3300046536 Bacteria 3945
466 Ga0495587_0028742 3300046536 Bacteria 3379
467 Ga0495609_0026332 3300046538 Bacteria 2663
468 Ga0495597_0028026 3300046542 Bacteria 2580
469 Ga0495645_0018632 3300046543 Bacteria 4988
470 Ga0495645_0162202 3300046543 Bacteria 1545
471 Ga0495622_0002977 3300046557 Bacteria 8052
472 Ga0495667_0000379 3300046559 Bacteria 28161
473 Ga0495667_0092297 3300046559 Bacteria 1960
474 Ga0495667_0281418 3300046559 Bacteria 1056
475 Ga0495656_0021970 3300046615 Bacteria 2492
476 Ga0495634_0000969 3300046642 Bacteria 27075
477 Ga0495634_0015671 3300046642 Bacteria 5438
478 Ga0495634_0018562 3300046642 Bacteria 4949
479 Ga0495634_0044526 3300046642 Bacteria 3003
480 Ga0495625_0053068 3300046660 Bacteria 2901
481 Ga0495625_0283918 3300046660 Bacteria 1064
482 Ga0495635_0000434 3300046663 Bacteria 26421
483 Ga0495635_0025444 3300046663 Bacteria 4122
484 Ga0495635_0059745 3300046663 Bacteria 2621
485 Ga0495635_0059871 3300046663 Bacteria 2619
486 Ga0495661_0016991 3300046665 Bacteria 4808
487 Ga0495588_0063025 3300046674 Bacteria 1922
488 Ga0495588_0073316 3300046674 Bacteria 1782
489 Ga0495657_0005912 3300046675 Bacteria 9612
490 Ga0495657_0007977 3300046675 Bacteria 8117
491 Ga0495657_0022986 3300046675 Bacteria 4460
492 Ga0495599_0002117 3300046678 Bacteria 11526
493 Ga0495599_0062858 3300046678 Bacteria 2319
494 Ga0495599_0129549 3300046678 Bacteria 1567
495 Ga0495623_0022452 3300046679 Bacteria 4076
496 Ga0495623_0064649 3300046679 Bacteria 2289
497 Ga0495646_0014985 3300046680 Bacteria 4925
498 Ga0495646_0021600 3300046680 Bacteria 4066
499 Ga0495646_0027263 3300046680 Bacteria 3584
500 Ga0495646_0141558 3300046680 Bacteria 1344
501 Ga0495647_0000360 3300046681 Bacteria 12869
502 Ga0495658_0009177 3300046683 Bacteria 4918
503 Ga0495658_0020094 3300046683 Bacteria 3498
504 Ga0495658_0109479 3300046683 Bacteria 1659
505 Ga0495613_0030595 3300046689 Bacteria 3999
506 Ga0495613_0031204 3300046689 Bacteria 3957
507 Ga0495624_0000445 3300046690 Bacteria 32525
508 Ga0495624_0105050 3300046690 Bacteria 1738
509 Ga0495670_0041658 3300046691 Bacteria 2291
510 Ga0495671_0156236 3300046692 Bacteria 1110
511 Ga0495600_0003883 3300046809 Bacteria 8870
512 Ga0495600_0015470 3300046809 Bacteria 4822
513 Ga0495600_0227209 3300046809 Bacteria 1192
514 Ga0495581_0001178 3300047315 Bacteria 14344
515 Ga0495581_0039724 3300047315 Bacteria 2724
516 Ga0495581_0164853 3300047315 Bacteria 1296
517 Ga0495604_0012567 3300047317 Bacteria 6733
518 Ga0495604_0043465 3300047317 Bacteria 3517
519 Ga0495604_0100106 3300047317 Bacteria 2131
520 Ga0495604_0175565 3300047317 Bacteria 1503
521 Ga0495674_0000443 3300047319 Bacteria 37259
522 Ga0495674_0010317 3300047319 Bacteria 8845
523 Ga0495674_0036232 3300047319 Bacteria 4443
524 Ga0495674_0038574 3300047319 Bacteria 4287
525 Ga0495674_0106388 3300047319 Bacteria 2383
526 Ga0495674_0171479 3300047319 Bacteria 1810
527 Ga0495672_0005199 3300047320 Bacteria 10374
528 Ga0495672_0006462 3300047320 Bacteria 9068
529 Ga0495672_0081743 3300047320 Bacteria 1798
530 Ga0495676_0066520 3300047321 Bacteria 2792
531 Ga0495676_0144347 3300047321 Bacteria 1702
532 Ga0495680_0001308 3300047322 Bacteria 27152
533 Ga0495680_0042578 3300047322 Bacteria 3601
534 Ga0495680_0076152 3300047322 Bacteria 2544
535 Ga0495683_0074363 3300047323 Bacteria 1665
536 Ga0495687_046825 3300047443 Bacteria 1864
537 Ga0495675_0068237 3300047444 Bacteria 2246
538 Ga0495685_063973 3300047447 Bacteria 1238
539 Ga0495673_0013330 3300047469 Bacteria 4323
540 Ga0495684_0002730 3300047471 Bacteria 13961
541 Ga0495684_0054251 3300047471 Bacteria 3057
542 Ga0495684_0105859 3300047471 Bacteria 2125
543 Ga0495684_0127653 3300047471 Bacteria 1912
544 Ga0495686_0126470 3300047472 Bacteria 1519
545 Ga0495593_0000495 3300047673 Bacteria 22212
546 Ga0495593_0001203 3300047673 Bacteria 15131
547 Ga0495593_0022477 3300047673 Bacteria 3513
548 Ga0495593_0124049 3300047673 Bacteria 1313
549 Ga0495602_0028623 3300048088 Bacteria 5327
550 Ga0495602_0049654 3300048088 Bacteria 3755
551 Ga0495602_0055132 3300048088 Bacteria 3502
552 Ga0495602_0146601 3300048088 Bacteria 1861
553 Ga0496100_0011667 3300048903 Bacteria 5008
554 Ga0496101_0003579 3300048904 Bacteria 9698
555 Ga0496101_0052485 3300048904 Bacteria 2940
556 Ga0496101_0146965 3300048904 Bacteria 1801
557 Ga0496101_0183960 3300048904 Bacteria 1610
558 Ga0496102_0007923 3300048905 Bacteria 9080
559 Ga0496102_0139950 3300048905 Bacteria 2269
560 Ga0496103_0121183 3300048906 Bacteria 1666
561 Ga0496103_0161673 3300048906 Bacteria 1436
562 Ga0496104_0069177 3300048907 Bacteria 3355
563 Ga0496104_0168040 3300048907 Bacteria 2103
564 Ga0496104_0237482 3300048907 Bacteria 1734
565 Ga0496105_0016857 3300048908 Bacteria 5843
566 Ga0496105_0026827 3300048908 Bacteria 4701
567 Ga0496105_0258754 3300048908 Bacteria 1408
568 Ga0496105_0322725 3300048908 Bacteria 1237
569 Ga0496106_0043115 3300048909 Bacteria 3385
570 Ga0496106_0104052 3300048909 Bacteria 2204
571 Ga0496107_0033299 3300048910 Bacteria 3686
572 Ga0496107_0066411 3300048910 Bacteria 2615
573 Ga0496107_0096532 3300048910 Bacteria 2163
574 Ga0496107_0140661 3300048910 Bacteria 1784
575 Ga0496107_0230720 3300048910 Bacteria 1377
576 Ga0496108_0074802 3300048911 Bacteria 2861
577 Ga0496109_0017997 3300048912 Bacteria 6203
578 Ga0496109_0116893 3300048912 Bacteria 2482
579 Ga0496110_0067181 3300048913 Bacteria 3172
580 Ga0496112_0000029 3300048915 Bacteria 122291
581 Ga0496112_0042235 3300048915 Bacteria 4460
582 Ga0496112_0074363 3300048915 Bacteria 3359
583 Ga0496112_0173866 3300048915 Bacteria 2119
584 Ga0496112_0197092 3300048915 Bacteria 1974
585 Ga0496112_0218968 3300048915 Bacteria 1860
586 Ga0496112_0396022 3300048915 Bacteria 1321
587 Ga0496113_0061050 3300048916 Bacteria 2843
588 Ga0496113_0182878 3300048916 Bacteria 1662
