F487541
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 986 | 467 | 835 | 372 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2867428634|2867435246 |
| Length | 424 |
| Sequence | LKRLSEEGVAIWLDDLSRKRITSGNLAELIDQQHVVGVTTNPSIFQKAISEGDGYDQQLSDLAARKVTVEEAIRMITTADVRDAADILRPVFDATGGQDGRVSIEVDPRLAHNEKATVAEAKQLAWLVDRPNTLIKIPATLAGIPAITDVIGLGISVNVTLIFSLERYREVMDAYLAGLERAKERGLDLSKIHSVASFFVSRVDTEIDKRIDALGTDEAKAARGKAGVANARLAYQAYEEVFSGERWAKLENAGANKQRPLWASTGVKDKAYKATLYVDELVAPNTVNTMPEATLQAIEQSGEIRGNAVAGTYEQARADLDAVEKLGISYDEVVQLLEDEGVEKFEASWNDLLKSTEAELQRLAPSKDASRALQPRQVGGSRTGLSTDLVRCKACGRHPESAGQTTATAPPGLQRVRGRRRSWR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 2 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 3 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 4 | 2554235227 | Arthrobacter sp. PAO19 | Isolate | Rhizosphere |
| 5 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 6 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 7 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 8 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 9 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 10 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 11 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 12 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 13 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 14 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 15 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 16 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 17 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 18 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 19 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 20 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 21 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 22 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 23 | 2654587600 | Glutamicibacter halophytocola KLBMP5180 | Isolate | Unclassified |
| 24 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 25 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 26 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 27 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 28 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 29 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 30 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 31 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 32 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 33 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 34 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 35 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 36 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 37 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 38 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 39 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 40 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 41 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 42 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 43 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 44 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 45 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 46 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 47 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 48 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 49 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 50 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 51 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 52 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 53 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 54 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 55 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 56 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 57 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 58 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 59 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 60 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 61 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 62 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 63 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 64 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 65 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 66 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 67 | 2920879853 | Kocuria salina CV6 | Isolate | Unclassified |
| 68 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 69 | 2939660829 | Mycetocola sp. 2940 | Isolate | Rhizosphere |
| 70 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 71 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 72 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 73 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 74 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 75 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 76 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 77 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 78 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 79 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 80 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 81 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 82 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 83 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 84 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 85 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 86 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 87 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 88 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 89 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 90 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 91 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 92 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 93 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 94 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 95 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 96 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 97 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 98 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 99 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 100 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 101 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 102 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 103 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 104 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 105 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 106 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 108 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 115 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 116 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 118 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 119 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 120 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 122 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 123 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 124 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 125 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 126 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 127 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 128 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 129 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 130 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 131 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 132 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 133 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 134 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 135 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 136 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 137 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 138 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 157 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 158 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 159 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 160 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 162 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 163 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 164 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 165 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 166 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 167 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 168 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 169 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 170 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 171 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 197 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 200 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 201 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 202 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 203 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 204 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 205 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 206 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 207 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 208 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 209 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 210 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 211 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 212 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 213 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 214 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 215 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 216 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 217 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 218 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 219 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 220 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 221 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 222 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 223 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 224 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 225 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 226 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 227 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 228 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 229 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 230 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 231 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 232 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 233 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 234 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 235 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 236 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 237 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 238 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 239 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 240 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 241 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 242 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 243 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 244 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 245 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 246 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 247 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 248 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 249 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 250 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 251 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 252 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 253 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 254 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 255 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 256 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 257 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 258 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 259 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 260 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 261 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 262 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 263 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 264 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 265 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 266 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 267 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 268 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 269 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 270 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 271 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 272 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 273 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 274 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 275 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 276 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 277 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 278 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 279 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 280 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 360 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 361 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 362 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 363 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 364 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 365 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 366 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 367 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 368 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 369 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 370 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 371 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 372 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 373 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 374 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 405 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 406 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 413 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 414 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 415 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 427 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 428 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 429 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 430 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 431 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 432 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 433 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 434 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 435 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 436 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 437 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 438 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 439 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 440 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 441 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 443 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 446 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 447 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 448 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 449 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 450 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 451 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 452 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 453 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 454 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 455 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 456 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 457 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 458 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 459 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 460 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 461 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 462 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 463 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 464 | 8056054917 | Glycomyces luteolus NEAU-A15 | Isolate | Rhizosphere |
| 465 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 466 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 467 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.25 |
| Metatranscriptomes | 2.43 |
| Isolates | 15.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.14 |
| Nodule | 0.41 |
| Rhizoplane | 4.36 |
| Rhizosphere | 79.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.68 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10019090 | 3300001989 | Bacteria | 2457 |
| 2 | JGI24739J22299_10026852 | 3300001989 | Bacteria | 2017 |
| 3 | JGI24737J22298_10007983 | 3300001990 | Bacteria | 3556 |
| 4 | JGI24738J21930_10012699 | 3300002075 | Bacteria | 1836 |