589 Ga0496113_0207468 3300048916 Bacteria 1559
590 Ga0496114_0011325 3300048917 Bacteria 7124
591 Ga0496114_0056814 3300048917 Bacteria 3266
592 Ga0496115_0000295 3300048918 Bacteria 42998
593 Ga0496115_0018198 3300048918 Bacteria 5389
594 Ga0496115_0076474 3300048918 Bacteria 2721
595 Ga0496115_0079903 3300048918 Bacteria 2662
596 Ga0496115_0142236 3300048918 Bacteria 1979
597 Ga0496116_0002462 3300048919 Bacteria 19411
598 Ga0496116_0040127 3300048919 Bacteria 3227
599 Ga0496117_0086744 3300048920 Bacteria 2032
600 Ga0496117_0153103 3300048920 Bacteria 1362
601 Ga0496118_0015057 3300048921 Bacteria 7190
602 Ga0496118_0037848 3300048921 Bacteria 3875
603 Ga0496118_0093022 3300048921 Bacteria 2067
604 Ga0496118_0100783 3300048921 Bacteria 1952
605 Ga0496118_0101437 3300048921 Bacteria 1943
606 Ga0496118_0128456 3300048921 Bacteria 1633
607 Ga0496119_0007315 3300048922 Bacteria 9989
608 Ga0496120_0002476 3300048923 Bacteria 18594
609 Ga0496120_0018821 3300048923 Bacteria 4437
610 Ga0496120_0126979 3300048923 Bacteria 1311
611 Ga0496121_0001687 3300048924 Bacteria 36333
612 Ga0496121_0022584 3300048924 Bacteria 6095
613 Ga0496121_0024664 3300048924 Bacteria 5741
614 Ga0496121_0036588 3300048924 Bacteria 4372
615 Ga0496121_0041193 3300048924 Bacteria 4041
616 Ga0496121_0050936 3300048924 Bacteria 3492
617 Ga0496121_0055607 3300048924 Bacteria 3295
618 Ga0496121_0063679 3300048924 Bacteria 3011
619 Ga0496121_0155941 3300048924 Bacteria 1675
620 Ga0496121_0158418 3300048924 Bacteria 1658
621 Ga0496121_0292411 3300048924 Bacteria 1109
622 Ga0496124_0134256 3300048927 Bacteria 1962
623 Ga0496124_0165185 3300048927 Bacteria 1721
624 Ga0496124_0212595 3300048927 Bacteria 1462
625 Ga0496125_0000154 3300048928 Bacteria 152240
626 Ga0496125_0004393 3300048928 Bacteria 16325
627 Ga0496125_0056873 3300048928 Bacteria 3173
628 Ga0496125_0074537 3300048928 Bacteria 2631
629 Ga0496126_0005939 3300048929 Bacteria 13755
630 Ga0496126_0007864 3300048929 Bacteria 11610
631 Ga0496126_0007926 3300048929 Bacteria 11546
632 Ga0496126_0010008 3300048929 Bacteria 10006
633 Ga0496126_0032301 3300048929 Bacteria 4932
634 Ga0496126_0035603 3300048929 Bacteria 4664
635 Ga0496126_0038680 3300048929 Bacteria 4435
636 Ga0496126_0082697 3300048929 Bacteria 2836
637 Ga0496126_0093307 3300048929 Bacteria 2643
638 Ga0496126_0258306 3300048929 Bacteria 1449
639 Ga0496126_0285803 3300048929 Bacteria 1365
640 Ga0496126_0290432 3300048929 Bacteria 1352
641 Ga0496126_0292181 3300048929 Bacteria 1347
642 Ga0495682_0051142 3300049460 Bacteria 1503
643 Ga0501031_0003990 3300049568 Bacteria 9517
644 Ga0501032_0000073 3300049569 Bacteria 85584
645 Ga0501033_0000136 3300049570 Bacteria 70952
646 Ga0501034_0000251 3300049571 Bacteria 99406
647 Ga0501034_0116531 3300049571 Bacteria 2659
648 Ga0501036_0000036 3300049572 Bacteria 87244
649 Ga0501036_0202301 3300049572 Bacteria 1670
650 Ga0501037_0000040 3300049573 Bacteria 119364
651 Ga0501038_0000150 3300049574 Bacteria 59508
652 Ga0501038_0368549 3300049574 Bacteria 1116
653 Ga0501039_0003418 3300049575 Bacteria 11852
654 Ga0501040_0300295 3300049576 Bacteria 1148
655 Ga0501042_0008136 3300049578 Bacteria 6907
656 Ga0501043_0000464 3300049579 Bacteria 36232
657 Ga0501043_0191031 3300049579 Bacteria 1592
658 Ga0501046_0000398 3300049580 Bacteria 43497
659 Ga0501046_0223674 3300049580 Bacteria 1392
660 Ga0501047_0000656 3300049581 Bacteria 36126
661 Ga0501047_0294580 3300049581 Bacteria 1466
662 Ga0501048_0000906 3300049582 Bacteria 21866
663 Ga0501067_0000192 3300049583 Bacteria 34520
664 Ga0501067_0035211 3300049583 Bacteria 2780
665 Ga0501068_0002765 3300049584 Bacteria 9319
666 Ga0501069_0014897 3300049585 Bacteria 4163
667 Ga0501070_0037271 3300049586 Bacteria 4060
668 Ga0501070_0076207 3300049586 Bacteria 2776
669 Ga0501070_0179220 3300049586 Bacteria 1744
670 Ga0501070_0203936 3300049586 Bacteria 1624
671 Ga0501071_0053825 3300049587 Bacteria 2903
672 Ga0501072_0002128 3300049588 Bacteria 14764
673 Ga0501073_0000037 3300049589 Bacteria 87345
674 Ga0501074_0000133 3300049590 Bacteria 38342
675 Ga0501079_0024353 3300049741 Bacteria 4643
676 Ga0501080_0000054 3300049742 Bacteria 74316
677 Ga0501080_0005201 3300049742 Bacteria 11597
678 Ga0501083_0001153 3300049744 Bacteria 17779
679 Ga0501035_0000142 3300049822 Bacteria 87561
680 Ga0501035_0278135 3300049822 Bacteria 1415
681 Ga0501044_0000985 3300049823 Bacteria 34233
682 Ga0501044_0102936 3300049823 Bacteria 2870
683 Ga0501045_0019721 3300049824 Bacteria 4811
684 nmdc:mga03683_17647_c1 3300050489 Bacteria 2704
685 nmdc:mga00v17_20486_c1 3300050491 Bacteria 3789
686 nmdc:mga00v17_215349_c1 3300050491 Bacteria 1243
687 nmdc:mga0yw44_91521_c1 3300050492 Bacteria 1923
688 nmdc:mga0yw44_942_c1 3300050492 Bacteria 11041
689 nmdc:mga06z11_14027_c1 3300050494 Bacteria 3536
690 nmdc:mga06z11_30068_c1 3300050494 Bacteria 2625
691 nmdc:mga07m45_69423_c1 3300050496 Bacteria 1110
692 nmdc:mga07m45_6998_c1 3300050496 Bacteria 5738
693 nmdc:mga0n895_115792_c1 3300050512 Bacteria 2699
694 nmdc:mga0n895_30146_c1 3300050512 Bacteria 5181
695 nmdc:mga0sz30_9846_c1 3300050516 Bacteria 3646
696 Ga0495601_0013434 3300053077 Bacteria 4926
697 Ga0495601_0083775 3300053077 Bacteria 2048
698 Ga0495612_0062530 3300053078 Bacteria 1543
699 Ga0500610_0097521 3300053079 Bacteria 1524
700 Ga0500635_0044597 3300053080 Bacteria 1497
701 Ga0495595_0000758 3300053084 Bacteria 12258
702 Ga0495619_0000617 3300053085 Bacteria 23526
703 Ga0495619_0217529 3300053085 Bacteria 1323
704 Ga0500643_000168 3300053087 Bacteria 64858
705 Ga0500581_052116 3300053089 Bacteria 2085
706 Ga0500646_0035013 3300053090 Bacteria 1394
707 Ga0500583_0012288 3300053092 Bacteria 3260
708 Ga0500651_0026339 3300053093 Bacteria 3654
709 Ga0500651_0098104 3300053093 Bacteria 1799
710 Ga0500651_0127566 3300053093 Bacteria 1540