| 5 | Ga0006777J48905_1026059 | 3300003308 | Bacteria | 1175 |
| 6 | rootH2_10008057 | 3300003320 | Bacteria | 2408 |
| 7 | Ga0006562J51391_1109412 | 3300003578 | Bacteria | 2610 |
| 8 | JGI25405J52794_10006402 | 3300003911 | Bacteria | 2152 |
| 9 | Ga0070683_100178183 | 3300005329 | Bacteria | 2018 |
| 10 | Ga0070670_100242993 | 3300005331 | Bacteria | 1568 |
| 11 | Ga0070680_100112524 | 3300005336 | Bacteria | 2267 |
| 12 | Ga0070660_100005230 | 3300005339 | Bacteria | 8977 |
| 13 | Ga0070668_100028825 | 3300005347 | Bacteria | 4212 |
| 14 | Ga0070668_100058984 | 3300005347 | Bacteria | 2970 |
| 15 | Ga0070659_100078977 | 3300005366 | Bacteria | 2626 |
| 16 | Ga0070714_100002556 | 3300005435 | Bacteria | 13399 |
| 17 | Ga0070714_100031451 | 3300005435 | Bacteria | 4428 |
| 18 | Ga0070714_100043111 | 3300005435 | Bacteria | 3814 |
| 19 | Ga0070714_100338035 | 3300005435 | Bacteria | 1411 |
| 20 | Ga0070663_100028092 | 3300005455 | Bacteria | 3826 |
| 21 | Ga0070662_100341253 | 3300005457 | Bacteria | 1225 |
| 22 | Ga0070681_10044433 | 3300005458 | Bacteria | 4447 |
| 23 | Ga0068867_100029542 | 3300005459 | Bacteria | 3950 |
| 24 | Ga0070699_100320600 | 3300005518 | Bacteria | 1393 |
| 25 | Ga0070679_100014163 | 3300005530 | Bacteria | 7651 |
| 26 | Ga0070684_100044105 | 3300005535 | Bacteria | 3855 |
| 27 | Ga0068853_100075340 | 3300005539 | Bacteria | 2945 |
| 28 | Ga0070665_100003530 | 3300005548 | Bacteria | 16627 |
| 29 | Ga0070665_100030289 | 3300005548 | Bacteria | 5446 |
| 30 | Ga0070665_100044001 | 3300005548 | Bacteria | 4485 |
| 31 | Ga0070665_100373410 | 3300005548 | Bacteria | 1433 |
| 32 | Ga0068854_100000899 | 3300005578 | Bacteria | 17894 |
| 33 | Ga0068854_100032930 | 3300005578 | Bacteria | 3610 |
| 34 | Ga0068852_100049839 | 3300005616 | Bacteria | 3585 |
| 35 | Ga0081455_10000389 | 3300005937 | Bacteria | 58107 |
| 36 | Ga0081455_10002237 | 3300005937 | Bacteria | 23049 |
| 37 | Ga0081455_10068793 | 3300005937 | Bacteria | 2946 |
| 38 | Ga0081455_10078077 | 3300005937 | Bacteria | 2721 |
| 39 | Ga0081538_10000958 | 3300005981 | Bacteria | 30846 |
| 40 | Ga0081538_10001594 | 3300005981 | Bacteria | 23286 |
| 41 | Ga0081538_10018403 | 3300005981 | Bacteria | 5247 |
| 42 | Ga0081540_1046845 | 3300005983 | Bacteria | 2179 |
| 43 | Ga0081539_10000292 | 3300005985 | Bacteria | 113454 |
| 44 | Ga0081539_10001399 | 3300005985 | Bacteria | 41546 |
| 45 | Ga0081539_10011343 | 3300005985 | Bacteria | 7065 |
| 46 | Ga0081539_10018862 | 3300005985 | Bacteria | 4755 |
| 47 | Ga0081539_10020454 | 3300005985 | Bacteria | 4473 |
| 48 | Ga0081539_10118178 | 3300005985 | Bacteria | 1322 |
| 49 | Ga0075364_10024749 | 3300006051 | Bacteria | 3815 |
| 50 | Ga0075364_10257527 | 3300006051 | Bacteria | 1186 |
| 51 | Ga0075432_10000058 | 3300006058 | Bacteria | 21877 |
| 52 | Ga0075432_10001078 | 3300006058 | Bacteria | 8671 |
| 53 | Ga0075428_100004393 | 3300006844 | Bacteria | 15564 |
| 54 | Ga0075428_100005267 | 3300006844 | Bacteria | 14385 |
| 55 | Ga0075428_100006278 | 3300006844 | Bacteria | 13214 |
| 56 | Ga0075428_100132945 | 3300006844 | Bacteria | 2705 |
| 57 | Ga0075430_100001112 | 3300006846 | Bacteria | 21393 |
| 58 | Ga0075430_100003006 | 3300006846 | Bacteria | 14108 |
| 59 | Ga0075431_100003087 | 3300006847 | Bacteria | 16126 |
| 60 | Ga0075431_100007843 | 3300006847 | Bacteria | 10640 |
| 61 | Ga0075431_100007939 | 3300006847 | Bacteria | 10578 |
| 62 | Ga0075433_10000219 | 3300006852 | Bacteria | 32497 |
| 63 | Ga0075433_10000698 | 3300006852 | Bacteria | 22940 |
| 64 | Ga0075434_100000609 | 3300006871 | Bacteria | 27718 |
| 65 | Ga0075434_100013208 | 3300006871 | Bacteria | 7848 |
| 66 | Ga0075429_100000303 | 3300006880 | Bacteria | 34915 |
| 67 | Ga0075429_100014193 | 3300006880 | Bacteria | 6905 |
| 68 | Ga0075429_100145690 | 3300006880 | Bacteria | 2073 |
| 69 | Ga0075436_100010602 | 3300006914 | Bacteria | 6320 |
| 70 | Ga0099826_10039049 | 3300006948 | Bacteria | 3326 |
| 71 | Ga0075435_100020295 | 3300007076 | Bacteria | 5088 |
| 72 | Ga0105251_10027990 | 3300009011 | Bacteria | 2851 |
| 73 | Ga0105240_10033493 | 3300009093 | Bacteria | 6637 |
| 74 | Ga0105240_10043420 | 3300009093 | Bacteria | 5720 |
| 75 | Ga0111539_10000761 | 3300009094 | Bacteria | 41945 |
| 76 | Ga0111539_10008525 | 3300009094 | Bacteria | 13023 |
| 77 | Ga0105245_10045486 | 3300009098 | Bacteria | 3921 |
| 78 | Ga0105245_10260995 | 3300009098 | Bacteria | 1686 |
| 79 | Ga0114129_10000041 | 3300009147 | Bacteria | 107656 |
| 80 | Ga0114129_10000100 | 3300009147 | Bacteria | 84154 |
| 81 | Ga0114129_10082418 | 3300009147 | Bacteria | 4469 |
| 82 | Ga0105243_10002638 | 3300009148 | Bacteria | 14899 |
| 83 | Ga0105242_10060004 | 3300009176 | Bacteria | 3123 |
| 84 | Ga0105238_10009367 | 3300009551 | Bacteria | 9804 |
| 85 | Ga0105238_10084884 | 3300009551 | Bacteria | 3155 |
| 86 | Ga0105249_10031513 | 3300009553 | Bacteria | 4796 |
| 87 | Ga0105239_10063085 | 3300010375 | Bacteria | 4068 |
| 88 | Ga0105239_10105341 | 3300010375 | Bacteria | 3123 |
| 89 | Ga0105246_10056793 | 3300011119 | Bacteria | 2707 |
| 90 | Ga0157370_10327625 | 3300013104 | Bacteria | 1412 |
| 91 | Ga0157369_10164287 | 3300013105 | Bacteria | 2342 |
| 92 | Ga0157374_10202172 | 3300013296 | Bacteria | 1946 |
| 93 | Ga0157378_10082171 | 3300013297 | Bacteria | 2913 |
| 94 | Ga0163162_10014513 | 3300013306 | Bacteria | 7698 |
| 95 | Ga0163162_10026523 | 3300013306 | Bacteria | 5726 |
| 96 | Ga0163162_10063073 | 3300013306 | Bacteria | 3747 |
| 97 | Ga0163162_10490383 | 3300013306 | Bacteria | 1360 |
| 98 | Ga0157372_10062032 | 3300013307 | Bacteria | 4187 |
| 99 | Ga0157372_10227221 | 3300013307 | Bacteria | 2164 |
| 100 | Ga0157372_10327031 | 3300013307 | Bacteria | 1785 |
| 101 | Ga0163163_10081519 | 3300014325 | Bacteria | 3237 |
| 102 | Ga0182008_10002136 | 3300014497 | Bacteria | 12605 |
| 103 | Ga0182008_10007117 | 3300014497 | Bacteria | 6196 |
| 104 | Ga0182006_1022929 | 3300015261 | Bacteria | 2588 |
| 105 | Ga0182007_10000188 | 3300015262 | Bacteria | 41467 |
| 106 | Ga0182007_10001633 | 3300015262 | Bacteria | 11886 |
| 107 | Ga0183367_1001 | 3300015688 | Bacteria | 1225545 |
| 108 | Ga0183367_1007 | 3300015688 | Bacteria | 498079 |
| 109 | Ga0163161_10101033 | 3300017792 | Bacteria | 2147 |
| 110 | Ga0197907_10887992 | 3300020069 | Bacteria | 2304 |
| 111 | Ga0197907_11047224 | 3300020069 | Bacteria | 2383 |
| 112 | Ga0206356_10823945 | 3300020070 | Bacteria | 1919 |
| 113 | Ga0206349_1184325 | 3300020075 | Bacteria | 3108 |
| 114 | Ga0206349_1610450 | 3300020075 | Bacteria | 1738 |
| 115 | Ga0206355_1062620 | 3300020076 | Bacteria | 3230 |
| 116 | Ga0206352_10129169 | 3300020078 | Bacteria | 2189 |
| 117 | Ga0206352_10792297 | 3300020078 | Bacteria | 1819 |
| 118 | Ga0206350_10033714 | 3300020080 | Bacteria | 3549 |
| 119 | Ga0206350_10850691 | 3300020080 | Bacteria | 2104 |
| 120 | Ga0206354_11547845 | 3300020081 | Bacteria | 2367 |
| 121 | Ga0206353_10237768 | 3300020082 | Bacteria | 7694 |
| 122 | Ga0206353_10892018 | 3300020082 | Bacteria | 1791 |
| 123 | Ga0213875_10006019 | 3300021388 | Bacteria | 6424 |
| 124 | Ga0224712_10001460 | 3300022467 | Bacteria | 5455 |
| 125 | Ga0224712_10011329 | 3300022467 | Bacteria | 2763 |
| 126 | Ga0224712_10013631 | 3300022467 | Bacteria | 2595 |
| 127 | Ga0209025_1031905 | 3300025294 | Bacteria | 2477 |
| 128 | Ga0209758_1003694 | 3300025297 | Bacteria | 13593 |
| 129 | Ga0209758_1007794 | 3300025297 | Bacteria | 7152 |
| 130 | Ga0207426_1001189 | 3300025302 | Bacteria | 23155 |
| 131 | Ga0207426_1003255 | 3300025302 | Bacteria | 9091 |
| 132 | Ga0207426_1013527 | 3300025302 | Bacteria | 3020 |
| 133 | Ga0207426_1021155 | 3300025302 | Bacteria | 2251 |
| 134 | Ga0207696_1005488 | 3300025711 | Bacteria | 5255 |
| 135 | Ga0207688_10089904 | 3300025901 | Bacteria | 1762 |
| 136 | Ga0207647_10002104 | 3300025904 | Bacteria | 15238 |
| 137 | Ga0207647_10026598 | 3300025904 | Bacteria | 3783 |
| 138 | Ga0207695_10001103 | 3300025913 | Bacteria | 46908 |
| 139 | Ga0207671_10000389 | 3300025914 | Bacteria | 61710 |
| 140 | Ga0207660_10125865 | 3300025917 | Bacteria | 1946 |
| 141 | Ga0207652_10027503 | 3300025921 | Bacteria | 4739 |
| 142 | Ga0207694_10004658 | 3300025924 | Bacteria | 10678 |
| 143 | Ga0207687_10031080 | 3300025927 | Bacteria | 3607 |
| 144 | Ga0207664_10021773 | 3300025929 | Bacteria | 4775 |
| 145 | Ga0207706_10014617 | 3300025933 | Bacteria | 7108 |
| 146 | Ga0207709_10008557 | 3300025935 | Bacteria | 5658 |
| 147 | Ga0207709_10083454 | 3300025935 | Bacteria | 2066 |
| 148 | Ga0207667_10033632 | 3300025949 | Bacteria | 5511 |
| 149 | Ga0207667_10048745 | 3300025949 | Bacteria | 4477 |
| 150 | Ga0207712_10026878 | 3300025961 | Bacteria | 3839 |
| 151 | Ga0207668_10003049 | 3300025972 | Bacteria | 9818 |
| 152 | Ga0207668_10068626 | 3300025972 | Bacteria | 2521 |
| 153 | Ga0207668_10100734 | 3300025972 | Bacteria | 2146 |
| 154 | Ga0207640_10004544 | 3300025981 | Bacteria | 7532 |
| 155 | Ga0207639_10109590 | 3300026041 | Bacteria | 2247 |
| 156 | Ga0207678_10059010 | 3300026067 | Bacteria | 3301 |
| 157 | Ga0207708_10132762 | 3300026075 | Bacteria | 1948 |
| 158 | Ga0207648_10043105 | 3300026089 | Bacteria | 3962 |
| 159 | Ga0207675_100019693 | 3300026118 | Bacteria | 6299 |
| 160 | Ga0207675_100212978 | 3300026118 | Bacteria | 1859 |
| 161 | Ga0209371_1016902 | 3300027312 | Bacteria | 1909 |
| 162 | Ga0207428_10000762 | 3300027907 | Bacteria | 36710 |
| 163 | Ga0207428_10002987 | 3300027907 | Bacteria | 16703 |
| 164 | Ga0268266_10023769 | 3300028379 | Bacteria | 5216 |
| 165 | Ga0268266_10140587 | 3300028379 | Bacteria | 2166 |
| 166 | Ga0268265_10013772 | 3300028380 | Bacteria | 5504 |
| 167 | Ga0268265_10024712 | 3300028380 | Bacteria | 4255 |
| 168 | Ga0265319_1003772 | 3300028563 | Bacteria | 7767 |
| 169 | Ga0265319_1018115 | 3300028563 | Bacteria | 2662 |
| 170 | Ga0265334_10009414 | 3300028573 | Bacteria | 4132 |
| 171 | Ga0265318_10000755 | 3300028577 | Bacteria | 21562 |
| 172 | Ga0307517_10011680 | 3300028786 | Bacteria | 12151 |
| 173 | Ga0307517_10080637 | 3300028786 | Bacteria | 2784 |
| 174 | Ga0307517_10094980 | 3300028786 | Bacteria | 2403 |
| 175 | Ga0307515_10000441 | 3300028794 | Bacteria | 99819 |
| 176 | Ga0307515_10012174 | 3300028794 | Bacteria | 16221 |
| 177 | Ga0307515_10031278 | 3300028794 | Bacteria | 8884 |
| 178 | Ga0307515_10087217 | 3300028794 | Bacteria | 3965 |
| 179 | Ga0307515_10142214 | 3300028794 | Bacteria | 2566 |
| 180 | Ga0307515_10214595 | 3300028794 | Bacteria | 1759 |
| 181 | Ga0265338_10016895 | 3300028800 | Bacteria | 7898 |
| 182 | Ga0265338_10174998 | 3300028800 | Bacteria | 1641 |
| 183 | Ga0307511_10006319 | 3300030521 | Bacteria | 11946 |
| 184 | Ga0307511_10022667 | 3300030521 | Bacteria | 5879 |
| 185 | Ga0307511_10053002 | 3300030521 | Bacteria | 3221 |
| 186 | Ga0307512_10012127 | 3300030522 | Bacteria | 8147 |
| 187 | Ga0307512_10016591 | 3300030522 | Bacteria | 6795 |
| 188 | Ga0307512_10108905 | 3300030522 | Bacteria | 1835 |
| 189 | Ga0316182_1376048 | 3300030745 | Bacteria | 3713 |
| 190 | Ga0265330_10004174 | 3300031235 | Bacteria | 7373 |
| 191 | Ga0265328_10001580 | 3300031239 | Bacteria | 10501 |
| 192 | Ga0265320_10003043 | 3300031240 | Bacteria | 11385 |
| 193 | Ga0265325_10003090 | 3300031241 | Bacteria | 10993 |
| 194 | Ga0265325_10104385 | 3300031241 | Bacteria | 1384 |
| 195 | Ga0265329_10004498 | 3300031242 | Bacteria | 5785 |
| 196 | Ga0265340_10002687 | 3300031247 | Bacteria | 10110 |
| 197 | Ga0265316_10020393 | 3300031344 | Bacteria | 5641 |
| 198 | Ga0307513_10000009 | 3300031456 | Bacteria | 403893 |
| 199 | Ga0307513_10004081 | 3300031456 | Bacteria | 19562 |
| 200 | Ga0307513_10005869 | 3300031456 | Bacteria | 16132 |
| 201 | Ga0307513_10080302 | 3300031456 | Bacteria | 3365 |
| 202 | Ga0307513_10090310 | 3300031456 | Bacteria | 3125 |
| 203 | Ga0307509_10007936 | 3300031507 | Bacteria | 13696 |
| 204 | Ga0307509_10018524 | 3300031507 | Bacteria | 7981 |
| 205 | Ga0307509_10146711 | 3300031507 | Bacteria | 2283 |
| 206 | Ga0307408_100011119 | 3300031548 | Bacteria | 5945 |
| 207 | Ga0307408_100012290 | 3300031548 | Bacteria | 5670 |
| 208 | Ga0307408_100088836 | 3300031548 | Bacteria | 2328 |
| 209 | Ga0307508_10000287 | 3300031616 | Bacteria | 61945 |
| 210 | Ga0307508_10001366 | 3300031616 | Bacteria | 27492 |
| 211 | Ga0307508_10018977 | 3300031616 | Bacteria | 6247 |
| 212 | Ga0307508_10050107 | 3300031616 | Bacteria | 3717 |
| 213 | Ga0307508_10094817 | 3300031616 | Bacteria | 2574 |
| 214 | Ga0307508_10118477 | 3300031616 | Bacteria | 2249 |
| 215 | Ga0307514_10004180 | 3300031649 | Bacteria | 13376 |
| 216 | Ga0307514_10044298 | 3300031649 | Bacteria | 3487 |
| 217 | Ga0307514_10056739 | 3300031649 | Bacteria | 3004 |
| 218 | Ga0307514_10095809 | 3300031649 | Bacteria | 2145 |
| 219 | Ga0265314_10051320 | 3300031711 | Bacteria | 2873 |
| 220 | Ga0316576_10049900 | 3300031727 | Bacteria | 3041 |
| 221 | Ga0307516_10011576 | 3300031730 | Bacteria | 9573 |
| 222 | Ga0307516_10032208 | 3300031730 | Bacteria | 5280 |
| 223 | Ga0307516_10073587 | 3300031730 | Bacteria | 3274 |
| 224 | Ga0307405_10076844 | 3300031731 | Bacteria | 2167 |
| 225 | Ga0307405_10124011 | 3300031731 | Bacteria | 1773 |
| 226 | Ga0307413_10029475 | 3300031824 | Bacteria | 3070 |
| 227 | Ga0307413_10038737 | 3300031824 | Bacteria | 2766 |
| 228 | Ga0307410_10000645 | 3300031852 | Bacteria | 14372 |
| 229 | Ga0307410_10032249 | 3300031852 | Bacteria | 3369 |
| 230 | Ga0307410_10082643 | 3300031852 | Bacteria | 2260 |
| 231 | Ga0307410_10098920 | 3300031852 | Bacteria | 2087 |
| 232 | Ga0307406_10000359 | 3300031901 | Bacteria | 26657 |
| 233 | Ga0307406_10004072 | 3300031901 | Bacteria | 7956 |
| 234 | Ga0307406_10027976 | 3300031901 | Bacteria | 3402 |
| 235 | Ga0307407_10000506 | 3300031903 | Bacteria | 12021 |
| 236 | Ga0307407_10001378 | 3300031903 | Bacteria | 8748 |
| 237 | Ga0307407_10045390 | 3300031903 | Bacteria | 2482 |
| 238 | Ga0307412_10003098 | 3300031911 | Bacteria | 9230 |
| 239 | Ga0307412_10093860 | 3300031911 | Bacteria | 2106 |
| 240 | Ga0307409_100001043 | 3300031995 | Bacteria | 13011 |
| 241 | Ga0307409_100024354 | 3300031995 | Bacteria | 4220 |
| 242 | Ga0307409_100055774 | 3300031995 | Bacteria | 3053 |
| 243 | Ga0307409_100121701 | 3300031995 | Bacteria | 2211 |
| 244 | Ga0307416_100000776 | 3300032002 | Bacteria | 16772 |
| 245 | Ga0307416_100003499 | 3300032002 | Bacteria | 9238 |
| 246 | Ga0307416_100065308 | 3300032002 | Bacteria | 2990 |
| 247 | Ga0307416_100075738 | 3300032002 | Bacteria | 2817 |
| 248 | Ga0307416_100125664 | 3300032002 | Bacteria | 2297 |
| 249 | Ga0307416_100159845 | 3300032002 | Bacteria | 2081 |
| 250 | Ga0307414_10007469 | 3300032004 | Bacteria | 6139 |
| 251 | Ga0307414_10117210 | 3300032004 | Bacteria | 2040 |
| 252 | Ga0307414_10335914 | 3300032004 | Bacteria | 1291 |
| 253 | Ga0307411_10004265 | 3300032005 | Bacteria | 6813 |
| 254 | Ga0307411_10016950 | 3300032005 | Bacteria | 4135 |
| 255 | Ga0307411_10221402 | 3300032005 | Bacteria | 1468 |
| 256 | Ga0307415_100006340 | 3300032126 | Bacteria | 6369 |
| 257 | Ga0307415_100015176 | 3300032126 | Bacteria | 4553 |
| 258 | Ga0307415_100069039 | 3300032126 | Bacteria | 2476 |
| 259 | Ga0307507_10000019 | 3300033179 | Bacteria | 224026 |
| 260 | Ga0307507_10008958 | 3300033179 | Bacteria | 13577 |
| 261 | Ga0307507_10054821 | 3300033179 | Bacteria | 3789 |
| 262 | Ga0307507_10096066 | 3300033179 | Bacteria | 2509 |
| 263 | Ga0307510_10040490 | 3300033180 | Bacteria | 5114 |
| 264 | Ga0307510_10046000 | 3300033180 | Bacteria | 4700 |
| 265 | Ga0307510_10129706 | 3300033180 | Bacteria | 2199 |
| 266 | Ga0373962_0004271 | 3300035242 | Bacteria | 3449 |
| 267 | Ga0395899_0120682 | 3300037312 | Bacteria | 1878 |
| 268 | Ga0395900_0009810 | 3300037418 | Bacteria | 9810 |
| 269 | Ga0395898_0002815 | 3300037466 | Bacteria | 19948 |
| 270 | Ga0395898_0003419 | 3300037466 | Bacteria | 17774 |
| 271 | Ga0395898_0057800 | 3300037466 | Bacteria | 3778 |
| 272 | Ga0395898_0092848 | 3300037466 | Bacteria | 2902 |
| 273 | Ga0395898_0275917 | 3300037466 | Bacteria | 1603 |
| 274 | Ga0395905_0270138 | 3300037471 | Bacteria | 1586 |
| 275 | Ga0436364_0312203 | 3300037853 | Bacteria | 39359 |
| 276 | Ga0395901_0013035 | 3300038443 | Bacteria | 8436 |
| 277 | Ga0395901_0052987 | 3300038443 | Bacteria | 4216 |
| 278 | Ga0436365_0548348 | 3300039437 | Bacteria | 22079 |
| 279 | Ga0436365_0877362 | 3300039437 | Bacteria | 1623 |
| 280 | Ga0439436_0000166 | 3300041404 | Bacteria | 15489 |
| 281 | Ga0439436_0008869 | 3300041404 | Bacteria | 3085 |
| 282 | Ga0439436_0038124 | 3300041404 | Bacteria | 1383 |
| 283 | Ga0439439_0004773 | 3300041406 | Bacteria | 3070 |
| 284 | Ga0451833_0440150 | 3300041491 | Bacteria | 8246 |
| 285 | Ga0451839_0296389 | 3300041496 | Bacteria | 5461 |
| 286 | Ga0451841_1036571 | 3300041498 | Bacteria | 2551 |
| 287 | Ga0451853_2434871 | 3300041512 | Bacteria | 1742 |
| 288 | Ga0451853_3381203 | 3300041512 | Bacteria | 1948 |
| 289 | Ga0439433_0000788 | 3300041999 | Bacteria | 6260 |
| 290 | Ga0439442_000989 | 3300042002 | Bacteria | 5743 |
| 291 | Ga0439448_0001325 | 3300042005 | Bacteria | 6336 |
| 292 | Ga0439432_029955 | 3300042006 | Bacteria | 1767 |
| 293 | Ga0439449_0000874 | 3300042007 | Bacteria | 11757 |
| 294 | Ga0439449_0004830 | 3300042007 | Bacteria | 5197 |
| 295 | Ga0439449_0007501 | 3300042007 | Bacteria | 4145 |
| 296 | Ga0439455_0000095 | 3300042012 | Bacteria | 8582 |
| 297 | Ga0439457_000843 | 3300042014 | Bacteria | 9203 |
| 298 | Ga0439457_001434 | 3300042014 | Bacteria | 7171 |
| 299 | Ga0439457_001850 | 3300042014 | Bacteria | 6242 |
| 300 | Ga0439457_002864 | 3300042014 | Bacteria | 4810 |
| 301 | Ga0439462_0009732 | 3300042015 | Bacteria | 2430 |
| 302 | Ga0439462_0013318 | 3300042015 | Bacteria | 2107 |
| 303 | Ga0450898_000603 | 3300042134 | Bacteria | 4310 |
| 304 | Ga0450899_000205 | 3300042135 | Bacteria | 6118 |
| 305 | Ga0450903_000034 | 3300042138 | Bacteria | 27428 |
| 306 | Ga0450903_000192 | 3300042138 | Bacteria | 13562 |
| 307 | Ga0450906_000520 | 3300042145 | Bacteria | 8095 |
| 308 | Ga0439458_0001095 | 3300042157 | Bacteria | 6908 |
| 309 | Ga0439435_0039769 | 3300042436 | Bacteria | 1311 |
| 310 | Ga0439464_0005535 | 3300042439 | Bacteria | 3270 |
| 311 | Ga0439464_0007100 | 3300042439 | Bacteria | 2927 |
| 312 | Ga0466969_0000609 | 3300044656 | Bacteria | 19347 |
| 313 | Ga0466969_0001666 | 3300044656 | Bacteria | 11883 |
| 314 | Ga0466969_0003320 | 3300044656 | Bacteria | 8561 |
| 315 | Ga0466969_0017395 | 3300044656 | Bacteria | 3752 |
| 316 | Ga0466969_0023298 | 3300044656 | Bacteria | 3190 |
| 317 | Ga0466972_0008588 | 3300044658 | Bacteria | 5125 |
| 318 | Ga0466972_0010739 | 3300044658 | Bacteria | 4596 |
| 319 | Ga0466965_0003319 | 3300044683 | Bacteria | 7040 |
| 320 | Ga0466965_0021558 | 3300044683 | Bacteria | 3102 |
| 321 | Ga0466965_0043039 | 3300044683 | Bacteria | 2229 |
| 322 | Ga0466966_0001295 | 3300044684 | Bacteria | 16018 |
| 323 | Ga0466966_0005253 | 3300044684 | Bacteria | 8514 |
| 324 | Ga0466966_0005929 | 3300044684 | Bacteria | 8064 |
| 325 | Ga0466966_0006679 | 3300044684 | Bacteria | 7641 |
| 326 | Ga0466966_0053001 | 3300044684 | Bacteria | 2574 |
| 327 | Ga0466961_0000891 | 3300044693 | Bacteria | 18585 |
| 328 | Ga0466961_0001045 | 3300044693 | Bacteria | 17043 |
| 329 | Ga0466961_0010648 | 3300044693 | Bacteria | 5870 |
| 330 | Ga0466961_0010788 | 3300044693 | Bacteria | 5836 |
| 331 | Ga0466961_0024465 | 3300044693 | Bacteria | 3884 |
| 332 | Ga0466961_0032499 | 3300044693 | Bacteria | 3353 |
| 333 | Ga0466961_0044816 | 3300044693 | Bacteria | 2830 |
| 334 | Ga0466961_0099295 | 3300044693 | Bacteria | 1835 |
| 335 | Ga0466961_0132357 | 3300044693 | Bacteria | 1563 |
| 336 | Ga0466963_0001647 | 3300044694 | Bacteria | 12166 |
| 337 | Ga0466963_0006548 | 3300044694 | Bacteria | 6897 |
| 338 | Ga0466963_0011325 | 3300044694 | Bacteria | 5427 |
| 339 | Ga0466963_0019548 | 3300044694 | Bacteria | 4250 |
| 340 | Ga0466963_0022816 | 3300044694 | Bacteria | 3968 |
| 341 | Ga0466964_0016597 | 3300044706 | Bacteria | 2813 |
| 342 | Ga0466971_0001266 | 3300044719 | Bacteria | 10528 |
| 343 | Ga0466971_0010456 | 3300044719 | Bacteria | 4055 |
| 344 | Ga0466971_0013702 | 3300044719 | Bacteria | 3565 |
| 345 | Ga0466971_0023066 | 3300044719 | Bacteria | 2773 |
| 346 | Ga0466971_0027828 | 3300044719 | Bacteria | 2532 |
| 347 | Ga0466971_0029149 | 3300044719 | Bacteria | 2468 |
| 348 | Ga0466968_0000717 | 3300044735 | Bacteria | 11466 |
| 349 | Ga0466968_0001751 | 3300044735 | Bacteria | 7829 |
| 350 | Ga0466970_0002303 | 3300044765 | Bacteria | 9232 |
| 351 | Ga0466970_0008956 | 3300044765 | Bacteria | 5047 |
| 352 | Ga0466970_0046361 | 3300044765 | Bacteria | 2315 |
| 353 | Ga0466957_0000245 | 3300044842 | Bacteria | 26013 |
| 354 | Ga0466957_0126315 | 3300044842 | Bacteria | 1634 |
| 355 | Ga0466960_0002720 | 3300044901 | Bacteria | 6683 |
| 356 | Ga0466960_0019159 | 3300044901 | Bacteria | 3010 |
| 357 | Ga0466960_0055713 | 3300044901 | Bacteria | 1923 |
| 358 | Ga0466959_0003522 | 3300045049 | Bacteria | 10277 |
| 359 | Ga0466959_0005036 | 3300045049 | Bacteria | 8976 |
| 360 | Ga0466959_0017618 | 3300045049 | Bacteria | 5237 |
| 361 | Ga0466959_0020374 | 3300045049 | Bacteria | 4886 |
| 362 | Ga0466959_0021303 | 3300045049 | Bacteria | 4779 |
| 363 | Ga0466958_0017180 | 3300045836 | Bacteria | 4178 |
| 364 | Ga0466958_0113190 | 3300045836 | Bacteria | 1695 |
| 365 | Ga0466958_0136322 | 3300045836 | Bacteria | 1544 |
| 366 | Ga0466967_0001931 | 3300045976 | Bacteria | 12533 |
| 367 | Ga0466967_0004056 | 3300045976 | Bacteria | 9770 |
| 368 | Ga0466967_0026413 | 3300045976 | Bacteria | 4810 |
| 369 | Ga0466967_0028197 | 3300045976 | Bacteria | 4684 |
| 370 | Ga0466967_0030537 | 3300045976 | Bacteria | 4524 |
| 371 | Ga0466967_0159755 | 3300045976 | Bacteria | 2114 |
| 372 | Ga0495617_006315 | 3300046452 | Bacteria | 4163 |
| 373 | Ga0495627_012636 | 3300046453 | Bacteria | 2991 |
| 374 | Ga0495592_0002763 | 3300046454 | Bacteria | 12441 |
| 375 | Ga0495592_0007118 | 3300046454 | Bacteria | 8373 |
| 376 | Ga0495592_0011557 | 3300046454 | Bacteria | 6683 |
| 377 | Ga0495592_0028400 | 3300046454 | Bacteria | 4237 |
| 378 | Ga0495592_0078120 | 3300046454 | Bacteria | 2398 |
| 379 | Ga0495592_0098219 | 3300046454 | Bacteria | 2090 |
| 380 | Ga0495603_0002358 | 3300046455 | Bacteria | 11083 |
| 381 | Ga0495603_0003057 | 3300046455 | Bacteria | 9926 |
| 382 | Ga0495603_0005293 | 3300046455 | Bacteria | 7691 |
| 383 | Ga0495603_0024352 | 3300046455 | Bacteria | 3659 |
| 384 | Ga0495603_0048040 | 3300046455 | Bacteria | 2541 |
| 385 | Ga0495603_0064545 | 3300046455 | Bacteria | 2158 |
| 386 | Ga0495603_0065036 | 3300046455 | Bacteria | 2149 |
| 387 | Ga0495590_0000234 | 3300046457 | Bacteria | 30439 |
| 388 | Ga0495629_0001210 | 3300046459 | Bacteria | 20267 |
| 389 | Ga0495629_0002991 | 3300046459 | Bacteria | 12852 |
| 390 | Ga0495629_0052828 | 3300046459 | Bacteria | 2843 |
| 391 | Ga0495629_0088010 | 3300046459 | Bacteria | 2166 |
| 392 | Ga0495629_0120492 | 3300046459 | Bacteria | 1828 |
| 393 | Ga0495629_0262315 | 3300046459 | Bacteria | 1187 |
| 394 | Ga0495638_0117677 | 3300046460 | Bacteria | 1572 |
| 395 | Ga0495651_0001241 | 3300046462 | Bacteria | 19736 |
| 396 | Ga0495651_0002734 | 3300046462 | Bacteria | 13673 |
| 397 | Ga0495651_0005548 | 3300046462 | Bacteria | 9620 |
| 398 | Ga0495651_0007103 | 3300046462 | Bacteria | 8559 |
| 399 | Ga0495651_0020136 | 3300046462 | Bacteria | 5178 |
| 400 | Ga0495653_0005937 | 3300046463 | Bacteria | 9996 |
| 401 | Ga0495580_0018355 | 3300046472 | Bacteria | 5209 |
| 402 | Ga0495582_0010165 | 3300046473 | Bacteria | 5183 |
| 403 | Ga0495582_0058349 | 3300046473 | Bacteria | 2128 |
| 404 | Ga0495582_0104995 | 3300046473 | Bacteria | 1584 |
| 405 | Ga0495639_0014570 | 3300046475 | Bacteria | 3405 |
| 406 | Ga0495662_0004079 | 3300046476 | Bacteria | 7353 |
| 407 | Ga0495662_0017105 | 3300046476 | Bacteria | 3510 |
| 408 | Ga0495662_0018191 | 3300046476 | Bacteria | 3400 |
| 409 | Ga0495662_0028188 | 3300046476 | Bacteria | 2711 |
| 410 | Ga0495664_0004530 | 3300046477 | Bacteria | 7600 |
| 411 | Ga0495664_0066158 | 3300046477 | Bacteria | 2155 |
| 412 | Ga0495584_0054468 | 3300046491 | Bacteria | 2013 |
| 413 | Ga0495585_0011522 | 3300046492 | Bacteria | 5232 |
| 414 | Ga0495594_0000550 | 3300046499 | Bacteria | 19188 |
| 415 | Ga0495594_0002955 | 3300046499 | Bacteria | 8812 |
| 416 | Ga0495594_0019204 | 3300046499 | Bacteria | 3630 |
| 417 | Ga0495594_0027793 | 3300046499 | Bacteria | 3050 |
| 418 | Ga0495594_0031513 | 3300046499 | Bacteria | 2874 |
| 419 | Ga0495594_0037228 | 3300046499 | Bacteria | 2654 |
| 420 | Ga0495594_0072370 | 3300046499 | Bacteria | 1917 |
| 421 | Ga0495596_0023776 | 3300046500 | Bacteria | 2485 |
| 422 | Ga0495596_0043390 | 3300046500 | Bacteria | 1772 |
| 423 | Ga0495607_0011764 | 3300046501 | Bacteria | 5803 |
| 424 | Ga0495607_0095019 | 3300046501 | Bacteria | 1607 |
| 425 | Ga0495606_0010862 | 3300046507 | Bacteria | 7500 |
| 426 | Ga0495606_0039152 | 3300046507 | Bacteria | 3199 |
| 427 | Ga0495608_0001164 | 3300046511 | Bacteria | 18625 |
| 428 | Ga0495608_0145202 | 3300046511 | Bacteria | 1513 |
| 429 | Ga0495616_0001635 | 3300046513 | Bacteria | 15364 |
| 430 | Ga0495616_0013790 | 3300046513 | Bacteria | 4547 |
| 431 | Ga0495618_0012044 | 3300046514 | Bacteria | 5247 |
| 432 | Ga0495618_0030256 | 3300046514 | Bacteria | 3381 |
| 433 | Ga0495618_0045750 | 3300046514 | Bacteria | 2761 |
| 434 | Ga0495618_0049846 | 3300046514 | Bacteria | 2644 |
| 435 | Ga0495618_0088506 | 3300046514 | Bacteria | 1980 |
| 436 | Ga0495618_0153551 | 3300046514 | Bacteria | 1470 |
| 437 | Ga0495620_0023636 | 3300046515 | Bacteria | 2935 |
| 438 | Ga0495628_0008399 | 3300046516 | Bacteria | 8858 |
| 439 | Ga0495628_0013505 | 3300046516 | Bacteria | 6869 |
| 440 | Ga0495628_0032907 | 3300046516 | Bacteria | 4181 |
| 441 | Ga0495628_0038232 | 3300046516 | Bacteria | 3843 |
| 442 | Ga0495628_0043335 | 3300046516 | Bacteria | 3585 |
| 443 | Ga0495628_0079730 | 3300046516 | Bacteria | 2545 |
| 444 | Ga0495630_0016089 | 3300046517 | Bacteria | 5466 |
| 445 | Ga0495630_0028340 | 3300046517 | Bacteria | 4162 |
| 446 | Ga0495630_0039887 | 3300046517 | Bacteria | 3509 |
| 447 | Ga0495631_0002123 | 3300046518 | Bacteria | 11479 |
| 448 | Ga0495631_0026533 | 3300046518 | Bacteria | 2659 |
| 449 | Ga0495643_0001512 | 3300046522 | Bacteria | 21014 |
| 450 | Ga0495643_0002349 | 3300046522 | Bacteria | 15174 |
| 451 | Ga0495648_0054949 | 3300046524 | Bacteria | 2402 |
| 452 | Ga0495666_0007255 | 3300046526 | Bacteria | 5563 |
| 453 | Ga0495666_0019935 | 3300046526 | Bacteria | 3327 |
| 454 | Ga0495666_0035048 | 3300046526 | Bacteria | 2447 |
| 455 | Ga0495666_0060342 | 3300046526 | Bacteria | 1812 |
| 456 | Ga0495642_0027981 | 3300046528 | Bacteria | 2244 |
| 457 | Ga0495652_0019500 | 3300046529 | Bacteria | 6037 |
| 458 | Ga0495652_0027446 | 3300046529 | Bacteria | 5016 |
| 459 | Ga0495652_0070413 | 3300046529 | Bacteria | 2923 |
| 460 | Ga0495654_0008355 | 3300046530 | Bacteria | 5724 |
| 461 | Ga0495654_0029806 | 3300046530 | Bacteria | 2781 |
| 462 | Ga0495665_0001197 | 3300046531 | Bacteria | 13819 |
| 463 | Ga0495640_0004947 | 3300046533 | Bacteria | 10594 |
| 464 | Ga0495640_0043870 | 3300046533 | Bacteria | 3112 |
| 465 | Ga0495586_0016311 | 3300046535 | Bacteria | 3951 |
| 466 | Ga0495586_0022259 | 3300046535 | Bacteria | 3381 |
| 467 | Ga0495586_0145788 | 3300046535 | Bacteria | 1330 |
| 468 | Ga0495587_0002646 | 3300046536 | Bacteria | 11963 |
| 469 | Ga0495609_0017410 | 3300046538 | Bacteria | 3336 |
| 470 | Ga0495609_0109486 | 3300046538 | Bacteria | 1193 |
| 471 | Ga0495645_0013132 | 3300046543 | Bacteria | 5854 |
| 472 | Ga0495645_0014863 | 3300046543 | Bacteria | 5531 |
| 473 | Ga0495622_0006833 | 3300046557 | Bacteria | 5296 |
| 474 | Ga0495622_0028187 | 3300046557 | Bacteria | 2622 |
| 475 | Ga0495622_0032646 | 3300046557 | Bacteria | 2430 |
| 476 | Ga0495633_0021607 | 3300046558 | Bacteria | 3216 |
| 477 | Ga0495633_0027002 | 3300046558 | Bacteria | 2810 |
| 478 | Ga0495667_0014718 | 3300046559 | Bacteria | 5286 |
| 479 | Ga0495668_0010883 | 3300046616 | Bacteria | 5477 |
| 480 | Ga0495634_0009383 | 3300046642 | Bacteria | 7217 |
| 481 | Ga0495634_0017111 | 3300046642 | Bacteria | 5177 |
| 482 | Ga0495634_0022697 | 3300046642 | Bacteria | 4421 |
| 483 | Ga0495634_0023503 | 3300046642 | Bacteria | 4331 |
| 484 | Ga0495634_0023507 | 3300046642 | Bacteria | 4330 |
| 485 | Ga0495611_0013679 | 3300046648 | Bacteria | 3458 |
| 486 | Ga0495625_0007615 | 3300046660 | Bacteria | 9399 |
| 487 | Ga0495625_0028467 | 3300046660 | Bacteria | 4190 |
| 488 | Ga0495625_0094048 | 3300046660 | Bacteria | 2068 |
| 489 | Ga0495625_0103074 | 3300046660 | Bacteria | 1957 |
| 490 | Ga0495635_0000520 | 3300046663 | Bacteria | 24388 |
| 491 | Ga0495635_0021076 | 3300046663 | Bacteria | 4542 |
| 492 | Ga0495635_0038666 | 3300046663 | Bacteria | 3302 |
| 493 | Ga0495635_0099309 | 3300046663 | Bacteria | 1989 |
| 494 | Ga0495635_0115511 | 3300046663 | Bacteria | 1832 |
| 495 | Ga0495635_0122230 | 3300046663 | Bacteria | 1775 |
| 496 | Ga0495661_0012079 | 3300046665 | Bacteria | 5841 |
| 497 | Ga0495661_0042422 | 3300046665 | Bacteria | 2804 |
| 498 | Ga0495588_0001136 | 3300046674 | Bacteria | 11462 |
| 499 | Ga0495588_0002833 | 3300046674 | Bacteria | 7457 |
| 500 | Ga0495657_0003233 | 3300046675 | Bacteria | 13393 |
| 501 | Ga0495657_0005001 | 3300046675 | Bacteria | 10535 |
| 502 | Ga0495657_0005893 | 3300046675 | Bacteria | 9633 |
| 503 | Ga0495657_0016339 | 3300046675 | Bacteria | 5408 |
| 504 | Ga0495657_0017933 | 3300046675 | Bacteria | 5133 |
| 505 | Ga0495657_0045310 | 3300046675 | Bacteria | 2985 |
| 506 | Ga0495623_0010669 | 3300046679 | Bacteria | 5948 |
| 507 | Ga0495623_0082593 | 3300046679 | Bacteria | 1985 |
| 508 | Ga0495646_0001970 | 3300046680 | Bacteria | 12382 |
| 509 | Ga0495646_0004975 | 3300046680 | Bacteria | 8391 |
| 510 | Ga0495646_0008850 | 3300046680 | Bacteria | 6393 |
| 511 | Ga0495658_0012481 | 3300046683 | Bacteria | 4306 |
| 512 | Ga0495613_0001173 | 3300046689 | Bacteria | 19990 |
| 513 | Ga0495613_0011991 | 3300046689 | Bacteria | 6441 |
| 514 | Ga0495613_0012635 | 3300046689 | Bacteria | 6278 |
| 515 | Ga0495613_0019804 | 3300046689 | Bacteria | 5013 |
| 516 | Ga0495613_0058473 | 3300046689 | Bacteria | 2829 |
| 517 | Ga0495613_0109405 | 3300046689 | Bacteria | 1992 |
| 518 | Ga0495624_0015475 | 3300046690 | Bacteria | 5150 |
| 519 | Ga0495624_0077432 | 3300046690 | Bacteria | 2062 |
| 520 | Ga0495670_0004198 | 3300046691 | Bacteria | 7058 |
| 521 | Ga0495670_0153968 | 3300046691 | Bacteria | 1206 |
| 522 | Ga0495671_0080989 | 3300046692 | Bacteria | 1591 |
| 523 | Ga0495649_0071333 | 3300046694 | Bacteria | 1862 |
| 524 | Ga0495589_0019738 | 3300046794 | Bacteria | 3449 |
| 525 | Ga0495589_0058085 | 3300046794 | Bacteria | 1902 |
| 526 | Ga0495600_0008201 | 3300046809 | Bacteria | 6414 |
| 527 | Ga0495600_0011153 | 3300046809 | Bacteria | 5595 |
| 528 | Ga0495600_0013585 | 3300046809 | Bacteria | 5120 |
| 529 | Ga0495600_0021087 | 3300046809 | Bacteria | 4170 |
| 530 | Ga0495600_0029931 | 3300046809 | Bacteria | 3526 |
| 531 | Ga0495600_0105461 | 3300046809 | Bacteria | 1836 |
| 532 | Ga0495660_0139356 | 3300046810 | Bacteria | 1208 |
| 533 | Ga0495581_0002333 | 3300047315 | Bacteria | 10697 |
| 534 | Ga0495581_0017993 | 3300047315 | Bacteria | 4106 |
| 535 | Ga0495581_0018769 | 3300047315 | Bacteria | 4014 |
| 536 | Ga0495581_0023185 | 3300047315 | Bacteria | 3596 |
| 537 | Ga0495604_0002431 | 3300047317 | Bacteria | 14899 |
| 538 | Ga0495604_0005551 | 3300047317 | Bacteria | 10002 |
| 539 | Ga0495604_0019901 | 3300047317 | Bacteria | 5367 |
| 540 | Ga0495604_0055391 | 3300047317 | Bacteria | 3056 |
| 541 | Ga0495636_0018696 | 3300047318 | Bacteria | 2781 |
| 542 | Ga0495636_0024114 | 3300047318 | Bacteria | 2465 |
| 543 | Ga0495674_0006537 | 3300047319 | Bacteria | 11187 |
| 544 | Ga0495674_0135421 | 3300047319 | Bacteria | 2073 |
| 545 | Ga0495676_0002779 | 3300047321 | Bacteria | 15733 |
| 546 | Ga0495676_0003250 | 3300047321 | Bacteria | 14695 |
| 547 | Ga0495676_0007323 | 3300047321 | Bacteria | 10124 |
| 548 | Ga0495676_0009016 | 3300047321 | Bacteria | 9102 |
| 549 | Ga0495676_0009639 | 3300047321 | Bacteria | 8786 |
| 550 | Ga0495676_0010811 | 3300047321 | Bacteria | 8256 |
| 551 | Ga0495676_0023060 | 3300047321 | Bacteria | 5406 |
| 552 | Ga0495680_0014414 | 3300047322 | Bacteria | 6844 |
| 553 | Ga0495680_0016762 | 3300047322 | Bacteria | 6281 |
| 554 | Ga0495687_004847 | 3300047443 | Bacteria | 8843 |
| 555 | Ga0495687_005971 | 3300047443 | Bacteria | 7593 |
| 556 | Ga0495687_039840 | 3300047443 | Bacteria | 2075 |
| 557 | Ga0495675_0004393 | 3300047444 | Bacteria | 8533 |
| 558 | Ga0495675_0011798 | 3300047444 | Bacteria | 5490 |
| 559 | Ga0495675_0012238 | 3300047444 | Bacteria | 5398 |
| 560 | Ga0495675_0068701 | 3300047444 | Bacteria | 2238 |
| 561 | Ga0495675_0071452 | 3300047444 | Bacteria | 2190 |
| 562 | Ga0495675_0162200 | 3300047444 | Bacteria | 1376 |
| 563 | Ga0495685_000221 | 3300047447 | Bacteria | 19406 |
| 564 | Ga0495685_003066 | 3300047447 | Bacteria | 5298 |
| 565 | Ga0495685_019655 | 3300047447 | Bacteria | 2321 |
| 566 | Ga0495685_041956 | 3300047447 | Bacteria | 1562 |
| 567 | Ga0495685_062430 | 3300047447 | Bacteria | 1254 |
| 568 | Ga0495681_0005609 | 3300047470 | Bacteria | 8370 |
| 569 | Ga0495681_0006380 | 3300047470 | Bacteria | 7759 |
| 570 | Ga0495681_0009675 | 3300047470 | Bacteria | 5912 |
| 571 | Ga0495681_0050900 | 3300047470 | Bacteria | 1950 |
| 572 | Ga0495681_0062301 | 3300047470 | Bacteria | 1715 |
| 573 | Ga0495684_0019913 | 3300047471 | Bacteria | 5171 |
| 574 | Ga0495684_0123910 | 3300047471 | Bacteria | 1945 |
| 575 | Ga0495684_0128758 | 3300047471 | Bacteria | 1903 |
| 576 | Ga0495686_0016525 | 3300047472 | Bacteria | 5003 |
| 577 | Ga0495686_0030332 | 3300047472 | Bacteria | 3512 |
| 578 | Ga0495686_0055049 | 3300047472 | Bacteria | 2489 |
| 579 | Ga0495593_0000873 | 3300047673 | Bacteria | 17468 |
| 580 | Ga0495593_0029698 | 3300047673 | Bacteria | 2996 |
| 581 | Ga0495593_0085041 | 3300047673 | Bacteria | 1632 |
| 582 | Ga0495602_0032202 | 3300048088 | Bacteria | 4941 |
| 583 | Ga0495614_0001082 | 3300048089 | Bacteria | 11659 |
| 584 | Ga0495614_0003707 | 3300048089 | Bacteria | 6860 |
| 585 | Ga0495614_0037764 | 3300048089 | Bacteria | 2072 |
| 586 | Ga0495626_0057035 | 3300048091 | Bacteria | 1787 |
| 587 | Ga0496100_0000374 | 3300048903 | Bacteria | 21787 |
| 588 | Ga0496101_0004976 | 3300048904 | Bacteria | 8437 |
| 589 | Ga0496102_0008486 | 3300048905 | Bacteria | 8806 |
| 590 | Ga0496102_0136474 | 3300048905 | Bacteria | 2299 |
| 591 | Ga0496103_0011717 | 3300048906 | Bacteria | 5202 |
| 592 | Ga0496104_0000785 | 3300048907 | Bacteria | 27175 |