711 Ga0500566_0000822 3300053094 Bacteria 17706
712 Ga0500566_0003799 3300053094 Bacteria 9002
713 Ga0500566_0015378 3300053094 Bacteria 4489
714 Ga0500641_0016085 3300053096 Bacteria 2783
715 Ga0500641_0039404 3300053096 Bacteria 1903
716 Ga0500650_0006577 3300053098 Bacteria 4451
717 Ga0500555_003167 3300053103 Bacteria 4691
718 Ga0500556_0000047 3300053104 Bacteria 126199
719 Ga0500595_003841 3300053119 Bacteria 6904
720 Ga0500595_015941 3300053119 Bacteria 2808
721 Ga0500595_023858 3300053119 Bacteria 2143
722 Ga0500608_015167 3300053122 Bacteria 3456
723 Ga0500618_011635 3300053125 Bacteria 2328
724 Ga0500642_0000142 3300053130 Bacteria 32016
725 Ga0500642_0000183 3300053130 Bacteria 25867
726 Ga0500642_0030123 3300053130 Bacteria 2255
727 Ga0500652_001628 3300053131 Bacteria 6828
728 Ga0500559_0000105 3300053136 Bacteria 65809
729 Ga0500559_0001644 3300053136 Bacteria 12374
730 Ga0500559_0004871 3300053136 Bacteria 6261
731 Ga0500568_0010399 3300053139 Bacteria 4359
732 Ga0500568_0030179 3300053139 Bacteria 2245
733 Ga0500568_0031881 3300053139 Bacteria 2170
734 Ga0500577_0000991 3300053142 Bacteria 7308
735 Ga0500603_000576 3300053150 Bacteria 9221
736 Ga0500603_051801 3300053150 Bacteria 1126
737 Ga0500604_0002170 3300053151 Bacteria 5398
738 Ga0500604_0008009 3300053151 Bacteria 2803
739 Ga0500616_0000038 3300053153 Bacteria 386801
740 Ga0500616_0000784 3300053153 Bacteria 36530
741 Ga0500619_025645 3300053154 Bacteria 1748
742 Ga0500622_0002394 3300053156 Bacteria 13562
743 Ga0500622_0008137 3300053156 Bacteria 5893
744 Ga0500627_0022514 3300053158 Bacteria 2557
745 Ga0500627_0098195 3300053158 Bacteria 1313
746 Ga0500638_000230 3300053162 Bacteria 11941
747 Ga0500636_0000592 3300053177 Bacteria 19795
748 Ga0500636_0003094 3300053177 Bacteria 9326
749 Ga0500636_0009727 3300053177 Bacteria 5600
750 Ga0500636_0054374 3300053177 Bacteria 2347
751 Ga0500636_0082718 3300053177 Bacteria 1847
752 Ga0500636_0104233 3300053177 Bacteria 1609
753 Ga0500637_0001711 3300053178 Bacteria 9461
754 Ga0500637_0003917 3300053178 Bacteria 6950
755 Ga0500625_000232 3300053729 Bacteria 12898
756 Ga0500645_007739 3300053730 Bacteria 3717
757 Ga0500609_009508 3300053731 Bacteria 1310
758 Ga0500596_003778 3300053735 Bacteria 2840
759 Ga0500596_003966 3300053735 Bacteria 2756
760 Ga0500599_000651 3300053736 Bacteria 3722
761 Ga0500601_000888 3300053737 Bacteria 3585
762 Ga0501084_0008150 3300054114 Bacteria 8638
763 Ga0500661_000294 3300055283 Bacteria 9104
764 Ga0501082_0005663 3300060353 Bacteria 10842
765 Ga0530510_0214055 3300061734 Bacteria 1432
766 2507505934 2507262055 Bacteria 8048963
767 2508540123 2508501009 Bacteria 7784016
768 2509148121 2508501128 Bacteria 8613869
769 2511396578 2511231028 Bacteria 8046582
770 2513627430 2513237092 Bacteria 8341956
771 2513638320 2513237094 Bacteria 8789602
772 2513649162 2513237095 Bacteria 8976980
773 2513657473 2513237096 Bacteria 8722461
774 2513674951 2513237098 Bacteria 9902361
775 2513696278 2513237101 Bacteria 7952346
776 2513700225 2513237102 Bacteria 7703324
777 2513861199 2513237137 Bacteria 9558895
778 2513877237 2513237139 Bacteria 8737671
779 2513891600 2513237141 Bacteria 8496279
780 2513916726 2513237145 Bacteria 8979722
781 2514014607 2513237161 Bacteria 8871253
782 2515628524 2515154112 Bacteria 8294334
783 2517103119 2517093001 Bacteria 9002274
784 2517889633 2517572143 Bacteria 9484767
785 2524442995 2524023205 Bacteria 8918781
786 2524465267 2524023210 Bacteria 9029266
787 2524533197 2524023228 Bacteria 10118060
788 2528850701 2528768022 Bacteria 10457665
789 2603857125 2602042107 Bacteria 6226103
790 2617347816 2617270735 Bacteria 9163226
791 2617374738 2617270741 Bacteria 8201522
792 2644290486 2643221651 Bacteria 4798932
793 2671119485 2667528175 Bacteria 7532676
794 2723842287 2721755755 Bacteria 8322773
795 2745081916 2744054633 Bacteria 8678936
796 2793061530 2791355196 Bacteria 7323613
797 2793070386 2791355197 Bacteria 8420563
798 2793080141
799 2805916163 2802429603 Bacteria 8777136
800 2818240553 2816332527 Bacteria 8933356
801 2824603628 2824600985 Bacteria 8488197
802 2824610786 2824609381 Bacteria 8672835
803 2824623208 2824617872 Bacteria 8814715
804 2824632194 2824626560 Bacteria 8813858
805 2824640813 2824635225 Bacteria 8785348
806 2824647965 2824644064 Bacteria 8743947
807 2824655232 2824653114 Bacteria 8493680
808 2824667356 2824661429 Bacteria 9877870
809 2824675049 2824671348 Bacteria 8369588
810 2824684446 2824679649 Bacteria 8248951
811 2824691784 2824687955 Bacteria 8360029
812 2824701063 2824696289 Bacteria 8335049
813 2824709281 2824704595 Bacteria 9667483
814 2824717978 2824714736 Bacteria 8717648
815 2824728194 2824723954 Bacteria 8758240
816 2824737037 2824732956 Bacteria 7810675
817 2824750817 2824746037 Bacteria 7911610
818 2824762003 2824753945 Bacteria 9787441
819 2824772370 2824763712 Bacteria 9792355
820 2824775702 2824773399 Bacteria 8360218
821 2838125077 2838122688 Bacteria 8803140
822 2841945815 2841941048 Bacteria 8688029
823 2841956914 2841949485 Bacteria 8680857
824 2841963963 2841957949 Bacteria 8652217
825 2841973525 2841966195 Bacteria 8673214
826 2841981996 2841974524 Bacteria 8931498
827 2841989413 2841983080 Bacteria 8395090
828 2842044401 2842038055 Bacteria 8002051
829 2842051610 2842045827 Bacteria 8006841
830 2844316264 2844315083 Bacteria 8138177
831 2847939424 2847930680 Bacteria 9342022
832 2847941185 2847939898 Bacteria 8606328
833 2849082171 2849076700 Bacteria 7039503
834 2857513353 2857509624 Bacteria 7472071
835 2857530870 2857524615 Bacteria 6615449
836 2874596330 2874590934 Bacteria 8299676
837 2874610124 2874604998 Bacteria 7834745
838 2874616469 2874612657 Bacteria 8252029
839 2874622488 2874620515 Bacteria 8290088
840 2874633394 2874628541 Bacteria 8630250
841 2874650317 2874645413 Bacteria 8214782
842 2876761654 2876761206 Bacteria 10111113
843 2876776795 2876771140 Bacteria 8287509
844 2876824585 2876818435 Bacteria 8274608
845 2879080932 2879074833 Bacteria 8279565
846 2879087096 2879083081 Bacteria 8587928
847 2879104427 2879099564 Bacteria 10442239
848 2879116991 2879110137 Bacteria 8907982
849 2879133777 2879127579 Bacteria 8294491
850 2879148279 2879142872 Bacteria 8267021
851 2881369588 2881364244 Bacteria 7710352
852 2881669694 2881665667 Bacteria 8175609
853 2885367766 2885366525 Bacteria 8326213
854 2885380886 2885374607 Bacteria 8927485
855 2885418886 2885409591 Bacteria 9235467
856 2888387230 2888378607 Bacteria 9652610
857 2888389921 2888388044 Bacteria 7304136
858 2888421180 2888419890 Bacteria 7857137
859 2889036410 2889033259 Bacteria 9099371
860 2893066373 2893066018 Bacteria 6158120
861 2903728400 2903727486 Bacteria 8281579
862 2903756086 2903748898 Bacteria 9972761
863 2903774682 2903768456 Bacteria 9749579
864 2904671505 2904666416 Bacteria 8226587
865 2904692069 2904690495 Bacteria 9412302
866 2904707611
867 2904719805 2904711408 Bacteria 9771557
868 2906606541 2906602504 Bacteria 8295279
869 2906614611
870 2906631421 2906626472 Bacteria 8826946
871 2906641980 2906635258 Bacteria 8601019
872 2906650657 2906643746 Bacteria 8722424
873 2906660934 2906660503 Bacteria 8595048
874 2908746567 2908739725 Bacteria 8628932
875 2908757349 2908756301 Bacteria 8864324
876 2908777220 2908775508 Bacteria 8092255
877 2922366714 2922361189 Bacteria 7436256
878 2922377409
879 2922389382 2922386360 Bacteria 7017218
880 2922398498 2922393267 Bacteria 8285685
881 2922426472
882 2929622197 2929615660 Bacteria 9193770
883 2929630156 2929624759 Bacteria 9339455
884 2932787915 2932784394 Bacteria 9704911
885 2932796038 2932794094 Bacteria 7915132
886 2932807615 2932801729 Bacteria 7987968
887 2932817641 2932809354 Bacteria 9135765
888 2932826199 2932818245 Bacteria 9955613
889 2932835057 2932828146 Bacteria 9745859
890 2933584188 2933577622 Bacteria 9116884
891 2935614359 2935608549 Bacteria 8203142
892 2935620434 2935616580 Bacteria 9032984
893 2935632813 2935630451 Bacteria 8169952
894 2935640757 2935638405 Bacteria 10015038
895 2935649388 2935648319 Bacteria 8801166
896 2935657840 2935656913 Bacteria 8965014
897 2935670260 2935665750 Bacteria 9571747
898 2935679689 2935675223 Bacteria 9928132
899 2935687258 2935684952 Bacteria 9590419
900 2935696771 2935694250 Bacteria 9291695
901 2935709137 2935703347 Bacteria 10242284
902 2935718717 2935713505 Bacteria 9608509
903 2935728369 2935722832 Bacteria 9608746
904 2935737034 2935732158 Bacteria 9706831
905 2935745963 2935741537 Bacteria 9707219
906 2935753224 2935750917 Bacteria 9590372
907 2935766384 2935760218 Bacteria 9817913
908 2935770223 2935769743 Bacteria 7878163
909 2935777748 2935777560 Bacteria 8077691
910 2935786724 2935785616 Bacteria 7962367
911 2935794778 2935793552 Bacteria 8012592
912 2935809064 2935801545 Bacteria 9301974
913 2935813755 2935810662 Bacteria 9401221
914 2935826577 2935819856 Bacteria 8261050
915 2935832264 2935827899 Bacteria 10038562
916 2935843969 2935837841 Bacteria 9454360
917 2935851129 2935847175 Bacteria 8228321
918 2935862760 2935855204 Bacteria 9035059
919 2935864503 2935864058 Bacteria 9784707
920 2935875145 2935873716 Bacteria 9632195
921 2935887307 2935883170 Bacteria 7964738
922 2935913179 2935908558 Bacteria 8568796
923 2935922601 2935916978 Bacteria 9113783
924 2935930896 2935926038 Bacteria 8601059
925 2935939770 2935934488 Bacteria 8602579
926 2935946719 2935942939 Bacteria 8599779
927 2935956080 2935951376 Bacteria 8602333
928 2935964984 2935959822 Bacteria 7869783
929 2935972873 2935967501 Bacteria 8603075
930 2935978212 2935975950 Bacteria 8347125
931 2935985664 2935984226 Bacteria 8302647
932 2935999236 2935992306 Bacteria 9802711
933 2936005791 2936002035 Bacteria 9362176
934 2936012059 2936011229 Bacteria 8801034
935 2936020860 2936019824 Bacteria 8804134
936 2936029352 2936028420 Bacteria 8965941
937 2936039311 2936037263 Bacteria 9446081
938 2936048324 2936046547 Bacteria 8903709
939 2940559137 2940556831 Bacteria 9590747
940 2941508523 2941507105 Bacteria 8166816
941 2941516353 2941515067 Bacteria 8166720
942 2941524631 2941523033 Bacteria 8169134
943 2941534578 2941531003 Bacteria 7653939
944 2941541832 2941538514 Bacteria 9402094
945 3005475814 3005474847 Bacteria 9259049
946 3005491082 3005483717 Bacteria 7877331
947 3005510923 3005506211 Bacteria 6943378
948 3005592162 3005587118 Bacteria 7794411
949 3005595877 3005594810 Bacteria 8716512
950 3005711819 3005710791 Bacteria 7622528
951 3005719073 3005718088 Bacteria 8283608
952 8006930187 8006926726 Bacteria 6749210
953 8006966308 8006964411 Bacteria 8966052
954 8006993122 8006984368 Bacteria 9651211
955 8006996975 8006994254 Bacteria 8309700
956 8016517250 8016511872 Bacteria 9921665
957 8016526987 8016522445 Bacteria 8156687
958 8016532066 8016530956 Bacteria 8155261
959 8016545277 8016539877 Bacteria 8155419
960 8016556811 8016548790 Bacteria 8155074
961 8016570356 8016566248 Bacteria 8158151
962 8016582902 8016575299 Bacteria 8154085
963 8016585395 8016583857 Bacteria 10421953
964 8016602810 8016595262 Bacteria 8149947
965 8016605674 8016603502 Bacteria 8731218
966 8016617585 8016613128 Bacteria 8794220
967 8016623986 8016622563 Bacteria 7999408
968 8016634874 8016630954 Bacteria 9217207
969 8017059343 8017057580 Bacteria 10023680
970 8019539645 8019538911 Bacteria 7872763
971 8019551008 8019547302 Bacteria 7996444
972 8019571604 8019565922 Bacteria 9639779
973 8019576282 8019576017 Bacteria 10049540
974 8019594156 8019586578 Bacteria 10212056
975 8019607407 8019597564 Bacteria 10041141
976 8019611105 8019608314 Bacteria 10042931
977 8019631370 8019629233 Bacteria 8687553
978 8019639246 8019638758 Bacteria 9062356
979 8019651393 8019648815 Bacteria 10014479