| 593 | Ga0496104_0048561 | 3300048907 | Bacteria | 4001 |
| 594 | Ga0496104_0057964 | 3300048907 | Bacteria | 3665 |
| 595 | Ga0496104_0354618 | 3300048907 | Bacteria | 1379 |
| 596 | Ga0496105_0004871 | 3300048908 | Bacteria | 10137 |
| 597 | Ga0496105_0128263 | 3300048908 | Bacteria | 2091 |
| 598 | Ga0496106_0240581 | 3300048909 | Bacteria | 1446 |
| 599 | Ga0496108_0005434 | 3300048911 | Bacteria | 10293 |
| 600 | Ga0496108_0066279 | 3300048911 | Bacteria | 3044 |
| 601 | Ga0496108_0102792 | 3300048911 | Bacteria | 2438 |
| 602 | Ga0496108_0106420 | 3300048911 | Bacteria | 2395 |
| 603 | Ga0496108_0186897 | 3300048911 | Bacteria | 1795 |
| 604 | Ga0496109_0026425 | 3300048912 | Bacteria | 5177 |
| 605 | Ga0496109_0102265 | 3300048912 | Bacteria | 2659 |
| 606 | Ga0496109_0186158 | 3300048912 | Bacteria | 1950 |
| 607 | Ga0496109_0187329 | 3300048912 | Bacteria | 1944 |
| 608 | Ga0496110_0006505 | 3300048913 | Bacteria | 9270 |
| 609 | Ga0496110_0101731 | 3300048913 | Bacteria | 2576 |
| 610 | Ga0496110_0120423 | 3300048913 | Bacteria | 2364 |
| 611 | Ga0496110_0231232 | 3300048913 | Bacteria | 1682 |
| 612 | Ga0496111_0021337 | 3300048914 | Bacteria | 4521 |
| 613 | Ga0496111_0035948 | 3300048914 | Bacteria | 3542 |
| 614 | Ga0496112_0006151 | 3300048915 | Bacteria | 10494 |
| 615 | Ga0496112_0010916 | 3300048915 | Bacteria | 8270 |
| 616 | Ga0496112_0029855 | 3300048915 | Bacteria | 5274 |
| 617 | Ga0496112_0269477 | 3300048915 | Bacteria | 1651 |
| 618 | Ga0496113_0080041 | 3300048916 | Bacteria | 2502 |
| 619 | Ga0496113_0157828 | 3300048916 | Bacteria | 1792 |
| 620 | Ga0496114_0002155 | 3300048917 | Bacteria | 14988 |
| 621 | Ga0496114_0003978 | 3300048917 | Bacteria | 11412 |
| 622 | Ga0496114_0007544 | 3300048917 | Bacteria | 8604 |
| 623 | Ga0496114_0007977 | 3300048917 | Bacteria | 8377 |
| 624 | Ga0496114_0019381 | 3300048917 | Bacteria | 5512 |
| 625 | Ga0496114_0030255 | 3300048917 | Bacteria | 4454 |
| 626 | Ga0496114_0054268 | 3300048917 | Bacteria | 3342 |
| 627 | Ga0496114_0112280 | 3300048917 | Bacteria | 2336 |
| 628 | Ga0496114_0205334 | 3300048917 | Bacteria | 1727 |
| 629 | Ga0496122_0000659 | 3300048925 | Bacteria | 69472 |
| 630 | Ga0496123_0018794 | 3300048926 | Bacteria | 5476 |
| 631 | Ga0496126_0003688 | 3300048929 | Bacteria | 19129 |
| 632 | Ga0501306_000871 | 3300049127 | Bacteria | 2587 |
| 633 | Ga0501306_008204 | 3300049127 | Bacteria | 1269 |
| 634 | Ga0495678_020853 | 3300049459 | Bacteria | 2894 |
| 635 | Ga0495682_0033404 | 3300049460 | Bacteria | 1899 |
| 636 | Ga0501323_000125 | 3300049539 | Bacteria | 4336 |
| 637 | Ga0501323_001566 | 3300049539 | Bacteria | 2069 |
| 638 | Ga0501324_000079 | 3300049540 | Bacteria | 3528 |
| 639 | Ga0501031_0000536 | 3300049568 | Bacteria | 22196 |
| 640 | Ga0501031_0002123 | 3300049568 | Bacteria | 12502 |
| 641 | Ga0501031_0006009 | 3300049568 | Bacteria | 7923 |
| 642 | Ga0501031_0014225 | 3300049568 | Bacteria | 5176 |
| 643 | Ga0501031_0090620 | 3300049568 | Bacteria | 1994 |
| 644 | Ga0501032_0002282 | 3300049569 | Bacteria | 15068 |
| 645 | Ga0501032_0003032 | 3300049569 | Bacteria | 13022 |
| 646 | Ga0501032_0004079 | 3300049569 | Bacteria | 11066 |
| 647 | Ga0501032_0005643 | 3300049569 | Bacteria | 9272 |
| 648 | Ga0501032_0011400 | 3300049569 | Bacteria | 6387 |
| 649 | Ga0501032_0019085 | 3300049569 | Bacteria | 4797 |
| 650 | Ga0501032_0121256 | 3300049569 | Bacteria | 1728 |
| 651 | Ga0501033_0002719 | 3300049570 | Bacteria | 14836 |
| 652 | Ga0501033_0007663 | 3300049570 | Bacteria | 8381 |
| 653 | Ga0501033_0008925 | 3300049570 | Bacteria | 7743 |
| 654 | Ga0501033_0027215 | 3300049570 | Bacteria | 4300 |
| 655 | Ga0501033_0030280 | 3300049570 | Bacteria | 4067 |
| 656 | Ga0501034_0004750 | 3300049571 | Bacteria | 15038 |
| 657 | Ga0501034_0007650 | 3300049571 | Bacteria | 11496 |
| 658 | Ga0501034_0008248 | 3300049571 | Bacteria | 11030 |
| 659 | Ga0501034_0011906 | 3300049571 | Bacteria | 8997 |
| 660 | Ga0501034_0016319 | 3300049571 | Bacteria | 7623 |
| 661 | Ga0501034_0095440 | 3300049571 | Bacteria | 2970 |
| 662 | Ga0501034_0143043 | 3300049571 | Bacteria | 2370 |
| 663 | Ga0501036_0005396 | 3300049572 | Bacteria | 10356 |
| 664 | Ga0501036_0010545 | 3300049572 | Bacteria | 7635 |
| 665 | Ga0501036_0012876 | 3300049572 | Bacteria | 6944 |
| 666 | Ga0501036_0022111 | 3300049572 | Bacteria | 5349 |
| 667 | Ga0501036_0046032 | 3300049572 | Bacteria | 3694 |
| 668 | Ga0501036_0046054 | 3300049572 | Bacteria | 3693 |
| 669 | Ga0501036_0099725 | 3300049572 | Bacteria | 2456 |
| 670 | Ga0501037_0003593 | 3300049573 | Bacteria | 11251 |
| 671 | Ga0501037_0004880 | 3300049573 | Bacteria | 9755 |
| 672 | Ga0501037_0008803 | 3300049573 | Bacteria | 7398 |
| 673 | Ga0501037_0040284 | 3300049573 | Bacteria | 3438 |
| 674 | Ga0501037_0041834 | 3300049573 | Bacteria | 3368 |
| 675 | Ga0501037_0073632 | 3300049573 | Bacteria | 2483 |
| 676 | Ga0501037_0200612 | 3300049573 | Bacteria | 1410 |
| 677 | Ga0501038_0003399 | 3300049574 | Bacteria | 14836 |
| 678 | Ga0501038_0011152 | 3300049574 | Bacteria | 8207 |
| 679 | Ga0501038_0015275 | 3300049574 | Bacteria | 6980 |
| 680 | Ga0501038_0037604 | 3300049574 | Bacteria | 4243 |
| 681 | Ga0501038_0048904 | 3300049574 | Bacteria | 3658 |
| 682 | Ga0501039_0010651 | 3300049575 | Bacteria | 7005 |
| 683 | Ga0501039_0011202 | 3300049575 | Bacteria | 6833 |
| 684 | Ga0501039_0015466 | 3300049575 | Bacteria | 5842 |
| 685 | Ga0501039_0018889 | 3300049575 | Bacteria | 5292 |
| 686 | Ga0501039_0145635 | 3300049575 | Bacteria | 1861 |
| 687 | Ga0501040_0001825 | 3300049576 | Bacteria | 13697 |
| 688 | Ga0501040_0003567 | 3300049576 | Bacteria | 10063 |
| 689 | Ga0501041_0001588 | 3300049577 | Bacteria | 12659 |
| 690 | Ga0501041_0004107 | 3300049577 | Bacteria | 8416 |
| 691 | Ga0501042_0001841 | 3300049578 | Bacteria | 12722 |
| 692 | Ga0501042_0007844 | 3300049578 | Bacteria | 7018 |
| 693 | Ga0501042_0024880 | 3300049578 | Bacteria | 4203 |
| 694 | Ga0501042_0068950 | 3300049578 | Bacteria | 2529 |
| 695 | Ga0501043_0002630 | 3300049579 | Bacteria | 15116 |
| 696 | Ga0501043_0002940 | 3300049579 | Bacteria | 14207 |
| 697 | Ga0501043_0004752 | 3300049579 | Bacteria | 11017 |
| 698 | Ga0501043_0010621 | 3300049579 | Bacteria | 7211 |
| 699 | Ga0501043_0023928 | 3300049579 | Bacteria | 4791 |
| 700 | Ga0501043_0043027 | 3300049579 | Bacteria | 3550 |
| 701 | Ga0501046_0003295 | 3300049580 | Bacteria | 14833 |
| 702 | Ga0501046_0005788 | 3300049580 | Bacteria | 11031 |
| 703 | Ga0501046_0010272 | 3300049580 | Bacteria | 8056 |
| 704 | Ga0501046_0013477 | 3300049580 | Bacteria | 6920 |
| 705 | Ga0501047_0000015 | 3300049581 | Bacteria | 307932 |
| 706 | Ga0501047_0000055 | 3300049581 | Bacteria | 144149 |
| 707 | Ga0501047_0000750 | 3300049581 | Bacteria | 33804 |
| 708 | Ga0501047_0001216 | 3300049581 | Bacteria | 25535 |
| 709 | Ga0501047_0004692 | 3300049581 | Bacteria | 12851 |
| 710 | Ga0501047_0009073 | 3300049581 | Bacteria | 9392 |
| 711 | Ga0501047_0010994 | 3300049581 | Bacteria | 8565 |
| 712 | Ga0501047_0017035 | 3300049581 | Bacteria | 6949 |
| 713 | Ga0501047_0056625 | 3300049581 | Bacteria | 3791 |
| 714 | Ga0501047_0098351 | 3300049581 | Bacteria | 2805 |
| 715 | Ga0501047_0219449 | 3300049581 | Bacteria | 1758 |
| 716 | Ga0501047_0282264 | 3300049581 | Bacteria | 1505 |
| 717 | Ga0501048_0004365 | 3300049582 | Bacteria | 10766 |
| 718 | Ga0501048_0006407 | 3300049582 | Bacteria | 8946 |
| 719 | Ga0501048_0148001 | 3300049582 | Bacteria | 1661 |
| 720 | Ga0501067_0001877 | 3300049583 | Bacteria | 11545 |
| 721 | Ga0501067_0002169 | 3300049583 | Bacteria | 10820 |
| 722 | Ga0501068_0000061 | 3300049584 | Bacteria | 42895 |
| 723 | Ga0501068_0005108 | 3300049584 | Bacteria | 7150 |
| 724 | Ga0501069_0001698 | 3300049585 | Bacteria | 10967 |
| 725 | Ga0501070_0009498 | 3300049586 | Bacteria | 8221 |
| 726 | Ga0501070_0016299 | 3300049586 | Bacteria | 6242 |
| 727 | Ga0501070_0021752 | 3300049586 | Bacteria | 5375 |
| 728 | Ga0501070_0043168 | 3300049586 | Bacteria | 3753 |
| 729 | Ga0501070_0148880 | 3300049586 | Bacteria | 1931 |
| 730 | Ga0501071_0000111 | 3300049587 | Bacteria | 32014 |
| 731 | Ga0501071_0000711 | 3300049587 | Bacteria | 17478 |
| 732 | Ga0501071_0046170 | 3300049587 | Bacteria | 3129 |
| 733 | Ga0501072_0005562 | 3300049588 | Bacteria | 9585 |
| 734 | Ga0501072_0005806 | 3300049588 | Bacteria | 9400 |
| 735 | Ga0501072_0068306 | 3300049588 | Bacteria | 2805 |
| 736 | Ga0501073_0002148 | 3300049589 | Bacteria | 14740 |
| 737 | Ga0501073_0010029 | 3300049589 | Bacteria | 6964 |
| 738 | Ga0501073_0062918 | 3300049589 | Bacteria | 2588 |
| 739 | Ga0501074_0002104 | 3300049590 | Bacteria | 13743 |
| 740 | Ga0501074_0002337 | 3300049590 | Bacteria | 13192 |
| 741 | Ga0501074_0035151 | 3300049590 | Bacteria | 3630 |
| 742 | Ga0501076_0007178 | 3300049592 | Bacteria | 8100 |
| 743 | Ga0501077_0003734 | 3300049593 | Bacteria | 9163 |
| 744 | Ga0501077_0011444 | 3300049593 | Bacteria | 5541 |
| 745 | Ga0501217_006471 | 3300049661 | Bacteria | 2490 |
| 746 | Ga0501225_0009459 | 3300049705 | Bacteria | 2774 |
| 747 | Ga0501079_0018017 | 3300049741 | Bacteria | 5392 |
| 748 | Ga0501079_0057755 | 3300049741 | Bacteria | 2993 |
| 749 | Ga0501080_0065356 | 3300049742 | Bacteria | 3383 |
| 750 | Ga0501080_0137357 | 3300049742 | Bacteria | 2261 |
| 751 | Ga0501083_0000169 | 3300049744 | Bacteria | 42763 |
| 752 | Ga0501083_0000393 | 3300049744 | Bacteria | 27798 |
| 753 | Ga0501083_0004738 | 3300049744 | Bacteria | 9610 |
| 754 | Ga0501035_0001243 | 3300049822 | Bacteria | 26482 |
| 755 | Ga0501035_0003733 | 3300049822 | Bacteria | 14519 |
| 756 | Ga0501035_0007178 | 3300049822 | Bacteria | 10424 |
| 757 | Ga0501035_0011951 | 3300049822 | Bacteria | 8032 |
| 758 | Ga0501035_0013913 | 3300049822 | Bacteria | 7424 |
| 759 | Ga0501035_0019079 | 3300049822 | Bacteria | 6312 |
| 760 | Ga0501035_0093615 | 3300049822 | Bacteria | 2643 |
| 761 | Ga0501035_0106475 | 3300049822 | Bacteria | 2458 |
| 762 | Ga0501035_0108526 | 3300049822 | Bacteria | 2433 |
| 763 | Ga0501035_0246245 | 3300049822 | Bacteria | 1519 |
| 764 | Ga0501044_0009004 | 3300049823 | Bacteria | 10918 |
| 765 | Ga0501044_0009018 | 3300049823 | Bacteria | 10906 |
| 766 | Ga0501044_0016851 | 3300049823 | Bacteria | 7838 |
| 767 | Ga0501044_0031763 | 3300049823 | Bacteria | 5554 |
| 768 | Ga0501044_0031984 | 3300049823 | Bacteria | 5531 |
| 769 | Ga0501044_0034418 | 3300049823 | Bacteria | 5313 |
| 770 | Ga0501044_0069908 | 3300049823 | Bacteria | 3573 |
| 771 | Ga0501044_0089560 | 3300049823 | Bacteria | 3105 |
| 772 | Ga0501044_0092045 | 3300049823 | Bacteria | 3058 |
| 773 | Ga0501044_0122347 | 3300049823 | Bacteria | 2602 |
| 774 | Ga0501045_0004757 | 3300049824 | Bacteria | 9375 |
| 775 | Ga0501045_0007462 | 3300049824 | Bacteria | 7595 |
| 776 | Ga0501045_0011850 | 3300049824 | Bacteria | 6127 |
| 777 | Ga0501045_0033009 | 3300049824 | Bacteria | 3753 |
| 778 | Ga0501045_0201019 | 3300049824 | Bacteria | 1485 |
| 779 | nmdc:mga03n38_11880_c1 | 3300050490 | Bacteria | 3258 |
| 780 | nmdc:mga03n38_7581_c1 | 3300050490 | Bacteria | 3846 |
| 781 | nmdc:mga00v17_35956_c1 | 3300050491 | Bacteria | 1847 |
| 782 | nmdc:mga06z11_5609_c1 | 3300050494 | Bacteria | 5048 |
| 783 | nmdc:mga05p37_39997_c1 | 3300050507 | Bacteria | 5758 |
| 784 | nmdc:mga05p37_7421_c1 | 3300050507 | Bacteria | 12935 |
| 785 | nmdc:mga05p37_804_c2 | 3300050507 | Bacteria | 30686 |
| 786 | nmdc:mga09592_2828_c1 | 3300050508 | Bacteria | 14070 |
| 787 | nmdc:mga09592_8674_c1 | 3300050508 | Bacteria | 8275 |
| 788 | nmdc:mga0qj67_1396_c1 | 3300050509 | Bacteria | 16943 |
| 789 | nmdc:mga0qj67_2509_c1 | 3300050509 | Bacteria | 13102 |
| 790 | nmdc:mga06r32_23470_c1 | 3300050510 | Bacteria | 5707 |
| 791 | nmdc:mga06r32_532_c1 | 3300050510 | Bacteria | 32919 |
| 792 | nmdc:mga06r32_8900_c1 | 3300050510 | Bacteria | 9050 |
| 793 | nmdc:mga08y16_138174_c1 | 3300050511 | Bacteria | 2534 |
| 794 | nmdc:mga08y16_7508_c1 | 3300050511 | Bacteria | 11418 |
| 795 | nmdc:mga0n895_217_c1 | 3300050512 | Bacteria | 36183 |
| 796 | nmdc:mga0rr50_5127_c1 | 3300050513 | Bacteria | 7779 |
| 797 | nmdc:mga08x19_5248_c1 | 3300050514 | Bacteria | 7668 |
| 798 | nmdc:mga0a205_10607_c1 | 3300050515 | Bacteria | 8469 |
| 799 | nmdc:mga0a205_1731_c1 | 3300050515 | Bacteria | 18865 |
| 800 | Ga0495601_0003728 | 3300053077 | Bacteria | 8771 |
| 801 | Ga0495601_0050566 | 3300053077 | Bacteria | 2621 |
| 802 | Ga0495601_0081822 | 3300053077 | Bacteria | 2073 |
| 803 | Ga0495619_0014049 | 3300053085 | Bacteria | 5052 |
| 804 | Ga0495619_0181060 | 3300053085 | Bacteria | 1458 |
| 805 | Ga0500583_0050301 | 3300053092 | Bacteria | 1932 |
| 806 | Ga0500566_0049684 | 3300053094 | Bacteria | 2402 |
| 807 | Ga0500640_004096 | 3300053095 | Bacteria | 5241 |
| 808 | Ga0500640_004273 | 3300053095 | Bacteria | 5164 |
| 809 | Ga0500641_0041881 | 3300053096 | Bacteria | 1854 |
| 810 | Ga0500654_028320 | 3300053099 | Bacteria | 3426 |
| 811 | Ga0500608_093215 | 3300053122 | Bacteria | 1405 |
| 812 | Ga0500628_001077 | 3300053129 | Bacteria | 4771 |
| 813 | Ga0500652_007170 | 3300053131 | Bacteria | 3633 |
| 814 | Ga0500658_0002174 | 3300053134 | Bacteria | 7620 |
| 815 | Ga0500561_0000602 | 3300053137 | Bacteria | 5775 |
| 816 | Ga0500573_0013167 | 3300053140 | Bacteria | 4657 |
| 817 | Ga0500616_0000783 | 3300053153 | Bacteria | 36539 |
| 818 | Ga0500616_0002034 | 3300053153 | Bacteria | 17835 |
| 819 | Ga0500616_0006951 | 3300053153 | Bacteria | 7287 |
| 820 | Ga0500627_0032050 | 3300053158 | Bacteria | 2213 |
| 821 | Ga0500634_0003601 | 3300053161 | Bacteria | 6941 |
| 822 | Ga0500656_001066 | 3300053732 | Bacteria | 2258 |
| 823 | Ga0501084_0006963 | 3300054114 | Bacteria | 9314 |
| 824 | Ga0501084_0008261 | 3300054114 | Bacteria | 8586 |
| 825 | Ga0501084_0146390 | 3300054114 | Bacteria | 1990 |
| 826 | Ga0590075_006130 | 3300059424 | Bacteria | 2848 |
| 827 | Ga0587106_009639 | 3300059605 | Bacteria | 1232 |
| 828 | Ga0501082_0001363 | 3300060353 | Bacteria | 21471 |
| 829 | Ga0501082_0002837 | 3300060353 | Bacteria | 15100 |
| 830 | Ga0501082_0010785 | 3300060353 | Bacteria | 7869 |
| 831 | Ga0501082_0162214 | 3300060353 | Bacteria | 1943 |
| 832 | Ga0466962_0000963 | 3300061719 | Bacteria | 13083 |
| 833 | Ga0466962_0002503 | 3300061719 | Bacteria | 8717 |
| 834 | Ga0466962_0037285 | 3300061719 | Bacteria | 2327 |
| 835 | Ga0530510_0006823 | 3300061734 | Bacteria | 7955 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046454 | Ga0495592_0078120 | Ga0495592_0078120_1388_2386 | 328 |
| 2 | 3300048911 | Ga0496108_0106420 | Ga0496108_0106420_1333_2373 | 328 |
| 3 | 3300005983 | Ga0081540_1046845 | Ga0081540_10468452 | 331 |
| 4 | 3300030521 | Ga0307511_10022667 | Ga0307511_100226673 | 338 |
| 5 | 3300033180 | Ga0307510_10129706 | Ga0307510_101297062 | 338 |
| 6 | 3300005981 | Ga0081538_10018403 | Ga0081538_100184032 | 341 |
| 7 | 3300048915 | Ga0496112_0269477 | Ga0496112_0269477_96_1136 | 342 |
| 8 | 3300005530 | Ga0070679_100014163 | Ga0070679_1000141635 | 345 |
| 9 | 3300025921 | Ga0207652_10027503 | Ga0207652_100275034 | 345 |
| 10 | 3300015688 | Ga0183367_1007 | Ga0183367_1007183 | 347 |
| 11 | 3300028794 | Ga0307515_10087217 | Ga0307515_100872172 | 347 |
| 12 | 3300030522 | Ga0307512_10016591 | Ga0307512_100165913 | 347 |
| 13 | 3300031649 | Ga0307514_10095809 | Ga0307514_100958092 | 347 |
| 14 | 3300044684 | Ga0466966_0005929 | Ga0466966_0005929_1209_2309 | 347 |
| 15 | 3300045049 | Ga0466959_0020374 | Ga0466959_0020374_884_1984 | 347 |
| 16 | 3300050490 | nmdc:mga03n38_7581_c1 | nmdc:mga03n38_7581_c1_1891_3009 | 348 |
| 17 | 3300044735 | Ga0466968_0001751 | Ga0466968_0001751_82_1182 | 349 |
| 18 | 3300046689 | Ga0495613_0058473 | Ga0495613_0058473_905_1966 | 349 |
| 19 | 3300047444 | Ga0495675_0162200 | Ga0495675_0162200_245_1366 | 349 |
| 20 | 3300032002 | Ga0307416_100065308 | Ga0307416_1000653082 | 350 |
| 21 | 3300032004 | Ga0307414_10117210 | Ga0307414_101172102 | 350 |
| 22 | 3300046453 | Ga0495627_012636 | Ga0495627_012636_635_1753 | 350 |
| 23 | 3300046455 | Ga0495603_0064545 | Ga0495603_0064545_421_1539 | 350 |
| 24 | 3300046499 | Ga0495594_0031513 | Ga0495594_0031513_1729_2847 | 350 |
| 25 | 3300046500 | Ga0495596_0023776 | Ga0495596_0023776_697_1815 | 350 |
| 26 | 3300046507 | Ga0495606_0039152 | Ga0495606_0039152_721_1839 | 350 |
| 27 | 3300046513 | Ga0495616_0001635 | Ga0495616_0001635_9921_11039 | 350 |
| 28 | 3300046514 | Ga0495618_0045750 | Ga0495618_0045750_892_2010 | 350 |
| 29 | 3300046518 | Ga0495631_0002123 | Ga0495631_0002123_9265_10383 | 350 |
| 30 | 3300046522 | Ga0495643_0001512 | Ga0495643_0001512_15119_16237 | 350 |
| 31 | 3300046526 | Ga0495666_0035048 | Ga0495666_0035048_630_1748 | 350 |
| 32 | 3300046528 | Ga0495642_0027981 | Ga0495642_0027981_804_1922 | 350 |
| 33 | 3300046530 | Ga0495654_0008355 | Ga0495654_0008355_1039_2157 | 350 |
| 34 | 3300046557 | Ga0495622_0032646 | Ga0495622_0032646_991_2109 | 350 |
| 35 | 3300046558 | Ga0495633_0027002 | Ga0495633_0027002_1255_2373 | 350 |
| 36 | 3300046663 | Ga0495635_0099309 | Ga0495635_0099309_201_1319 | 350 |
| 37 | 3300046665 | Ga0495661_0012079 | Ga0495661_0012079_1525_2643 | 350 |
| 38 | 3300046679 | Ga0495623_0010669 | Ga0495623_0010669_4184_5302 | 350 |
| 39 | 3300046690 | Ga0495624_0077432 | Ga0495624_0077432_272_1390 | 350 |
| 40 | 3300046794 | Ga0495589_0058085 | Ga0495589_0058085_688_1806 | 350 |
| 41 | 3300047317 | Ga0495604_0055391 | Ga0495604_0055391_727_1845 | 350 |
| 42 | 3300047321 | Ga0495676_0023060 | Ga0495676_0023060_3908_5026 | 350 |
| 43 | 3300047322 | Ga0495680_0016762 | Ga0495680_0016762_1732_2850 | 350 |
| 44 | 3300047470 | Ga0495681_0050900 | Ga0495681_0050900_464_1582 | 350 |
| 45 | 3300047472 | Ga0495686_0055049 | Ga0495686_0055049_734_1852 | 350 |
| 46 | 3300049460 | Ga0495682_0033404 | Ga0495682_0033404_503_1621 | 350 |
| 47 | 3300046452 | Ga0495617_006315 | Ga0495617_006315_2248_3366 | 351 |
| 48 | 3300046454 | Ga0495592_0098219 | Ga0495592_0098219_119_1231 | 351 |
| 49 | 3300046491 | Ga0495584_0054468 | Ga0495584_0054468_636_1754 | 351 |
| 50 | 3300046533 | Ga0495640_0004947 | Ga0495640_0004947_4271_5389 | 351 |
| 51 | 3300046809 | Ga0495600_0008201 | Ga0495600_0008201_849_1967 | 351 |
| 52 | 3300005329 | Ga0070683_100178183 | Ga0070683_1001781832 | 353 |
| 53 | 3300005981 | Ga0081538_10000958 | Ga0081538_1000095816 | 353 |
| 54 | 3300009176 | Ga0105242_10060004 | Ga0105242_100600043 | 353 |
| 55 | 3300013306 | Ga0163162_10490383 | Ga0163162_104903832 | 353 |
| 56 | 3300017792 | Ga0163161_10101033 | Ga0163161_101010332 | 353 |
| 57 | 3300048911 | Ga0496108_0066279 | Ga0496108_0066279_1221_2342 | 353 |
| 58 | 3300048913 | Ga0496110_0101731 | Ga0496110_0101731_770_1891 | 353 |
| 59 | 3300048914 | Ga0496111_0021337 | Ga0496111_0021337_3115_4236 | 353 |
| 60 | 3300048915 | Ga0496112_0029855 | Ga0496112_0029855_1045_2166 | 353 |
| 61 | 3300048916 | Ga0496113_0157828 | Ga0496113_0157828_647_1768 | 353 |
| 62 | 3300048917 | Ga0496114_0007544 | Ga0496114_0007544_4206_5327 | 353 |
| 63 | 3300049705 | Ga0501225_0009459 | Ga0501225_0009459_1354_2427 | 353 |
| 64 | 3300046455 | Ga0495603_0002358 | Ga0495603_0002358_911_2029 | 354 |
| 65 | 3300046455 | Ga0495603_0065036 | Ga0495603_0065036_25_1143 | 354 |
| 66 | 3300046473 | Ga0495582_0058349 | Ga0495582_0058349_317_1435 | 354 |
| 67 | 3300046475 | Ga0495639_0014570 | Ga0495639_0014570_1663_2781 | 354 |
| 68 | 3300046476 | Ga0495662_0028188 | Ga0495662_0028188_1461_2579 | 354 |
| 69 | 3300046499 | Ga0495594_0072370 | Ga0495594_0072370_501_1619 | 354 |
| 70 | 3300046663 | Ga0495635_0115511 | Ga0495635_0115511_400_1518 | 354 |
| 71 | 3300046674 | Ga0495588_0001136 | Ga0495588_0001136_371_1489 | 354 |
| 72 | 3300046675 | Ga0495657_0016339 | Ga0495657_0016339_4099_5217 | 354 |
| 73 | 3300046689 | Ga0495613_0109405 | Ga0495613_0109405_615_1733 | 354 |
| 74 | 3300046691 | Ga0495670_0153968 | Ga0495670_0153968_60_1178 | 354 |
| 75 | 3300047444 | Ga0495675_0004393 | Ga0495675_0004393_4066_5184 | 354 |
| 76 | 3300047447 | Ga0495685_062430 | Ga0495685_062430_27_1145 | 354 |
| 77 | 3300049127 | Ga0501306_000871 | Ga0501306_000871_301_1419 | 354 |
| 78 | 3300049587 | Ga0501071_0046170 | Ga0501071_0046170_1112_2197 | 354 |
| 79 | 3300060353 | Ga0501082_0162214 | Ga0501082_0162214_533_1618 | 354 |
| 80 | 3300061734 | Ga0530510_0006823 | Ga0530510_0006823_4236_5321 | 354 |
| 81 | 3300006844 | Ga0075428_100132945 | Ga0075428_1001329452 | 355 |
| 82 | 3300020082 | Ga0206353_10237768 | Ga0206353_102377687 | 355 |
| 83 | 3300047318 | Ga0495636_0018696 | Ga0495636_0018696_407_1546 | 355 |
| 84 | 3300047447 | Ga0495685_041956 | Ga0495685_041956_371_1510 | 355 |
| 85 | 3300044656 | Ga0466969_0017395 | Ga0466969_0017395_907_2022 | 356 |
| 86 | 3300044684 | Ga0466966_0006679 | Ga0466966_0006679_3447_4562 | 356 |
| 87 | 3300044693 | Ga0466961_0001045 | Ga0466961_0001045_480_1595 | 356 |
| 88 | 3300044719 | Ga0466971_0001266 | Ga0466971_0001266_5044_6159 | 356 |
| 89 | 3300045049 | Ga0466959_0005036 | Ga0466959_0005036_6555_7670 | 356 |
| 90 | 3300045836 | Ga0466958_0017180 | Ga0466958_0017180_2097_3212 | 356 |
| 91 | 3300045976 | Ga0466967_0030537 | Ga0466967_0030537_244_1362 | 356 |
| 92 | 3300046514 | Ga0495618_0049846 | Ga0495618_0049846_836_1948 | 356 |
| 93 | 3300046516 | Ga0495628_0079730 | Ga0495628_0079730_1091_2203 | 356 |
| 94 | 3300046642 | Ga0495634_0023503 | Ga0495634_0023503_872_1984 | 356 |
| 95 | 3300050494 | nmdc:mga06z11_5609_c1 | nmdc:mga06z11_5609_c1_3903_5021 | 356 |
| 96 | 3300053077 | Ga0495601_0050566 | Ga0495601_0050566_64_1176 | 356 |
| 97 | 3300061719 | Ga0466962_0002503 | Ga0466962_0002503_6755_7870 | 356 |
| 98 | 3300001989 | JGI24739J22299_10026852 | JGI24739J22299_100268522 | 357 |
| 99 | 3300002075 | JGI24738J21930_10012699 | JGI24738J21930_100126991 | 357 |
| 100 | 3300013307 | Ga0157372_10327031 | Ga0157372_103270311 | 357 |
| 101 | 3300025904 | Ga0207647_10026598 | Ga0207647_100265982 | 357 |
| 102 | 3300028794 | Ga0307515_10142214 | Ga0307515_101422142 | 357 |
| 103 | 3300030522 | Ga0307512_10012127 | Ga0307512_100121274 | 357 |
| 104 | 3300031456 | Ga0307513_10090310 | Ga0307513_100903103 | 357 |
| 105 | 3300031616 | Ga0307508_10094817 | Ga0307508_100948172 | 357 |
| 106 | 3300046663 | Ga0495635_0122230 | Ga0495635_0122230_584_1708 | 357 |
| 107 | 3300005985 | Ga0081539_10000292 | Ga0081539_10000292109 | 358 |
| 108 | 3300005985 | Ga0081539_10011343 | Ga0081539_100113435 | 358 |
| 109 | 3300005985 | Ga0081539_10018862 | Ga0081539_100188623 | 358 |
| 110 | 3300005985 | Ga0081539_10020454 | Ga0081539_100204541 | 358 |
| 111 | 3300006844 | Ga0075428_100004393 | Ga0075428_10000439318 | 358 |
| 112 | 3300006846 | Ga0075430_100003006 | Ga0075430_1000030067 | 358 |
| 113 | 3300006847 | Ga0075431_100003087 | Ga0075431_1000030877 | 358 |
| 114 | 3300006880 | Ga0075429_100000303 | Ga0075429_1000003037 | 358 |
| 115 | 3300009147 | Ga0114129_10000100 | Ga0114129_1000010028 | 358 |
| 116 | 3300031731 | Ga0307405_10124011 | Ga0307405_101240112 | 358 |
| 117 | 3300031852 | Ga0307410_10082643 | Ga0307410_100826432 | 358 |
| 118 | 3300031995 | Ga0307409_100121701 | Ga0307409_1001217012 | 358 |
| 119 | 3300032002 | Ga0307416_100075738 | Ga0307416_1000757381 | 358 |
| 120 | 3300032002 | Ga0307416_100125664 | Ga0307416_1001256643 | 358 |
| 121 | 3300032126 | Ga0307415_100069039 | Ga0307415_1000690392 | 358 |
| 122 | 3300033179 | Ga0307507_10000019 | Ga0307507_10000019190 | 358 |
| 123 | 3300044656 | Ga0466969_0023298 | Ga0466969_0023298_1558_2697 | 358 |
| 124 | 3300044693 | Ga0466961_0132357 | Ga0466961_0132357_327_1466 | 358 |
| 125 | 3300044719 | Ga0466971_0029149 | Ga0466971_0029149_330_1469 | 358 |
| 126 | 3300045049 | Ga0466959_0021303 | Ga0466959_0021303_1315_2454 | 358 |
| 127 | 3300049539 | Ga0501323_000125 | Ga0501323_000125_2305_3420 | 358 |
| 128 | 3300049540 | Ga0501324_000079 | Ga0501324_000079_1844_2959 | 358 |
| 129 | 3300050507 | nmdc:mga05p37_804_c2 | nmdc:mga05p37_804_c2_24015_25124 | 358 |
| 130 | 3300050508 | nmdc:mga09592_2828_c1 | nmdc:mga09592_2828_c1_10541_11650 | 358 |
| 131 | 3300050509 | nmdc:mga0qj67_2509_c1 | nmdc:mga0qj67_2509_c1_10312_11421 | 358 |
| 132 | 3300050510 | nmdc:mga06r32_532_c1 | nmdc:mga06r32_532_c1_17455_18564 | 358 |
| 133 | 3300059424 | Ga0590075_006130 | Ga0590075_006130_273_1367 | 358 |
| 134 | 3300046454 | Ga0495592_0002763 | Ga0495592_0002763_3369_4487 | 359 |
| 135 | 3300046462 | Ga0495651_0020136 | Ga0495651_0020136_3249_4367 | 359 |
| 136 | 3300046529 | Ga0495652_0070413 | Ga0495652_0070413_890_2008 | 359 |
| 137 | 3300046642 | Ga0495634_0017111 | Ga0495634_0017111_724_1842 | 359 |
| 138 | 3300046809 | Ga0495600_0011153 | Ga0495600_0011153_3132_4250 | 359 |
| 139 | 3300047444 | Ga0495675_0071452 | Ga0495675_0071452_893_2011 | 359 |
| 140 | 3300005336 | Ga0070680_100112524 | Ga0070680_1001125242 | 360 |
| 141 | 3300005339 | Ga0070660_100005230 | Ga0070660_1000052304 | 360 |
| 142 | 3300005458 | Ga0070681_10044433 | Ga0070681_100444332 | 360 |
| 143 | 3300005535 | Ga0070684_100044105 | Ga0070684_1000441052 | 360 |
| 144 | 3300005981 | Ga0081538_10001594 | Ga0081538_1000159424 | 360 |
| 145 | 3300009093 | Ga0105240_10033493 | Ga0105240_100334935 | 360 |
| 146 | 3300020069 | Ga0197907_11047224 | Ga0197907_110472242 | 360 |
| 147 | 3300025917 | Ga0207660_10125865 | Ga0207660_101258652 | 360 |
| 148 | 3300025929 | Ga0207664_10021773 | Ga0207664_100217732 | 360 |
| 149 | 3300025949 | Ga0207667_10048745 | Ga0207667_100487453 | 360 |
| 150 | 3300030745 | Ga0316182_1376048 | Ga0316182_13760482 | 360 |
| 151 | 3300031456 | Ga0307513_10000009 | Ga0307513_10000009233 | 360 |
| 152 | 3300048911 | Ga0496108_0186897 | Ga0496108_0186897_189_1280 | 360 |
| 153 | 3300048917 | Ga0496114_0054268 | Ga0496114_0054268_509_1600 | 360 |
| 154 | 3300048917 | Ga0496114_0205334 | Ga0496114_0205334_322_1413 | 360 |
| 155 | 3300049661 | Ga0501217_006471 | Ga0501217_006471_965_2101 | 360 |
| 156 | iso_pu_bacteria | 2554235227 | 2555231176 | 360 |
| 157 | iso_pu_bacteria | 2654587600 | 2655032833 | 360 |
| 158 | 3300031995 | Ga0307409_100055774 | Ga0307409_1000557742 | 361 |
| 159 | iso_pu_bacteria | 2643221601 | 2644017883 | 361 |
| 160 | iso_pu_bacteria | 2643221631 | 2644180829 | 361 |
| 161 | iso_pu_bacteria | 2891395885 | 2891400673 | 361 |
| 162 | iso_pu_bacteria | 2920879853 | 2920882583 | 361 |
| 163 | 3300005455 | Ga0070663_100028092 | Ga0070663_1000280923 | 362 |
| 164 | 3300005548 | Ga0070665_100030289 | Ga0070665_1000302893 | 362 |
| 165 | 3300005578 | Ga0068854_100000899 | Ga0068854_1000008998 | 362 |
| 166 | 3300005616 | Ga0068852_100049839 | Ga0068852_1000498392 | 362 |
| 167 | 3300009093 | Ga0105240_10043420 | Ga0105240_100434202 | 362 |
| 168 | 3300009551 | Ga0105238_10009367 | Ga0105238_100093672 | 362 |
| 169 | 3300010375 | Ga0105239_10063085 | Ga0105239_100630853 | 362 |
| 170 | 3300013105 | Ga0157369_10164287 | Ga0157369_101642872 | 362 |
| 171 | 3300013296 | Ga0157374_10202172 | Ga0157374_102021722 | 362 |
| 172 | 3300020069 | Ga0197907_10887992 | Ga0197907_108879922 | 362 |
| 173 | 3300020070 | Ga0206356_10823945 | Ga0206356_108239452 | 362 |
| 174 | 3300020075 | Ga0206349_1610450 | Ga0206349_16104502 | 362 |
| 175 | 3300020078 | Ga0206352_10792297 | Ga0206352_107922972 | 362 |
| 176 | 3300020080 | Ga0206350_10850691 | Ga0206350_108506912 | 362 |
| 177 | 3300022467 | Ga0224712_10011329 | Ga0224712_100113292 | 362 |
| 178 | 3300022467 | Ga0224712_10013631 | Ga0224712_100136312 | 362 |
| 179 | 3300025904 | Ga0207647_10002104 | Ga0207647_100021044 | 362 |
| 180 | 3300025913 | Ga0207695_10001103 | Ga0207695_1000110310 | 362 |
| 181 | 3300025914 | Ga0207671_10000389 | Ga0207671_1000038948 | 362 |
| 182 | 3300025924 | Ga0207694_10004658 | Ga0207694_100046582 | 362 |
| 183 | 3300025949 | Ga0207667_10033632 | Ga0207667_100336325 | 362 |
| 184 | 3300025981 | Ga0207640_10004544 | Ga0207640_100045442 | 362 |
| 185 | 3300026067 | Ga0207678_10059010 | Ga0207678_100590102 | 362 |
| 186 | 3300028379 | Ga0268266_10140587 | Ga0268266_101405872 | 362 |
| 187 | 3300044656 | Ga0466969_0001666 | Ga0466969_0001666_8316_9416 | 362 |
| 188 | 3300044693 | Ga0466961_0010788 | Ga0466961_0010788_1720_2820 | 362 |
| 189 | 3300044765 | Ga0466970_0002303 | Ga0466970_0002303_3498_4598 | 362 |
| 190 | 3300046462 | Ga0495651_0001241 | Ga0495651_0001241_3368_4468 | 362 |
| 191 | 3300046511 | Ga0495608_0145202 | Ga0495608_0145202_79_1269 | 362 |
| 192 | 3300046516 | Ga0495628_0032907 | Ga0495628_0032907_1063_2163 | 362 |
| 193 | 3300046529 | Ga0495652_0019500 | Ga0495652_0019500_3185_4285 | 362 |
| 194 | 3300046543 | Ga0495645_0013132 | Ga0495645_0013132_1936_3036 | 362 |
| 195 | 3300046809 | Ga0495600_0013585 | Ga0495600_0013585_1826_2926 | 362 |
| 196 | 3300047443 | Ga0495687_039840 | Ga0495687_039840_380_1468 | 362 |
| 197 | 3300048917 | Ga0496114_0112280 | Ga0496114_0112280_1142_2245 | 362 |
| 198 | 3300053077 | Ga0495601_0081822 | Ga0495601_0081822_941_2041 | 362 |
| 199 | iso_pu_bacteria | 2643221711 | 2644611135 | 362 |
| 200 | iso_pu_bacteria | 2738541264 | 2738669361 | 362 |
| 201 | iso_pu_bacteria | 2738541356 | 2739148485 | 362 |
| 202 | iso_pu_bacteria | 2816332119 | 2816426193 | 362 |
| 203 | iso_pu_bacteria | 2818991318 | 2819427792 | 362 |
| 204 | 3300048917 | Ga0496114_0002155 | Ga0496114_0002155_12734_13843 | 363 |
| 205 | iso_pu_bacteria | 2868088558 | 2868089035 | 363 |
| 206 | iso_pu_bacteria | 2902799365 | 2902801127 | 363 |
| 207 | iso_pu_bacteria | 3006425503 | 3006426396 | 363 |
| 208 | iso_pu_bacteria | 8025478263 | 8025479271 | 363 |
| 209 | iso_pu_bacteria | 8056054917 | 8056059438 | 363 |
| 210 | iso_pu_bacteria | 8056447290 | 8056452231 | 363 |
| 211 | iso_pu_bacteria | 8056667051 | 8056667615 | 363 |
| 212 | 3300005435 | Ga0070714_100002556 | Ga0070714_1000025565 | 364 |
| 213 | 3300005518 | Ga0070699_100320600 | Ga0070699_1003206001 | 364 |
| 214 | 3300013104 | Ga0157370_10327625 | Ga0157370_103276251 | 364 |
| 215 | 3300013306 | Ga0163162_10063073 | Ga0163162_100630732 | 364 |
| 216 | 3300028563 | Ga0265319_1003772 | Ga0265319_10037727 | 364 |
| 217 | 3300028563 | Ga0265319_1018115 | Ga0265319_10181153 | 364 |
| 218 | 3300028573 | Ga0265334_10009414 | Ga0265334_100094143 | 364 |
| 219 | 3300028577 | Ga0265318_10000755 | Ga0265318_1000075510 | 364 |
| 220 | 3300028800 | Ga0265338_10016895 | Ga0265338_100168956 | 364 |
| 221 | 3300028800 | Ga0265338_10174998 | Ga0265338_101749982 | 364 |
| 222 | 3300031235 | Ga0265330_10004174 | Ga0265330_100041744 | 364 |
| 223 | 3300031239 | Ga0265328_10001580 | Ga0265328_100015807 | 364 |
| 224 | 3300031240 | Ga0265320_10003043 | Ga0265320_100030438 | 364 |
| 225 | 3300031241 | Ga0265325_10003090 | Ga0265325_100030909 | 364 |
| 226 | 3300031241 | Ga0265325_10104385 | Ga0265325_101043852 | 364 |
| 227 | 3300031242 | Ga0265329_10004498 | Ga0265329_100044982 | 364 |
| 228 | 3300031247 | Ga0265340_10002687 | Ga0265340_100026875 | 364 |
| 229 | 3300031344 | Ga0265316_10020393 | Ga0265316_100203933 | 364 |
| 230 | 3300031711 | Ga0265314_10051320 | Ga0265314_100513203 | 364 |
| 231 | 3300037418 | Ga0395900_0009810 | Ga0395900_0009810_3583_4695 | 364 |
| 232 | 3300037466 | Ga0395898_0092848 | Ga0395898_0092848_704_1816 | 364 |
| 233 | 3300037471 | Ga0395905_0270138 | Ga0395905_0270138_111_1223 | 364 |
| 234 | 3300038443 | Ga0395901_0013035 | Ga0395901_0013035_4800_5912 | 364 |
| 235 | 3300045836 | Ga0466958_0113190 | Ga0466958_0113190_162_1274 | 364 |
| 236 | 3300046535 | Ga0495586_0145788 | Ga0495586_0145788_17_1129 | 364 |
| 237 | 3300047317 | Ga0495604_0005551 | Ga0495604_0005551_3613_4725 | 364 |
| 238 | 3300047444 | Ga0495675_0011798 | Ga0495675_0011798_2798_3910 | 364 |
| 239 | 3300048903 | Ga0496100_0000374 | Ga0496100_0000374_7017_8129 | 364 |
| 240 | 3300048904 | Ga0496101_0004976 | Ga0496101_0004976_5363_6475 | 364 |
| 241 | 3300048905 | Ga0496102_0008486 | Ga0496102_0008486_6688_7800 | 364 |
| 242 | 3300048906 | Ga0496103_0011717 | Ga0496103_0011717_3331_4443 | 364 |
| 243 | 3300048907 | Ga0496104_0000785 | Ga0496104_0000785_1672_2784 | 364 |
| 244 | 3300048907 | Ga0496104_0057964 | Ga0496104_0057964_2456_3568 | 364 |
| 245 | 3300048907 | Ga0496104_0354618 | Ga0496104_0354618_49_1161 | 364 |
| 246 | 3300048908 | Ga0496105_0004871 | Ga0496105_0004871_7211_8323 | 364 |
| 247 | 3300048908 | Ga0496105_0128263 | Ga0496105_0128263_647_1759 | 364 |
| 248 | 3300048911 | Ga0496108_0102792 | Ga0496108_0102792_433_1545 | 364 |
| 249 | 3300048913 | Ga0496110_0006505 | Ga0496110_0006505_6487_7599 | 364 |
| 250 | 3300048914 | Ga0496111_0035948 | Ga0496111_0035948_1615_2727 | 364 |
| 251 | 3300048915 | Ga0496112_0010916 | Ga0496112_0010916_1824_2936 | 364 |
| 252 | 3300048916 | Ga0496113_0080041 | Ga0496113_0080041_715_1827 | 364 |
| 253 | 3300048917 | Ga0496114_0003978 | Ga0496114_0003978_1305_2417 | 364 |
| 254 | 3300048917 | Ga0496114_0019381 | Ga0496114_0019381_1853_2965 | 364 |
| 255 | 3300048917 | Ga0496114_0030255 | Ga0496114_0030255_1710_2822 | 364 |
| 256 | iso_pu_bacteria | 2547132111 | 2547412986 | 364 |
| 257 | iso_pu_bacteria | 2554235005 | 2554259132 | 364 |
| 258 | iso_pu_bacteria | 2582581312 | 2585298656 | 364 |
| 259 | iso_pu_bacteria | 2582581313 | 2585307626 | 364 |
| 260 | iso_pu_bacteria | 2582581314 | 2585314325 | 364 |
| 261 | iso_pu_bacteria | 2616644814 | 2616694052 | 364 |
| 262 | iso_pu_bacteria | 2616644941 | 2616899229 | 364 |
| 263 | iso_pu_bacteria | 2643221548 | 2643759121 | 364 |
| 264 | iso_pu_bacteria | 2643221578 | 2643897173 | 364 |
| 265 | iso_pu_bacteria | 2643221587 | 2643945357 | 364 |
| 266 | iso_pu_bacteria | 2643221647 | 2644270898 | 364 |
| 267 | iso_pu_bacteria | 2643221670 | 2644387577 | 364 |
| 268 | iso_pu_bacteria | 2643221673 | 2644408318 | 364 |
| 269 | iso_pu_bacteria | 2643221677 | 2644432256 | 364 |
| 270 | iso_pu_bacteria | 2643221678 | 2644435565 | 364 |
| 271 | iso_pu_bacteria | 2643221682 | 2644463461 | 364 |
| 272 | iso_pu_bacteria | 2643221714 | 2644630452 | 364 |
| 273 | iso_pu_bacteria | 2767802112 | 2768646746 | 364 |
| 274 | iso_pu_bacteria | 2784132148 | 2784587197 | 364 |
| 275 | iso_pu_bacteria | 2784746763 | 2785345179 | 364 |
| 276 | iso_pu_bacteria | 2784746768 | 2785367707 | 364 |
| 277 | iso_pu_bacteria | 2786546132 | 2786668762 | 364 |
| 278 | iso_pu_bacteria | 2791355406 | 2793981215 | 364 |
| 279 | iso_pu_bacteria | 2802429296 | 2804844223 | 364 |
| 280 | iso_pu_bacteria | 2808606359 | 2808848183 | 364 |
| 281 | iso_pu_bacteria | 2808606375 | 2808916725 | 364 |
| 282 | iso_pu_bacteria | 2808606375 | 2808918947 | 364 |
| 283 | iso_pu_bacteria | 2808606448 | 2809230756 | 364 |
| 284 | iso_pu_bacteria | 2808606982 | 2811847410 | 364 |
| 285 | iso_pu_bacteria | 2811994872 | 2812322896 | 364 |
| 286 | iso_pu_bacteria | 2811994879 | 2812359820 | 364 |
| 287 | iso_pu_bacteria | 2811994917 | 2812481905 | 364 |
| 288 | iso_pu_bacteria | 2818991463 | 2819694306 | 364 |
| 289 | iso_pu_bacteria | 2839986021 | 2839987203 | 364 |