980 8019668175 8019659431 Bacteria 8577854
981 8019677637 8019668869 Bacteria 8791617
982 8019687308 8019678201 Bacteria 8863603
983 8055743553 8055742211 Bacteria 9226248
984 8056678162 8056673599 Bacteria 7871253
985 8056683411 8056681323 Bacteria 8472857
986 8056974152 8056967851 Bacteria 9038162
987 Ga0500645_024708
988 JGI24740J21852_10005937
989 JGI25406J46586_10000012
990 JGI25406J46586_10038146
991 JGI25153J46596_10008046
992 JGI25153J46596_10019332
993 JGI25160J50197_1005561
994 JGI25160J50197_1007198
995 JGI25160J50197_1015110
996 JGI25404J52841_10006703
997 JGI25404J52841_10010612
998 Ga0055539_1002997
999 Ga0055543_1005993
1000 Ga0065165_1000982
1001 Ga0065165_1007672
1002 Ga0065165_1008445
1003 Ga0070670_100068271
1004 Ga0068869_100023869
1005 Ga0070680_100016577
1006 Ga0070680_100064099
1007 Ga0070680_100367073
1008 Ga0068868_100071269
1009 Ga0070660_100238356
1010 Ga0070660_100280343
1011 Ga0070661_100310121
1012 Ga0070668_100041152
1013 Ga0070668_100087155
1014 Ga0070668_100137630
1015 Ga0070671_100044664
1016 Ga0070674_100096396
1017 Ga0070688_100166279
1018 Ga0070709_10002283
1019 Ga0070714_100022105
1020 Ga0070714_100039738
1021 Ga0070713_100022749
1022 Ga0070713_100060987
1023 Ga0070713_100129624
1024 Ga0070713_100162662
1025 Ga0070710_10018697
1026 Ga0070708_100387090
1027 Ga0070663_100028428
1028 Ga0070663_100169745
1029 Ga0070678_100178156
1030 Ga0070678_100279634
1031 Ga0070662_100185930
1032 Ga0070662_100367923
1033 Ga0070681_10187131
1034 Ga0070681_10419787
1035 Ga0070706_100133515
1036 Ga0070707_100054763
1037 Ga0070707_100433063
1038 Ga0070698_100047957
1039 Ga0070679_100270231
1040 Ga0070684_100065197
1041 Ga0070684_100115278
1042 Ga0070684_100213839
1043 Ga0068853_100032830
1044 Ga0068853_100040910
1045 Ga0068853_100109745
1046 Ga0070672_100185134
1047 Ga0070686_100183444
1048 Ga0070665_100012864
1049 Ga0070665_100058353
1050 Ga0068855_100080478
1051 Ga0068855_100117639
1052 Ga0068855_100154127
1053 Ga0068855_100218105
1054 Ga0068855_100358675
1055 Ga0068857_100023618
1056 Ga0068854_100072638
1057 Ga0068856_100000137
1058 Ga0068856_100063543
1059 Ga0068856_100118565
1060 Ga0068856_100540575
1061 Ga0068852_100006606
1062 Ga0068852_100010212
1063 Ga0068852_100448392
1064 Ga0068851_10003838
1065 Ga0068851_10061017
1066 Ga0068860_100000837
1067 Ga0068860_100274052
1068 Ga0068860_100468621
1069 Ga0068862_100137583
1070 Ga0068862_100249676
1071 Ga0068862_100315305
1072 Ga0081455_10008940
1073 Ga0081455_10011276
1074 Ga0081455_10013423
1075 Ga0081455_10032605
1076 Ga0081538_10037995
1077 Ga0081540_1002034
1078 Ga0081540_1007800
1079 Ga0081540_1008423
1080 Ga0081540_1012078
1081 Ga0081540_1020975
1082 Ga0081540_1023647
1083 Ga0081540_1051055
1084 Ga0081540_1065713
1085 Ga0081540_1068142
1086 Ga0081539_10000040
1087 Ga0081539_10000157
1088 Ga0081539_10006006
1089 Ga0081539_10063904
1090 Ga0081539_10105346
1091 Ga0070717_10017655
1092 Ga0075365_10043977
1093 Ga0075365_10110776
1094 Ga0075368_10016127
1095 Ga0075363_100115619
1096 Ga0075363_100125154
1097 Ga0070716_100014843
1098 Ga0070716_100021483
1099 Ga0070716_100114369
1100 Ga0070712_100152298
1101 Ga0075367_10061551
1102 Ga0075367_10121060
1103 Ga0075369_10010149
1104 Ga0075369_10132724
1105 Ga0075366_10023825
1106 Ga0099794_10005590
1107 Ga0105240_10012243
1108 Ga0105240_10015437
1109 Ga0105240_10069358
1110 Ga0105240_10135717
1111 Ga0111539_10347138
1112 Ga0111539_10351823
1113 Ga0105245_10148468
1114 Ga0105243_10224948
1115 Ga0105241_10001280
1116 Ga0105241_10043926
1117 Ga0105241_10070526
1118 Ga0105241_10081915
1119 Ga0105248_10036476
1120 Ga0105248_10497588
1121 Ga0105237_10044776
1122 Ga0105237_10140850
1123 Ga0105238_10044002
1124 Ga0105238_10079710
1125 Ga0099796_10019249
1126 Ga0105239_10054114
1127 Ga0105239_10187359
1128 Ga0105239_10211117
1129 Ga0105239_10267778
1130 Ga0105246_10111990
1131 Ga0157370_10040880
1132 Ga0157370_10532625
1133 Ga0157369_10151451
1134 Ga0157374_10134006
1135 Ga0157378_10074226
1136 Ga0157378_10078348
1137 Ga0157378_10544548
1138 Ga0163162_10654083
1139 Ga0157372_10100045
1140 Ga0157375_10055890
1141 Ga0157375_10190888
1142 Ga0163163_10150156
1143 Ga0163163_10222436
1144 Ga0163163_10268407
1145 Ga0157376_10022471
1146 Ga0157376_10240448
1147 Ga0214544_1000011
1148 Ga0214542_1000009
1149 Ga0214545_1000007
1150 Ga0214543_1000020
1151 Ga0213871_10033779
1152 Ga0209677_102183
1153 Ga0209148_1000321
1154 Ga0209233_1004336
1155 Ga0209233_1008907
1156 Ga0209455_1000807
1157 Ga0209455_1023034
1158 Ga0209564_1000477
1159 Ga0209758_1000206
1160 Ga0209758_1000536
1161 Ga0209758_1001539
1162 Ga0209758_1001550
1163 Ga0209758_1002309
1164 Ga0209758_1004564
1165 Ga0209256_1011364
1166 Ga0207426_1000773
1167 Ga0207426_1000990
1168 Ga0207426_1003444
1169 Ga0209051_1048370
1170 Ga0209257_1000394
1171 Ga0209257_1011695
1172 Ga0209257_1034598
1173 Ga0207656_10005846
1174 Ga0207692_10000138
1175 Ga0207692_10008172
1176 Ga0207692_10010497
1177 Ga0207710_10035205
1178 Ga0207647_10005671
1179 Ga0207699_10000122
1180 Ga0207699_10003146
1181 Ga0207699_10221479
1182 Ga0207643_10008642
1183 Ga0207705_10124422
1184 Ga0207684_10037662
1185 Ga0207654_10000153
1186 Ga0207654_10039326
1187 Ga0207654_10048569
1188 Ga0207707_10002207
1189 Ga0207695_10000006
1190 Ga0207695_10000506
1191 Ga0207695_10051564
1192 Ga0207695_10402539
1193 Ga0207671_10021063
1194 Ga0207671_10110521
1195 Ga0207671_10313295
1196 Ga0207693_10004906
1197 Ga0207693_10009351
1198 Ga0207693_10068086
1199 Ga0207663_10000161
1200 Ga0207663_10000623
1201 Ga0207663_10209013
1202 Ga0207660_10227703
1203 Ga0207660_10243940
1204 Ga0207662_10099985
1205 Ga0207657_10033356
1206 Ga0207657_10242711
1207 Ga0207652_10047975
1208 Ga0207652_10373220
1209 Ga0207646_10050177
1210 Ga0207681_10275586
1211 Ga0207694_10003910
1212 Ga0207694_10034184
1213 Ga0207694_10038204
1214 Ga0207694_10081906
1215 Ga0207694_10219491
1216 Ga0207687_10009895
1217 Ga0207687_10029818
1218 Ga0207687_10274318
1219 Ga0207700_10045317
1220 Ga0207700_10053147
1221 Ga0207700_10057556
1222 Ga0207664_10021734
1223 Ga0207664_10120275
1224 Ga0207706_10065562
1225 Ga0207706_10312768
1226 Ga0207669_10029132
1227 Ga0207665_10000183
1228 Ga0207665_10171674
1229 Ga0207665_10175312
1230 Ga0207691_10049861
1231 Ga0207691_10274416
1232 Ga0207711_10033479
1233 Ga0207689_10046436
1234 Ga0207689_10093199
1235 Ga0207689_10104918
1236 Ga0207661_10000828
1237 Ga0207667_10072942
1238 Ga0207667_10087422
1239 Ga0207667_10114421
1240 Ga0207667_10119463
1241 Ga0207667_10244025
1242 Ga0207667_10271534
1243 Ga0207712_10128647
1244 Ga0207668_10104398
1245 Ga0207668_10118457
1246 Ga0207668_10366631
1247 Ga0207677_10175196
1248 Ga0207639_10007981
1249 Ga0207639_10042056
1250 Ga0207639_10346164
1251 Ga0207678_10038686
1252 Ga0207678_10065333
1253 Ga0207678_10086765
1254 Ga0207678_10174584
1255 Ga0207678_10426764
1256 Ga0207702_10000006
1257 Ga0207702_10000063
1258 Ga0207702_10063018
1259 Ga0207702_10610005
1260 Ga0207648_10285701
1261 Ga0207676_10089134
1262 Ga0207674_10048571
1263 Ga0207674_10048718
1264 Ga0207674_10130837
1265 Ga0207675_100236199
1266 Ga0207683_10121878
1267 Ga0207683_10174513
1268 Ga0207683_10308371
1269 Ga0207683_10375902
1270 Ga0207698_10045959
1271 Ga0207698_10057730
1272 Ga0207698_10420215
1273 Ga0207698_10427495
1274 Ga0209389_1000034
1275 Ga0209389_1000039
1276 Ga0209589_1000038
1277 Ga0209489_100023
1278 Ga0209489_100087
1279 Ga0209700_100090
1280 Ga0209588_1005208
1281 Ga0268266_10034894
1282 Ga0268266_10053634
1283 Ga0268266_10163006
1284 Ga0268266_10187728
1285 Ga0268266_10497615
1286 Ga0268265_10277711
1287 Ga0268265_10461022
1288 Ga0268264_10000537
1289 Ga0268264_10066486
1290 Ga0307517_10050575
1291 Ga0307515_10046793
1292 Ga0307515_10063600
1293 Ga0265338_10063970
1294 Ga0265763_1002954
1295 Ga0265330_10072948
1296 Ga0265340_10052128
1297 Ga0265339_10000281
1298 Ga0265339_10026845
1299 Ga0307513_10139543
1300 Ga0307509_10053131
1301 Ga0307509_10106470
1302 Ga0307508_10000012
1303 Ga0307508_10033210
1304 Ga0307508_10078988
1305 Ga0307508_10210862
1306 Ga0307508_10217175
1307 Ga0265314_10011033
1308 Ga0265314_10063614
1309 Ga0265342_10014904
1310 Ga0265342_10049510
1311 Ga0307516_10014001
1312 Ga0307516_10068943
1313 Ga0307516_10290305
1314 Ga0307405_10223239
1315 Ga0307412_10029996
1316 Ga0307411_10210904
1317 Ga0307510_10022874
1318 Ga0307510_10037361
1319 Ga0373944_0021553
1320 Ga0373944_0026026
1321 Ga0373923_0065718
1322 Ga0373936_0114188
1323 Ga0373953_0001704
1324 Ga0373953_0002691
1325 Ga0373954_0007407
1326 Ga0373954_0037173
1327 Ga0373956_0012937
1328 Ga0373957_0012302
1329 Ga0373957_0013220
1330 Ga0373943_0002235
1331 Ga0373946_0126793
1332 Ga0373955_0027684
1333 Ga0373955_0154980
1334 Ga0373924_0069573
1335 Ga0373935_0003730
1336 Ga0373935_0048374
1337 Ga0373927_0001492
1338 Ga0373927_0001793
1339 Ga0373927_0033848
1340 Ga0373927_0140989
1341 Ga0373933_0000267
1342 Ga0373947_0001861
1343 Ga0373947_0133714
1344 Ga0373937_0034261
1345 Ga0373937_0051137
1346 Ga0373937_0057297
1347 Ga0372808_013234
1348 Ga0373925_0013546
1349 Ga0373925_0058364
1350 Ga0373925_0114613
1351 Ga0395900_0001496
1352 Ga0395898_0019947
1353 Ga0395898_0070389
1354 Ga0395905_0004165
1355 Ga0395905_0032236
1356 Ga0395905_0083368
1357 Ga0395905_0124402
1358 Ga0395901_0064055
1359 Ga0395901_0231437
1360 Ga0436365_0344664
1361 Ga0436365_0389593
1362 Ga0436360_0441680
1363 Ga0436360_0560055
1364 Ga0436360_0600621
1365 Ga0436361_0686082
1366 Ga0436361_1065603
1367 Ga0436363_0135082
1368 Ga0436363_0460586
1369 Ga0436362_1080726
1370 Ga0466965_0022945
1371 Ga0466966_0003788
1372 Ga0466961_0000227
1373 Ga0466961_0059356
1374 Ga0466963_0018798
1375 Ga0466970_0169879
1376 Ga0466957_0148709
1377 Ga0466960_0009796
1378 Ga0466960_0041081
1379 Ga0466960_0113129
1380 Ga0466959_0000605
1381 Ga0466959_0024944
1382 Ga0466959_0061469
1383 Ga0466959_0181687
1384 Ga0466967_0157884
1385 Ga0495617_013424
1386 Ga0495592_0002227
1387 Ga0495592_0041547
1388 Ga0495592_0060638
1389 Ga0495603_0000036
1390 Ga0495603_0008447
1391 Ga0495603_0015690
1392 Ga0495629_0000148
1393 Ga0495629_0000331
1394 Ga0495629_0049085
1395 Ga0495629_0242116
1396 Ga0495638_0022001
1397 Ga0495638_0032248
1398 Ga0495638_0033836
1399 Ga0495641_0008477
1400 Ga0495641_0121183
1401 Ga0495651_0015094
1402 Ga0495651_0016761
1403 Ga0495651_0032670
1404 Ga0495653_0000697
1405 Ga0495653_0033411
1406 Ga0495653_0080356
1407 Ga0495653_0228582
1408 Ga0495580_0000705
1409 Ga0495582_0002450
1410 Ga0495639_0000135
1411 Ga0495639_0004541
1412 Ga0495639_0055478
1413 Ga0495662_0000811
1414 Ga0495664_0015540
1415 Ga0495584_0137167
1416 Ga0495585_0049604
1417 Ga0495594_0001252
1418 Ga0495594_0016885
1419 Ga0495607_0035604
1420 Ga0495606_0001350
1421 Ga0495608_0038216
1422 Ga0495608_0130635
1423 Ga0495608_0139318
1424 Ga0495608_0183184
1425 Ga0495610_0039906
1426 Ga0495616_0132872
1427 Ga0495618_0081584
1428 Ga0495618_0149881
1429 Ga0495618_0184896
1430 Ga0495620_0013412
1431 Ga0495628_0028014
1432 Ga0495628_0032806
1433 Ga0495628_0037061
1434 Ga0495628_0211900
1435 Ga0495631_0070222
1436 Ga0495643_0037685
1437 Ga0495643_0121212
1438 Ga0495648_0000310
1439 Ga0495648_0004337
1440 Ga0495648_0130331
1441 Ga0495666_0118010
1442 Ga0495652_0025648
1443 Ga0495652_0033885
1444 Ga0495652_0076325
1445 Ga0495652_0103067
1446 Ga0495652_0174301
1447 Ga0495665_0000118
1448 Ga0495640_0032839
1449 Ga0495640_0045231
1450 Ga0495640_0058195
1451 Ga0495587_0021863
1452 Ga0495587_0028742
1453 Ga0495609_0026332
1454 Ga0495597_0028026
1455 Ga0495645_0018632
1456 Ga0495645_0162202
1457 Ga0495622_0002977
1458 Ga0495667_0000379
1459 Ga0495667_0092297
1460 Ga0495667_0281418
1461 Ga0495656_0021970
1462 Ga0495634_0000969
1463 Ga0495634_0015671
1464 Ga0495634_0018562