| 290 | iso_pu_bacteria | 2852635781 | 2852638202 | 364 |
| 291 | iso_pu_bacteria | 2862178590 | 2862183154 | 364 |
| 292 | iso_pu_bacteria | 2862281513 | 2862288935 | 364 |
| 293 | iso_pu_bacteria | 2862290372 | 2862291561 | 364 |
| 294 | iso_pu_bacteria | 2862382967 | 2862389139 | 364 |
| 295 | iso_pu_bacteria | 2862507626 | 2862508582 | 364 |
| 296 | iso_pu_bacteria | 2862574272 | 2862583184 | 364 |
| 297 | iso_pu_bacteria | 2862705112 | 2862707272 | 364 |
| 298 | iso_pu_bacteria | 2863404153 | 2863406436 | 364 |
| 299 | iso_pu_bacteria | 2867346516 | 2867352003 | 364 |
| 300 | iso_pu_bacteria | 2867428634 | 2867430634 | 364 |
| 301 | iso_pu_bacteria | 2867475112 | 2867476247 | 364 |
| 302 | iso_pu_bacteria | 2873151551 | 2873157221 | 364 |
| 303 | iso_pu_bacteria | 2875391855 | 2875393120 | 364 |
| 304 | iso_pu_bacteria | 2877676314 | 2877682843 | 364 |
| 305 | iso_pu_bacteria | 2912715099 | 2912721864 | 364 |
| 306 | iso_pu_bacteria | 2912723979 | 2912725670 | 364 |
| 307 | iso_pu_bacteria | 2912757875 | 2912759321 | 364 |
| 308 | iso_pu_bacteria | 2918501144 | 2918502999 | 364 |
| 309 | iso_pu_bacteria | 2935390628 | 2935394333 | 364 |
| 310 | iso_pu_bacteria | 2946045630 | 2946051570 | 364 |
| 311 | iso_pu_bacteria | 2946064051 | 2946066088 | 364 |
| 312 | iso_pu_bacteria | 2946072368 | 2946074390 | 364 |
| 313 | iso_pu_bacteria | 2947224130 | 2947231286 | 364 |
| 314 | iso_pu_bacteria | 2954002825 | 2954004568 | 364 |
| 315 | iso_pu_bacteria | 2954380949 | 2954388035 | 364 |
| 316 | iso_pu_bacteria | 2954673503 | 2954675042 | 364 |
| 317 | iso_pu_bacteria | 2954682443 | 2954689093 | 364 |
| 318 | iso_pu_bacteria | 2954691527 | 2954698845 | 364 |
| 319 | iso_pu_bacteria | 2954701450 | 2954703377 | 364 |
| 320 | iso_pu_bacteria | 2954711539 | 2954717823 | 364 |
| 321 | iso_pu_bacteria | 2954721474 | 2954727789 | 364 |
| 322 | iso_pu_bacteria | 2954731030 | 2954734013 | 364 |
| 323 | iso_pu_bacteria | 2954740390 | 2954746689 | 364 |
| 324 | iso_pu_bacteria | 2954749733 | 2954752896 | 364 |
| 325 | iso_pu_bacteria | 2954759201 | 2954765799 | 364 |
| 326 | iso_pu_bacteria | 2966598605 | 2966603921 | 364 |
| 327 | iso_pu_bacteria | 2990044586 | 2990044730 | 364 |
| 328 | iso_pu_bacteria | 2990059506 | 2990066316 | 364 |
| 329 | iso_pu_bacteria | 2990088156 | 2990092908 | 364 |
| 330 | iso_pu_bacteria | 2997451912 | 2997458727 | 364 |
| 331 | iso_pu_bacteria | 2997600082 | 2997606764 | 364 |
| 332 | iso_pu_bacteria | 3006321560 | 3006323280 | 364 |
| 333 | iso_pu_bacteria | 3006393351 | 3006395514 | 364 |
| 334 | iso_pu_bacteria | 3006486233 | 3006492996 | 364 |
| 335 | iso_pu_bacteria | 3006493962 | 3006496526 | 364 |
| 336 | iso_pu_bacteria | 8008485437 | 8008489695 | 364 |
| 337 | iso_pu_bacteria | 8008558824 | 8008561870 | 364 |
| 338 | iso_pu_bacteria | 8008574985 | 8008580287 | 364 |
| 339 | iso_pu_bacteria | 8023623736 | 8023628029 | 364 |
| 340 | iso_pu_bacteria | 8025413630 | 8025419641 | 364 |
| 341 | iso_pu_bacteria | 8025524527 | 8025528729 | 364 |
| 342 | iso_pu_bacteria | 8025530807 | 8025535555 | 364 |
| 343 | iso_pu_bacteria | 8033684223 | 8033687337 | 364 |
| 344 | iso_pu_bacteria | 8047893842 | 8047899789 | 364 |
| 345 | iso_pu_bacteria | 8048127548 | 8048137457 | 364 |
| 346 | iso_pu_bacteria | 8048356638 | 8048359141 | 364 |
| 347 | iso_pu_bacteria | 8048369669 | 8048376737 | 364 |
| 348 | iso_pu_bacteria | 8048379754 | 8048385790 | 364 |
| 349 | iso_pu_bacteria | 8048406513 | 8048407730 | 364 |
| 350 | iso_pu_bacteria | 8054160619 | 8054163491 | 364 |
| 351 | iso_pu_bacteria | 8056829672 | 8056833109 | 364 |
| 352 | 3300003911 | JGI25405J52794_10006402 | JGI25405J52794_100064022 | 365 |
| 353 | 3300005331 | Ga0070670_100242993 | Ga0070670_1002429932 | 365 |
| 354 | 3300005347 | Ga0070668_100028825 | Ga0070668_1000288253 | 365 |
| 355 | 3300005347 | Ga0070668_100058984 | Ga0070668_1000589842 | 365 |
| 356 | 3300005366 | Ga0070659_100078977 | Ga0070659_1000789771 | 365 |
| 357 | 3300005435 | Ga0070714_100031451 | Ga0070714_1000314514 | 365 |
| 358 | 3300005435 | Ga0070714_100043111 | Ga0070714_1000431113 | 365 |
| 359 | 3300005457 | Ga0070662_100341253 | Ga0070662_1003412531 | 365 |
| 360 | 3300005459 | Ga0068867_100029542 | Ga0068867_1000295422 | 365 |
| 361 | 3300005539 | Ga0068853_100075340 | Ga0068853_1000753402 | 365 |
| 362 | 3300005548 | Ga0070665_100003530 | Ga0070665_10000353013 | 365 |
| 363 | 3300005578 | Ga0068854_100032930 | Ga0068854_1000329301 | 365 |
| 364 | 3300005937 | Ga0081455_10000389 | Ga0081455_1000038916 | 365 |
| 365 | 3300005937 | Ga0081455_10002237 | Ga0081455_1000223710 | 365 |
| 366 | 3300005937 | Ga0081455_10068793 | Ga0081455_100687932 | 365 |
| 367 | 3300006051 | Ga0075364_10257527 | Ga0075364_102575271 | 365 |
| 368 | 3300006058 | Ga0075432_10000058 | Ga0075432_100000587 | 365 |
| 369 | 3300006058 | Ga0075432_10001078 | Ga0075432_100010788 | 365 |
| 370 | 3300006844 | Ga0075428_100005267 | Ga0075428_10000526711 | 365 |
| 371 | 3300006844 | Ga0075428_100006278 | Ga0075428_10000627814 | 365 |
| 372 | 3300006847 | Ga0075431_100007939 | Ga0075431_1000079392 | 365 |
| 373 | 3300006852 | Ga0075433_10000219 | Ga0075433_1000021915 | 365 |
| 374 | 3300006852 | Ga0075433_10000698 | Ga0075433_100006989 | 365 |
| 375 | 3300006871 | Ga0075434_100000609 | Ga0075434_1000006093 | 365 |
| 376 | 3300006871 | Ga0075434_100013208 | Ga0075434_1000132085 | 365 |
| 377 | 3300006880 | Ga0075429_100145690 | Ga0075429_1001456902 | 365 |
| 378 | 3300006914 | Ga0075436_100010602 | Ga0075436_1000106023 | 365 |
| 379 | 3300007076 | Ga0075435_100020295 | Ga0075435_1000202954 | 365 |
| 380 | 3300009094 | Ga0111539_10000761 | Ga0111539_1000076115 | 365 |
| 381 | 3300009094 | Ga0111539_10008525 | Ga0111539_100085258 | 365 |
| 382 | 3300009098 | Ga0105245_10045486 | Ga0105245_100454862 | 365 |
| 383 | 3300009098 | Ga0105245_10260995 | Ga0105245_102609952 | 365 |
| 384 | 3300009147 | Ga0114129_10000041 | Ga0114129_1000004143 | 365 |
| 385 | 3300009147 | Ga0114129_10082418 | Ga0114129_100824183 | 365 |
| 386 | 3300009148 | Ga0105243_10002638 | Ga0105243_1000263811 | 365 |
| 387 | 3300009551 | Ga0105238_10084884 | Ga0105238_100848842 | 365 |
| 388 | 3300009553 | Ga0105249_10031513 | Ga0105249_100315132 | 365 |
| 389 | 3300010375 | Ga0105239_10105341 | Ga0105239_101053412 | 365 |
| 390 | 3300013297 | Ga0157378_10082171 | Ga0157378_100821712 | 365 |
| 391 | 3300013306 | Ga0163162_10014513 | Ga0163162_100145133 | 365 |
| 392 | 3300013306 | Ga0163162_10026523 | Ga0163162_100265232 | 365 |
| 393 | 3300013307 | Ga0157372_10062032 | Ga0157372_100620322 | 365 |
| 394 | 3300013307 | Ga0157372_10227221 | Ga0157372_102272212 | 365 |
| 395 | 3300014325 | Ga0163163_10081519 | Ga0163163_100815192 | 365 |
| 396 | 3300020078 | Ga0206352_10129169 | Ga0206352_101291692 | 365 |
| 397 | 3300020081 | Ga0206354_11547845 | Ga0206354_115478452 | 365 |
| 398 | 3300020082 | Ga0206353_10892018 | Ga0206353_108920182 | 365 |
| 399 | 3300025294 | Ga0209025_1031905 | Ga0209025_10319052 | 365 |
| 400 | 3300025901 | Ga0207688_10089904 | Ga0207688_100899042 | 365 |
| 401 | 3300025933 | Ga0207706_10014617 | Ga0207706_100146171 | 365 |
| 402 | 3300025935 | Ga0207709_10008557 | Ga0207709_100085574 | 365 |
| 403 | 3300025935 | Ga0207709_10083454 | Ga0207709_100834542 | 365 |
| 404 | 3300025961 | Ga0207712_10026878 | Ga0207712_100268782 | 365 |
| 405 | 3300025972 | Ga0207668_10068626 | Ga0207668_100686262 | 365 |
| 406 | 3300025972 | Ga0207668_10100734 | Ga0207668_101007341 | 365 |
| 407 | 3300026041 | Ga0207639_10109590 | Ga0207639_101095902 | 365 |
| 408 | 3300026075 | Ga0207708_10132762 | Ga0207708_101327622 | 365 |
| 409 | 3300026089 | Ga0207648_10043105 | Ga0207648_100431052 | 365 |
| 410 | 3300026118 | Ga0207675_100019693 | Ga0207675_1000196935 | 365 |
| 411 | 3300026118 | Ga0207675_100212978 | Ga0207675_1002129781 | 365 |
| 412 | 3300027907 | Ga0207428_10000762 | Ga0207428_1000076224 | 365 |
| 413 | 3300027907 | Ga0207428_10002987 | Ga0207428_1000298711 | 365 |
| 414 | 3300028380 | Ga0268265_10024712 | Ga0268265_100247122 | 365 |
| 415 | 3300028794 | Ga0307515_10214595 | Ga0307515_102145952 | 365 |
| 416 | 3300031548 | Ga0307408_100011119 | Ga0307408_1000111195 | 365 |
| 417 | 3300031548 | Ga0307408_100012290 | Ga0307408_1000122902 | 365 |
| 418 | 3300031548 | Ga0307408_100088836 | Ga0307408_1000888362 | 365 |
| 419 | 3300031731 | Ga0307405_10076844 | Ga0307405_100768442 | 365 |
| 420 | 3300031824 | Ga0307413_10029475 | Ga0307413_100294752 | 365 |
| 421 | 3300031824 | Ga0307413_10038737 | Ga0307413_100387372 | 365 |
| 422 | 3300031852 | Ga0307410_10000645 | Ga0307410_100006455 | 365 |
| 423 | 3300031852 | Ga0307410_10032249 | Ga0307410_100322492 | 365 |
| 424 | 3300031852 | Ga0307410_10098920 | Ga0307410_100989202 | 365 |
| 425 | 3300031901 | Ga0307406_10000359 | Ga0307406_1000035920 | 365 |
| 426 | 3300031901 | Ga0307406_10004072 | Ga0307406_100040724 | 365 |
| 427 | 3300031901 | Ga0307406_10027976 | Ga0307406_100279762 | 365 |
| 428 | 3300031903 | Ga0307407_10000506 | Ga0307407_100005067 | 365 |
| 429 | 3300031903 | Ga0307407_10001378 | Ga0307407_100013785 | 365 |
| 430 | 3300031903 | Ga0307407_10045390 | Ga0307407_100453902 | 365 |
| 431 | 3300031911 | Ga0307412_10003098 | Ga0307412_100030986 | 365 |
| 432 | 3300031911 | Ga0307412_10093860 | Ga0307412_100938602 | 365 |
| 433 | 3300031995 | Ga0307409_100001043 | Ga0307409_1000010436 | 365 |
| 434 | 3300032002 | Ga0307416_100000776 | Ga0307416_10000077612 | 365 |
| 435 | 3300032002 | Ga0307416_100003499 | Ga0307416_1000034995 | 365 |
| 436 | 3300032002 | Ga0307416_100159845 | Ga0307416_1001598452 | 365 |
| 437 | 3300032004 | Ga0307414_10007469 | Ga0307414_100074694 | 365 |
| 438 | 3300032004 | Ga0307414_10335914 | Ga0307414_103359141 | 365 |
| 439 | 3300032005 | Ga0307411_10004265 | Ga0307411_100042652 | 365 |
| 440 | 3300032005 | Ga0307411_10016950 | Ga0307411_100169502 | 365 |
| 441 | 3300032005 | Ga0307411_10221402 | Ga0307411_102214021 | 365 |
| 442 | 3300032126 | Ga0307415_100006340 | Ga0307415_1000063402 | 365 |
| 443 | 3300032126 | Ga0307415_100015176 | Ga0307415_1000151763 | 365 |
| 444 | 3300033179 | Ga0307507_10054821 | Ga0307507_100548212 | 365 |
| 445 | 3300035242 | Ga0373962_0004271 | Ga0373962_0004271_1561_2664 | 365 |
| 446 | 3300039437 | Ga0436365_0877362 | Ga0436365_0877362_30_1148 | 365 |
| 447 | 3300042436 | Ga0439435_0039769 | Ga0439435_0039769_168_1283 | 365 |
| 448 | 3300042439 | Ga0439464_0005535 | Ga0439464_0005535_682_1797 | 365 |
| 449 | 3300042439 | Ga0439464_0007100 | Ga0439464_0007100_421_1536 | 365 |
| 450 | 3300044683 | Ga0466965_0003319 | Ga0466965_0003319_629_1738 | 365 |
| 451 | 3300044693 | Ga0466961_0099295 | Ga0466961_0099295_713_1819 | 365 |
| 452 | 3300044694 | Ga0466963_0006548 | Ga0466963_0006548_2558_3664 | 365 |
| 453 | 3300044694 | Ga0466963_0019548 | Ga0466963_0019548_85_1188 | 365 |
| 454 | 3300044694 | Ga0466963_0022816 | Ga0466963_0022816_136_1245 | 365 |
| 455 | 3300044706 | Ga0466964_0016597 | Ga0466964_0016597_1455_2564 | 365 |
| 456 | 3300044735 | Ga0466968_0000717 | Ga0466968_0000717_7228_8343 | 365 |
| 457 | 3300044765 | Ga0466970_0046361 | Ga0466970_0046361_286_1395 | 365 |
| 458 | 3300044901 | Ga0466960_0019159 | Ga0466960_0019159_26_1141 | 365 |
| 459 | 3300045049 | Ga0466959_0003522 | Ga0466959_0003522_5099_6214 | 365 |
| 460 | 3300045836 | Ga0466958_0136322 | Ga0466958_0136322_17_1126 | 365 |
| 461 | 3300045976 | Ga0466967_0001931 | Ga0466967_0001931_2042_3151 | 365 |
| 462 | 3300045976 | Ga0466967_0004056 | Ga0466967_0004056_4026_5132 | 365 |
| 463 | 3300045976 | Ga0466967_0159755 | Ga0466967_0159755_367_1482 | 365 |
| 464 | 3300046457 | Ga0495590_0000234 | Ga0495590_0000234_11932_13041 | 365 |
| 465 | 3300046538 | Ga0495609_0109486 | Ga0495609_0109486_49_1164 | 365 |
| 466 | 3300048905 | Ga0496102_0136474 | Ga0496102_0136474_264_1379 | 365 |
| 467 | 3300048915 | Ga0496112_0006151 | Ga0496112_0006151_3466_4581 | 365 |
| 468 | 3300048926 | Ga0496123_0018794 | Ga0496123_0018794_2647_3762 | 365 |
| 469 | 3300048929 | Ga0496126_0003688 | Ga0496126_0003688_10837_11952 | 365 |
| 470 | 3300049568 | Ga0501031_0000536 | Ga0501031_0000536_13438_14574 | 365 |
| 471 | 3300049569 | Ga0501032_0002282 | Ga0501032_0002282_13427_14563 | 365 |
| 472 | 3300049570 | Ga0501033_0002719 | Ga0501033_0002719_13397_14533 | 365 |
| 473 | 3300049570 | Ga0501033_0030280 | Ga0501033_0030280_688_1794 | 365 |
| 474 | 3300049571 | Ga0501034_0004750 | Ga0501034_0004750_506_1642 | 365 |
| 475 | 3300049571 | Ga0501034_0143043 | Ga0501034_0143043_678_1784 | 365 |
| 476 | 3300049572 | Ga0501036_0005396 | Ga0501036_0005396_297_1433 | 365 |
| 477 | 3300049573 | Ga0501037_0003593 | Ga0501037_0003593_6820_7956 | 365 |
| 478 | 3300049574 | Ga0501038_0003399 | Ga0501038_0003399_304_1440 | 365 |
| 479 | 3300049575 | Ga0501039_0018889 | Ga0501039_0018889_2500_3636 | 365 |
| 480 | 3300049576 | Ga0501040_0001825 | Ga0501040_0001825_12229_13365 | 365 |
| 481 | 3300049577 | Ga0501041_0004107 | Ga0501041_0004107_6858_7994 | 365 |
| 482 | 3300049578 | Ga0501042_0001841 | Ga0501042_0001841_5637_6773 | 365 |
| 483 | 3300049579 | Ga0501043_0002630 | Ga0501043_0002630_297_1433 | 365 |
| 484 | 3300049580 | Ga0501046_0003295 | Ga0501046_0003295_13397_14533 | 365 |
| 485 | 3300049581 | Ga0501047_0000750 | Ga0501047_0000750_29163_30299 | 365 |
| 486 | 3300049581 | Ga0501047_0098351 | Ga0501047_0098351_125_1234 | 365 |
| 487 | 3300049582 | Ga0501048_0006407 | Ga0501048_0006407_6528_7664 | 365 |
| 488 | 3300049583 | Ga0501067_0002169 | Ga0501067_0002169_6148_7284 | 365 |
| 489 | 3300049584 | Ga0501068_0005108 | Ga0501068_0005108_65_1201 | 365 |
| 490 | 3300049585 | Ga0501069_0001698 | Ga0501069_0001698_780_1916 | 365 |
| 491 | 3300049586 | Ga0501070_0016299 | Ga0501070_0016299_304_1440 | 365 |
| 492 | 3300049586 | Ga0501070_0043168 | Ga0501070_0043168_1197_2309 | 365 |
| 493 | 3300049587 | Ga0501071_0000711 | Ga0501071_0000711_15094_16230 | 365 |
| 494 | 3300049588 | Ga0501072_0005806 | Ga0501072_0005806_50_1186 | 365 |
| 495 | 3300049588 | Ga0501072_0068306 | Ga0501072_0068306_843_1949 | 365 |
| 496 | 3300049589 | Ga0501073_0002148 | Ga0501073_0002148_5450_6586 | 365 |
| 497 | 3300049589 | Ga0501073_0062918 | Ga0501073_0062918_858_1964 | 365 |
| 498 | 3300049590 | Ga0501074_0002337 | Ga0501074_0002337_6883_8019 | 365 |
| 499 | 3300049593 | Ga0501077_0003734 | Ga0501077_0003734_7871_9007 | 365 |
| 500 | 3300049741 | Ga0501079_0057755 | Ga0501079_0057755_330_1466 | 365 |
| 501 | 3300049742 | Ga0501080_0137357 | Ga0501080_0137357_559_1695 | 365 |
| 502 | 3300049744 | Ga0501083_0000393 | Ga0501083_0000393_3292_4428 | 365 |
| 503 | 3300049822 | Ga0501035_0001243 | Ga0501035_0001243_3277_4413 | 365 |
| 504 | 3300049823 | Ga0501044_0009004 | Ga0501044_0009004_6325_7461 | 365 |
| 505 | 3300049824 | Ga0501045_0004757 | Ga0501045_0004757_3665_4801 | 365 |
| 506 | 3300050507 | nmdc:mga05p37_39997_c1 | nmdc:mga05p37_39997_c1_1424_2533 | 365 |
| 507 | 3300050507 | nmdc:mga05p37_7421_c1 | nmdc:mga05p37_7421_c1_11627_12742 | 365 |
| 508 | 3300050508 | nmdc:mga09592_8674_c1 | nmdc:mga09592_8674_c1_2104_3213 | 365 |
| 509 | 3300050509 | nmdc:mga0qj67_1396_c1 | nmdc:mga0qj67_1396_c1_13804_14913 | 365 |
| 510 | 3300050510 | nmdc:mga06r32_23470_c1 | nmdc:mga06r32_23470_c1_2373_3488 | 365 |
| 511 | 3300050510 | nmdc:mga06r32_8900_c1 | nmdc:mga06r32_8900_c1_2264_3373 | 365 |
| 512 | 3300050511 | nmdc:mga08y16_138174_c1 | nmdc:mga08y16_138174_c1_927_2042 | 365 |
| 513 | 3300050511 | nmdc:mga08y16_7508_c1 | nmdc:mga08y16_7508_c1_9085_10200 | 365 |
| 514 | 3300050512 | nmdc:mga0n895_217_c1 | nmdc:mga0n895_217_c1_25405_26520 | 365 |
| 515 | 3300050513 | nmdc:mga0rr50_5127_c1 | nmdc:mga0rr50_5127_c1_3011_4126 | 365 |
| 516 | 3300050514 | nmdc:mga08x19_5248_c1 | nmdc:mga08x19_5248_c1_1977_3092 | 365 |
| 517 | 3300050515 | nmdc:mga0a205_10607_c1 | nmdc:mga0a205_10607_c1_3248_4363 | 365 |
| 518 | 3300050515 | nmdc:mga0a205_1731_c1 | nmdc:mga0a205_1731_c1_8474_9589 | 365 |
| 519 | 3300054114 | Ga0501084_0006963 | Ga0501084_0006963_6325_7461 | 365 |
| 520 | 3300060353 | Ga0501082_0001363 | Ga0501082_0001363_19777_20913 | 365 |
| 521 | 3300061719 | Ga0466962_0037285 | Ga0466962_0037285_250_1359 | 365 |
| 522 | iso_pu_bacteria | 3001889506 | 3001891526 | 365 |
| 523 | iso_pu_bacteria | 8004021418 | 8004022768 | 365 |
| 524 | 3300031507 | Ga0307509_10146711 | Ga0307509_101467112 | 366 |
| 525 | 3300039437 | Ga0436365_0548348 | Ga0436365_0548348_19218_20339 | 366 |
| 526 | 3300042002 | Ga0439442_000989 | Ga0439442_000989_729_1874 | 366 |
| 527 | 3300042006 | Ga0439432_029955 | Ga0439432_029955_85_1230 | 366 |
| 528 | 3300044719 | Ga0466971_0027828 | Ga0466971_0027828_56_1183 | 366 |
| 529 | 3300044842 | Ga0466957_0126315 | Ga0466957_0126315_390_1517 | 366 |
| 530 | 3300045976 | Ga0466967_0026413 | Ga0466967_0026413_1224_2336 | 366 |
| 531 | 3300046462 | Ga0495651_0002734 | Ga0495651_0002734_5335_6447 | 366 |
| 532 | 3300046679 | Ga0495623_0082593 | Ga0495623_0082593_86_1198 | 366 |
| 533 | 3300046680 | Ga0495646_0008850 | Ga0495646_0008850_3337_4449 | 366 |
| 534 | 3300046809 | Ga0495600_0105461 | Ga0495600_0105461_421_1533 | 366 |
| 535 | 3300049581 | Ga0501047_0000015 | Ga0501047_0000015_258168_259295 | 366 |
| 536 | 3300005435 | Ga0070714_100338035 | Ga0070714_1003380351 | 367 |
| 537 | 3300006846 | Ga0075430_100001112 | Ga0075430_10000111216 | 367 |
| 538 | 3300006847 | Ga0075431_100007843 | Ga0075431_1000078434 | 367 |