1465 Ga0495634_0044526
1466 Ga0495625_0053068
1467 Ga0495625_0283918
1468 Ga0495635_0000434
1469 Ga0495635_0025444
1470 Ga0495635_0059745
1471 Ga0495635_0059871
1472 Ga0495661_0016991
1473 Ga0495588_0063025
1474 Ga0495588_0073316
1475 Ga0495657_0005912
1476 Ga0495657_0007977
1477 Ga0495657_0022986
1478 Ga0495599_0002117
1479 Ga0495599_0062858
1480 Ga0495599_0129549
1481 Ga0495623_0022452
1482 Ga0495623_0064649
1483 Ga0495646_0014985
1484 Ga0495646_0021600
1485 Ga0495646_0027263
1486 Ga0495646_0141558
1487 Ga0495647_0000360
1488 Ga0495658_0009177
1489 Ga0495658_0020094
1490 Ga0495658_0109479
1491 Ga0495613_0030595
1492 Ga0495613_0031204
1493 Ga0495624_0000445
1494 Ga0495624_0105050
1495 Ga0495670_0041658
1496 Ga0495671_0156236
1497 Ga0495600_0003883
1498 Ga0495600_0015470
1499 Ga0495600_0227209
1500 Ga0495581_0001178
1501 Ga0495581_0039724
1502 Ga0495581_0164853
1503 Ga0495604_0012567
1504 Ga0495604_0043465
1505 Ga0495604_0100106
1506 Ga0495604_0175565
1507 Ga0495674_0000443
1508 Ga0495674_0010317
1509 Ga0495674_0036232
1510 Ga0495674_0038574
1511 Ga0495674_0106388
1512 Ga0495674_0171479
1513 Ga0495672_0005199
1514 Ga0495672_0006462
1515 Ga0495672_0081743
1516 Ga0495676_0066520
1517 Ga0495676_0144347
1518 Ga0495680_0001308
1519 Ga0495680_0042578
1520 Ga0495680_0076152
1521 Ga0495683_0074363
1522 Ga0495687_046825
1523 Ga0495675_0068237
1524 Ga0495685_063973
1525 Ga0495673_0013330
1526 Ga0495684_0002730
1527 Ga0495684_0054251
1528 Ga0495684_0105859
1529 Ga0495684_0127653
1530 Ga0495686_0126470
1531 Ga0495593_0000495
1532 Ga0495593_0001203
1533 Ga0495593_0022477
1534 Ga0495593_0124049
1535 Ga0495602_0028623
1536 Ga0495602_0049654
1537 Ga0495602_0055132
1538 Ga0495602_0146601
1539 Ga0496100_0011667
1540 Ga0496101_0003579
1541 Ga0496101_0052485
1542 Ga0496101_0146965
1543 Ga0496101_0183960
1544 Ga0496102_0007923
1545 Ga0496102_0139950
1546 Ga0496103_0121183
1547 Ga0496103_0161673
1548 Ga0496104_0069177
1549 Ga0496104_0168040
1550 Ga0496104_0237482
1551 Ga0496105_0016857
1552 Ga0496105_0026827
1553 Ga0496105_0258754
1554 Ga0496105_0322725
1555 Ga0496106_0043115
1556 Ga0496106_0104052
1557 Ga0496107_0033299
1558 Ga0496107_0066411
1559 Ga0496107_0096532
1560 Ga0496107_0140661
1561 Ga0496107_0230720
1562 Ga0496108_0074802
1563 Ga0496109_0017997
1564 Ga0496109_0116893
1565 Ga0496110_0067181
1566 Ga0496112_0000029
1567 Ga0496112_0042235
1568 Ga0496112_0074363
1569 Ga0496112_0173866
1570 Ga0496112_0197092
1571 Ga0496112_0218968
1572 Ga0496112_0396022
1573 Ga0496113_0061050
1574 Ga0496113_0182878
1575 Ga0496113_0207468
1576 Ga0496114_0011325
1577 Ga0496114_0056814
1578 Ga0496115_0000295
1579 Ga0496115_0018198
1580 Ga0496115_0076474
1581 Ga0496115_0079903
1582 Ga0496115_0142236
1583 Ga0496116_0002462
1584 Ga0496116_0040127
1585 Ga0496117_0086744
1586 Ga0496117_0153103
1587 Ga0496118_0015057
1588 Ga0496118_0037848
1589 Ga0496118_0093022
1590 Ga0496118_0100783
1591 Ga0496118_0101437
1592 Ga0496118_0128456
1593 Ga0496119_0007315
1594 Ga0496120_0002476
1595 Ga0496120_0018821
1596 Ga0496120_0126979
1597 Ga0496121_0001687
1598 Ga0496121_0022584
1599 Ga0496121_0024664
1600 Ga0496121_0036588
1601 Ga0496121_0041193
1602 Ga0496121_0050936
1603 Ga0496121_0055607
1604 Ga0496121_0063679
1605 Ga0496121_0155941
1606 Ga0496121_0158418
1607 Ga0496121_0292411
1608 Ga0496124_0134256
1609 Ga0496124_0165185
1610 Ga0496124_0212595
1611 Ga0496125_0000154
1612 Ga0496125_0004393
1613 Ga0496125_0056873
1614 Ga0496125_0074537
1615 Ga0496126_0005939
1616 Ga0496126_0007864
1617 Ga0496126_0007926
1618 Ga0496126_0010008
1619 Ga0496126_0032301
1620 Ga0496126_0035603
1621 Ga0496126_0038680
1622 Ga0496126_0082697
1623 Ga0496126_0093307
1624 Ga0496126_0258306
1625 Ga0496126_0285803
1626 Ga0496126_0290432
1627 Ga0496126_0292181
1628 Ga0495682_0051142
1629 Ga0501031_0003990
1630 Ga0501032_0000073
1631 Ga0501033_0000136
1632 Ga0501034_0000251
1633 Ga0501034_0116531
1634 Ga0501036_0000036
1635 Ga0501036_0202301
1636 Ga0501037_0000040
1637 Ga0501038_0000150
1638 Ga0501038_0368549
1639 Ga0501039_0003418
1640 Ga0501040_0300295
1641 Ga0501042_0008136
1642 Ga0501043_0000464
1643 Ga0501043_0191031
1644 Ga0501046_0000398
1645 Ga0501046_0223674
1646 Ga0501047_0000656
1647 Ga0501047_0294580
1648 Ga0501048_0000906
1649 Ga0501067_0000192
1650 Ga0501067_0035211
1651 Ga0501068_0002765
1652 Ga0501069_0014897
1653 Ga0501070_0037271
1654 Ga0501070_0076207
1655 Ga0501070_0179220
1656 Ga0501070_0203936
1657 Ga0501071_0053825
1658 Ga0501072_0002128
1659 Ga0501073_0000037
1660 Ga0501074_0000133
1661 Ga0501079_0024353
1662 Ga0501080_0000054
1663 Ga0501080_0005201
1664 Ga0501083_0001153
1665 Ga0501035_0000142
1666 Ga0501035_0278135
1667 Ga0501044_0000985
1668 Ga0501044_0102936
1669 Ga0501045_0019721
1670 nmdc:mga03683_17647_c1
1671 nmdc:mga00v17_20486_c1
1672 nmdc:mga00v17_215349_c1
1673 nmdc:mga0yw44_91521_c1
1674 nmdc:mga0yw44_942_c1
1675 nmdc:mga06z11_14027_c1
1676 nmdc:mga06z11_30068_c1
1677 nmdc:mga07m45_69423_c1
1678 nmdc:mga07m45_6998_c1
1679 nmdc:mga0n895_115792_c1
1680 nmdc:mga0n895_30146_c1
1681 nmdc:mga0sz30_9846_c1
1682 Ga0495601_0013434
1683 Ga0495601_0083775
1684 Ga0495612_0062530
1685 Ga0500610_0097521
1686 Ga0500635_0044597
1687 Ga0495595_0000758
1688 Ga0495619_0000617
1689 Ga0495619_0217529
1690 Ga0500643_000168
1691 Ga0500581_052116
1692 Ga0500646_0035013
1693 Ga0500583_0012288
1694 Ga0500651_0026339
1695 Ga0500651_0098104
1696 Ga0500651_0127566
1697 Ga0500566_0000822
1698 Ga0500566_0003799
1699 Ga0500566_0015378
1700 Ga0500641_0016085
1701 Ga0500641_0039404
1702 Ga0500650_0006577
1703 Ga0500555_003167
1704 Ga0500556_0000047
1705 Ga0500595_003841
1706 Ga0500595_015941
1707 Ga0500595_023858
1708 Ga0500608_015167
1709 Ga0500618_011635
1710 Ga0500642_0000142
1711 Ga0500642_0000183
1712 Ga0500642_0030123
1713 Ga0500652_001628
1714 Ga0500559_0000105
1715 Ga0500559_0001644