| 539 | 3300006880 | Ga0075429_100014193 | Ga0075429_1000141932 | 367 |
| 540 | 3300031456 | Ga0307513_10004081 | Ga0307513_100040817 | 367 |
| 541 | 3300031727 | Ga0316576_10049900 | Ga0316576_100499002 | 367 |
| 542 | 3300041491 | Ga0451833_0440150 | Ga0451833_0440150_5502_6626 | 367 |
| 543 | 3300041496 | Ga0451839_0296389 | Ga0451839_0296389_4248_5372 | 367 |
| 544 | 3300041498 | Ga0451841_1036571 | Ga0451841_1036571_349_1473 | 367 |
| 545 | 3300042014 | Ga0439457_002864 | Ga0439457_002864_353_1474 | 367 |
| 546 | 3300044656 | Ga0466969_0003320 | Ga0466969_0003320_4486_5610 | 367 |
| 547 | 3300044684 | Ga0466966_0053001 | Ga0466966_0053001_447_1571 | 367 |
| 548 | 3300044693 | Ga0466961_0024465 | Ga0466961_0024465_723_1847 | 367 |
| 549 | 3300044719 | Ga0466971_0013702 | Ga0466971_0013702_1611_2735 | 367 |
| 550 | 3300048912 | Ga0496109_0186158 | Ga0496109_0186158_79_1197 | 367 |
| 551 | 3300048913 | Ga0496110_0120423 | Ga0496110_0120423_439_1557 | 367 |
| 552 | 3300048925 | Ga0496122_0000659 | Ga0496122_0000659_64237_65370 | 367 |
| 553 | 3300049569 | Ga0501032_0003032 | Ga0501032_0003032_1042_2172 | 367 |
| 554 | 3300049571 | Ga0501034_0007650 | Ga0501034_0007650_6219_7349 | 367 |
| 555 | 3300049572 | Ga0501036_0022111 | Ga0501036_0022111_138_1268 | 367 |
| 556 | 3300049573 | Ga0501037_0200612 | Ga0501037_0200612_208_1338 | 367 |
| 557 | 3300049574 | Ga0501038_0048904 | Ga0501038_0048904_360_1490 | 367 |
| 558 | 3300049579 | Ga0501043_0043027 | Ga0501043_0043027_2384_3514 | 367 |
| 559 | 3300049580 | Ga0501046_0010272 | Ga0501046_0010272_4227_5357 | 367 |
| 560 | 3300049581 | Ga0501047_0004692 | Ga0501047_0004692_8608_9738 | 367 |
| 561 | 3300049822 | Ga0501035_0003733 | Ga0501035_0003733_9334_10464 | 367 |
| 562 | 3300049823 | Ga0501044_0034418 | Ga0501044_0034418_2575_3705 | 367 |
| 563 | 3300053153 | Ga0500616_0000783 | Ga0500616_0000783_8344_9468 | 367 |
| 564 | 3300053153 | Ga0500616_0002034 | Ga0500616_0002034_11626_12750 | 367 |
| 565 | 3300060353 | Ga0501082_0002837 | Ga0501082_0002837_4267_5397 | 367 |
| 566 | 3300061719 | Ga0466962_0000963 | Ga0466962_0000963_2037_3161 | 367 |
| 567 | 3300003308 | Ga0006777J48905_1026059 | Ga0006777J48905_10260591 | 368 |
| 568 | 3300003320 | rootH2_10008057 | rootH2_100080572 | 368 |
| 569 | 3300005548 | Ga0070665_100044001 | Ga0070665_1000440012 | 368 |
| 570 | 3300005985 | Ga0081539_10118178 | Ga0081539_101181782 | 368 |
| 571 | 3300006051 | Ga0075364_10024749 | Ga0075364_100247492 | 368 |
| 572 | 3300006948 | Ga0099826_10039049 | Ga0099826_100390492 | 368 |
| 573 | 3300014497 | Ga0182008_10007117 | Ga0182008_100071173 | 368 |
| 574 | 3300015262 | Ga0182007_10000188 | Ga0182007_1000018833 | 368 |
| 575 | 3300021388 | Ga0213875_10006019 | Ga0213875_100060192 | 368 |
| 576 | 3300025297 | Ga0209758_1003694 | Ga0209758_10036942 | 368 |
| 577 | 3300025302 | Ga0207426_1001189 | Ga0207426_100118915 | 368 |
| 578 | 3300025302 | Ga0207426_1003255 | Ga0207426_10032552 | 368 |
| 579 | 3300025302 | Ga0207426_1013527 | Ga0207426_10135272 | 368 |
| 580 | 3300025711 | Ga0207696_1005488 | Ga0207696_10054883 | 368 |
| 581 | 3300027312 | Ga0209371_1016902 | Ga0209371_10169022 | 368 |
| 582 | 3300028379 | Ga0268266_10023769 | Ga0268266_100237695 | 368 |
| 583 | 3300028786 | Ga0307517_10080637 | Ga0307517_100806372 | 368 |
| 584 | 3300028786 | Ga0307517_10094980 | Ga0307517_100949802 | 368 |
| 585 | 3300028794 | Ga0307515_10012174 | Ga0307515_1001217412 | 368 |
| 586 | 3300030521 | Ga0307511_10053002 | Ga0307511_100530022 | 368 |
| 587 | 3300031456 | Ga0307513_10080302 | Ga0307513_100803022 | 368 |
| 588 | 3300031507 | Ga0307509_10007936 | Ga0307509_1000793613 | 368 |
| 589 | 3300031616 | Ga0307508_10001366 | Ga0307508_1000136610 | 368 |
| 590 | 3300031616 | Ga0307508_10050107 | Ga0307508_100501072 | 368 |
| 591 | 3300031616 | Ga0307508_10118477 | Ga0307508_101184772 | 368 |
| 592 | 3300031649 | Ga0307514_10004180 | Ga0307514_100041808 | 368 |
| 593 | 3300031649 | Ga0307514_10044298 | Ga0307514_100442982 | 368 |
| 594 | 3300031649 | Ga0307514_10056739 | Ga0307514_100567392 | 368 |
| 595 | 3300031730 | Ga0307516_10011576 | Ga0307516_100115768 | 368 |
| 596 | 3300031730 | Ga0307516_10032208 | Ga0307516_100322083 | 368 |
| 597 | 3300033179 | Ga0307507_10096066 | Ga0307507_100960662 | 368 |
| 598 | 3300033180 | Ga0307510_10046000 | Ga0307510_100460001 | 368 |
| 599 | 3300037466 | Ga0395898_0002815 | Ga0395898_0002815_18316_19434 | 368 |
| 600 | 3300037466 | Ga0395898_0275917 | Ga0395898_0275917_127_1245 | 368 |
| 601 | 3300037853 | Ga0436364_0312203 | Ga0436364_0312203_24471_25589 | 368 |
| 602 | 3300038443 | Ga0395901_0052987 | Ga0395901_0052987_1721_2839 | 368 |
| 603 | 3300041404 | Ga0439436_0000166 | Ga0439436_0000166_4624_5742 | 368 |
| 604 | 3300041404 | Ga0439436_0008869 | Ga0439436_0008869_1199_2317 | 368 |
| 605 | 3300041404 | Ga0439436_0038124 | Ga0439436_0038124_28_1146 | 368 |
| 606 | 3300041512 | Ga0451853_3381203 | Ga0451853_3381203_637_1755 | 368 |
| 607 | 3300041999 | Ga0439433_0000788 | Ga0439433_0000788_2767_3885 | 368 |
| 608 | 3300042007 | Ga0439449_0000874 | Ga0439449_0000874_759_1877 | 368 |
| 609 | 3300042007 | Ga0439449_0004830 | Ga0439449_0004830_493_1611 | 368 |
| 610 | 3300042014 | Ga0439457_000843 | Ga0439457_000843_6932_8050 | 368 |
| 611 | 3300042014 | Ga0439457_001434 | Ga0439457_001434_3893_5011 | 368 |
| 612 | 3300042015 | Ga0439462_0009732 | Ga0439462_0009732_189_1307 | 368 |
| 613 | 3300042134 | Ga0450898_000603 | Ga0450898_000603_2650_3768 | 368 |
| 614 | 3300042135 | Ga0450899_000205 | Ga0450899_000205_2350_3468 | 368 |
| 615 | 3300042138 | Ga0450903_000034 | Ga0450903_000034_5064_6182 | 368 |
| 616 | 3300042145 | Ga0450906_000520 | Ga0450906_000520_5834_6952 | 368 |
| 617 | 3300044658 | Ga0466972_0008588 | Ga0466972_0008588_617_1735 | 368 |
| 618 | 3300044658 | Ga0466972_0010739 | Ga0466972_0010739_1594_2712 | 368 |
| 619 | 3300044683 | Ga0466965_0021558 | Ga0466965_0021558_1592_2710 | 368 |
| 620 | 3300044693 | Ga0466961_0000891 | Ga0466961_0000891_10099_11217 | 368 |
| 621 | 3300044693 | Ga0466961_0044816 | Ga0466961_0044816_794_1912 | 368 |
| 622 | 3300044694 | Ga0466963_0001647 | Ga0466963_0001647_6921_8039 | 368 |
| 623 | 3300044694 | Ga0466963_0011325 | Ga0466963_0011325_3851_4969 | 368 |
| 624 | 3300044719 | Ga0466971_0010456 | Ga0466971_0010456_2545_3663 | 368 |
| 625 | 3300044842 | Ga0466957_0000245 | Ga0466957_0000245_7033_8151 | 368 |
| 626 | 3300044901 | Ga0466960_0002720 | Ga0466960_0002720_3609_4727 | 368 |
| 627 | 3300045049 | Ga0466959_0017618 | Ga0466959_0017618_1575_2693 | 368 |
| 628 | 3300045976 | Ga0466967_0028197 | Ga0466967_0028197_3279_4397 | 368 |
| 629 | 3300046455 | Ga0495603_0005293 | Ga0495603_0005293_3955_5073 | 368 |
| 630 | 3300046455 | Ga0495603_0048040 | Ga0495603_0048040_263_1381 | 368 |
| 631 | 3300046459 | Ga0495629_0002991 | Ga0495629_0002991_9279_10397 | 368 |
| 632 | 3300046459 | Ga0495629_0052828 | Ga0495629_0052828_621_1739 | 368 |
| 633 | 3300046459 | Ga0495629_0262315 | Ga0495629_0262315_42_1160 | 368 |
| 634 | 3300046476 | Ga0495662_0017105 | Ga0495662_0017105_703_1821 | 368 |
| 635 | 3300046499 | Ga0495594_0000550 | Ga0495594_0000550_17687_18805 | 368 |
| 636 | 3300046499 | Ga0495594_0019204 | Ga0495594_0019204_449_1567 | 368 |
| 637 | 3300046514 | Ga0495618_0088506 | Ga0495618_0088506_546_1664 | 368 |
| 638 | 3300046516 | Ga0495628_0008399 | Ga0495628_0008399_3053_4171 | 368 |
| 639 | 3300046516 | Ga0495628_0038232 | Ga0495628_0038232_414_1532 | 368 |
| 640 | 3300046517 | Ga0495630_0016089 | Ga0495630_0016089_1366_2484 | 368 |
| 641 | 3300046522 | Ga0495643_0002349 | Ga0495643_0002349_3387_4505 | 368 |
| 642 | 3300046557 | Ga0495622_0006833 | Ga0495622_0006833_400_1518 | 368 |
| 643 | 3300046642 | Ga0495634_0022697 | Ga0495634_0022697_1443_2561 | 368 |
| 644 | 3300046648 | Ga0495611_0013679 | Ga0495611_0013679_1316_2434 | 368 |
| 645 | 3300046660 | Ga0495625_0028467 | Ga0495625_0028467_1282_2400 | 368 |
| 646 | 3300046660 | Ga0495625_0103074 | Ga0495625_0103074_307_1425 | 368 |
| 647 | 3300046674 | Ga0495588_0002833 | Ga0495588_0002833_2301_3419 | 368 |
| 648 | 3300046675 | Ga0495657_0005893 | Ga0495657_0005893_5049_6167 | 368 |
| 649 | 3300046675 | Ga0495657_0017933 | Ga0495657_0017933_804_1922 | 368 |
| 650 | 3300046680 | Ga0495646_0001970 | Ga0495646_0001970_10042_11160 | 368 |
| 651 | 3300046683 | Ga0495658_0012481 | Ga0495658_0012481_2342_3460 | 368 |
| 652 | 3300046689 | Ga0495613_0001173 | Ga0495613_0001173_10490_11608 | 368 |
| 653 | 3300046689 | Ga0495613_0012635 | Ga0495613_0012635_3467_4585 | 368 |
| 654 | 3300046690 | Ga0495624_0015475 | Ga0495624_0015475_2985_4103 | 368 |
| 655 | 3300046691 | Ga0495670_0004198 | Ga0495670_0004198_1019_2137 | 368 |
| 656 | 3300046694 | Ga0495649_0071333 | Ga0495649_0071333_22_1140 | 368 |
| 657 | 3300046794 | Ga0495589_0019738 | Ga0495589_0019738_309_1427 | 368 |
| 658 | 3300047315 | Ga0495581_0023185 | Ga0495581_0023185_2214_3332 | 368 |
| 659 | 3300047321 | Ga0495676_0003250 | Ga0495676_0003250_9123_10241 | 368 |
| 660 | 3300047321 | Ga0495676_0009016 | Ga0495676_0009016_3117_4235 | 368 |
| 661 | 3300047321 | Ga0495676_0010811 | Ga0495676_0010811_21_1139 | 368 |
| 662 | 3300047443 | Ga0495687_005971 | Ga0495687_005971_865_1983 | 368 |
| 663 | 3300047447 | Ga0495685_000221 | Ga0495685_000221_2470_3588 | 368 |
| 664 | 3300047447 | Ga0495685_003066 | Ga0495685_003066_3395_4513 | 368 |
| 665 | 3300047470 | Ga0495681_0005609 | Ga0495681_0005609_6648_7766 | 368 |
| 666 | 3300047470 | Ga0495681_0009675 | Ga0495681_0009675_3451_4569 | 368 |
| 667 | 3300047471 | Ga0495684_0128758 | Ga0495684_0128758_118_1236 | 368 |
| 668 | 3300047472 | Ga0495686_0030332 | Ga0495686_0030332_2036_3154 | 368 |
| 669 | 3300048089 | Ga0495614_0001082 | Ga0495614_0001082_658_1776 | 368 |
| 670 | 3300048089 | Ga0495614_0003707 | Ga0495614_0003707_4461_5579 | 368 |
| 671 | 3300048909 | Ga0496106_0240581 | Ga0496106_0240581_12_1130 | 368 |
| 672 | 3300048912 | Ga0496109_0102265 | Ga0496109_0102265_320_1438 | 368 |
| 673 | 3300048913 | Ga0496110_0231232 | Ga0496110_0231232_143_1261 | 368 |
| 674 | 3300049127 | Ga0501306_008204 | Ga0501306_008204_118_1236 | 368 |
| 675 | 3300049539 | Ga0501323_001566 | Ga0501323_001566_706_1824 | 368 |
| 676 | 3300049568 | Ga0501031_0002123 | Ga0501031_0002123_7959_9077 | 368 |
| 677 | 3300049568 | Ga0501031_0006009 | Ga0501031_0006009_5174_6295 | 368 |
| 678 | 3300049568 | Ga0501031_0014225 | Ga0501031_0014225_3478_4620 | 368 |
| 679 | 3300049568 | Ga0501031_0090620 | Ga0501031_0090620_313_1431 | 368 |
| 680 | 3300049569 | Ga0501032_0004079 | Ga0501032_0004079_6486_7604 | 368 |
| 681 | 3300049569 | Ga0501032_0005643 | Ga0501032_0005643_4314_5432 | 368 |
| 682 | 3300049569 | Ga0501032_0011400 | Ga0501032_0011400_93_1214 | 368 |
| 683 | 3300049569 | Ga0501032_0019085 | Ga0501032_0019085_223_1365 | 368 |
| 684 | 3300049569 | Ga0501032_0121256 | Ga0501032_0121256_45_1163 | 368 |
| 685 | 3300049570 | Ga0501033_0007663 | Ga0501033_0007663_5402_6544 | 368 |
| 686 | 3300049570 | Ga0501033_0008925 | Ga0501033_0008925_1509_2627 | 368 |
| 687 | 3300049570 | Ga0501033_0027215 | Ga0501033_0027215_2609_3727 | 368 |
| 688 | 3300049571 | Ga0501034_0008248 | Ga0501034_0008248_3426_4544 | 368 |
| 689 | 3300049571 | Ga0501034_0011906 | Ga0501034_0011906_2788_3909 | 368 |
| 690 | 3300049571 | Ga0501034_0016319 | Ga0501034_0016319_4610_5728 | 368 |
| 691 | 3300049571 | Ga0501034_0095440 | Ga0501034_0095440_832_1974 | 368 |
| 692 | 3300049572 | Ga0501036_0010545 | Ga0501036_0010545_3414_4535 | 368 |
| 693 | 3300049572 | Ga0501036_0012876 | Ga0501036_0012876_3426_4544 | 368 |
| 694 | 3300049572 | Ga0501036_0046032 | Ga0501036_0046032_1390_2508 | 368 |
| 695 | 3300049572 | Ga0501036_0046054 | Ga0501036_0046054_60_1178 | 368 |
| 696 | 3300049572 | Ga0501036_0099725 | Ga0501036_0099725_595_1713 | 368 |
| 697 | 3300049573 | Ga0501037_0004880 | Ga0501037_0004880_5212_6330 | 368 |
| 698 | 3300049573 | Ga0501037_0008803 | Ga0501037_0008803_3220_4362 | 368 |
| 699 | 3300049573 | Ga0501037_0040284 | Ga0501037_0040284_2048_3169 | 368 |
| 700 | 3300049573 | Ga0501037_0041834 | Ga0501037_0041834_429_1547 | 368 |
| 701 | 3300049573 | Ga0501037_0073632 | Ga0501037_0073632_1338_2456 | 368 |
| 702 | 3300049574 | Ga0501038_0011152 | Ga0501038_0011152_3597_4715 | 368 |
| 703 | 3300049574 | Ga0501038_0015275 | Ga0501038_0015275_2401_3519 | 368 |
| 704 | 3300049574 | Ga0501038_0037604 | Ga0501038_0037604_793_1911 | 368 |
| 705 | 3300049575 | Ga0501039_0010651 | Ga0501039_0010651_3151_4269 | 368 |
| 706 | 3300049575 | Ga0501039_0011202 | Ga0501039_0011202_4769_5887 | 368 |
| 707 | 3300049575 | Ga0501039_0015466 | Ga0501039_0015466_1132_2250 | 368 |
| 708 | 3300049575 | Ga0501039_0145635 | Ga0501039_0145635_509_1630 | 368 |
| 709 | 3300049576 | Ga0501040_0003567 | Ga0501040_0003567_2401_3519 | 368 |
| 710 | 3300049577 | Ga0501041_0001588 | Ga0501041_0001588_3657_4775 | 368 |
| 711 | 3300049578 | Ga0501042_0007844 | Ga0501042_0007844_2401_3519 | 368 |
| 712 | 3300049578 | Ga0501042_0024880 | Ga0501042_0024880_1874_2992 | 368 |
| 713 | 3300049578 | Ga0501042_0068950 | Ga0501042_0068950_1201_2343 | 368 |
| 714 | 3300049579 | Ga0501043_0002940 | Ga0501043_0002940_2124_3242 | 368 |
| 715 | 3300049579 | Ga0501043_0004752 | Ga0501043_0004752_3426_4544 | 368 |
| 716 | 3300049579 | Ga0501043_0010621 | Ga0501043_0010621_3284_4405 | 368 |
| 717 | 3300049579 | Ga0501043_0023928 | Ga0501043_0023928_3529_4647 | 368 |
| 718 | 3300049580 | Ga0501046_0005788 | Ga0501046_0005788_6488_7606 | 368 |
| 719 | 3300049580 | Ga0501046_0013477 | Ga0501046_0013477_3536_4678 | 368 |
| 720 | 3300049581 | Ga0501047_0000055 | Ga0501047_0000055_14420_15538 | 368 |
| 721 | 3300049581 | Ga0501047_0001216 | Ga0501047_0001216_20992_22110 | 368 |
| 722 | 3300049581 | Ga0501047_0009073 | Ga0501047_0009073_266_1384 | 368 |
| 723 | 3300049581 | Ga0501047_0010994 | Ga0501047_0010994_3502_4620 | 368 |
| 724 | 3300049581 | Ga0501047_0017035 | Ga0501047_0017035_722_1843 | 368 |
| 725 | 3300049581 | Ga0501047_0056625 | Ga0501047_0056625_56_1198 | 368 |
| 726 | 3300049581 | Ga0501047_0219449 | Ga0501047_0219449_10_1128 | 368 |
| 727 | 3300049581 | Ga0501047_0282264 | Ga0501047_0282264_54_1172 | 368 |
| 728 | 3300049582 | Ga0501048_0004365 | Ga0501048_0004365_6017_7135 | 368 |
| 729 | 3300049582 | Ga0501048_0148001 | Ga0501048_0148001_505_1626 | 368 |
| 730 | 3300049583 | Ga0501067_0001877 | Ga0501067_0001877_6615_7733 | 368 |
| 731 | 3300049584 | Ga0501068_0000061 | Ga0501068_0000061_35786_36904 | 368 |
| 732 | 3300049586 | Ga0501070_0009498 | Ga0501070_0009498_3426_4544 | 368 |
| 733 | 3300049586 | Ga0501070_0021752 | Ga0501070_0021752_708_1826 | 368 |
| 734 | 3300049586 | Ga0501070_0148880 | Ga0501070_0148880_415_1536 | 368 |
| 735 | 3300049587 | Ga0501071_0000111 | Ga0501071_0000111_27171_28289 | 368 |
| 736 | 3300049588 | Ga0501072_0005562 | Ga0501072_0005562_3484_4602 | 368 |
| 737 | 3300049589 | Ga0501073_0010029 | Ga0501073_0010029_2401_3519 | 368 |
| 738 | 3300049590 | Ga0501074_0002104 | Ga0501074_0002104_792_1910 | 368 |
| 739 | 3300049590 | Ga0501074_0035151 | Ga0501074_0035151_574_1692 | 368 |
| 740 | 3300049592 | Ga0501076_0007178 | Ga0501076_0007178_3639_4757 | 368 |
| 741 | 3300049593 | Ga0501077_0011444 | Ga0501077_0011444_890_2008 | 368 |
| 742 | 3300049741 | Ga0501079_0018017 | Ga0501079_0018017_3948_5066 | 368 |
| 743 | 3300049742 | Ga0501080_0065356 | Ga0501080_0065356_1939_3057 | 368 |
| 744 | 3300049744 | Ga0501083_0000169 | Ga0501083_0000169_41597_42715 | 368 |
| 745 | 3300049744 | Ga0501083_0004738 | Ga0501083_0004738_6554_7672 | 368 |
| 746 | 3300049822 | Ga0501035_0007178 | Ga0501035_0007178_3426_4544 | 368 |
| 747 | 3300049822 | Ga0501035_0011951 | Ga0501035_0011951_3561_4682 | 368 |
| 748 | 3300049822 | Ga0501035_0013913 | Ga0501035_0013913_2299_3417 | 368 |
| 749 | 3300049822 | Ga0501035_0019079 | Ga0501035_0019079_2105_3223 | 368 |
| 750 | 3300049822 | Ga0501035_0093615 | Ga0501035_0093615_537_1655 | 368 |
| 751 | 3300049822 | Ga0501035_0106475 | Ga0501035_0106475_1272_2414 | 368 |
| 752 | 3300049822 | Ga0501035_0108526 | Ga0501035_0108526_664_1782 | 368 |
| 753 | 3300049822 | Ga0501035_0246245 | Ga0501035_0246245_323_1441 | 368 |
| 754 | 3300049823 | Ga0501044_0009018 | Ga0501044_0009018_6363_7481 | 368 |
| 755 | 3300049823 | Ga0501044_0016851 | Ga0501044_0016851_3784_4905 | 368 |
| 756 | 3300049823 | Ga0501044_0031763 | Ga0501044_0031763_856_1974 | 368 |
| 757 | 3300049823 | Ga0501044_0031984 | Ga0501044_0031984_3771_4889 | 368 |
| 758 | 3300049823 | Ga0501044_0069908 | Ga0501044_0069908_242_1360 | 368 |
| 759 | 3300049823 | Ga0501044_0089560 | Ga0501044_0089560_927_2069 | 368 |
| 760 | 3300049823 | Ga0501044_0092045 | Ga0501044_0092045_1340_2458 | 368 |
| 761 | 3300049823 | Ga0501044_0122347 | Ga0501044_0122347_116_1234 | 368 |
| 762 | 3300049824 | Ga0501045_0007462 | Ga0501045_0007462_6195_7316 | 368 |
| 763 | 3300049824 | Ga0501045_0011850 | Ga0501045_0011850_2401_3519 | 368 |
| 764 | 3300049824 | Ga0501045_0033009 | Ga0501045_0033009_455_1597 | 368 |
| 765 | 3300049824 | Ga0501045_0201019 | Ga0501045_0201019_53_1171 | 368 |
| 766 | 3300050491 | nmdc:mga00v17_35956_c1 | nmdc:mga00v17_35956_c1_517_1659 | 368 |
| 767 | 3300053094 | Ga0500566_0049684 | Ga0500566_0049684_1157_2275 | 368 |
| 768 | 3300053095 | Ga0500640_004096 | Ga0500640_004096_2585_3703 | 368 |
| 769 | 3300053096 | Ga0500641_0041881 | Ga0500641_0041881_700_1818 | 368 |
| 770 | 3300053099 | Ga0500654_028320 | Ga0500654_028320_607_1725 | 368 |