1716 Ga0500559_0004871
1717 Ga0500568_0010399
1718 Ga0500568_0030179
1719 Ga0500568_0031881
1720 Ga0500577_0000991
1721 Ga0500603_000576
1722 Ga0500603_051801
1723 Ga0500604_0002170
1724 Ga0500604_0008009
1725 Ga0500616_0000038
1726 Ga0500616_0000784
1727 Ga0500619_025645
1728 Ga0500622_0002394
1729 Ga0500622_0008137
1730 Ga0500627_0022514
1731 Ga0500627_0098195
1732 Ga0500638_000230
1733 Ga0500636_0000592
1734 Ga0500636_0003094
1735 Ga0500636_0009727
1736 Ga0500636_0054374
1737 Ga0500636_0082718
1738 Ga0500636_0104233
1739 Ga0500637_0001711
1740 Ga0500637_0003917
1741 Ga0500625_000232
1742 Ga0500645_007739
1743 Ga0500609_009508
1744 Ga0500596_003778
1745 Ga0500596_003966
1746 Ga0500599_000651
1747 Ga0500601_000888
1748 Ga0501084_0008150
1749 Ga0500661_000294
1750 Ga0501082_0005663
1751 Ga0530510_0214055
1752 2507505934
1753 2508540123
1754 2509148121
1755 2511396578
1756 2513627430
1757 2513638320
1758 2513649162
1759 2513657473
1760 2513674951
1761 2513696278
1762 2513700225
1763 2513861199
1764 2513877237
1765 2513891600
1766 2513916726
1767 2514014607
1768 2515628524
1769 2517103119
1770 2517889633
1771 2524442995
1772 2524465267
1773 2524533197
1774 2528850701
1775 2603857125
1776 2617347816
1777 2617374738
1778 2644290486
1779 2671119485
1780 2723842287
1781 2745081916
1782 2793061530
1783 2793070386
1784 2793080141
1785 2805916163
1786 2818240553
1787 2824603628
1788 2824610786
1789 2824623208
1790 2824632194
1791 2824640813
1792 2824647965
1793 2824655232
1794 2824667356
1795 2824675049
1796 2824684446
1797 2824691784
1798 2824701063
1799 2824709281
1800 2824717978
1801 2824728194
1802 2824737037
1803 2824750817
1804 2824762003
1805 2824772370
1806 2824775702
1807 2838125077
1808 2841945815
1809 2841956914
1810 2841963963
1811 2841973525
1812 2841981996
1813 2841989413
1814 2842044401
1815 2842051610
1816 2844316264
1817 2847939424
1818 2847941185
1819 2849082171
1820 2857513353
1821 2857530870
1822 2874596330
1823 2874610124
1824 2874616469
1825 2874622488
1826 2874633394
1827 2874650317
1828 2876761654
1829 2876776795
1830 2876824585
1831 2879080932
1832 2879087096
1833 2879104427
1834 2879116991
1835 2879133777
1836 2879148279
1837 2881369588
1838 2881669694
1839 2885367766
1840 2885380886
1841 2885418886
1842 2888387230
1843 2888389921
1844 2888421180
1845 2889036410
1846 2893066373
1847 2903728400
1848 2903756086
1849 2903774682
1850 2904671505
1851 2904692069
1852 2904707611
1853 2904719805
1854 2906606541
1855 2906614611
1856 2906631421
1857 2906641980
1858 2906650657
1859 2906660934
1860 2908746567
1861 2908757349
1862 2908777220
1863 2922366714
1864 2922377409
1865 2922389382
1866 2922398498
1867 2922426472
1868 2929622197
1869 2929630156
1870 2932787915
1871 2932796038
1872 2932807615
1873 2932817641
1874 2932826199
1875 2932835057
1876 2933584188
1877 2935614359
1878 2935620434
1879 2935632813
1880 2935640757
1881 2935649388
1882 2935657840
1883 2935670260
1884 2935679689
1885 2935687258
1886 2935696771
1887 2935709137
1888 2935718717
1889 2935728369
1890 2935737034
1891 2935745963
1892 2935753224
1893 2935766384
1894 2935770223
1895 2935777748
1896 2935786724
1897 2935794778
1898 2935809064
1899 2935813755
1900 2935826577
1901 2935832264
1902 2935843969
1903 2935851129
1904 2935862760
1905 2935864503
1906 2935875145
1907 2935887307
1908 2935913179
1909 2935922601
1910 2935930896
1911 2935939770
1912 2935946719
1913 2935956080
1914 2935964984
1915 2935972873
1916 2935978212
1917 2935985664
1918 2935999236
1919 2936005791
1920 2936012059
1921 2936020860
1922 2936029352
1923 2936039311
1924 2936048324
1925 2940559137
1926 2941508523
1927 2941516353
1928 2941524631
1929 2941534578
1930 2941541832
1931 3005475814
1932 3005491082
1933 3005510923
1934 3005592162
1935 3005595877
1936 3005711819
1937 3005719073
1938 8006930187
1939 8006966308
1940 8006993122
1941 8006996975
1942 8016517250
1943 8016526987
1944 8016532066
1945 8016545277
1946 8016556811
1947 8016570356
1948 8016582902
1949 8016585395
1950 8016602810
1951 8016605674
1952 8016617585
1953 8016623986
1954 8016634874
1955 8017059343
1956 8019539645
1957 8019551008
1958 8019571604
1959 8019576282
1960 8019594156
1961 8019607407
1962 8019611105
1963 8019631370
1964 8019639246
1965 8019651393
1966 8019668175
1967 8019677637
1968 8019687308
1969 8055743553
1970 8056678162
1971 8056683411
1972 8056974152

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

2

185

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4us5-assembly1.cif.gz_A crystal structure of apo-msno8 0.9176 1 334
4us5-assembly2.cif.gz_D crystal structure of apo-msno8 0.9176 2 334
4us5-assembly2.cif.gz_C crystal structure of apo-msno8 0.9113 1 334
4us5-assembly1.cif.gz_A crystal structure of apo-msno8 0.9096 1 334
4us5-assembly2.cif.gz_C crystal structure of apo-msno8 0.9034 1 334
ID Description Score Start End Superfamily
4us5A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9164 1 334 3.20.20.30
af_P0ADV5_3_330_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9162 1 330 3.20.20.30
4us5A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9083 1 334 3.20.20.30
af_P0ADV5_3_330_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9056 1 330 3.20.20.30
af_Q2FXV3_1_329_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8972 2 332 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A1H4ZNQ5-F1-model_v4 Luciferase family oxidoreductase, group 1 0.9752 1 337 GO:0005829
GO:0016705
AF-A0A1H4ZNQ5-F1-model_v4 Luciferase family oxidoreductase, group 1 0.9723 1 337 GO:0005829
GO:0016705
AF-A0A7C9RFL3-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.962 68 332 GO:0005829
GO:0016705
AF-A0A537S3K2-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9615 65 334 GO:0005829
GO:0016705
AF-A0A401U2I4-F1-model_v4 Luciferase-like domain-containing protein 0.9613 208 337 GO:0005829
GO:0016705

Map