| 771 | 3300053129 | Ga0500628_001077 | Ga0500628_001077_2824_3942 | 368 |
| 772 | 3300053131 | Ga0500652_007170 | Ga0500652_007170_839_1957 | 368 |
| 773 | 3300053134 | Ga0500658_0002174 | Ga0500658_0002174_5180_6298 | 368 |
| 774 | 3300053137 | Ga0500561_0000602 | Ga0500561_0000602_66_1184 | 368 |
| 775 | 3300053140 | Ga0500573_0013167 | Ga0500573_0013167_662_1780 | 368 |
| 776 | 3300053153 | Ga0500616_0006951 | Ga0500616_0006951_3366_4484 | 368 |
| 777 | 3300053158 | Ga0500627_0032050 | Ga0500627_0032050_97_1215 | 368 |
| 778 | 3300053161 | Ga0500634_0003601 | Ga0500634_0003601_5375_6493 | 368 |
| 779 | 3300053732 | Ga0500656_001066 | Ga0500656_001066_553_1671 | 368 |
| 780 | 3300054114 | Ga0501084_0008261 | Ga0501084_0008261_4860_5978 | 368 |
| 781 | 3300054114 | Ga0501084_0146390 | Ga0501084_0146390_485_1627 | 368 |
| 782 | 3300060353 | Ga0501082_0010785 | Ga0501082_0010785_3765_4883 | 368 |
| 783 | iso_pu_bacteria | 2537561592 | 2537898219 | 368 |
| 784 | iso_pu_bacteria | 2867428634 | 2867435246 | 368 |
| 785 | 3300005548 | Ga0070665_100373410 | Ga0070665_1003734102 | 369 |
| 786 | 3300005985 | Ga0081539_10001399 | Ga0081539_100013997 | 369 |
| 787 | 3300025972 | Ga0207668_10003049 | Ga0207668_100030499 | 369 |
| 788 | 3300028380 | Ga0268265_10013772 | Ga0268265_100137722 | 369 |
| 789 | 3300031616 | Ga0307508_10000287 | Ga0307508_1000028715 | 369 |
| 790 | 3300031995 | Ga0307409_100024354 | Ga0307409_1000243542 | 369 |
| 791 | 3300044656 | Ga0466969_0000609 | Ga0466969_0000609_9811_10929 | 369 |
| 792 | 3300044684 | Ga0466966_0005253 | Ga0466966_0005253_1778_2896 | 369 |
| 793 | 3300044693 | Ga0466961_0032499 | Ga0466961_0032499_319_1437 | 369 |
| 794 | 3300046454 | Ga0495592_0028400 | Ga0495592_0028400_20_1150 | 369 |
| 795 | 3300046459 | Ga0495629_0120492 | Ga0495629_0120492_174_1304 | 369 |
| 796 | 3300046462 | Ga0495651_0005548 | Ga0495651_0005548_4232_5362 | 369 |
| 797 | 3300046463 | Ga0495653_0005937 | Ga0495653_0005937_7028_8158 | 369 |
| 798 | 3300046472 | Ga0495580_0018355 | Ga0495580_0018355_3394_4524 | 369 |
| 799 | 3300046476 | Ga0495662_0018191 | Ga0495662_0018191_928_2058 | 369 |
| 800 | 3300046511 | Ga0495608_0001164 | Ga0495608_0001164_6565_7695 | 369 |
| 801 | 3300046514 | Ga0495618_0153551 | Ga0495618_0153551_314_1444 | 369 |
| 802 | 3300046516 | Ga0495628_0013505 | Ga0495628_0013505_4940_6070 | 369 |
| 803 | 3300046517 | Ga0495630_0039887 | Ga0495630_0039887_1929_3059 | 369 |
| 804 | 3300046518 | Ga0495631_0026533 | Ga0495631_0026533_179_1297 | 369 |
| 805 | 3300046526 | Ga0495666_0007255 | Ga0495666_0007255_2867_3997 | 369 |
| 806 | 3300046531 | Ga0495665_0001197 | Ga0495665_0001197_11716_12846 | 369 |
| 807 | 3300046535 | Ga0495586_0022259 | Ga0495586_0022259_689_1819 | 369 |
| 808 | 3300046559 | Ga0495667_0014718 | Ga0495667_0014718_1439_2569 | 369 |
| 809 | 3300046642 | Ga0495634_0023507 | Ga0495634_0023507_2960_4090 | 369 |
| 810 | 3300046663 | Ga0495635_0038666 | Ga0495635_0038666_1929_3059 | 369 |
| 811 | 3300046675 | Ga0495657_0005001 | Ga0495657_0005001_6816_7946 | 369 |
| 812 | 3300046689 | Ga0495613_0019804 | Ga0495613_0019804_2493_3623 | 369 |
| 813 | 3300046809 | Ga0495600_0029931 | Ga0495600_0029931_2365_3495 | 369 |
| 814 | 3300047315 | Ga0495581_0002333 | Ga0495581_0002333_7222_8352 | 369 |
| 815 | 3300047317 | Ga0495604_0002431 | Ga0495604_0002431_6092_7222 | 369 |
| 816 | 3300047319 | Ga0495674_0006537 | Ga0495674_0006537_4292_5422 | 369 |
| 817 | 3300047444 | Ga0495675_0012238 | Ga0495675_0012238_1929_3059 | 369 |
| 818 | 3300047673 | Ga0495593_0029698 | Ga0495593_0029698_184_1314 | 369 |
| 819 | 3300053077 | Ga0495601_0003728 | Ga0495601_0003728_927_2057 | 369 |
| 820 | 3300053085 | Ga0495619_0014049 | Ga0495619_0014049_2631_3761 | 369 |
| 821 | 3300059605 | Ga0587106_009639 | Ga0587106_009639_20_1150 | 369 |
| 822 | iso_pu_bacteria | 2939660829 | 2939662854 | 369 |
| 823 | 3300025927 | Ga0207687_10031080 | Ga0207687_100310802 | 370 |
| 824 | 3300048907 | Ga0496104_0048561 | Ga0496104_0048561_53_1237 | 370 |
| 825 | 3300048911 | Ga0496108_0005434 | Ga0496108_0005434_2122_3306 | 370 |
| 826 | 3300048912 | Ga0496109_0026425 | Ga0496109_0026425_750_1934 | 370 |
| 827 | 3300048917 | Ga0496114_0007977 | Ga0496114_0007977_5628_6812 | 370 |
| 828 | 3300020075 | Ga0206349_1184325 | Ga0206349_11843252 | 371 |
| 829 | 3300020076 | Ga0206355_1062620 | Ga0206355_10626202 | 371 |
| 830 | 3300020080 | Ga0206350_10033714 | Ga0206350_100337142 | 371 |
| 831 | 3300022467 | Ga0224712_10001460 | Ga0224712_100014602 | 371 |
| 832 | 3300046535 | Ga0495586_0016311 | Ga0495586_0016311_615_1733 | 372 |
| 833 | iso_pu_bacteria | 2862281513 | 2862283216 | 374 |
| 834 | iso_pu_bacteria | 2867428634 | 2867428734 | 374 |
| 835 | iso_pu_bacteria | 2877676314 | 2877677883 | 374 |
| 836 | iso_pu_bacteria | 2912715099 | 2912716141 | 374 |
| 837 | iso_pu_bacteria | 2919468124 | 2919471022 | 374 |
| 838 | iso_pu_bacteria | 3006493962 | 3006501694 | 374 |
| 839 | 3300046455 | Ga0495603_0003057 | Ga0495603_0003057_2278_3405 | 375 |
| 840 | 3300046459 | Ga0495629_0001210 | Ga0495629_0001210_3633_4760 | 375 |
| 841 | 3300046499 | Ga0495594_0002955 | Ga0495594_0002955_6965_8092 | 375 |
| 842 | 3300046557 | Ga0495622_0028187 | Ga0495622_0028187_1401_2528 | 375 |
| 843 | 3300047321 | Ga0495676_0009639 | Ga0495676_0009639_3933_5060 | 375 |
| 844 | 3300046499 | Ga0495594_0037228 | Ga0495594_0037228_760_1905 | 376 |
| 845 | 3300046501 | Ga0495607_0095019 | Ga0495607_0095019_67_1212 | 376 |
| 846 | 3300047447 | Ga0495685_019655 | Ga0495685_019655_311_1456 | 376 |
| 847 | iso_pu_bacteria | 2547132111 | 2547412090 | 377 |
| 848 | iso_pu_bacteria | 2616644814 | 2616693496 | 377 |
| 849 | iso_pu_bacteria | 2643221647 | 2644266456 | 377 |
| 850 | iso_pu_bacteria | 2643221678 | 2644438026 | 377 |
| 851 | iso_pu_bacteria | 2784132148 | 2784591821 | 377 |
| 852 | iso_pu_bacteria | 2784746768 | 2785372807 | 377 |
| 853 | iso_pu_bacteria | 2786546132 | 2786675166 | 377 |
| 854 | iso_pu_bacteria | 2808606359 | 2808845168 | 377 |
| 855 | iso_pu_bacteria | 2808606375 | 2808914763 | 377 |
| 856 | iso_pu_bacteria | 2808606448 | 2809235441 | 377 |
| 857 | iso_pu_bacteria | 2946064051 | 2946071133 | 377 |
| 858 | iso_pu_bacteria | 2947224130 | 2947225598 | 377 |
| 859 | iso_pu_bacteria | 2954380949 | 2954382673 | 377 |
| 860 | iso_pu_bacteria | 2954673503 | 2954680209 | 377 |
| 861 | iso_pu_bacteria | 2954682443 | 2954683942 | 377 |
| 862 | iso_pu_bacteria | 2954691527 | 2954693496 | 377 |
| 863 | iso_pu_bacteria | 2954701450 | 2954708590 | 377 |
| 864 | iso_pu_bacteria | 2954711539 | 2954713159 | 377 |
| 865 | iso_pu_bacteria | 2954721474 | 2954723119 | 377 |
| 866 | iso_pu_bacteria | 2954731030 | 2954738710 | 377 |
| 867 | iso_pu_bacteria | 2954740390 | 2954742026 | 377 |
| 868 | iso_pu_bacteria | 2954749733 | 2954757568 | 377 |
| 869 | iso_pu_bacteria | 2954759201 | 2954761004 | 377 |
| 870 | iso_pu_bacteria | 8023623736 | 8023631573 | 377 |
| 871 | iso_pu_bacteria | 2954002825 | 2954009773 | 378 |
| 872 | iso_pu_bacteria | 2990059506 | 2990065445 | 378 |
| 873 | 3300041512 | Ga0451853_2434871 | Ga0451853_2434871_321_1463 | 380 |
| 874 | 3300001989 | JGI24739J22299_10019090 | JGI24739J22299_100190902 | 381 |
| 875 | 3300001990 | JGI24737J22298_10007983 | JGI24737J22298_100079832 | 381 |
| 876 | 3300003578 | Ga0006562J51391_1109412 | Ga0006562J51391_11094122 | 381 |
| 877 | 3300005937 | Ga0081455_10078077 | Ga0081455_100780772 | 381 |
| 878 | 3300009011 | Ga0105251_10027990 | Ga0105251_100279902 | 381 |
| 879 | 3300011119 | Ga0105246_10056793 | Ga0105246_100567932 | 381 |
| 880 | 3300014497 | Ga0182008_10002136 | Ga0182008_100021368 | 381 |
| 881 | 3300015261 | Ga0182006_1022929 | Ga0182006_10229292 | 381 |
| 882 | 3300015262 | Ga0182007_10001633 | Ga0182007_100016337 | 381 |
| 883 | 3300015688 | Ga0183367_1001 | Ga0183367_1001731 | 381 |
| 884 | 3300025297 | Ga0209758_1007794 | Ga0209758_10077944 | 381 |
| 885 | 3300025302 | Ga0207426_1021155 | Ga0207426_10211552 | 381 |
| 886 | 3300028786 | Ga0307517_10011680 | Ga0307517_100116804 | 381 |
| 887 | 3300028794 | Ga0307515_10000441 | Ga0307515_1000044187 | 381 |
| 888 | 3300028794 | Ga0307515_10031278 | Ga0307515_100312786 | 381 |
| 889 | 3300030521 | Ga0307511_10006319 | Ga0307511_100063195 | 381 |
| 890 | 3300030522 | Ga0307512_10108905 | Ga0307512_101089052 | 381 |
| 891 | 3300031456 | Ga0307513_10005869 | Ga0307513_100058693 | 381 |
| 892 | 3300031507 | Ga0307509_10018524 | Ga0307509_100185245 | 381 |
| 893 | 3300031616 | Ga0307508_10018977 | Ga0307508_100189776 | 381 |
| 894 | 3300031730 | Ga0307516_10073587 | Ga0307516_100735872 | 381 |
| 895 | 3300033179 | Ga0307507_10008958 | Ga0307507_100089584 | 381 |
| 896 | 3300033180 | Ga0307510_10040490 | Ga0307510_100404902 | 381 |
| 897 | 3300037312 | Ga0395899_0120682 | Ga0395899_0120682_641_1786 | 381 |
| 898 | 3300037466 | Ga0395898_0003419 | Ga0395898_0003419_1612_2757 | 381 |
| 899 | 3300037466 | Ga0395898_0057800 | Ga0395898_0057800_1871_3016 | 381 |
| 900 | 3300041406 | Ga0439439_0004773 | Ga0439439_0004773_1599_2744 | 381 |
| 901 | 3300042005 | Ga0439448_0001325 | Ga0439448_0001325_4203_5375 | 381 |
| 902 | 3300042007 | Ga0439449_0007501 | Ga0439449_0007501_126_1271 | 381 |
| 903 | 3300042012 | Ga0439455_0000095 | Ga0439455_0000095_1004_2176 | 381 |
| 904 | 3300042014 | Ga0439457_001850 | Ga0439457_001850_5075_6220 | 381 |
| 905 | 3300042015 | Ga0439462_0013318 | Ga0439462_0013318_534_1679 | 381 |
| 906 | 3300042138 | Ga0450903_000192 | Ga0450903_000192_3338_4510 | 381 |
| 907 | 3300042157 | Ga0439458_0001095 | Ga0439458_0001095_4336_5508 | 381 |
| 908 | 3300044683 | Ga0466965_0043039 | Ga0466965_0043039_843_1988 | 381 |
| 909 | 3300044684 | Ga0466966_0001295 | Ga0466966_0001295_14301_15446 | 381 |
| 910 | 3300044693 | Ga0466961_0010648 | Ga0466961_0010648_1549_2694 | 381 |
| 911 | 3300044719 | Ga0466971_0023066 | Ga0466971_0023066_1389_2534 | 381 |
| 912 | 3300044765 | Ga0466970_0008956 | Ga0466970_0008956_1620_2768 | 381 |
| 913 | 3300044901 | Ga0466960_0055713 | Ga0466960_0055713_213_1358 | 381 |
| 914 | 3300046454 | Ga0495592_0007118 | Ga0495592_0007118_3786_4970 | 381 |
| 915 | 3300046454 | Ga0495592_0011557 | Ga0495592_0011557_277_1422 | 381 |
| 916 | 3300046455 | Ga0495603_0024352 | Ga0495603_0024352_2488_3633 | 381 |
| 917 | 3300046459 | Ga0495629_0088010 | Ga0495629_0088010_87_1232 | 381 |
| 918 | 3300046460 | Ga0495638_0117677 | Ga0495638_0117677_236_1381 | 381 |
| 919 | 3300046462 | Ga0495651_0007103 | Ga0495651_0007103_3531_4715 | 381 |
| 920 | 3300046473 | Ga0495582_0010165 | Ga0495582_0010165_2210_3394 | 381 |
| 921 | 3300046473 | Ga0495582_0104995 | Ga0495582_0104995_102_1247 | 381 |
| 922 | 3300046476 | Ga0495662_0004079 | Ga0495662_0004079_3402_4586 | 381 |
| 923 | 3300046477 | Ga0495664_0004530 | Ga0495664_0004530_3354_4538 | 381 |
| 924 | 3300046477 | Ga0495664_0066158 | Ga0495664_0066158_279_1424 | 381 |
| 925 | 3300046492 | Ga0495585_0011522 | Ga0495585_0011522_3012_4157 | 381 |
| 926 | 3300046499 | Ga0495594_0027793 | Ga0495594_0027793_1711_2856 | 381 |
| 927 | 3300046500 | Ga0495596_0043390 | Ga0495596_0043390_244_1389 | 381 |
| 928 | 3300046501 | Ga0495607_0011764 | Ga0495607_0011764_1327_2472 | 381 |
| 929 | 3300046507 | Ga0495606_0010862 | Ga0495606_0010862_4961_6106 | 381 |
| 930 | 3300046513 | Ga0495616_0013790 | Ga0495616_0013790_1246_2391 | 381 |
| 931 | 3300046514 | Ga0495618_0012044 | Ga0495618_0012044_2126_3271 | 381 |
| 932 | 3300046514 | Ga0495618_0030256 | Ga0495618_0030256_703_1887 | 381 |
| 933 | 3300046515 | Ga0495620_0023636 | Ga0495620_0023636_1507_2652 | 381 |
| 934 | 3300046516 | Ga0495628_0043335 | Ga0495628_0043335_46_1191 | 381 |
| 935 | 3300046517 | Ga0495630_0028340 | Ga0495630_0028340_2687_3871 | 381 |
| 936 | 3300046524 | Ga0495648_0054949 | Ga0495648_0054949_77_1222 | 381 |
| 937 | 3300046526 | Ga0495666_0019935 | Ga0495666_0019935_853_2037 | 381 |
| 938 | 3300046526 | Ga0495666_0060342 | Ga0495666_0060342_39_1184 | 381 |
| 939 | 3300046529 | Ga0495652_0027446 | Ga0495652_0027446_728_1873 | 381 |
| 940 | 3300046530 | Ga0495654_0029806 | Ga0495654_0029806_1462_2607 | 381 |
| 941 | 3300046533 | Ga0495640_0043870 | Ga0495640_0043870_108_1292 | 381 |
| 942 | 3300046536 | Ga0495587_0002646 | Ga0495587_0002646_7573_8757 | 381 |
| 943 | 3300046538 | Ga0495609_0017410 | Ga0495609_0017410_696_1841 | 381 |
| 944 | 3300046543 | Ga0495645_0014863 | Ga0495645_0014863_1844_3028 | 381 |
| 945 | 3300046558 | Ga0495633_0021607 | Ga0495633_0021607_1908_3053 | 381 |
| 946 | 3300046616 | Ga0495668_0010883 | Ga0495668_0010883_1379_2524 | 381 |
| 947 | 3300046642 | Ga0495634_0009383 | Ga0495634_0009383_5853_7037 | 381 |
| 948 | 3300046660 | Ga0495625_0007615 | Ga0495625_0007615_635_1819 | 381 |
| 949 | 3300046660 | Ga0495625_0094048 | Ga0495625_0094048_808_1953 | 381 |
| 950 | 3300046663 | Ga0495635_0000520 | Ga0495635_0000520_17921_19105 | 381 |
| 951 | 3300046663 | Ga0495635_0021076 | Ga0495635_0021076_520_1665 | 381 |
| 952 | 3300046665 | Ga0495661_0042422 | Ga0495661_0042422_644_1789 | 381 |
| 953 | 3300046675 | Ga0495657_0003233 | Ga0495657_0003233_8221_9405 | 381 |
| 954 | 3300046675 | Ga0495657_0045310 | Ga0495657_0045310_1112_2257 | 381 |
| 955 | 3300046680 | Ga0495646_0004975 | Ga0495646_0004975_3362_4546 | 381 |
| 956 | 3300046689 | Ga0495613_0011991 | Ga0495613_0011991_1808_2992 | 381 |
| 957 | 3300046692 | Ga0495671_0080989 | Ga0495671_0080989_326_1471 | 381 |
| 958 | 3300046809 | Ga0495600_0021087 | Ga0495600_0021087_347_1531 | 381 |
| 959 | 3300046810 | Ga0495660_0139356 | Ga0495660_0139356_37_1182 | 381 |
| 960 | 3300047315 | Ga0495581_0017993 | Ga0495581_0017993_1834_3018 | 381 |
| 961 | 3300047315 | Ga0495581_0018769 | Ga0495581_0018769_1814_2959 | 381 |
| 962 | 3300047317 | Ga0495604_0019901 | Ga0495604_0019901_4003_5187 | 381 |
| 963 | 3300047318 | Ga0495636_0024114 | Ga0495636_0024114_276_1421 | 381 |
| 964 | 3300047319 | Ga0495674_0135421 | Ga0495674_0135421_87_1232 | 381 |
| 965 | 3300047321 | Ga0495676_0002779 | Ga0495676_0002779_4007_5191 | 381 |
| 966 | 3300047321 | Ga0495676_0007323 | Ga0495676_0007323_465_1610 | 381 |
| 967 | 3300047322 | Ga0495680_0014414 | Ga0495680_0014414_3330_4475 | 381 |
| 968 | 3300047443 | Ga0495687_004847 | Ga0495687_004847_4495_5709 | 381 |
| 969 | 3300047444 | Ga0495675_0068701 | Ga0495675_0068701_643_1788 | 381 |
| 970 | 3300047470 | Ga0495681_0006380 | Ga0495681_0006380_3131_4315 | 381 |
| 971 | 3300047470 | Ga0495681_0062301 | Ga0495681_0062301_453_1598 | 381 |
| 972 | 3300047471 | Ga0495684_0019913 | Ga0495684_0019913_1762_2946 | 381 |
| 973 | 3300047471 | Ga0495684_0123910 | Ga0495684_0123910_561_1706 | 381 |
| 974 | 3300047472 | Ga0495686_0016525 | Ga0495686_0016525_249_1394 | 381 |
| 975 | 3300047673 | Ga0495593_0000873 | Ga0495593_0000873_12811_13995 | 381 |
| 976 | 3300047673 | Ga0495593_0085041 | Ga0495593_0085041_176_1321 | 381 |
| 977 | 3300048088 | Ga0495602_0032202 | Ga0495602_0032202_55_1239 | 381 |
| 978 | 3300048089 | Ga0495614_0037764 | Ga0495614_0037764_591_1736 | 381 |
| 979 | 3300048091 | Ga0495626_0057035 | Ga0495626_0057035_275_1420 | 381 |
| 980 | 3300048912 | Ga0496109_0187329 | Ga0496109_0187329_690_1859 | 381 |
| 981 | 3300049459 | Ga0495678_020853 | Ga0495678_020853_1125_2270 | 381 |
| 982 | 3300050490 | nmdc:mga03n38_11880_c1 | nmdc:mga03n38_11880_c1_1944_3116 | 381 |
| 983 | 3300053085 | Ga0495619_0181060 | Ga0495619_0181060_20_1204 | 381 |
| 984 | 3300053092 | Ga0500583_0050301 | Ga0500583_0050301_169_1314 | 381 |
| 985 | 3300053095 | Ga0500640_004273 | Ga0500640_004273_194_1378 | 381 |
| 986 | 3300053122 | Ga0500608_093215 | Ga0500608_093215_178_1362 | 381 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7oey-assembly1.cif.gz_B | neisseria gonnorhoeae variant e93q at 1.35 angstrom resolution | 0.9771 | 13 | 368 |
| 7bbw-assembly2.cif.gz_B | neisseria gonorrhoeae transaldolase, variant c38s | 0.9765 | 14 | 368 |
| 7bbx-assembly1.cif.gz_A | neisseria gonorrhoeae transaldolase, variant k8a | 0.9748 | 13 | 368 |
| 7odq-assembly1.cif.gz_A | neisseria gonorrhoeae transaldolase at 5.4 mgy dose | 0.974 | 13 | 368 |
| 7oey-assembly1.cif.gz_B | neisseria gonnorhoeae variant e93q at 1.35 angstrom resolution | 0.9689 | 13 | 368 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B4FRC9_66_421_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9728 | 13 | 370 | 3.20.20.70 |
| 3clmA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9722 | 13 | 368 | 3.20.20.70 |
| af_K7L4A2_15_219_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9719 | 58 | 260 | 3.20.20.70 |
| af_I1JM01_1_306_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9699 | 74 | 370 | 3.20.20.70 |
| 3r5eA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9644 | 12 | 372 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A505D201-F1-model_v4 | Transaldolase (EC 2.2.1.2) | 1.002 | 97 | 295 |
GO:0004801
GO:0005737 GO:0005975 GO:0006098 |
| AF-A0A2S9G7Y1-F1-model_v4 | Transaldolase (EC 2.2.1.2) | 0.9999 | 84 | 163 |
GO:0004801
GO:0005737 GO:0005975 GO:0006098 |
| AF-A0A6G3XGD8-F1-model_v4 | transaldolase (EC 2.2.1.2) | 0.9998 | 100 | 180 |
GO:0004801
GO:0005737 GO:0005975 GO:0006098 |
| AF-A0A2W6E122-F1-model_v4 | Transaldolase (EC 2.2.1.2) | 0.9992 | 169 | 374 |
GO:0004801
GO:0005737 GO:0005975 GO:0006098 |
| AF-A0A6G3XK19-F1-model_v4 | Transaldolase (EC 2.2.1.2) | 0.9984 | 215 | 306 |
GO:0004801
GO:0005737 GO:0005975 GO:0006098 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar