F487541

General Info

Members Datasets Scaffolds Average Seq Length
986 467 835 372

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2867428634|2867435246
Length 424
Sequence LKRLSEEGVAIWLDDLSRKRITSGNLAELIDQQHVVGVTTNPSIFQKAISEGDGYDQQLSDLAARKVTVEEAIRMITTADVRDAADILRPVFDATGGQDGRVSIEVDPRLAHNEKATVAEAKQLAWLVDRPNTLIKIPATLAGIPAITDVIGLGISVNVTLIFSLERYREVMDAYLAGLERAKERGLDLSKIHSVASFFVSRVDTEIDKRIDALGTDEAKAARGKAGVANARLAYQAYEEVFSGERWAKLENAGANKQRPLWASTGVKDKAYKATLYVDELVAPNTVNTMPEATLQAIEQSGEIRGNAVAGTYEQARADLDAVEKLGISYDEVVQLLEDEGVEKFEASWNDLLKSTEAELQRLAPSKDASRALQPRQVGGSRTGLSTDLVRCKACGRHPESAGQTTATAPPGLQRVRGRRRSWR

Samples

Sample ID Description Type Environment
1 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
2 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
3 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
4 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
5 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
6 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
7 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
8 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
9 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
10 2643221548 Streptomyces sp. Root55 Isolate Unclassified
11 2643221578 Streptomyces sp. Root63 Isolate Unclassified
12 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
13 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
14 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
15 2643221647 Streptomyces sp. Root369 Isolate Unclassified
16 2643221670 Streptomyces sp. Root431 Isolate Unclassified
17 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
18 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
19 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
20 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
21 2643221711 Terrabacter sp. Root85 Isolate Unclassified
22 2643221714 Streptomyces sp. Root264 Isolate Unclassified
23 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
24 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
25 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
26 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
27 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
28 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
29 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
30 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
31 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
32 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
33 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
34 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
35 2808606448 Streptomyces sp. 193411 Isolate Unclassified
36 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
37 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
38 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
39 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
40 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
41 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
42 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
43 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
44 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
45 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
46 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
47 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
48 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
49 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
50 2862574272 Streptomyces sp. AcE210 Isolate Nodule
51 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
52 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
53 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
54 2867428634 Streptomyces sp. RP5T Isolate Unclassified
55 2867475112 Streptomyces sp. TM32 Isolate Unclassified
56 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
57 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
58 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
59 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
60 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
61 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
62 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
63 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
64 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
65 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
66 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
67 2920879853 Kocuria salina CV6 Isolate Unclassified
68 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
69 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
70 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
71 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
72 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
73 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
74 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
75 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
76 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
77 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
78 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
79 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
80 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
81 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
82 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
83 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
84 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
85 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
86 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
87 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
88 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
89 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
90 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
91 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
92 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
93 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
94 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
95 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
96 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
97 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
98 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
99 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
100 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
101 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
102 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
103 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
104 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
105 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
106 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
107 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
108 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
109 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
110 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
111 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
112 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
113 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
114 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
115 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
116 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
117 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
118 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
119 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
120 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
121 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
122 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
123 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
124 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
125 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
126 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
127 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
128 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
129 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
130 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
131 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
132 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
133 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
134 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
135 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
136 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
137 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
138 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
139 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
140 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
141 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
142 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
143 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
144 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
145 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
146 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
147 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
148 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
149 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
150 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
151 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
152 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
153 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
154 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
155 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
156 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
157 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
158 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
159 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
160 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
161 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
162 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
163 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
165 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
167 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
168 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
170 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
171 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
172 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
173 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
174 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
200 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
201 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
202 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
203 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
204 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
205 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
206 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
207 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
208 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
209 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
210 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
211 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
212 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
213 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
214 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
215 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
216 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
217 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
218 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
219 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
220 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
221 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
222 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
223 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
224 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
225 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
226 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
227 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
228 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
229 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
230 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
231 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
232 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
233 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
234 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
235 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
236 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
237 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
238 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
239 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
240 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
241 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
242 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
243 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
244 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
245 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
246 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
247 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
248 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
249 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
250 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
251 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
252 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
253 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
254 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
255 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
256 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
257 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
258 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
259 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
260 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
261 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
262 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
263 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
264 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
265 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
266 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
267 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
268 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
269 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
270 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
271 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
272 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
273 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
274 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
275 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
276 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
277 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
278 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
279 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
280 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
281 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
282 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
283 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
284 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
285 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
286 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
287 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
288 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
289 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
290 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
291 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
292 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
293 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
294 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
295 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
296 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
297 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
298 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
299 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
300 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
301 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
302 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
303 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
304 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
305 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
306 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
307 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
308 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
309 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
310 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
311 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
312 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
313 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
314 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
315 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
316 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
317 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
318 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
319 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
320 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
321 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
322 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
323 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
324 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
325 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
326 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
327 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
328 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
329 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
330 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
331 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
332 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
333 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
334 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
335 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
336 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
337 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
338 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
339 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
340 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
341 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
342 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
343 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
344 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
345 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
346 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
347 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
348 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
349 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
350 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
351 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
352 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
353 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
354 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
355 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
356 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
357 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
358 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
359 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
360 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
361 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
362 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
363 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
364 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
365 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
366 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
367 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
368 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
369 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
370 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
371 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
372 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
373 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
374 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
376 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
377 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
390 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
395 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
396 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
397 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
398 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
399 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
400 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
401 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
402 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
403 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
404 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
405 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
406 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
407 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
408 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
409 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
412 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
413 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
414 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
415 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
416 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
417 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
418 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
419 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
420 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
421 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
422 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
423 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
424 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
425 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
426 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
427 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
428 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
429 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
430 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
431 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
432 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
433 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
434 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
435 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
436 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
437 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
438 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
439 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
440 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
441 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
442 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
443 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
445 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
446 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
447 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
448 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
449 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
450 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
451 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
452 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
453 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
454 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
455 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
456 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
457 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
458 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
459 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
460 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
461 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
462 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
463 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
464 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
465 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
466 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
467 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.25
Metatranscriptomes 2.43
Isolates 15.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.14
Nodule 0.41
Rhizoplane 4.36
Rhizosphere 79.41
Stem 0
Stem Tuber 0
Unclassified 12.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10019090 3300001989 Bacteria 2457
2 JGI24739J22299_10026852 3300001989 Bacteria 2017
3 JGI24737J22298_10007983 3300001990 Bacteria 3556
4 JGI24738J21930_10012699 3300002075 Bacteria 1836
5 Ga0006777J48905_1026059 3300003308 Bacteria 1175
6 rootH2_10008057 3300003320 Bacteria 2408
7 Ga0006562J51391_1109412 3300003578 Bacteria 2610
8 JGI25405J52794_10006402 3300003911 Bacteria 2152
9 Ga0070683_100178183 3300005329 Bacteria 2018
10 Ga0070670_100242993 3300005331 Bacteria 1568
11 Ga0070680_100112524 3300005336 Bacteria 2267
12 Ga0070660_100005230 3300005339 Bacteria 8977
13 Ga0070668_100028825 3300005347 Bacteria 4212
14 Ga0070668_100058984 3300005347 Bacteria 2970
15 Ga0070659_100078977 3300005366 Bacteria 2626
16 Ga0070714_100002556 3300005435 Bacteria 13399
17 Ga0070714_100031451 3300005435 Bacteria 4428
18 Ga0070714_100043111 3300005435 Bacteria 3814
19 Ga0070714_100338035 3300005435 Bacteria 1411
20 Ga0070663_100028092 3300005455 Bacteria 3826
21 Ga0070662_100341253 3300005457 Bacteria 1225
22 Ga0070681_10044433 3300005458 Bacteria 4447
23 Ga0068867_100029542 3300005459 Bacteria 3950
24 Ga0070699_100320600 3300005518 Bacteria 1393
25 Ga0070679_100014163 3300005530 Bacteria 7651
26 Ga0070684_100044105 3300005535 Bacteria 3855
27 Ga0068853_100075340 3300005539 Bacteria 2945
28 Ga0070665_100003530 3300005548 Bacteria 16627
29 Ga0070665_100030289 3300005548 Bacteria 5446
30 Ga0070665_100044001 3300005548 Bacteria 4485
31 Ga0070665_100373410 3300005548 Bacteria 1433
32 Ga0068854_100000899 3300005578 Bacteria 17894
33 Ga0068854_100032930 3300005578 Bacteria 3610
34 Ga0068852_100049839 3300005616 Bacteria 3585
35 Ga0081455_10000389 3300005937 Bacteria 58107
36 Ga0081455_10002237 3300005937 Bacteria 23049
37 Ga0081455_10068793 3300005937 Bacteria 2946
38 Ga0081455_10078077 3300005937 Bacteria 2721
39 Ga0081538_10000958 3300005981 Bacteria 30846
40 Ga0081538_10001594 3300005981 Bacteria 23286
41 Ga0081538_10018403 3300005981 Bacteria 5247
42 Ga0081540_1046845 3300005983 Bacteria 2179
43 Ga0081539_10000292 3300005985 Bacteria 113454
44 Ga0081539_10001399 3300005985 Bacteria 41546
45 Ga0081539_10011343 3300005985 Bacteria 7065
46 Ga0081539_10018862 3300005985 Bacteria 4755
47 Ga0081539_10020454 3300005985 Bacteria 4473
48 Ga0081539_10118178 3300005985 Bacteria 1322
49 Ga0075364_10024749 3300006051 Bacteria 3815
50 Ga0075364_10257527 3300006051 Bacteria 1186
51 Ga0075432_10000058 3300006058 Bacteria 21877
52 Ga0075432_10001078 3300006058 Bacteria 8671
53 Ga0075428_100004393 3300006844 Bacteria 15564
54 Ga0075428_100005267 3300006844 Bacteria 14385
55 Ga0075428_100006278 3300006844 Bacteria 13214
56 Ga0075428_100132945 3300006844 Bacteria 2705
57 Ga0075430_100001112 3300006846 Bacteria 21393
58 Ga0075430_100003006 3300006846 Bacteria 14108
59 Ga0075431_100003087 3300006847 Bacteria 16126
60 Ga0075431_100007843 3300006847 Bacteria 10640
61 Ga0075431_100007939 3300006847 Bacteria 10578
62 Ga0075433_10000219 3300006852 Bacteria 32497
63 Ga0075433_10000698 3300006852 Bacteria 22940
64 Ga0075434_100000609 3300006871 Bacteria 27718
65 Ga0075434_100013208 3300006871 Bacteria 7848
66 Ga0075429_100000303 3300006880 Bacteria 34915
67 Ga0075429_100014193 3300006880 Bacteria 6905
68 Ga0075429_100145690 3300006880 Bacteria 2073
69 Ga0075436_100010602 3300006914 Bacteria 6320
70 Ga0099826_10039049 3300006948 Bacteria 3326
71 Ga0075435_100020295 3300007076 Bacteria 5088
72 Ga0105251_10027990 3300009011 Bacteria 2851
73 Ga0105240_10033493 3300009093 Bacteria 6637
74 Ga0105240_10043420 3300009093 Bacteria 5720
75 Ga0111539_10000761 3300009094 Bacteria 41945
76 Ga0111539_10008525 3300009094 Bacteria 13023
77 Ga0105245_10045486 3300009098 Bacteria 3921
78 Ga0105245_10260995 3300009098 Bacteria 1686
79 Ga0114129_10000041 3300009147 Bacteria 107656
80 Ga0114129_10000100 3300009147 Bacteria 84154
81 Ga0114129_10082418 3300009147 Bacteria 4469
82 Ga0105243_10002638 3300009148 Bacteria 14899
83 Ga0105242_10060004 3300009176 Bacteria 3123
84 Ga0105238_10009367 3300009551 Bacteria 9804
85 Ga0105238_10084884 3300009551 Bacteria 3155
86 Ga0105249_10031513 3300009553 Bacteria 4796
87 Ga0105239_10063085 3300010375 Bacteria 4068
88 Ga0105239_10105341 3300010375 Bacteria 3123
89 Ga0105246_10056793 3300011119 Bacteria 2707
90 Ga0157370_10327625 3300013104 Bacteria 1412
91 Ga0157369_10164287 3300013105 Bacteria 2342
92 Ga0157374_10202172 3300013296 Bacteria 1946
93 Ga0157378_10082171 3300013297 Bacteria 2913
94 Ga0163162_10014513 3300013306 Bacteria 7698
95 Ga0163162_10026523 3300013306 Bacteria 5726
96 Ga0163162_10063073 3300013306 Bacteria 3747
97 Ga0163162_10490383 3300013306 Bacteria 1360
98 Ga0157372_10062032 3300013307 Bacteria 4187
99 Ga0157372_10227221 3300013307 Bacteria 2164
100 Ga0157372_10327031 3300013307 Bacteria 1785
101 Ga0163163_10081519 3300014325 Bacteria 3237
102 Ga0182008_10002136 3300014497 Bacteria 12605
103 Ga0182008_10007117 3300014497 Bacteria 6196
104 Ga0182006_1022929 3300015261 Bacteria 2588
105 Ga0182007_10000188 3300015262 Bacteria 41467
106 Ga0182007_10001633 3300015262 Bacteria 11886
107 Ga0183367_1001 3300015688 Bacteria 1225545
108 Ga0183367_1007 3300015688 Bacteria 498079
109 Ga0163161_10101033 3300017792 Bacteria 2147
110 Ga0197907_10887992 3300020069 Bacteria 2304
111 Ga0197907_11047224 3300020069 Bacteria 2383
112 Ga0206356_10823945 3300020070 Bacteria 1919
113 Ga0206349_1184325 3300020075 Bacteria 3108
114 Ga0206349_1610450 3300020075 Bacteria 1738
115 Ga0206355_1062620 3300020076 Bacteria 3230
116 Ga0206352_10129169 3300020078 Bacteria 2189
117 Ga0206352_10792297 3300020078 Bacteria 1819
118 Ga0206350_10033714 3300020080 Bacteria 3549
119 Ga0206350_10850691 3300020080 Bacteria 2104
120 Ga0206354_11547845 3300020081 Bacteria 2367
121 Ga0206353_10237768 3300020082 Bacteria 7694
122 Ga0206353_10892018 3300020082 Bacteria 1791
123 Ga0213875_10006019 3300021388 Bacteria 6424
124 Ga0224712_10001460 3300022467 Bacteria 5455
125 Ga0224712_10011329 3300022467 Bacteria 2763
126 Ga0224712_10013631 3300022467 Bacteria 2595
127 Ga0209025_1031905 3300025294 Bacteria 2477
128 Ga0209758_1003694 3300025297 Bacteria 13593
129 Ga0209758_1007794 3300025297 Bacteria 7152
130 Ga0207426_1001189 3300025302 Bacteria 23155
131 Ga0207426_1003255 3300025302 Bacteria 9091
132 Ga0207426_1013527 3300025302 Bacteria 3020
133 Ga0207426_1021155 3300025302 Bacteria 2251
134 Ga0207696_1005488 3300025711 Bacteria 5255
135 Ga0207688_10089904 3300025901 Bacteria 1762
136 Ga0207647_10002104 3300025904 Bacteria 15238
137 Ga0207647_10026598 3300025904 Bacteria 3783
138 Ga0207695_10001103 3300025913 Bacteria 46908
139 Ga0207671_10000389 3300025914 Bacteria 61710
140 Ga0207660_10125865 3300025917 Bacteria 1946
141 Ga0207652_10027503 3300025921 Bacteria 4739
142 Ga0207694_10004658 3300025924 Bacteria 10678
143 Ga0207687_10031080 3300025927 Bacteria 3607
144 Ga0207664_10021773 3300025929 Bacteria 4775
145 Ga0207706_10014617 3300025933 Bacteria 7108
146 Ga0207709_10008557 3300025935 Bacteria 5658
147 Ga0207709_10083454 3300025935 Bacteria 2066
148 Ga0207667_10033632 3300025949 Bacteria 5511
149 Ga0207667_10048745 3300025949 Bacteria 4477
150 Ga0207712_10026878 3300025961 Bacteria 3839
151 Ga0207668_10003049 3300025972 Bacteria 9818
152 Ga0207668_10068626 3300025972 Bacteria 2521
153 Ga0207668_10100734 3300025972 Bacteria 2146
154 Ga0207640_10004544 3300025981 Bacteria 7532
155 Ga0207639_10109590 3300026041 Bacteria 2247
156 Ga0207678_10059010 3300026067 Bacteria 3301
157 Ga0207708_10132762 3300026075 Bacteria 1948
158 Ga0207648_10043105 3300026089 Bacteria 3962
159 Ga0207675_100019693 3300026118 Bacteria 6299
160 Ga0207675_100212978 3300026118 Bacteria 1859
161 Ga0209371_1016902 3300027312 Bacteria 1909
162 Ga0207428_10000762 3300027907 Bacteria 36710
163 Ga0207428_10002987 3300027907 Bacteria 16703
164 Ga0268266_10023769 3300028379 Bacteria 5216
165 Ga0268266_10140587 3300028379 Bacteria 2166
166 Ga0268265_10013772 3300028380 Bacteria 5504
167 Ga0268265_10024712 3300028380 Bacteria 4255
168 Ga0265319_1003772 3300028563 Bacteria 7767
169 Ga0265319_1018115 3300028563 Bacteria 2662
170 Ga0265334_10009414 3300028573 Bacteria 4132
171 Ga0265318_10000755 3300028577 Bacteria 21562
172 Ga0307517_10011680 3300028786 Bacteria 12151
173 Ga0307517_10080637 3300028786 Bacteria 2784
174 Ga0307517_10094980 3300028786 Bacteria 2403
175 Ga0307515_10000441 3300028794 Bacteria 99819
176 Ga0307515_10012174 3300028794 Bacteria 16221
177 Ga0307515_10031278 3300028794 Bacteria 8884
178 Ga0307515_10087217 3300028794 Bacteria 3965
179 Ga0307515_10142214 3300028794 Bacteria 2566
180 Ga0307515_10214595 3300028794 Bacteria 1759
181 Ga0265338_10016895 3300028800 Bacteria 7898
182 Ga0265338_10174998 3300028800 Bacteria 1641
183 Ga0307511_10006319 3300030521 Bacteria 11946
184 Ga0307511_10022667 3300030521 Bacteria 5879
185 Ga0307511_10053002 3300030521 Bacteria 3221
186 Ga0307512_10012127 3300030522 Bacteria 8147
187 Ga0307512_10016591 3300030522 Bacteria 6795
188 Ga0307512_10108905 3300030522 Bacteria 1835
189 Ga0316182_1376048 3300030745 Bacteria 3713
190 Ga0265330_10004174 3300031235 Bacteria 7373
191 Ga0265328_10001580 3300031239 Bacteria 10501
192 Ga0265320_10003043 3300031240 Bacteria 11385
193 Ga0265325_10003090 3300031241 Bacteria 10993
194 Ga0265325_10104385 3300031241 Bacteria 1384
195 Ga0265329_10004498 3300031242 Bacteria 5785
196 Ga0265340_10002687 3300031247 Bacteria 10110
197 Ga0265316_10020393 3300031344 Bacteria 5641
198 Ga0307513_10000009 3300031456 Bacteria 403893
199 Ga0307513_10004081 3300031456 Bacteria 19562
200 Ga0307513_10005869 3300031456 Bacteria 16132
201 Ga0307513_10080302 3300031456 Bacteria 3365
202 Ga0307513_10090310 3300031456 Bacteria 3125
203 Ga0307509_10007936 3300031507 Bacteria 13696
204 Ga0307509_10018524 3300031507 Bacteria 7981
205 Ga0307509_10146711 3300031507 Bacteria 2283
206 Ga0307408_100011119 3300031548 Bacteria 5945
207 Ga0307408_100012290 3300031548 Bacteria 5670
208 Ga0307408_100088836 3300031548 Bacteria 2328
209 Ga0307508_10000287 3300031616 Bacteria 61945
210 Ga0307508_10001366 3300031616 Bacteria 27492
211 Ga0307508_10018977 3300031616 Bacteria 6247
212 Ga0307508_10050107 3300031616 Bacteria 3717
213 Ga0307508_10094817 3300031616 Bacteria 2574
214 Ga0307508_10118477 3300031616 Bacteria 2249
215 Ga0307514_10004180 3300031649 Bacteria 13376
216 Ga0307514_10044298 3300031649 Bacteria 3487
217 Ga0307514_10056739 3300031649 Bacteria 3004
218 Ga0307514_10095809 3300031649 Bacteria 2145
219 Ga0265314_10051320 3300031711 Bacteria 2873
220 Ga0316576_10049900 3300031727 Bacteria 3041
221 Ga0307516_10011576 3300031730 Bacteria 9573
222 Ga0307516_10032208 3300031730 Bacteria 5280
223 Ga0307516_10073587 3300031730 Bacteria 3274
224 Ga0307405_10076844 3300031731 Bacteria 2167
225 Ga0307405_10124011 3300031731 Bacteria 1773
226 Ga0307413_10029475 3300031824 Bacteria 3070
227 Ga0307413_10038737 3300031824 Bacteria 2766
228 Ga0307410_10000645 3300031852 Bacteria 14372
229 Ga0307410_10032249 3300031852 Bacteria 3369
230 Ga0307410_10082643 3300031852 Bacteria 2260
231 Ga0307410_10098920 3300031852 Bacteria 2087
232 Ga0307406_10000359 3300031901 Bacteria 26657
233 Ga0307406_10004072 3300031901 Bacteria 7956
234 Ga0307406_10027976 3300031901 Bacteria 3402
235 Ga0307407_10000506 3300031903 Bacteria 12021
236 Ga0307407_10001378 3300031903 Bacteria 8748
237 Ga0307407_10045390 3300031903 Bacteria 2482
238 Ga0307412_10003098 3300031911 Bacteria 9230
239 Ga0307412_10093860 3300031911 Bacteria 2106
240 Ga0307409_100001043 3300031995 Bacteria 13011
241 Ga0307409_100024354 3300031995 Bacteria 4220
242 Ga0307409_100055774 3300031995 Bacteria 3053
243 Ga0307409_100121701 3300031995 Bacteria 2211
244 Ga0307416_100000776 3300032002 Bacteria 16772
245 Ga0307416_100003499 3300032002 Bacteria 9238
246 Ga0307416_100065308 3300032002 Bacteria 2990
247 Ga0307416_100075738 3300032002 Bacteria 2817
248 Ga0307416_100125664 3300032002 Bacteria 2297
249 Ga0307416_100159845 3300032002 Bacteria 2081
250 Ga0307414_10007469 3300032004 Bacteria 6139
251 Ga0307414_10117210 3300032004 Bacteria 2040
252 Ga0307414_10335914 3300032004 Bacteria 1291
253 Ga0307411_10004265 3300032005 Bacteria 6813
254 Ga0307411_10016950 3300032005 Bacteria 4135
255 Ga0307411_10221402 3300032005 Bacteria 1468
256 Ga0307415_100006340 3300032126 Bacteria 6369
257 Ga0307415_100015176 3300032126 Bacteria 4553
258 Ga0307415_100069039 3300032126 Bacteria 2476
259 Ga0307507_10000019 3300033179 Bacteria 224026
260 Ga0307507_10008958 3300033179 Bacteria 13577
261 Ga0307507_10054821 3300033179 Bacteria 3789
262 Ga0307507_10096066 3300033179 Bacteria 2509
263 Ga0307510_10040490 3300033180 Bacteria 5114
264 Ga0307510_10046000 3300033180 Bacteria 4700
265 Ga0307510_10129706 3300033180 Bacteria 2199
266 Ga0373962_0004271 3300035242 Bacteria 3449
267 Ga0395899_0120682 3300037312 Bacteria 1878
268 Ga0395900_0009810 3300037418 Bacteria 9810
269 Ga0395898_0002815 3300037466 Bacteria 19948
270 Ga0395898_0003419 3300037466 Bacteria 17774
271 Ga0395898_0057800 3300037466 Bacteria 3778
272 Ga0395898_0092848 3300037466 Bacteria 2902
273 Ga0395898_0275917 3300037466 Bacteria 1603
274 Ga0395905_0270138 3300037471 Bacteria 1586
275 Ga0436364_0312203 3300037853 Bacteria 39359
276 Ga0395901_0013035 3300038443 Bacteria 8436
277 Ga0395901_0052987 3300038443 Bacteria 4216
278 Ga0436365_0548348 3300039437 Bacteria 22079
279 Ga0436365_0877362 3300039437 Bacteria 1623
280 Ga0439436_0000166 3300041404 Bacteria 15489
281 Ga0439436_0008869 3300041404 Bacteria 3085
282 Ga0439436_0038124 3300041404 Bacteria 1383
283 Ga0439439_0004773 3300041406 Bacteria 3070
284 Ga0451833_0440150 3300041491 Bacteria 8246
285 Ga0451839_0296389 3300041496 Bacteria 5461
286 Ga0451841_1036571 3300041498 Bacteria 2551
287 Ga0451853_2434871 3300041512 Bacteria 1742
288 Ga0451853_3381203 3300041512 Bacteria 1948
289 Ga0439433_0000788 3300041999 Bacteria 6260
290 Ga0439442_000989 3300042002 Bacteria 5743
291 Ga0439448_0001325 3300042005 Bacteria 6336
292 Ga0439432_029955 3300042006 Bacteria 1767
293 Ga0439449_0000874 3300042007 Bacteria 11757
294 Ga0439449_0004830 3300042007 Bacteria 5197
295 Ga0439449_0007501 3300042007 Bacteria 4145
296 Ga0439455_0000095 3300042012 Bacteria 8582
297 Ga0439457_000843 3300042014 Bacteria 9203
298 Ga0439457_001434 3300042014 Bacteria 7171
299 Ga0439457_001850 3300042014 Bacteria 6242
300 Ga0439457_002864 3300042014 Bacteria 4810
301 Ga0439462_0009732 3300042015 Bacteria 2430
302 Ga0439462_0013318 3300042015 Bacteria 2107
303 Ga0450898_000603 3300042134 Bacteria 4310
304 Ga0450899_000205 3300042135 Bacteria 6118
305 Ga0450903_000034 3300042138 Bacteria 27428
306 Ga0450903_000192 3300042138 Bacteria 13562
307 Ga0450906_000520 3300042145 Bacteria 8095
308 Ga0439458_0001095 3300042157 Bacteria 6908
309 Ga0439435_0039769 3300042436 Bacteria 1311
310 Ga0439464_0005535 3300042439 Bacteria 3270
311 Ga0439464_0007100 3300042439 Bacteria 2927
312 Ga0466969_0000609 3300044656 Bacteria 19347
313 Ga0466969_0001666 3300044656 Bacteria 11883
314 Ga0466969_0003320 3300044656 Bacteria 8561
315 Ga0466969_0017395 3300044656 Bacteria 3752
316 Ga0466969_0023298 3300044656 Bacteria 3190
317 Ga0466972_0008588 3300044658 Bacteria 5125
318 Ga0466972_0010739 3300044658 Bacteria 4596
319 Ga0466965_0003319 3300044683 Bacteria 7040
320 Ga0466965_0021558 3300044683 Bacteria 3102
321 Ga0466965_0043039 3300044683 Bacteria 2229
322 Ga0466966_0001295 3300044684 Bacteria 16018
323 Ga0466966_0005253 3300044684 Bacteria 8514
324 Ga0466966_0005929 3300044684 Bacteria 8064
325 Ga0466966_0006679 3300044684 Bacteria 7641
326 Ga0466966_0053001 3300044684 Bacteria 2574
327 Ga0466961_0000891 3300044693 Bacteria 18585
328 Ga0466961_0001045 3300044693 Bacteria 17043
329 Ga0466961_0010648 3300044693 Bacteria 5870
330 Ga0466961_0010788 3300044693 Bacteria 5836
331 Ga0466961_0024465 3300044693 Bacteria 3884
332 Ga0466961_0032499 3300044693 Bacteria 3353
333 Ga0466961_0044816 3300044693 Bacteria 2830
334 Ga0466961_0099295 3300044693 Bacteria 1835
335 Ga0466961_0132357 3300044693 Bacteria 1563
336 Ga0466963_0001647 3300044694 Bacteria 12166
337 Ga0466963_0006548 3300044694 Bacteria 6897
338 Ga0466963_0011325 3300044694 Bacteria 5427
339 Ga0466963_0019548 3300044694 Bacteria 4250
340 Ga0466963_0022816 3300044694 Bacteria 3968
341 Ga0466964_0016597 3300044706 Bacteria 2813
342 Ga0466971_0001266 3300044719 Bacteria 10528
343 Ga0466971_0010456 3300044719 Bacteria 4055
344 Ga0466971_0013702 3300044719 Bacteria 3565
345 Ga0466971_0023066 3300044719 Bacteria 2773
346 Ga0466971_0027828 3300044719 Bacteria 2532
347 Ga0466971_0029149 3300044719 Bacteria 2468
348 Ga0466968_0000717 3300044735 Bacteria 11466
349 Ga0466968_0001751 3300044735 Bacteria 7829
350 Ga0466970_0002303 3300044765 Bacteria 9232
351 Ga0466970_0008956 3300044765 Bacteria 5047
352 Ga0466970_0046361 3300044765 Bacteria 2315
353 Ga0466957_0000245 3300044842 Bacteria 26013
354 Ga0466957_0126315 3300044842 Bacteria 1634
355 Ga0466960_0002720 3300044901 Bacteria 6683
356 Ga0466960_0019159 3300044901 Bacteria 3010
357 Ga0466960_0055713 3300044901 Bacteria 1923
358 Ga0466959_0003522 3300045049 Bacteria 10277
359 Ga0466959_0005036 3300045049 Bacteria 8976
360 Ga0466959_0017618 3300045049 Bacteria 5237
361 Ga0466959_0020374 3300045049 Bacteria 4886
362 Ga0466959_0021303 3300045049 Bacteria 4779
363 Ga0466958_0017180 3300045836 Bacteria 4178
364 Ga0466958_0113190 3300045836 Bacteria 1695
365 Ga0466958_0136322 3300045836 Bacteria 1544
366 Ga0466967_0001931 3300045976 Bacteria 12533
367 Ga0466967_0004056 3300045976 Bacteria 9770
368 Ga0466967_0026413 3300045976 Bacteria 4810
369 Ga0466967_0028197 3300045976 Bacteria 4684
370 Ga0466967_0030537 3300045976 Bacteria 4524
371 Ga0466967_0159755 3300045976 Bacteria 2114
372 Ga0495617_006315 3300046452 Bacteria 4163
373 Ga0495627_012636 3300046453 Bacteria 2991
374 Ga0495592_0002763 3300046454 Bacteria 12441
375 Ga0495592_0007118 3300046454 Bacteria 8373
376 Ga0495592_0011557 3300046454 Bacteria 6683
377 Ga0495592_0028400 3300046454 Bacteria 4237
378 Ga0495592_0078120 3300046454 Bacteria 2398
379 Ga0495592_0098219 3300046454 Bacteria 2090
380 Ga0495603_0002358 3300046455 Bacteria 11083
381 Ga0495603_0003057 3300046455 Bacteria 9926
382 Ga0495603_0005293 3300046455 Bacteria 7691
383 Ga0495603_0024352 3300046455 Bacteria 3659
384 Ga0495603_0048040 3300046455 Bacteria 2541
385 Ga0495603_0064545 3300046455 Bacteria 2158
386 Ga0495603_0065036 3300046455 Bacteria 2149
387 Ga0495590_0000234 3300046457 Bacteria 30439
388 Ga0495629_0001210 3300046459 Bacteria 20267
389 Ga0495629_0002991 3300046459 Bacteria 12852
390 Ga0495629_0052828 3300046459 Bacteria 2843
391 Ga0495629_0088010 3300046459 Bacteria 2166
392 Ga0495629_0120492 3300046459 Bacteria 1828
393 Ga0495629_0262315 3300046459 Bacteria 1187
394 Ga0495638_0117677 3300046460 Bacteria 1572
395 Ga0495651_0001241 3300046462 Bacteria 19736
396 Ga0495651_0002734 3300046462 Bacteria 13673
397 Ga0495651_0005548 3300046462 Bacteria 9620
398 Ga0495651_0007103 3300046462 Bacteria 8559
399 Ga0495651_0020136 3300046462 Bacteria 5178
400 Ga0495653_0005937 3300046463 Bacteria 9996
401 Ga0495580_0018355 3300046472 Bacteria 5209
402 Ga0495582_0010165 3300046473 Bacteria 5183
403 Ga0495582_0058349 3300046473 Bacteria 2128
404 Ga0495582_0104995 3300046473 Bacteria 1584
405 Ga0495639_0014570 3300046475 Bacteria 3405
406 Ga0495662_0004079 3300046476 Bacteria 7353
407 Ga0495662_0017105 3300046476 Bacteria 3510
408 Ga0495662_0018191 3300046476 Bacteria 3400
409 Ga0495662_0028188 3300046476 Bacteria 2711
410 Ga0495664_0004530 3300046477 Bacteria 7600
411 Ga0495664_0066158 3300046477 Bacteria 2155
412 Ga0495584_0054468 3300046491 Bacteria 2013
413 Ga0495585_0011522 3300046492 Bacteria 5232
414 Ga0495594_0000550 3300046499 Bacteria 19188
415 Ga0495594_0002955 3300046499 Bacteria 8812
416 Ga0495594_0019204 3300046499 Bacteria 3630
417 Ga0495594_0027793 3300046499 Bacteria 3050
418 Ga0495594_0031513 3300046499 Bacteria 2874
419 Ga0495594_0037228 3300046499 Bacteria 2654
420 Ga0495594_0072370 3300046499 Bacteria 1917
421 Ga0495596_0023776 3300046500 Bacteria 2485
422 Ga0495596_0043390 3300046500 Bacteria 1772
423 Ga0495607_0011764 3300046501 Bacteria 5803
424 Ga0495607_0095019 3300046501 Bacteria 1607
425 Ga0495606_0010862 3300046507 Bacteria 7500
426 Ga0495606_0039152 3300046507 Bacteria 3199
427 Ga0495608_0001164 3300046511 Bacteria 18625
428 Ga0495608_0145202 3300046511 Bacteria 1513
429 Ga0495616_0001635 3300046513 Bacteria 15364
430 Ga0495616_0013790 3300046513 Bacteria 4547
431 Ga0495618_0012044 3300046514 Bacteria 5247
432 Ga0495618_0030256 3300046514 Bacteria 3381
433 Ga0495618_0045750 3300046514 Bacteria 2761
434 Ga0495618_0049846 3300046514 Bacteria 2644
435 Ga0495618_0088506 3300046514 Bacteria 1980
436 Ga0495618_0153551 3300046514 Bacteria 1470
437 Ga0495620_0023636 3300046515 Bacteria 2935
438 Ga0495628_0008399 3300046516 Bacteria 8858
439 Ga0495628_0013505 3300046516 Bacteria 6869
440 Ga0495628_0032907 3300046516 Bacteria 4181
441 Ga0495628_0038232 3300046516 Bacteria 3843
442 Ga0495628_0043335 3300046516 Bacteria 3585
443 Ga0495628_0079730 3300046516 Bacteria 2545
444 Ga0495630_0016089 3300046517 Bacteria 5466
445 Ga0495630_0028340 3300046517 Bacteria 4162
446 Ga0495630_0039887 3300046517 Bacteria 3509
447 Ga0495631_0002123 3300046518 Bacteria 11479
448 Ga0495631_0026533 3300046518 Bacteria 2659
449 Ga0495643_0001512 3300046522 Bacteria 21014
450 Ga0495643_0002349 3300046522 Bacteria 15174
451 Ga0495648_0054949 3300046524 Bacteria 2402
452 Ga0495666_0007255 3300046526 Bacteria 5563
453 Ga0495666_0019935 3300046526 Bacteria 3327
454 Ga0495666_0035048 3300046526 Bacteria 2447
455 Ga0495666_0060342 3300046526 Bacteria 1812
456 Ga0495642_0027981 3300046528 Bacteria 2244
457 Ga0495652_0019500 3300046529 Bacteria 6037
458 Ga0495652_0027446 3300046529 Bacteria 5016
459 Ga0495652_0070413 3300046529 Bacteria 2923
460 Ga0495654_0008355 3300046530 Bacteria 5724
461 Ga0495654_0029806 3300046530 Bacteria 2781
462 Ga0495665_0001197 3300046531 Bacteria 13819
463 Ga0495640_0004947 3300046533 Bacteria 10594
464 Ga0495640_0043870 3300046533 Bacteria 3112
465 Ga0495586_0016311 3300046535 Bacteria 3951
466 Ga0495586_0022259 3300046535 Bacteria 3381
467 Ga0495586_0145788 3300046535 Bacteria 1330
468 Ga0495587_0002646 3300046536 Bacteria 11963
469 Ga0495609_0017410 3300046538 Bacteria 3336
470 Ga0495609_0109486 3300046538 Bacteria 1193
471 Ga0495645_0013132 3300046543 Bacteria 5854
472 Ga0495645_0014863 3300046543 Bacteria 5531
473 Ga0495622_0006833 3300046557 Bacteria 5296
474 Ga0495622_0028187 3300046557 Bacteria 2622
475 Ga0495622_0032646 3300046557 Bacteria 2430
476 Ga0495633_0021607 3300046558 Bacteria 3216
477 Ga0495633_0027002 3300046558 Bacteria 2810
478 Ga0495667_0014718 3300046559 Bacteria 5286
479 Ga0495668_0010883 3300046616 Bacteria 5477
480 Ga0495634_0009383 3300046642 Bacteria 7217
481 Ga0495634_0017111 3300046642 Bacteria 5177
482 Ga0495634_0022697 3300046642 Bacteria 4421
483 Ga0495634_0023503 3300046642 Bacteria 4331
484 Ga0495634_0023507 3300046642 Bacteria 4330
485 Ga0495611_0013679 3300046648 Bacteria 3458
486 Ga0495625_0007615 3300046660 Bacteria 9399
487 Ga0495625_0028467 3300046660 Bacteria 4190
488 Ga0495625_0094048 3300046660 Bacteria 2068
489 Ga0495625_0103074 3300046660 Bacteria 1957
490 Ga0495635_0000520 3300046663 Bacteria 24388
491 Ga0495635_0021076 3300046663 Bacteria 4542
492 Ga0495635_0038666 3300046663 Bacteria 3302
493 Ga0495635_0099309 3300046663 Bacteria 1989
494 Ga0495635_0115511 3300046663 Bacteria 1832
495 Ga0495635_0122230 3300046663 Bacteria 1775
496 Ga0495661_0012079 3300046665 Bacteria 5841
497 Ga0495661_0042422 3300046665 Bacteria 2804
498 Ga0495588_0001136 3300046674 Bacteria 11462
499 Ga0495588_0002833 3300046674 Bacteria 7457
500 Ga0495657_0003233 3300046675 Bacteria 13393
501 Ga0495657_0005001 3300046675 Bacteria 10535
502 Ga0495657_0005893 3300046675 Bacteria 9633
503 Ga0495657_0016339 3300046675 Bacteria 5408
504 Ga0495657_0017933 3300046675 Bacteria 5133
505 Ga0495657_0045310 3300046675 Bacteria 2985
506 Ga0495623_0010669 3300046679 Bacteria 5948
507 Ga0495623_0082593 3300046679 Bacteria 1985
508 Ga0495646_0001970 3300046680 Bacteria 12382
509 Ga0495646_0004975 3300046680 Bacteria 8391
510 Ga0495646_0008850 3300046680 Bacteria 6393
511 Ga0495658_0012481 3300046683 Bacteria 4306
512 Ga0495613_0001173 3300046689 Bacteria 19990
513 Ga0495613_0011991 3300046689 Bacteria 6441
514 Ga0495613_0012635 3300046689 Bacteria 6278
515 Ga0495613_0019804 3300046689 Bacteria 5013
516 Ga0495613_0058473 3300046689 Bacteria 2829
517 Ga0495613_0109405 3300046689 Bacteria 1992
518 Ga0495624_0015475 3300046690 Bacteria 5150
519 Ga0495624_0077432 3300046690 Bacteria 2062
520 Ga0495670_0004198 3300046691 Bacteria 7058
521 Ga0495670_0153968 3300046691 Bacteria 1206
522 Ga0495671_0080989 3300046692 Bacteria 1591
523 Ga0495649_0071333 3300046694 Bacteria 1862
524 Ga0495589_0019738 3300046794 Bacteria 3449
525 Ga0495589_0058085 3300046794 Bacteria 1902
526 Ga0495600_0008201 3300046809 Bacteria 6414
527 Ga0495600_0011153 3300046809 Bacteria 5595
528 Ga0495600_0013585 3300046809 Bacteria 5120
529 Ga0495600_0021087 3300046809 Bacteria 4170
530 Ga0495600_0029931 3300046809 Bacteria 3526
531 Ga0495600_0105461 3300046809 Bacteria 1836
532 Ga0495660_0139356 3300046810 Bacteria 1208
533 Ga0495581_0002333 3300047315 Bacteria 10697
534 Ga0495581_0017993 3300047315 Bacteria 4106
535 Ga0495581_0018769 3300047315 Bacteria 4014
536 Ga0495581_0023185 3300047315 Bacteria 3596
537 Ga0495604_0002431 3300047317 Bacteria 14899
538 Ga0495604_0005551 3300047317 Bacteria 10002
539 Ga0495604_0019901 3300047317 Bacteria 5367
540 Ga0495604_0055391 3300047317 Bacteria 3056
541 Ga0495636_0018696 3300047318 Bacteria 2781
542 Ga0495636_0024114 3300047318 Bacteria 2465
543 Ga0495674_0006537 3300047319 Bacteria 11187
544 Ga0495674_0135421 3300047319 Bacteria 2073
545 Ga0495676_0002779 3300047321 Bacteria 15733
546 Ga0495676_0003250 3300047321 Bacteria 14695
547 Ga0495676_0007323 3300047321 Bacteria 10124
548 Ga0495676_0009016 3300047321 Bacteria 9102
549 Ga0495676_0009639 3300047321 Bacteria 8786
550 Ga0495676_0010811 3300047321 Bacteria 8256
551 Ga0495676_0023060 3300047321 Bacteria 5406
552 Ga0495680_0014414 3300047322 Bacteria 6844
553 Ga0495680_0016762 3300047322 Bacteria 6281
554 Ga0495687_004847 3300047443 Bacteria 8843
555 Ga0495687_005971 3300047443 Bacteria 7593
556 Ga0495687_039840 3300047443 Bacteria 2075
557 Ga0495675_0004393 3300047444 Bacteria 8533
558 Ga0495675_0011798 3300047444 Bacteria 5490
559 Ga0495675_0012238 3300047444 Bacteria 5398
560 Ga0495675_0068701 3300047444 Bacteria 2238
561 Ga0495675_0071452 3300047444 Bacteria 2190
562 Ga0495675_0162200 3300047444 Bacteria 1376
563 Ga0495685_000221 3300047447 Bacteria 19406
564 Ga0495685_003066 3300047447 Bacteria 5298
565 Ga0495685_019655 3300047447 Bacteria 2321
566 Ga0495685_041956 3300047447 Bacteria 1562
567 Ga0495685_062430 3300047447 Bacteria 1254
568 Ga0495681_0005609 3300047470 Bacteria 8370
569 Ga0495681_0006380 3300047470 Bacteria 7759
570 Ga0495681_0009675 3300047470 Bacteria 5912
571 Ga0495681_0050900 3300047470 Bacteria 1950
572 Ga0495681_0062301 3300047470 Bacteria 1715
573 Ga0495684_0019913 3300047471 Bacteria 5171
574 Ga0495684_0123910 3300047471 Bacteria 1945
575 Ga0495684_0128758 3300047471 Bacteria 1903
576 Ga0495686_0016525 3300047472 Bacteria 5003
577 Ga0495686_0030332 3300047472 Bacteria 3512
578 Ga0495686_0055049 3300047472 Bacteria 2489
579 Ga0495593_0000873 3300047673 Bacteria 17468
580 Ga0495593_0029698 3300047673 Bacteria 2996
581 Ga0495593_0085041 3300047673 Bacteria 1632
582 Ga0495602_0032202 3300048088 Bacteria 4941
583 Ga0495614_0001082 3300048089 Bacteria 11659
584 Ga0495614_0003707 3300048089 Bacteria 6860
585 Ga0495614_0037764 3300048089 Bacteria 2072
586 Ga0495626_0057035 3300048091 Bacteria 1787
587 Ga0496100_0000374 3300048903 Bacteria 21787
588 Ga0496101_0004976 3300048904 Bacteria 8437
589 Ga0496102_0008486 3300048905 Bacteria 8806
590 Ga0496102_0136474 3300048905 Bacteria 2299
591 Ga0496103_0011717 3300048906 Bacteria 5202
592 Ga0496104_0000785 3300048907 Bacteria 27175
593 Ga0496104_0048561 3300048907 Bacteria 4001
594 Ga0496104_0057964 3300048907 Bacteria 3665
595 Ga0496104_0354618 3300048907 Bacteria 1379
596 Ga0496105_0004871 3300048908 Bacteria 10137
597 Ga0496105_0128263 3300048908 Bacteria 2091
598 Ga0496106_0240581 3300048909 Bacteria 1446
599 Ga0496108_0005434 3300048911 Bacteria 10293
600 Ga0496108_0066279 3300048911 Bacteria 3044
601 Ga0496108_0102792 3300048911 Bacteria 2438
602 Ga0496108_0106420 3300048911 Bacteria 2395
603 Ga0496108_0186897 3300048911 Bacteria 1795
604 Ga0496109_0026425 3300048912 Bacteria 5177
605 Ga0496109_0102265 3300048912 Bacteria 2659
606 Ga0496109_0186158 3300048912 Bacteria 1950
607 Ga0496109_0187329 3300048912 Bacteria 1944
608 Ga0496110_0006505 3300048913 Bacteria 9270
609 Ga0496110_0101731 3300048913 Bacteria 2576
610 Ga0496110_0120423 3300048913 Bacteria 2364
611 Ga0496110_0231232 3300048913 Bacteria 1682
612 Ga0496111_0021337 3300048914 Bacteria 4521
613 Ga0496111_0035948 3300048914 Bacteria 3542
614 Ga0496112_0006151 3300048915 Bacteria 10494
615 Ga0496112_0010916 3300048915 Bacteria 8270
616 Ga0496112_0029855 3300048915 Bacteria 5274
617 Ga0496112_0269477 3300048915 Bacteria 1651
618 Ga0496113_0080041 3300048916 Bacteria 2502
619 Ga0496113_0157828 3300048916 Bacteria 1792
620 Ga0496114_0002155 3300048917 Bacteria 14988
621 Ga0496114_0003978 3300048917 Bacteria 11412
622 Ga0496114_0007544 3300048917 Bacteria 8604
623 Ga0496114_0007977 3300048917 Bacteria 8377
624 Ga0496114_0019381 3300048917 Bacteria 5512
625 Ga0496114_0030255 3300048917 Bacteria 4454
626 Ga0496114_0054268 3300048917 Bacteria 3342
627 Ga0496114_0112280 3300048917 Bacteria 2336
628 Ga0496114_0205334 3300048917 Bacteria 1727
629 Ga0496122_0000659 3300048925 Bacteria 69472
630 Ga0496123_0018794 3300048926 Bacteria 5476
631 Ga0496126_0003688 3300048929 Bacteria 19129
632 Ga0501306_000871 3300049127 Bacteria 2587
633 Ga0501306_008204 3300049127 Bacteria 1269
634 Ga0495678_020853 3300049459 Bacteria 2894
635 Ga0495682_0033404 3300049460 Bacteria 1899
636 Ga0501323_000125 3300049539 Bacteria 4336
637 Ga0501323_001566 3300049539 Bacteria 2069
638 Ga0501324_000079 3300049540 Bacteria 3528
639 Ga0501031_0000536 3300049568 Bacteria 22196
640 Ga0501031_0002123 3300049568 Bacteria 12502
641 Ga0501031_0006009 3300049568 Bacteria 7923
642 Ga0501031_0014225 3300049568 Bacteria 5176
643 Ga0501031_0090620 3300049568 Bacteria 1994
644 Ga0501032_0002282 3300049569 Bacteria 15068
645 Ga0501032_0003032 3300049569 Bacteria 13022
646 Ga0501032_0004079 3300049569 Bacteria 11066
647 Ga0501032_0005643 3300049569 Bacteria 9272
648 Ga0501032_0011400 3300049569 Bacteria 6387
649 Ga0501032_0019085 3300049569 Bacteria 4797
650 Ga0501032_0121256 3300049569 Bacteria 1728
651 Ga0501033_0002719 3300049570 Bacteria 14836
652 Ga0501033_0007663 3300049570 Bacteria 8381
653 Ga0501033_0008925 3300049570 Bacteria 7743
654 Ga0501033_0027215 3300049570 Bacteria 4300
655 Ga0501033_0030280 3300049570 Bacteria 4067
656 Ga0501034_0004750 3300049571 Bacteria 15038
657 Ga0501034_0007650 3300049571 Bacteria 11496
658 Ga0501034_0008248 3300049571 Bacteria 11030
659 Ga0501034_0011906 3300049571 Bacteria 8997
660 Ga0501034_0016319 3300049571 Bacteria 7623
661 Ga0501034_0095440 3300049571 Bacteria 2970
662 Ga0501034_0143043 3300049571 Bacteria 2370
663 Ga0501036_0005396 3300049572 Bacteria 10356
664 Ga0501036_0010545 3300049572 Bacteria 7635
665 Ga0501036_0012876 3300049572 Bacteria 6944
666 Ga0501036_0022111 3300049572 Bacteria 5349
667 Ga0501036_0046032 3300049572 Bacteria 3694
668 Ga0501036_0046054 3300049572 Bacteria 3693
669 Ga0501036_0099725 3300049572 Bacteria 2456
670 Ga0501037_0003593 3300049573 Bacteria 11251
671 Ga0501037_0004880 3300049573 Bacteria 9755
672 Ga0501037_0008803 3300049573 Bacteria 7398
673 Ga0501037_0040284 3300049573 Bacteria 3438
674 Ga0501037_0041834 3300049573 Bacteria 3368
675 Ga0501037_0073632 3300049573 Bacteria 2483
676 Ga0501037_0200612 3300049573 Bacteria 1410
677 Ga0501038_0003399 3300049574 Bacteria 14836
678 Ga0501038_0011152 3300049574 Bacteria 8207
679 Ga0501038_0015275 3300049574 Bacteria 6980
680 Ga0501038_0037604 3300049574 Bacteria 4243
681 Ga0501038_0048904 3300049574 Bacteria 3658
682 Ga0501039_0010651 3300049575 Bacteria 7005
683 Ga0501039_0011202 3300049575 Bacteria 6833
684 Ga0501039_0015466 3300049575 Bacteria 5842
685 Ga0501039_0018889 3300049575 Bacteria 5292
686 Ga0501039_0145635 3300049575 Bacteria 1861
687 Ga0501040_0001825 3300049576 Bacteria 13697
688 Ga0501040_0003567 3300049576 Bacteria 10063
689 Ga0501041_0001588 3300049577 Bacteria 12659
690 Ga0501041_0004107 3300049577 Bacteria 8416
691 Ga0501042_0001841 3300049578 Bacteria 12722
692 Ga0501042_0007844 3300049578 Bacteria 7018
693 Ga0501042_0024880 3300049578 Bacteria 4203
694 Ga0501042_0068950 3300049578 Bacteria 2529
695 Ga0501043_0002630 3300049579 Bacteria 15116
696 Ga0501043_0002940 3300049579 Bacteria 14207
697 Ga0501043_0004752 3300049579 Bacteria 11017
698 Ga0501043_0010621 3300049579 Bacteria 7211
699 Ga0501043_0023928 3300049579 Bacteria 4791
700 Ga0501043_0043027 3300049579 Bacteria 3550
701 Ga0501046_0003295 3300049580 Bacteria 14833
702 Ga0501046_0005788 3300049580 Bacteria 11031
703 Ga0501046_0010272 3300049580 Bacteria 8056
704 Ga0501046_0013477 3300049580 Bacteria 6920
705 Ga0501047_0000015 3300049581 Bacteria 307932
706 Ga0501047_0000055 3300049581 Bacteria 144149
707 Ga0501047_0000750 3300049581 Bacteria 33804
708 Ga0501047_0001216 3300049581 Bacteria 25535
709 Ga0501047_0004692 3300049581 Bacteria 12851
710 Ga0501047_0009073 3300049581 Bacteria 9392
711 Ga0501047_0010994 3300049581 Bacteria 8565
712 Ga0501047_0017035 3300049581 Bacteria 6949
713 Ga0501047_0056625 3300049581 Bacteria 3791
714 Ga0501047_0098351 3300049581 Bacteria 2805
715 Ga0501047_0219449 3300049581 Bacteria 1758
716 Ga0501047_0282264 3300049581 Bacteria 1505
717 Ga0501048_0004365 3300049582 Bacteria 10766
718 Ga0501048_0006407 3300049582 Bacteria 8946
719 Ga0501048_0148001 3300049582 Bacteria 1661
720 Ga0501067_0001877 3300049583 Bacteria 11545
721 Ga0501067_0002169 3300049583 Bacteria 10820
722 Ga0501068_0000061 3300049584 Bacteria 42895
723 Ga0501068_0005108 3300049584 Bacteria 7150
724 Ga0501069_0001698 3300049585 Bacteria 10967
725 Ga0501070_0009498 3300049586 Bacteria 8221
726 Ga0501070_0016299 3300049586 Bacteria 6242
727 Ga0501070_0021752 3300049586 Bacteria 5375
728 Ga0501070_0043168 3300049586 Bacteria 3753
729 Ga0501070_0148880 3300049586 Bacteria 1931
730 Ga0501071_0000111 3300049587 Bacteria 32014
731 Ga0501071_0000711 3300049587 Bacteria 17478
732 Ga0501071_0046170 3300049587 Bacteria 3129
733 Ga0501072_0005562 3300049588 Bacteria 9585
734 Ga0501072_0005806 3300049588 Bacteria 9400
735 Ga0501072_0068306 3300049588 Bacteria 2805
736 Ga0501073_0002148 3300049589 Bacteria 14740
737 Ga0501073_0010029 3300049589 Bacteria 6964
738 Ga0501073_0062918 3300049589 Bacteria 2588
739 Ga0501074_0002104 3300049590 Bacteria 13743
740 Ga0501074_0002337 3300049590 Bacteria 13192
741 Ga0501074_0035151 3300049590 Bacteria 3630
742 Ga0501076_0007178 3300049592 Bacteria 8100
743 Ga0501077_0003734 3300049593 Bacteria 9163
744 Ga0501077_0011444 3300049593 Bacteria 5541
745 Ga0501217_006471 3300049661 Bacteria 2490
746 Ga0501225_0009459 3300049705 Bacteria 2774
747 Ga0501079_0018017 3300049741 Bacteria 5392
748 Ga0501079_0057755 3300049741 Bacteria 2993
749 Ga0501080_0065356 3300049742 Bacteria 3383
750 Ga0501080_0137357 3300049742 Bacteria 2261
751 Ga0501083_0000169 3300049744 Bacteria 42763
752 Ga0501083_0000393 3300049744 Bacteria 27798
753 Ga0501083_0004738 3300049744 Bacteria 9610
754 Ga0501035_0001243 3300049822 Bacteria 26482
755 Ga0501035_0003733 3300049822 Bacteria 14519
756 Ga0501035_0007178 3300049822 Bacteria 10424
757 Ga0501035_0011951 3300049822 Bacteria 8032
758 Ga0501035_0013913 3300049822 Bacteria 7424
759 Ga0501035_0019079 3300049822 Bacteria 6312
760 Ga0501035_0093615 3300049822 Bacteria 2643
761 Ga0501035_0106475 3300049822 Bacteria 2458
762 Ga0501035_0108526 3300049822 Bacteria 2433
763 Ga0501035_0246245 3300049822 Bacteria 1519
764 Ga0501044_0009004 3300049823 Bacteria 10918
765 Ga0501044_0009018 3300049823 Bacteria 10906
766 Ga0501044_0016851 3300049823 Bacteria 7838
767 Ga0501044_0031763 3300049823 Bacteria 5554
768 Ga0501044_0031984 3300049823 Bacteria 5531
769 Ga0501044_0034418 3300049823 Bacteria 5313
770 Ga0501044_0069908 3300049823 Bacteria 3573
771 Ga0501044_0089560 3300049823 Bacteria 3105
772 Ga0501044_0092045 3300049823 Bacteria 3058
773 Ga0501044_0122347 3300049823 Bacteria 2602
774 Ga0501045_0004757 3300049824 Bacteria 9375
775 Ga0501045_0007462 3300049824 Bacteria 7595
776 Ga0501045_0011850 3300049824 Bacteria 6127
777 Ga0501045_0033009 3300049824 Bacteria 3753
778 Ga0501045_0201019 3300049824 Bacteria 1485
779 nmdc:mga03n38_11880_c1 3300050490 Bacteria 3258
780 nmdc:mga03n38_7581_c1 3300050490 Bacteria 3846
781 nmdc:mga00v17_35956_c1 3300050491 Bacteria 1847
782 nmdc:mga06z11_5609_c1 3300050494 Bacteria 5048
783 nmdc:mga05p37_39997_c1 3300050507 Bacteria 5758
784 nmdc:mga05p37_7421_c1 3300050507 Bacteria 12935
785 nmdc:mga05p37_804_c2 3300050507 Bacteria 30686
786 nmdc:mga09592_2828_c1 3300050508 Bacteria 14070
787 nmdc:mga09592_8674_c1 3300050508 Bacteria 8275
788 nmdc:mga0qj67_1396_c1 3300050509 Bacteria 16943
789 nmdc:mga0qj67_2509_c1 3300050509 Bacteria 13102
790 nmdc:mga06r32_23470_c1 3300050510 Bacteria 5707
791 nmdc:mga06r32_532_c1 3300050510 Bacteria 32919
792 nmdc:mga06r32_8900_c1 3300050510 Bacteria 9050
793 nmdc:mga08y16_138174_c1 3300050511 Bacteria 2534
794 nmdc:mga08y16_7508_c1 3300050511 Bacteria 11418
795 nmdc:mga0n895_217_c1 3300050512 Bacteria 36183
796 nmdc:mga0rr50_5127_c1 3300050513 Bacteria 7779
797 nmdc:mga08x19_5248_c1 3300050514 Bacteria 7668
798 nmdc:mga0a205_10607_c1 3300050515 Bacteria 8469
799 nmdc:mga0a205_1731_c1 3300050515 Bacteria 18865
800 Ga0495601_0003728 3300053077 Bacteria 8771
801 Ga0495601_0050566 3300053077 Bacteria 2621
802 Ga0495601_0081822 3300053077 Bacteria 2073
803 Ga0495619_0014049 3300053085 Bacteria 5052
804 Ga0495619_0181060 3300053085 Bacteria 1458
805 Ga0500583_0050301 3300053092 Bacteria 1932
806 Ga0500566_0049684 3300053094 Bacteria 2402
807 Ga0500640_004096 3300053095 Bacteria 5241
808 Ga0500640_004273 3300053095 Bacteria 5164
809 Ga0500641_0041881 3300053096 Bacteria 1854
810 Ga0500654_028320 3300053099 Bacteria 3426
811 Ga0500608_093215 3300053122 Bacteria 1405
812 Ga0500628_001077 3300053129 Bacteria 4771
813 Ga0500652_007170 3300053131 Bacteria 3633
814 Ga0500658_0002174 3300053134 Bacteria 7620
815 Ga0500561_0000602 3300053137 Bacteria 5775
816 Ga0500573_0013167 3300053140 Bacteria 4657
817 Ga0500616_0000783 3300053153 Bacteria 36539
818 Ga0500616_0002034 3300053153 Bacteria 17835
819 Ga0500616_0006951 3300053153 Bacteria 7287
820 Ga0500627_0032050 3300053158 Bacteria 2213
821 Ga0500634_0003601 3300053161 Bacteria 6941
822 Ga0500656_001066 3300053732 Bacteria 2258
823 Ga0501084_0006963 3300054114 Bacteria 9314
824 Ga0501084_0008261 3300054114 Bacteria 8586
825 Ga0501084_0146390 3300054114 Bacteria 1990
826 Ga0590075_006130 3300059424 Bacteria 2848
827 Ga0587106_009639 3300059605 Bacteria 1232
828 Ga0501082_0001363 3300060353 Bacteria 21471
829 Ga0501082_0002837 3300060353 Bacteria 15100
830 Ga0501082_0010785 3300060353 Bacteria 7869
831 Ga0501082_0162214 3300060353 Bacteria 1943
832 Ga0466962_0000963 3300061719 Bacteria 13083
833 Ga0466962_0002503 3300061719 Bacteria 8717
834 Ga0466962_0037285 3300061719 Bacteria 2327
835 Ga0530510_0006823 3300061734 Bacteria 7955

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046454 Ga0495592_0078120 Ga0495592_0078120_1388_2386 328
2 3300048911 Ga0496108_0106420 Ga0496108_0106420_1333_2373 328
3 3300005983 Ga0081540_1046845 Ga0081540_10468452 331
4 3300030521 Ga0307511_10022667 Ga0307511_100226673 338
5 3300033180 Ga0307510_10129706 Ga0307510_101297062 338
6 3300005981 Ga0081538_10018403 Ga0081538_100184032 341
7 3300048915 Ga0496112_0269477 Ga0496112_0269477_96_1136 342
8 3300005530 Ga0070679_100014163 Ga0070679_1000141635 345
9 3300025921 Ga0207652_10027503 Ga0207652_100275034 345
10 3300015688 Ga0183367_1007 Ga0183367_1007183 347
11 3300028794 Ga0307515_10087217 Ga0307515_100872172 347
12 3300030522 Ga0307512_10016591 Ga0307512_100165913 347
13 3300031649 Ga0307514_10095809 Ga0307514_100958092 347
14 3300044684 Ga0466966_0005929 Ga0466966_0005929_1209_2309 347
15 3300045049 Ga0466959_0020374 Ga0466959_0020374_884_1984 347
16 3300050490 nmdc:mga03n38_7581_c1 nmdc:mga03n38_7581_c1_1891_3009 348
17 3300044735 Ga0466968_0001751 Ga0466968_0001751_82_1182 349
18 3300046689 Ga0495613_0058473 Ga0495613_0058473_905_1966 349
19 3300047444 Ga0495675_0162200 Ga0495675_0162200_245_1366 349
20 3300032002 Ga0307416_100065308 Ga0307416_1000653082 350
21 3300032004 Ga0307414_10117210 Ga0307414_101172102 350
22 3300046453 Ga0495627_012636 Ga0495627_012636_635_1753 350
23 3300046455 Ga0495603_0064545 Ga0495603_0064545_421_1539 350
24 3300046499 Ga0495594_0031513 Ga0495594_0031513_1729_2847 350
25 3300046500 Ga0495596_0023776 Ga0495596_0023776_697_1815 350
26 3300046507 Ga0495606_0039152 Ga0495606_0039152_721_1839 350
27 3300046513 Ga0495616_0001635 Ga0495616_0001635_9921_11039 350
28 3300046514 Ga0495618_0045750 Ga0495618_0045750_892_2010 350
29 3300046518 Ga0495631_0002123 Ga0495631_0002123_9265_10383 350
30 3300046522 Ga0495643_0001512 Ga0495643_0001512_15119_16237 350
31 3300046526 Ga0495666_0035048 Ga0495666_0035048_630_1748 350
32 3300046528 Ga0495642_0027981 Ga0495642_0027981_804_1922 350
33 3300046530 Ga0495654_0008355 Ga0495654_0008355_1039_2157 350
34 3300046557 Ga0495622_0032646 Ga0495622_0032646_991_2109 350
35 3300046558 Ga0495633_0027002 Ga0495633_0027002_1255_2373 350
36 3300046663 Ga0495635_0099309 Ga0495635_0099309_201_1319 350
37 3300046665 Ga0495661_0012079 Ga0495661_0012079_1525_2643 350
38 3300046679 Ga0495623_0010669 Ga0495623_0010669_4184_5302 350
39 3300046690 Ga0495624_0077432 Ga0495624_0077432_272_1390 350
40 3300046794 Ga0495589_0058085 Ga0495589_0058085_688_1806 350
41 3300047317 Ga0495604_0055391 Ga0495604_0055391_727_1845 350
42 3300047321 Ga0495676_0023060 Ga0495676_0023060_3908_5026 350
43 3300047322 Ga0495680_0016762 Ga0495680_0016762_1732_2850 350
44 3300047470 Ga0495681_0050900 Ga0495681_0050900_464_1582 350
45 3300047472 Ga0495686_0055049 Ga0495686_0055049_734_1852 350
46 3300049460 Ga0495682_0033404 Ga0495682_0033404_503_1621 350
47 3300046452 Ga0495617_006315 Ga0495617_006315_2248_3366 351
48 3300046454 Ga0495592_0098219 Ga0495592_0098219_119_1231 351
49 3300046491 Ga0495584_0054468 Ga0495584_0054468_636_1754 351
50 3300046533 Ga0495640_0004947 Ga0495640_0004947_4271_5389 351
51 3300046809 Ga0495600_0008201 Ga0495600_0008201_849_1967 351
52 3300005329 Ga0070683_100178183 Ga0070683_1001781832 353
53 3300005981 Ga0081538_10000958 Ga0081538_1000095816 353
54 3300009176 Ga0105242_10060004 Ga0105242_100600043 353
55 3300013306 Ga0163162_10490383 Ga0163162_104903832 353
56 3300017792 Ga0163161_10101033 Ga0163161_101010332 353
57 3300048911 Ga0496108_0066279 Ga0496108_0066279_1221_2342 353
58 3300048913 Ga0496110_0101731 Ga0496110_0101731_770_1891 353
59 3300048914 Ga0496111_0021337 Ga0496111_0021337_3115_4236 353
60 3300048915 Ga0496112_0029855 Ga0496112_0029855_1045_2166 353
61 3300048916 Ga0496113_0157828 Ga0496113_0157828_647_1768 353
62 3300048917 Ga0496114_0007544 Ga0496114_0007544_4206_5327 353
63 3300049705 Ga0501225_0009459 Ga0501225_0009459_1354_2427 353
64 3300046455 Ga0495603_0002358 Ga0495603_0002358_911_2029 354
65 3300046455 Ga0495603_0065036 Ga0495603_0065036_25_1143 354
66 3300046473 Ga0495582_0058349 Ga0495582_0058349_317_1435 354
67 3300046475 Ga0495639_0014570 Ga0495639_0014570_1663_2781 354
68 3300046476 Ga0495662_0028188 Ga0495662_0028188_1461_2579 354
69 3300046499 Ga0495594_0072370 Ga0495594_0072370_501_1619 354
70 3300046663 Ga0495635_0115511 Ga0495635_0115511_400_1518 354
71 3300046674 Ga0495588_0001136 Ga0495588_0001136_371_1489 354
72 3300046675 Ga0495657_0016339 Ga0495657_0016339_4099_5217 354
73 3300046689 Ga0495613_0109405 Ga0495613_0109405_615_1733 354
74 3300046691 Ga0495670_0153968 Ga0495670_0153968_60_1178 354
75 3300047444 Ga0495675_0004393 Ga0495675_0004393_4066_5184 354
76 3300047447 Ga0495685_062430 Ga0495685_062430_27_1145 354
77 3300049127 Ga0501306_000871 Ga0501306_000871_301_1419 354
78 3300049587 Ga0501071_0046170 Ga0501071_0046170_1112_2197 354
79 3300060353 Ga0501082_0162214 Ga0501082_0162214_533_1618 354
80 3300061734 Ga0530510_0006823 Ga0530510_0006823_4236_5321 354
81 3300006844 Ga0075428_100132945 Ga0075428_1001329452 355
82 3300020082 Ga0206353_10237768 Ga0206353_102377687 355
83 3300047318 Ga0495636_0018696 Ga0495636_0018696_407_1546 355
84 3300047447 Ga0495685_041956 Ga0495685_041956_371_1510 355
85 3300044656 Ga0466969_0017395 Ga0466969_0017395_907_2022 356
86 3300044684 Ga0466966_0006679 Ga0466966_0006679_3447_4562 356
87 3300044693 Ga0466961_0001045 Ga0466961_0001045_480_1595 356
88 3300044719 Ga0466971_0001266 Ga0466971_0001266_5044_6159 356
89 3300045049 Ga0466959_0005036 Ga0466959_0005036_6555_7670 356
90 3300045836 Ga0466958_0017180 Ga0466958_0017180_2097_3212 356
91 3300045976 Ga0466967_0030537 Ga0466967_0030537_244_1362 356
92 3300046514 Ga0495618_0049846 Ga0495618_0049846_836_1948 356
93 3300046516 Ga0495628_0079730 Ga0495628_0079730_1091_2203 356
94 3300046642 Ga0495634_0023503 Ga0495634_0023503_872_1984 356
95 3300050494 nmdc:mga06z11_5609_c1 nmdc:mga06z11_5609_c1_3903_5021 356
96 3300053077 Ga0495601_0050566 Ga0495601_0050566_64_1176 356
97 3300061719 Ga0466962_0002503 Ga0466962_0002503_6755_7870 356
98 3300001989 JGI24739J22299_10026852 JGI24739J22299_100268522 357
99 3300002075 JGI24738J21930_10012699 JGI24738J21930_100126991 357
100 3300013307 Ga0157372_10327031 Ga0157372_103270311 357
101 3300025904 Ga0207647_10026598 Ga0207647_100265982 357
102 3300028794 Ga0307515_10142214 Ga0307515_101422142 357
103 3300030522 Ga0307512_10012127 Ga0307512_100121274 357
104 3300031456 Ga0307513_10090310 Ga0307513_100903103 357
105 3300031616 Ga0307508_10094817 Ga0307508_100948172 357
106 3300046663 Ga0495635_0122230 Ga0495635_0122230_584_1708 357
107 3300005985 Ga0081539_10000292 Ga0081539_10000292109 358
108 3300005985 Ga0081539_10011343 Ga0081539_100113435 358
109 3300005985 Ga0081539_10018862 Ga0081539_100188623 358
110 3300005985 Ga0081539_10020454 Ga0081539_100204541 358
111 3300006844 Ga0075428_100004393 Ga0075428_10000439318 358
112 3300006846 Ga0075430_100003006 Ga0075430_1000030067 358
113 3300006847 Ga0075431_100003087 Ga0075431_1000030877 358
114 3300006880 Ga0075429_100000303 Ga0075429_1000003037 358
115 3300009147 Ga0114129_10000100 Ga0114129_1000010028 358
116 3300031731 Ga0307405_10124011 Ga0307405_101240112 358
117 3300031852 Ga0307410_10082643 Ga0307410_100826432 358
118 3300031995 Ga0307409_100121701 Ga0307409_1001217012 358
119 3300032002 Ga0307416_100075738 Ga0307416_1000757381 358
120 3300032002 Ga0307416_100125664 Ga0307416_1001256643 358
121 3300032126 Ga0307415_100069039 Ga0307415_1000690392 358
122 3300033179 Ga0307507_10000019 Ga0307507_10000019190 358
123 3300044656 Ga0466969_0023298 Ga0466969_0023298_1558_2697 358
124 3300044693 Ga0466961_0132357 Ga0466961_0132357_327_1466 358
125 3300044719 Ga0466971_0029149 Ga0466971_0029149_330_1469 358
126 3300045049 Ga0466959_0021303 Ga0466959_0021303_1315_2454 358
127 3300049539 Ga0501323_000125 Ga0501323_000125_2305_3420 358
128 3300049540 Ga0501324_000079 Ga0501324_000079_1844_2959 358
129 3300050507 nmdc:mga05p37_804_c2 nmdc:mga05p37_804_c2_24015_25124 358
130 3300050508 nmdc:mga09592_2828_c1 nmdc:mga09592_2828_c1_10541_11650 358
131 3300050509 nmdc:mga0qj67_2509_c1 nmdc:mga0qj67_2509_c1_10312_11421 358
132 3300050510 nmdc:mga06r32_532_c1 nmdc:mga06r32_532_c1_17455_18564 358
133 3300059424 Ga0590075_006130 Ga0590075_006130_273_1367 358
134 3300046454 Ga0495592_0002763 Ga0495592_0002763_3369_4487 359
135 3300046462 Ga0495651_0020136 Ga0495651_0020136_3249_4367 359
136 3300046529 Ga0495652_0070413 Ga0495652_0070413_890_2008 359
137 3300046642 Ga0495634_0017111 Ga0495634_0017111_724_1842 359
138 3300046809 Ga0495600_0011153 Ga0495600_0011153_3132_4250 359
139 3300047444 Ga0495675_0071452 Ga0495675_0071452_893_2011 359
140 3300005336 Ga0070680_100112524 Ga0070680_1001125242 360
141 3300005339 Ga0070660_100005230 Ga0070660_1000052304 360
142 3300005458 Ga0070681_10044433 Ga0070681_100444332 360
143 3300005535 Ga0070684_100044105 Ga0070684_1000441052 360
144 3300005981 Ga0081538_10001594 Ga0081538_1000159424 360
145 3300009093 Ga0105240_10033493 Ga0105240_100334935 360
146 3300020069 Ga0197907_11047224 Ga0197907_110472242 360
147 3300025917 Ga0207660_10125865 Ga0207660_101258652 360
148 3300025929 Ga0207664_10021773 Ga0207664_100217732 360
149 3300025949 Ga0207667_10048745 Ga0207667_100487453 360
150 3300030745 Ga0316182_1376048 Ga0316182_13760482 360
151 3300031456 Ga0307513_10000009 Ga0307513_10000009233 360
152 3300048911 Ga0496108_0186897 Ga0496108_0186897_189_1280 360
153 3300048917 Ga0496114_0054268 Ga0496114_0054268_509_1600 360
154 3300048917 Ga0496114_0205334 Ga0496114_0205334_322_1413 360
155 3300049661 Ga0501217_006471 Ga0501217_006471_965_2101 360
156 iso_pu_bacteria 2554235227 2555231176 360
157 iso_pu_bacteria 2654587600 2655032833 360
158 3300031995 Ga0307409_100055774 Ga0307409_1000557742 361
159 iso_pu_bacteria 2643221601 2644017883 361
160 iso_pu_bacteria 2643221631 2644180829 361
161 iso_pu_bacteria 2891395885 2891400673 361
162 iso_pu_bacteria 2920879853 2920882583 361
163 3300005455 Ga0070663_100028092 Ga0070663_1000280923 362
164 3300005548 Ga0070665_100030289 Ga0070665_1000302893 362
165 3300005578 Ga0068854_100000899 Ga0068854_1000008998 362
166 3300005616 Ga0068852_100049839 Ga0068852_1000498392 362
167 3300009093 Ga0105240_10043420 Ga0105240_100434202 362
168 3300009551 Ga0105238_10009367 Ga0105238_100093672 362
169 3300010375 Ga0105239_10063085 Ga0105239_100630853 362
170 3300013105 Ga0157369_10164287 Ga0157369_101642872 362
171 3300013296 Ga0157374_10202172 Ga0157374_102021722 362
172 3300020069 Ga0197907_10887992 Ga0197907_108879922 362
173 3300020070 Ga0206356_10823945 Ga0206356_108239452 362
174 3300020075 Ga0206349_1610450 Ga0206349_16104502 362
175 3300020078 Ga0206352_10792297 Ga0206352_107922972 362
176 3300020080 Ga0206350_10850691 Ga0206350_108506912 362
177 3300022467 Ga0224712_10011329 Ga0224712_100113292 362
178 3300022467 Ga0224712_10013631 Ga0224712_100136312 362
179 3300025904 Ga0207647_10002104 Ga0207647_100021044 362
180 3300025913 Ga0207695_10001103 Ga0207695_1000110310 362
181 3300025914 Ga0207671_10000389 Ga0207671_1000038948 362
182 3300025924 Ga0207694_10004658 Ga0207694_100046582 362
183 3300025949 Ga0207667_10033632 Ga0207667_100336325 362
184 3300025981 Ga0207640_10004544 Ga0207640_100045442 362
185 3300026067 Ga0207678_10059010 Ga0207678_100590102 362
186 3300028379 Ga0268266_10140587 Ga0268266_101405872 362
187 3300044656 Ga0466969_0001666 Ga0466969_0001666_8316_9416 362
188 3300044693 Ga0466961_0010788 Ga0466961_0010788_1720_2820 362
189 3300044765 Ga0466970_0002303 Ga0466970_0002303_3498_4598 362
190 3300046462 Ga0495651_0001241 Ga0495651_0001241_3368_4468 362
191 3300046511 Ga0495608_0145202 Ga0495608_0145202_79_1269 362
192 3300046516 Ga0495628_0032907 Ga0495628_0032907_1063_2163 362
193 3300046529 Ga0495652_0019500 Ga0495652_0019500_3185_4285 362
194 3300046543 Ga0495645_0013132 Ga0495645_0013132_1936_3036 362
195 3300046809 Ga0495600_0013585 Ga0495600_0013585_1826_2926 362
196 3300047443 Ga0495687_039840 Ga0495687_039840_380_1468 362
197 3300048917 Ga0496114_0112280 Ga0496114_0112280_1142_2245 362
198 3300053077 Ga0495601_0081822 Ga0495601_0081822_941_2041 362
199 iso_pu_bacteria 2643221711 2644611135 362
200 iso_pu_bacteria 2738541264 2738669361 362
201 iso_pu_bacteria 2738541356 2739148485 362
202 iso_pu_bacteria 2816332119 2816426193 362
203 iso_pu_bacteria 2818991318 2819427792 362
204 3300048917 Ga0496114_0002155 Ga0496114_0002155_12734_13843 363
205 iso_pu_bacteria 2868088558 2868089035 363
206 iso_pu_bacteria 2902799365 2902801127 363
207 iso_pu_bacteria 3006425503 3006426396 363
208 iso_pu_bacteria 8025478263 8025479271 363
209 iso_pu_bacteria 8056054917 8056059438 363
210 iso_pu_bacteria 8056447290 8056452231 363
211 iso_pu_bacteria 8056667051 8056667615 363
212 3300005435 Ga0070714_100002556 Ga0070714_1000025565 364
213 3300005518 Ga0070699_100320600 Ga0070699_1003206001 364
214 3300013104 Ga0157370_10327625 Ga0157370_103276251 364
215 3300013306 Ga0163162_10063073 Ga0163162_100630732 364
216 3300028563 Ga0265319_1003772 Ga0265319_10037727 364
217 3300028563 Ga0265319_1018115 Ga0265319_10181153 364
218 3300028573 Ga0265334_10009414 Ga0265334_100094143 364
219 3300028577 Ga0265318_10000755 Ga0265318_1000075510 364
220 3300028800 Ga0265338_10016895 Ga0265338_100168956 364
221 3300028800 Ga0265338_10174998 Ga0265338_101749982 364
222 3300031235 Ga0265330_10004174 Ga0265330_100041744 364
223 3300031239 Ga0265328_10001580 Ga0265328_100015807 364
224 3300031240 Ga0265320_10003043 Ga0265320_100030438 364
225 3300031241 Ga0265325_10003090 Ga0265325_100030909 364
226 3300031241 Ga0265325_10104385 Ga0265325_101043852 364
227 3300031242 Ga0265329_10004498 Ga0265329_100044982 364
228 3300031247 Ga0265340_10002687 Ga0265340_100026875 364
229 3300031344 Ga0265316_10020393 Ga0265316_100203933 364
230 3300031711 Ga0265314_10051320 Ga0265314_100513203 364
231 3300037418 Ga0395900_0009810 Ga0395900_0009810_3583_4695 364
232 3300037466 Ga0395898_0092848 Ga0395898_0092848_704_1816 364
233 3300037471 Ga0395905_0270138 Ga0395905_0270138_111_1223 364
234 3300038443 Ga0395901_0013035 Ga0395901_0013035_4800_5912 364
235 3300045836 Ga0466958_0113190 Ga0466958_0113190_162_1274 364
236 3300046535 Ga0495586_0145788 Ga0495586_0145788_17_1129 364
237 3300047317 Ga0495604_0005551 Ga0495604_0005551_3613_4725 364
238 3300047444 Ga0495675_0011798 Ga0495675_0011798_2798_3910 364
239 3300048903 Ga0496100_0000374 Ga0496100_0000374_7017_8129 364
240 3300048904 Ga0496101_0004976 Ga0496101_0004976_5363_6475 364
241 3300048905 Ga0496102_0008486 Ga0496102_0008486_6688_7800 364
242 3300048906 Ga0496103_0011717 Ga0496103_0011717_3331_4443 364
243 3300048907 Ga0496104_0000785 Ga0496104_0000785_1672_2784 364
244 3300048907 Ga0496104_0057964 Ga0496104_0057964_2456_3568 364
245 3300048907 Ga0496104_0354618 Ga0496104_0354618_49_1161 364
246 3300048908 Ga0496105_0004871 Ga0496105_0004871_7211_8323 364
247 3300048908 Ga0496105_0128263 Ga0496105_0128263_647_1759 364
248 3300048911 Ga0496108_0102792 Ga0496108_0102792_433_1545 364
249 3300048913 Ga0496110_0006505 Ga0496110_0006505_6487_7599 364
250 3300048914 Ga0496111_0035948 Ga0496111_0035948_1615_2727 364
251 3300048915 Ga0496112_0010916 Ga0496112_0010916_1824_2936 364
252 3300048916 Ga0496113_0080041 Ga0496113_0080041_715_1827 364
253 3300048917 Ga0496114_0003978 Ga0496114_0003978_1305_2417 364
254 3300048917 Ga0496114_0019381 Ga0496114_0019381_1853_2965 364
255 3300048917 Ga0496114_0030255 Ga0496114_0030255_1710_2822 364
256 iso_pu_bacteria 2547132111 2547412986 364
257 iso_pu_bacteria 2554235005 2554259132 364
258 iso_pu_bacteria 2582581312 2585298656 364
259 iso_pu_bacteria 2582581313 2585307626 364
260 iso_pu_bacteria 2582581314 2585314325 364
261 iso_pu_bacteria 2616644814 2616694052 364
262 iso_pu_bacteria 2616644941 2616899229 364
263 iso_pu_bacteria 2643221548 2643759121 364
264 iso_pu_bacteria 2643221578 2643897173 364
265 iso_pu_bacteria 2643221587 2643945357 364
266 iso_pu_bacteria 2643221647 2644270898 364
267 iso_pu_bacteria 2643221670 2644387577 364
268 iso_pu_bacteria 2643221673 2644408318 364
269 iso_pu_bacteria 2643221677 2644432256 364
270 iso_pu_bacteria 2643221678 2644435565 364
271 iso_pu_bacteria 2643221682 2644463461 364
272 iso_pu_bacteria 2643221714 2644630452 364
273 iso_pu_bacteria 2767802112 2768646746 364
274 iso_pu_bacteria 2784132148 2784587197 364
275 iso_pu_bacteria 2784746763 2785345179 364
276 iso_pu_bacteria 2784746768 2785367707 364
277 iso_pu_bacteria 2786546132 2786668762 364
278 iso_pu_bacteria 2791355406 2793981215 364
279 iso_pu_bacteria 2802429296 2804844223 364
280 iso_pu_bacteria 2808606359 2808848183 364
281 iso_pu_bacteria 2808606375 2808916725 364
282 iso_pu_bacteria 2808606375 2808918947 364
283 iso_pu_bacteria 2808606448 2809230756 364
284 iso_pu_bacteria 2808606982 2811847410 364
285 iso_pu_bacteria 2811994872 2812322896 364
286 iso_pu_bacteria 2811994879 2812359820 364
287 iso_pu_bacteria 2811994917 2812481905 364
288 iso_pu_bacteria 2818991463 2819694306 364
289 iso_pu_bacteria 2839986021 2839987203 364
290 iso_pu_bacteria 2852635781 2852638202 364
291 iso_pu_bacteria 2862178590 2862183154 364
292 iso_pu_bacteria 2862281513 2862288935 364
293 iso_pu_bacteria 2862290372 2862291561 364
294 iso_pu_bacteria 2862382967 2862389139 364
295 iso_pu_bacteria 2862507626 2862508582 364
296 iso_pu_bacteria 2862574272 2862583184 364
297 iso_pu_bacteria 2862705112 2862707272 364
298 iso_pu_bacteria 2863404153 2863406436 364
299 iso_pu_bacteria 2867346516 2867352003 364
300 iso_pu_bacteria 2867428634 2867430634 364
301 iso_pu_bacteria 2867475112 2867476247 364
302 iso_pu_bacteria 2873151551 2873157221 364
303 iso_pu_bacteria 2875391855 2875393120 364
304 iso_pu_bacteria 2877676314 2877682843 364
305 iso_pu_bacteria 2912715099 2912721864 364
306 iso_pu_bacteria 2912723979 2912725670 364
307 iso_pu_bacteria 2912757875 2912759321 364
308 iso_pu_bacteria 2918501144 2918502999 364
309 iso_pu_bacteria 2935390628 2935394333 364
310 iso_pu_bacteria 2946045630 2946051570 364
311 iso_pu_bacteria 2946064051 2946066088 364
312 iso_pu_bacteria 2946072368 2946074390 364
313 iso_pu_bacteria 2947224130 2947231286 364
314 iso_pu_bacteria 2954002825 2954004568 364
315 iso_pu_bacteria 2954380949 2954388035 364
316 iso_pu_bacteria 2954673503 2954675042 364
317 iso_pu_bacteria 2954682443 2954689093 364
318 iso_pu_bacteria 2954691527 2954698845 364
319 iso_pu_bacteria 2954701450 2954703377 364
320 iso_pu_bacteria 2954711539 2954717823 364
321 iso_pu_bacteria 2954721474 2954727789 364
322 iso_pu_bacteria 2954731030 2954734013 364
323 iso_pu_bacteria 2954740390 2954746689 364
324 iso_pu_bacteria 2954749733 2954752896 364
325 iso_pu_bacteria 2954759201 2954765799 364
326 iso_pu_bacteria 2966598605 2966603921 364
327 iso_pu_bacteria 2990044586 2990044730 364
328 iso_pu_bacteria 2990059506 2990066316 364
329 iso_pu_bacteria 2990088156 2990092908 364
330 iso_pu_bacteria 2997451912 2997458727 364
331 iso_pu_bacteria 2997600082 2997606764 364
332 iso_pu_bacteria 3006321560 3006323280 364
333 iso_pu_bacteria 3006393351 3006395514 364
334 iso_pu_bacteria 3006486233 3006492996 364
335 iso_pu_bacteria 3006493962 3006496526 364
336 iso_pu_bacteria 8008485437 8008489695 364
337 iso_pu_bacteria 8008558824 8008561870 364
338 iso_pu_bacteria 8008574985 8008580287 364
339 iso_pu_bacteria 8023623736 8023628029 364
340 iso_pu_bacteria 8025413630 8025419641 364
341 iso_pu_bacteria 8025524527 8025528729 364
342 iso_pu_bacteria 8025530807 8025535555 364
343 iso_pu_bacteria 8033684223 8033687337 364
344 iso_pu_bacteria 8047893842 8047899789 364
345 iso_pu_bacteria 8048127548 8048137457 364
346 iso_pu_bacteria 8048356638 8048359141 364
347 iso_pu_bacteria 8048369669 8048376737 364
348 iso_pu_bacteria 8048379754 8048385790 364
349 iso_pu_bacteria 8048406513 8048407730 364
350 iso_pu_bacteria 8054160619 8054163491 364
351 iso_pu_bacteria 8056829672 8056833109 364
352 3300003911 JGI25405J52794_10006402 JGI25405J52794_100064022 365
353 3300005331 Ga0070670_100242993 Ga0070670_1002429932 365
354 3300005347 Ga0070668_100028825 Ga0070668_1000288253 365
355 3300005347 Ga0070668_100058984 Ga0070668_1000589842 365
356 3300005366 Ga0070659_100078977 Ga0070659_1000789771 365
357 3300005435 Ga0070714_100031451 Ga0070714_1000314514 365
358 3300005435 Ga0070714_100043111 Ga0070714_1000431113 365
359 3300005457 Ga0070662_100341253 Ga0070662_1003412531 365
360 3300005459 Ga0068867_100029542 Ga0068867_1000295422 365
361 3300005539 Ga0068853_100075340 Ga0068853_1000753402 365
362 3300005548 Ga0070665_100003530 Ga0070665_10000353013 365
363 3300005578 Ga0068854_100032930 Ga0068854_1000329301 365
364 3300005937 Ga0081455_10000389 Ga0081455_1000038916 365
365 3300005937 Ga0081455_10002237 Ga0081455_1000223710 365
366 3300005937 Ga0081455_10068793 Ga0081455_100687932 365
367 3300006051 Ga0075364_10257527 Ga0075364_102575271 365
368 3300006058 Ga0075432_10000058 Ga0075432_100000587 365
369 3300006058 Ga0075432_10001078 Ga0075432_100010788 365
370 3300006844 Ga0075428_100005267 Ga0075428_10000526711 365
371 3300006844 Ga0075428_100006278 Ga0075428_10000627814 365
372 3300006847 Ga0075431_100007939 Ga0075431_1000079392 365
373 3300006852 Ga0075433_10000219 Ga0075433_1000021915 365
374 3300006852 Ga0075433_10000698 Ga0075433_100006989 365
375 3300006871 Ga0075434_100000609 Ga0075434_1000006093 365
376 3300006871 Ga0075434_100013208 Ga0075434_1000132085 365
377 3300006880 Ga0075429_100145690 Ga0075429_1001456902 365
378 3300006914 Ga0075436_100010602 Ga0075436_1000106023 365
379 3300007076 Ga0075435_100020295 Ga0075435_1000202954 365
380 3300009094 Ga0111539_10000761 Ga0111539_1000076115 365
381 3300009094 Ga0111539_10008525 Ga0111539_100085258 365
382 3300009098 Ga0105245_10045486 Ga0105245_100454862 365
383 3300009098 Ga0105245_10260995 Ga0105245_102609952 365
384 3300009147 Ga0114129_10000041 Ga0114129_1000004143 365
385 3300009147 Ga0114129_10082418 Ga0114129_100824183 365
386 3300009148 Ga0105243_10002638 Ga0105243_1000263811 365
387 3300009551 Ga0105238_10084884 Ga0105238_100848842 365
388 3300009553 Ga0105249_10031513 Ga0105249_100315132 365
389 3300010375 Ga0105239_10105341 Ga0105239_101053412 365
390 3300013297 Ga0157378_10082171 Ga0157378_100821712 365
391 3300013306 Ga0163162_10014513 Ga0163162_100145133 365
392 3300013306 Ga0163162_10026523 Ga0163162_100265232 365
393 3300013307 Ga0157372_10062032 Ga0157372_100620322 365
394 3300013307 Ga0157372_10227221 Ga0157372_102272212 365
395 3300014325 Ga0163163_10081519 Ga0163163_100815192 365
396 3300020078 Ga0206352_10129169 Ga0206352_101291692 365
397 3300020081 Ga0206354_11547845 Ga0206354_115478452 365
398 3300020082 Ga0206353_10892018 Ga0206353_108920182 365
399 3300025294 Ga0209025_1031905 Ga0209025_10319052 365
400 3300025901 Ga0207688_10089904 Ga0207688_100899042 365
401 3300025933 Ga0207706_10014617 Ga0207706_100146171 365
402 3300025935 Ga0207709_10008557 Ga0207709_100085574 365
403 3300025935 Ga0207709_10083454 Ga0207709_100834542 365
404 3300025961 Ga0207712_10026878 Ga0207712_100268782 365
405 3300025972 Ga0207668_10068626 Ga0207668_100686262 365
406 3300025972 Ga0207668_10100734 Ga0207668_101007341 365
407 3300026041 Ga0207639_10109590 Ga0207639_101095902 365
408 3300026075 Ga0207708_10132762 Ga0207708_101327622 365
409 3300026089 Ga0207648_10043105 Ga0207648_100431052 365
410 3300026118 Ga0207675_100019693 Ga0207675_1000196935 365
411 3300026118 Ga0207675_100212978 Ga0207675_1002129781 365
412 3300027907 Ga0207428_10000762 Ga0207428_1000076224 365
413 3300027907 Ga0207428_10002987 Ga0207428_1000298711 365
414 3300028380 Ga0268265_10024712 Ga0268265_100247122 365
415 3300028794 Ga0307515_10214595 Ga0307515_102145952 365
416 3300031548 Ga0307408_100011119 Ga0307408_1000111195 365
417 3300031548 Ga0307408_100012290 Ga0307408_1000122902 365
418 3300031548 Ga0307408_100088836 Ga0307408_1000888362 365
419 3300031731 Ga0307405_10076844 Ga0307405_100768442 365
420 3300031824 Ga0307413_10029475 Ga0307413_100294752 365
421 3300031824 Ga0307413_10038737 Ga0307413_100387372 365
422 3300031852 Ga0307410_10000645 Ga0307410_100006455 365
423 3300031852 Ga0307410_10032249 Ga0307410_100322492 365
424 3300031852 Ga0307410_10098920 Ga0307410_100989202 365
425 3300031901 Ga0307406_10000359 Ga0307406_1000035920 365
426 3300031901 Ga0307406_10004072 Ga0307406_100040724 365
427 3300031901 Ga0307406_10027976 Ga0307406_100279762 365
428 3300031903 Ga0307407_10000506 Ga0307407_100005067 365
429 3300031903 Ga0307407_10001378 Ga0307407_100013785 365
430 3300031903 Ga0307407_10045390 Ga0307407_100453902 365
431 3300031911 Ga0307412_10003098 Ga0307412_100030986 365
432 3300031911 Ga0307412_10093860 Ga0307412_100938602 365
433 3300031995 Ga0307409_100001043 Ga0307409_1000010436 365
434 3300032002 Ga0307416_100000776 Ga0307416_10000077612 365
435 3300032002 Ga0307416_100003499 Ga0307416_1000034995 365
436 3300032002 Ga0307416_100159845 Ga0307416_1001598452 365
437 3300032004 Ga0307414_10007469 Ga0307414_100074694 365
438 3300032004 Ga0307414_10335914 Ga0307414_103359141 365
439 3300032005 Ga0307411_10004265 Ga0307411_100042652 365
440 3300032005 Ga0307411_10016950 Ga0307411_100169502 365
441 3300032005 Ga0307411_10221402 Ga0307411_102214021 365
442 3300032126 Ga0307415_100006340 Ga0307415_1000063402 365
443 3300032126 Ga0307415_100015176 Ga0307415_1000151763 365
444 3300033179 Ga0307507_10054821 Ga0307507_100548212 365
445 3300035242 Ga0373962_0004271 Ga0373962_0004271_1561_2664 365
446 3300039437 Ga0436365_0877362 Ga0436365_0877362_30_1148 365
447 3300042436 Ga0439435_0039769 Ga0439435_0039769_168_1283 365
448 3300042439 Ga0439464_0005535 Ga0439464_0005535_682_1797 365
449 3300042439 Ga0439464_0007100 Ga0439464_0007100_421_1536 365
450 3300044683 Ga0466965_0003319 Ga0466965_0003319_629_1738 365
451 3300044693 Ga0466961_0099295 Ga0466961_0099295_713_1819 365
452 3300044694 Ga0466963_0006548 Ga0466963_0006548_2558_3664 365
453 3300044694 Ga0466963_0019548 Ga0466963_0019548_85_1188 365
454 3300044694 Ga0466963_0022816 Ga0466963_0022816_136_1245 365
455 3300044706 Ga0466964_0016597 Ga0466964_0016597_1455_2564 365
456 3300044735 Ga0466968_0000717 Ga0466968_0000717_7228_8343 365
457 3300044765 Ga0466970_0046361 Ga0466970_0046361_286_1395 365
458 3300044901 Ga0466960_0019159 Ga0466960_0019159_26_1141 365
459 3300045049 Ga0466959_0003522 Ga0466959_0003522_5099_6214 365
460 3300045836 Ga0466958_0136322 Ga0466958_0136322_17_1126 365
461 3300045976 Ga0466967_0001931 Ga0466967_0001931_2042_3151 365
462 3300045976 Ga0466967_0004056 Ga0466967_0004056_4026_5132 365
463 3300045976 Ga0466967_0159755 Ga0466967_0159755_367_1482 365
464 3300046457 Ga0495590_0000234 Ga0495590_0000234_11932_13041 365
465 3300046538 Ga0495609_0109486 Ga0495609_0109486_49_1164 365
466 3300048905 Ga0496102_0136474 Ga0496102_0136474_264_1379 365
467 3300048915 Ga0496112_0006151 Ga0496112_0006151_3466_4581 365
468 3300048926 Ga0496123_0018794 Ga0496123_0018794_2647_3762 365
469 3300048929 Ga0496126_0003688 Ga0496126_0003688_10837_11952 365
470 3300049568 Ga0501031_0000536 Ga0501031_0000536_13438_14574 365
471 3300049569 Ga0501032_0002282 Ga0501032_0002282_13427_14563 365
472 3300049570 Ga0501033_0002719 Ga0501033_0002719_13397_14533 365
473 3300049570 Ga0501033_0030280 Ga0501033_0030280_688_1794 365
474 3300049571 Ga0501034_0004750 Ga0501034_0004750_506_1642 365
475 3300049571 Ga0501034_0143043 Ga0501034_0143043_678_1784 365
476 3300049572 Ga0501036_0005396 Ga0501036_0005396_297_1433 365
477 3300049573 Ga0501037_0003593 Ga0501037_0003593_6820_7956 365
478 3300049574 Ga0501038_0003399 Ga0501038_0003399_304_1440 365
479 3300049575 Ga0501039_0018889 Ga0501039_0018889_2500_3636 365
480 3300049576 Ga0501040_0001825 Ga0501040_0001825_12229_13365 365
481 3300049577 Ga0501041_0004107 Ga0501041_0004107_6858_7994 365
482 3300049578 Ga0501042_0001841 Ga0501042_0001841_5637_6773 365
483 3300049579 Ga0501043_0002630 Ga0501043_0002630_297_1433 365
484 3300049580 Ga0501046_0003295 Ga0501046_0003295_13397_14533 365
485 3300049581 Ga0501047_0000750 Ga0501047_0000750_29163_30299 365
486 3300049581 Ga0501047_0098351 Ga0501047_0098351_125_1234 365
487 3300049582 Ga0501048_0006407 Ga0501048_0006407_6528_7664 365
488 3300049583 Ga0501067_0002169 Ga0501067_0002169_6148_7284 365
489 3300049584 Ga0501068_0005108 Ga0501068_0005108_65_1201 365
490 3300049585 Ga0501069_0001698 Ga0501069_0001698_780_1916 365
491 3300049586 Ga0501070_0016299 Ga0501070_0016299_304_1440 365
492 3300049586 Ga0501070_0043168 Ga0501070_0043168_1197_2309 365
493 3300049587 Ga0501071_0000711 Ga0501071_0000711_15094_16230 365
494 3300049588 Ga0501072_0005806 Ga0501072_0005806_50_1186 365
495 3300049588 Ga0501072_0068306 Ga0501072_0068306_843_1949 365
496 3300049589 Ga0501073_0002148 Ga0501073_0002148_5450_6586 365
497 3300049589 Ga0501073_0062918 Ga0501073_0062918_858_1964 365
498 3300049590 Ga0501074_0002337 Ga0501074_0002337_6883_8019 365
499 3300049593 Ga0501077_0003734 Ga0501077_0003734_7871_9007 365
500 3300049741 Ga0501079_0057755 Ga0501079_0057755_330_1466 365
501 3300049742 Ga0501080_0137357 Ga0501080_0137357_559_1695 365
502 3300049744 Ga0501083_0000393 Ga0501083_0000393_3292_4428 365
503 3300049822 Ga0501035_0001243 Ga0501035_0001243_3277_4413 365
504 3300049823 Ga0501044_0009004 Ga0501044_0009004_6325_7461 365
505 3300049824 Ga0501045_0004757 Ga0501045_0004757_3665_4801 365
506 3300050507 nmdc:mga05p37_39997_c1 nmdc:mga05p37_39997_c1_1424_2533 365
507 3300050507 nmdc:mga05p37_7421_c1 nmdc:mga05p37_7421_c1_11627_12742 365
508 3300050508 nmdc:mga09592_8674_c1 nmdc:mga09592_8674_c1_2104_3213 365
509 3300050509 nmdc:mga0qj67_1396_c1 nmdc:mga0qj67_1396_c1_13804_14913 365
510 3300050510 nmdc:mga06r32_23470_c1 nmdc:mga06r32_23470_c1_2373_3488 365
511 3300050510 nmdc:mga06r32_8900_c1 nmdc:mga06r32_8900_c1_2264_3373 365
512 3300050511 nmdc:mga08y16_138174_c1 nmdc:mga08y16_138174_c1_927_2042 365
513 3300050511 nmdc:mga08y16_7508_c1 nmdc:mga08y16_7508_c1_9085_10200 365
514 3300050512 nmdc:mga0n895_217_c1 nmdc:mga0n895_217_c1_25405_26520 365
515 3300050513 nmdc:mga0rr50_5127_c1 nmdc:mga0rr50_5127_c1_3011_4126 365
516 3300050514 nmdc:mga08x19_5248_c1 nmdc:mga08x19_5248_c1_1977_3092 365
517 3300050515 nmdc:mga0a205_10607_c1 nmdc:mga0a205_10607_c1_3248_4363 365
518 3300050515 nmdc:mga0a205_1731_c1 nmdc:mga0a205_1731_c1_8474_9589 365
519 3300054114 Ga0501084_0006963 Ga0501084_0006963_6325_7461 365
520 3300060353 Ga0501082_0001363 Ga0501082_0001363_19777_20913 365
521 3300061719 Ga0466962_0037285 Ga0466962_0037285_250_1359 365
522 iso_pu_bacteria 3001889506 3001891526 365
523 iso_pu_bacteria 8004021418 8004022768 365
524 3300031507 Ga0307509_10146711 Ga0307509_101467112 366
525 3300039437 Ga0436365_0548348 Ga0436365_0548348_19218_20339 366
526 3300042002 Ga0439442_000989 Ga0439442_000989_729_1874 366
527 3300042006 Ga0439432_029955 Ga0439432_029955_85_1230 366
528 3300044719 Ga0466971_0027828 Ga0466971_0027828_56_1183 366
529 3300044842 Ga0466957_0126315 Ga0466957_0126315_390_1517 366
530 3300045976 Ga0466967_0026413 Ga0466967_0026413_1224_2336 366
531 3300046462 Ga0495651_0002734 Ga0495651_0002734_5335_6447 366
532 3300046679 Ga0495623_0082593 Ga0495623_0082593_86_1198 366
533 3300046680 Ga0495646_0008850 Ga0495646_0008850_3337_4449 366
534 3300046809 Ga0495600_0105461 Ga0495600_0105461_421_1533 366
535 3300049581 Ga0501047_0000015 Ga0501047_0000015_258168_259295 366
536 3300005435 Ga0070714_100338035 Ga0070714_1003380351 367
537 3300006846 Ga0075430_100001112 Ga0075430_10000111216 367
538 3300006847 Ga0075431_100007843 Ga0075431_1000078434 367
539 3300006880 Ga0075429_100014193 Ga0075429_1000141932 367
540 3300031456 Ga0307513_10004081 Ga0307513_100040817 367
541 3300031727 Ga0316576_10049900 Ga0316576_100499002 367
542 3300041491 Ga0451833_0440150 Ga0451833_0440150_5502_6626 367
543 3300041496 Ga0451839_0296389 Ga0451839_0296389_4248_5372 367
544 3300041498 Ga0451841_1036571 Ga0451841_1036571_349_1473 367
545 3300042014 Ga0439457_002864 Ga0439457_002864_353_1474 367
546 3300044656 Ga0466969_0003320 Ga0466969_0003320_4486_5610 367
547 3300044684 Ga0466966_0053001 Ga0466966_0053001_447_1571 367
548 3300044693 Ga0466961_0024465 Ga0466961_0024465_723_1847 367
549 3300044719 Ga0466971_0013702 Ga0466971_0013702_1611_2735 367
550 3300048912 Ga0496109_0186158 Ga0496109_0186158_79_1197 367
551 3300048913 Ga0496110_0120423 Ga0496110_0120423_439_1557 367
552 3300048925 Ga0496122_0000659 Ga0496122_0000659_64237_65370 367
553 3300049569 Ga0501032_0003032 Ga0501032_0003032_1042_2172 367
554 3300049571 Ga0501034_0007650 Ga0501034_0007650_6219_7349 367
555 3300049572 Ga0501036_0022111 Ga0501036_0022111_138_1268 367
556 3300049573 Ga0501037_0200612 Ga0501037_0200612_208_1338 367
557 3300049574 Ga0501038_0048904 Ga0501038_0048904_360_1490 367
558 3300049579 Ga0501043_0043027 Ga0501043_0043027_2384_3514 367
559 3300049580 Ga0501046_0010272 Ga0501046_0010272_4227_5357 367
560 3300049581 Ga0501047_0004692 Ga0501047_0004692_8608_9738 367
561 3300049822 Ga0501035_0003733 Ga0501035_0003733_9334_10464 367
562 3300049823 Ga0501044_0034418 Ga0501044_0034418_2575_3705 367
563 3300053153 Ga0500616_0000783 Ga0500616_0000783_8344_9468 367
564 3300053153 Ga0500616_0002034 Ga0500616_0002034_11626_12750 367
565 3300060353 Ga0501082_0002837 Ga0501082_0002837_4267_5397 367
566 3300061719 Ga0466962_0000963 Ga0466962_0000963_2037_3161 367
567 3300003308 Ga0006777J48905_1026059 Ga0006777J48905_10260591 368
568 3300003320 rootH2_10008057 rootH2_100080572 368
569 3300005548 Ga0070665_100044001 Ga0070665_1000440012 368
570 3300005985 Ga0081539_10118178 Ga0081539_101181782 368
571 3300006051 Ga0075364_10024749 Ga0075364_100247492 368
572 3300006948 Ga0099826_10039049 Ga0099826_100390492 368
573 3300014497 Ga0182008_10007117 Ga0182008_100071173 368
574 3300015262 Ga0182007_10000188 Ga0182007_1000018833 368
575 3300021388 Ga0213875_10006019 Ga0213875_100060192 368
576 3300025297 Ga0209758_1003694 Ga0209758_10036942 368
577 3300025302 Ga0207426_1001189 Ga0207426_100118915 368
578 3300025302 Ga0207426_1003255 Ga0207426_10032552 368
579 3300025302 Ga0207426_1013527 Ga0207426_10135272 368
580 3300025711 Ga0207696_1005488 Ga0207696_10054883 368
581 3300027312 Ga0209371_1016902 Ga0209371_10169022 368
582 3300028379 Ga0268266_10023769 Ga0268266_100237695 368
583 3300028786 Ga0307517_10080637 Ga0307517_100806372 368
584 3300028786 Ga0307517_10094980 Ga0307517_100949802 368
585 3300028794 Ga0307515_10012174 Ga0307515_1001217412 368
586 3300030521 Ga0307511_10053002 Ga0307511_100530022 368
587 3300031456 Ga0307513_10080302 Ga0307513_100803022 368
588 3300031507 Ga0307509_10007936 Ga0307509_1000793613 368
589 3300031616 Ga0307508_10001366 Ga0307508_1000136610 368
590 3300031616 Ga0307508_10050107 Ga0307508_100501072 368
591 3300031616 Ga0307508_10118477 Ga0307508_101184772 368
592 3300031649 Ga0307514_10004180 Ga0307514_100041808 368
593 3300031649 Ga0307514_10044298 Ga0307514_100442982 368
594 3300031649 Ga0307514_10056739 Ga0307514_100567392 368
595 3300031730 Ga0307516_10011576 Ga0307516_100115768 368
596 3300031730 Ga0307516_10032208 Ga0307516_100322083 368
597 3300033179 Ga0307507_10096066 Ga0307507_100960662 368
598 3300033180 Ga0307510_10046000 Ga0307510_100460001 368
599 3300037466 Ga0395898_0002815 Ga0395898_0002815_18316_19434 368
600 3300037466 Ga0395898_0275917 Ga0395898_0275917_127_1245 368
601 3300037853 Ga0436364_0312203 Ga0436364_0312203_24471_25589 368
602 3300038443 Ga0395901_0052987 Ga0395901_0052987_1721_2839 368
603 3300041404 Ga0439436_0000166 Ga0439436_0000166_4624_5742 368
604 3300041404 Ga0439436_0008869 Ga0439436_0008869_1199_2317 368
605 3300041404 Ga0439436_0038124 Ga0439436_0038124_28_1146 368
606 3300041512 Ga0451853_3381203 Ga0451853_3381203_637_1755 368
607 3300041999 Ga0439433_0000788 Ga0439433_0000788_2767_3885 368
608 3300042007 Ga0439449_0000874 Ga0439449_0000874_759_1877 368
609 3300042007 Ga0439449_0004830 Ga0439449_0004830_493_1611 368
610 3300042014 Ga0439457_000843 Ga0439457_000843_6932_8050 368
611 3300042014 Ga0439457_001434 Ga0439457_001434_3893_5011 368
612 3300042015 Ga0439462_0009732 Ga0439462_0009732_189_1307 368
613 3300042134 Ga0450898_000603 Ga0450898_000603_2650_3768 368
614 3300042135 Ga0450899_000205 Ga0450899_000205_2350_3468 368
615 3300042138 Ga0450903_000034 Ga0450903_000034_5064_6182 368
616 3300042145 Ga0450906_000520 Ga0450906_000520_5834_6952 368
617 3300044658 Ga0466972_0008588 Ga0466972_0008588_617_1735 368
618 3300044658 Ga0466972_0010739 Ga0466972_0010739_1594_2712 368
619 3300044683 Ga0466965_0021558 Ga0466965_0021558_1592_2710 368
620 3300044693 Ga0466961_0000891 Ga0466961_0000891_10099_11217 368
621 3300044693 Ga0466961_0044816 Ga0466961_0044816_794_1912 368
622 3300044694 Ga0466963_0001647 Ga0466963_0001647_6921_8039 368
623 3300044694 Ga0466963_0011325 Ga0466963_0011325_3851_4969 368
624 3300044719 Ga0466971_0010456 Ga0466971_0010456_2545_3663 368
625 3300044842 Ga0466957_0000245 Ga0466957_0000245_7033_8151 368
626 3300044901 Ga0466960_0002720 Ga0466960_0002720_3609_4727 368
627 3300045049 Ga0466959_0017618 Ga0466959_0017618_1575_2693 368
628 3300045976 Ga0466967_0028197 Ga0466967_0028197_3279_4397 368
629 3300046455 Ga0495603_0005293 Ga0495603_0005293_3955_5073 368
630 3300046455 Ga0495603_0048040 Ga0495603_0048040_263_1381 368
631 3300046459 Ga0495629_0002991 Ga0495629_0002991_9279_10397 368
632 3300046459 Ga0495629_0052828 Ga0495629_0052828_621_1739 368
633 3300046459 Ga0495629_0262315 Ga0495629_0262315_42_1160 368
634 3300046476 Ga0495662_0017105 Ga0495662_0017105_703_1821 368
635 3300046499 Ga0495594_0000550 Ga0495594_0000550_17687_18805 368
636 3300046499 Ga0495594_0019204 Ga0495594_0019204_449_1567 368
637 3300046514 Ga0495618_0088506 Ga0495618_0088506_546_1664 368
638 3300046516 Ga0495628_0008399 Ga0495628_0008399_3053_4171 368
639 3300046516 Ga0495628_0038232 Ga0495628_0038232_414_1532 368
640 3300046517 Ga0495630_0016089 Ga0495630_0016089_1366_2484 368
641 3300046522 Ga0495643_0002349 Ga0495643_0002349_3387_4505 368
642 3300046557 Ga0495622_0006833 Ga0495622_0006833_400_1518 368
643 3300046642 Ga0495634_0022697 Ga0495634_0022697_1443_2561 368
644 3300046648 Ga0495611_0013679 Ga0495611_0013679_1316_2434 368
645 3300046660 Ga0495625_0028467 Ga0495625_0028467_1282_2400 368
646 3300046660 Ga0495625_0103074 Ga0495625_0103074_307_1425 368
647 3300046674 Ga0495588_0002833 Ga0495588_0002833_2301_3419 368
648 3300046675 Ga0495657_0005893 Ga0495657_0005893_5049_6167 368
649 3300046675 Ga0495657_0017933 Ga0495657_0017933_804_1922 368
650 3300046680 Ga0495646_0001970 Ga0495646_0001970_10042_11160 368
651 3300046683 Ga0495658_0012481 Ga0495658_0012481_2342_3460 368
652 3300046689 Ga0495613_0001173 Ga0495613_0001173_10490_11608 368
653 3300046689 Ga0495613_0012635 Ga0495613_0012635_3467_4585 368
654 3300046690 Ga0495624_0015475 Ga0495624_0015475_2985_4103 368
655 3300046691 Ga0495670_0004198 Ga0495670_0004198_1019_2137 368
656 3300046694 Ga0495649_0071333 Ga0495649_0071333_22_1140 368
657 3300046794 Ga0495589_0019738 Ga0495589_0019738_309_1427 368
658 3300047315 Ga0495581_0023185 Ga0495581_0023185_2214_3332 368
659 3300047321 Ga0495676_0003250 Ga0495676_0003250_9123_10241 368
660 3300047321 Ga0495676_0009016 Ga0495676_0009016_3117_4235 368
661 3300047321 Ga0495676_0010811 Ga0495676_0010811_21_1139 368
662 3300047443 Ga0495687_005971 Ga0495687_005971_865_1983 368
663 3300047447 Ga0495685_000221 Ga0495685_000221_2470_3588 368
664 3300047447 Ga0495685_003066 Ga0495685_003066_3395_4513 368
665 3300047470 Ga0495681_0005609 Ga0495681_0005609_6648_7766 368
666 3300047470 Ga0495681_0009675 Ga0495681_0009675_3451_4569 368
667 3300047471 Ga0495684_0128758 Ga0495684_0128758_118_1236 368
668 3300047472 Ga0495686_0030332 Ga0495686_0030332_2036_3154 368
669 3300048089 Ga0495614_0001082 Ga0495614_0001082_658_1776 368
670 3300048089 Ga0495614_0003707 Ga0495614_0003707_4461_5579 368
671 3300048909 Ga0496106_0240581 Ga0496106_0240581_12_1130 368
672 3300048912 Ga0496109_0102265 Ga0496109_0102265_320_1438 368
673 3300048913 Ga0496110_0231232 Ga0496110_0231232_143_1261 368
674 3300049127 Ga0501306_008204 Ga0501306_008204_118_1236 368
675 3300049539 Ga0501323_001566 Ga0501323_001566_706_1824 368
676 3300049568 Ga0501031_0002123 Ga0501031_0002123_7959_9077 368
677 3300049568 Ga0501031_0006009 Ga0501031_0006009_5174_6295 368
678 3300049568 Ga0501031_0014225 Ga0501031_0014225_3478_4620 368
679 3300049568 Ga0501031_0090620 Ga0501031_0090620_313_1431 368
680 3300049569 Ga0501032_0004079 Ga0501032_0004079_6486_7604 368
681 3300049569 Ga0501032_0005643 Ga0501032_0005643_4314_5432 368
682 3300049569 Ga0501032_0011400 Ga0501032_0011400_93_1214 368
683 3300049569 Ga0501032_0019085 Ga0501032_0019085_223_1365 368
684 3300049569 Ga0501032_0121256 Ga0501032_0121256_45_1163 368
685 3300049570 Ga0501033_0007663 Ga0501033_0007663_5402_6544 368
686 3300049570 Ga0501033_0008925 Ga0501033_0008925_1509_2627 368
687 3300049570 Ga0501033_0027215 Ga0501033_0027215_2609_3727 368
688 3300049571 Ga0501034_0008248 Ga0501034_0008248_3426_4544 368
689 3300049571 Ga0501034_0011906 Ga0501034_0011906_2788_3909 368
690 3300049571 Ga0501034_0016319 Ga0501034_0016319_4610_5728 368
691 3300049571 Ga0501034_0095440 Ga0501034_0095440_832_1974 368
692 3300049572 Ga0501036_0010545 Ga0501036_0010545_3414_4535 368
693 3300049572 Ga0501036_0012876 Ga0501036_0012876_3426_4544 368
694 3300049572 Ga0501036_0046032 Ga0501036_0046032_1390_2508 368
695 3300049572 Ga0501036_0046054 Ga0501036_0046054_60_1178 368
696 3300049572 Ga0501036_0099725 Ga0501036_0099725_595_1713 368
697 3300049573 Ga0501037_0004880 Ga0501037_0004880_5212_6330 368
698 3300049573 Ga0501037_0008803 Ga0501037_0008803_3220_4362 368
699 3300049573 Ga0501037_0040284 Ga0501037_0040284_2048_3169 368
700 3300049573 Ga0501037_0041834 Ga0501037_0041834_429_1547 368
701 3300049573 Ga0501037_0073632 Ga0501037_0073632_1338_2456 368
702 3300049574 Ga0501038_0011152 Ga0501038_0011152_3597_4715 368
703 3300049574 Ga0501038_0015275 Ga0501038_0015275_2401_3519 368
704 3300049574 Ga0501038_0037604 Ga0501038_0037604_793_1911 368
705 3300049575 Ga0501039_0010651 Ga0501039_0010651_3151_4269 368
706 3300049575 Ga0501039_0011202 Ga0501039_0011202_4769_5887 368
707 3300049575 Ga0501039_0015466 Ga0501039_0015466_1132_2250 368
708 3300049575 Ga0501039_0145635 Ga0501039_0145635_509_1630 368
709 3300049576 Ga0501040_0003567 Ga0501040_0003567_2401_3519 368
710 3300049577 Ga0501041_0001588 Ga0501041_0001588_3657_4775 368
711 3300049578 Ga0501042_0007844 Ga0501042_0007844_2401_3519 368
712 3300049578 Ga0501042_0024880 Ga0501042_0024880_1874_2992 368
713 3300049578 Ga0501042_0068950 Ga0501042_0068950_1201_2343 368
714 3300049579 Ga0501043_0002940 Ga0501043_0002940_2124_3242 368
715 3300049579 Ga0501043_0004752 Ga0501043_0004752_3426_4544 368
716 3300049579 Ga0501043_0010621 Ga0501043_0010621_3284_4405 368
717 3300049579 Ga0501043_0023928 Ga0501043_0023928_3529_4647 368
718 3300049580 Ga0501046_0005788 Ga0501046_0005788_6488_7606 368
719 3300049580 Ga0501046_0013477 Ga0501046_0013477_3536_4678 368
720 3300049581 Ga0501047_0000055 Ga0501047_0000055_14420_15538 368
721 3300049581 Ga0501047_0001216 Ga0501047_0001216_20992_22110 368
722 3300049581 Ga0501047_0009073 Ga0501047_0009073_266_1384 368
723 3300049581 Ga0501047_0010994 Ga0501047_0010994_3502_4620 368
724 3300049581 Ga0501047_0017035 Ga0501047_0017035_722_1843 368
725 3300049581 Ga0501047_0056625 Ga0501047_0056625_56_1198 368
726 3300049581 Ga0501047_0219449 Ga0501047_0219449_10_1128 368
727 3300049581 Ga0501047_0282264 Ga0501047_0282264_54_1172 368
728 3300049582 Ga0501048_0004365 Ga0501048_0004365_6017_7135 368
729 3300049582 Ga0501048_0148001 Ga0501048_0148001_505_1626 368
730 3300049583 Ga0501067_0001877 Ga0501067_0001877_6615_7733 368
731 3300049584 Ga0501068_0000061 Ga0501068_0000061_35786_36904 368
732 3300049586 Ga0501070_0009498 Ga0501070_0009498_3426_4544 368
733 3300049586 Ga0501070_0021752 Ga0501070_0021752_708_1826 368
734 3300049586 Ga0501070_0148880 Ga0501070_0148880_415_1536 368
735 3300049587 Ga0501071_0000111 Ga0501071_0000111_27171_28289 368
736 3300049588 Ga0501072_0005562 Ga0501072_0005562_3484_4602 368
737 3300049589 Ga0501073_0010029 Ga0501073_0010029_2401_3519 368
738 3300049590 Ga0501074_0002104 Ga0501074_0002104_792_1910 368
739 3300049590 Ga0501074_0035151 Ga0501074_0035151_574_1692 368
740 3300049592 Ga0501076_0007178 Ga0501076_0007178_3639_4757 368
741 3300049593 Ga0501077_0011444 Ga0501077_0011444_890_2008 368
742 3300049741 Ga0501079_0018017 Ga0501079_0018017_3948_5066 368
743 3300049742 Ga0501080_0065356 Ga0501080_0065356_1939_3057 368
744 3300049744 Ga0501083_0000169 Ga0501083_0000169_41597_42715 368
745 3300049744 Ga0501083_0004738 Ga0501083_0004738_6554_7672 368
746 3300049822 Ga0501035_0007178 Ga0501035_0007178_3426_4544 368
747 3300049822 Ga0501035_0011951 Ga0501035_0011951_3561_4682 368
748 3300049822 Ga0501035_0013913 Ga0501035_0013913_2299_3417 368
749 3300049822 Ga0501035_0019079 Ga0501035_0019079_2105_3223 368
750 3300049822 Ga0501035_0093615 Ga0501035_0093615_537_1655 368
751 3300049822 Ga0501035_0106475 Ga0501035_0106475_1272_2414 368
752 3300049822 Ga0501035_0108526 Ga0501035_0108526_664_1782 368
753 3300049822 Ga0501035_0246245 Ga0501035_0246245_323_1441 368
754 3300049823 Ga0501044_0009018 Ga0501044_0009018_6363_7481 368
755 3300049823 Ga0501044_0016851 Ga0501044_0016851_3784_4905 368
756 3300049823 Ga0501044_0031763 Ga0501044_0031763_856_1974 368
757 3300049823 Ga0501044_0031984 Ga0501044_0031984_3771_4889 368
758 3300049823 Ga0501044_0069908 Ga0501044_0069908_242_1360 368
759 3300049823 Ga0501044_0089560 Ga0501044_0089560_927_2069 368
760 3300049823 Ga0501044_0092045 Ga0501044_0092045_1340_2458 368
761 3300049823 Ga0501044_0122347 Ga0501044_0122347_116_1234 368
762 3300049824 Ga0501045_0007462 Ga0501045_0007462_6195_7316 368
763 3300049824 Ga0501045_0011850 Ga0501045_0011850_2401_3519 368
764 3300049824 Ga0501045_0033009 Ga0501045_0033009_455_1597 368
765 3300049824 Ga0501045_0201019 Ga0501045_0201019_53_1171 368
766 3300050491 nmdc:mga00v17_35956_c1 nmdc:mga00v17_35956_c1_517_1659 368
767 3300053094 Ga0500566_0049684 Ga0500566_0049684_1157_2275 368
768 3300053095 Ga0500640_004096 Ga0500640_004096_2585_3703 368
769 3300053096 Ga0500641_0041881 Ga0500641_0041881_700_1818 368
770 3300053099 Ga0500654_028320 Ga0500654_028320_607_1725 368
771 3300053129 Ga0500628_001077 Ga0500628_001077_2824_3942 368
772 3300053131 Ga0500652_007170 Ga0500652_007170_839_1957 368
773 3300053134 Ga0500658_0002174 Ga0500658_0002174_5180_6298 368
774 3300053137 Ga0500561_0000602 Ga0500561_0000602_66_1184 368
775 3300053140 Ga0500573_0013167 Ga0500573_0013167_662_1780 368
776 3300053153 Ga0500616_0006951 Ga0500616_0006951_3366_4484 368
777 3300053158 Ga0500627_0032050 Ga0500627_0032050_97_1215 368
778 3300053161 Ga0500634_0003601 Ga0500634_0003601_5375_6493 368
779 3300053732 Ga0500656_001066 Ga0500656_001066_553_1671 368
780 3300054114 Ga0501084_0008261 Ga0501084_0008261_4860_5978 368
781 3300054114 Ga0501084_0146390 Ga0501084_0146390_485_1627 368
782 3300060353 Ga0501082_0010785 Ga0501082_0010785_3765_4883 368
783 iso_pu_bacteria 2537561592 2537898219 368
784 iso_pu_bacteria 2867428634 2867435246 368
785 3300005548 Ga0070665_100373410 Ga0070665_1003734102 369
786 3300005985 Ga0081539_10001399 Ga0081539_100013997 369
787 3300025972 Ga0207668_10003049 Ga0207668_100030499 369
788 3300028380 Ga0268265_10013772 Ga0268265_100137722 369
789 3300031616 Ga0307508_10000287 Ga0307508_1000028715 369
790 3300031995 Ga0307409_100024354 Ga0307409_1000243542 369
791 3300044656 Ga0466969_0000609 Ga0466969_0000609_9811_10929 369
792 3300044684 Ga0466966_0005253 Ga0466966_0005253_1778_2896 369
793 3300044693 Ga0466961_0032499 Ga0466961_0032499_319_1437 369
794 3300046454 Ga0495592_0028400 Ga0495592_0028400_20_1150 369
795 3300046459 Ga0495629_0120492 Ga0495629_0120492_174_1304 369
796 3300046462 Ga0495651_0005548 Ga0495651_0005548_4232_5362 369
797 3300046463 Ga0495653_0005937 Ga0495653_0005937_7028_8158 369
798 3300046472 Ga0495580_0018355 Ga0495580_0018355_3394_4524 369
799 3300046476 Ga0495662_0018191 Ga0495662_0018191_928_2058 369
800 3300046511 Ga0495608_0001164 Ga0495608_0001164_6565_7695 369
801 3300046514 Ga0495618_0153551 Ga0495618_0153551_314_1444 369
802 3300046516 Ga0495628_0013505 Ga0495628_0013505_4940_6070 369
803 3300046517 Ga0495630_0039887 Ga0495630_0039887_1929_3059 369
804 3300046518 Ga0495631_0026533 Ga0495631_0026533_179_1297 369
805 3300046526 Ga0495666_0007255 Ga0495666_0007255_2867_3997 369
806 3300046531 Ga0495665_0001197 Ga0495665_0001197_11716_12846 369
807 3300046535 Ga0495586_0022259 Ga0495586_0022259_689_1819 369
808 3300046559 Ga0495667_0014718 Ga0495667_0014718_1439_2569 369
809 3300046642 Ga0495634_0023507 Ga0495634_0023507_2960_4090 369
810 3300046663 Ga0495635_0038666 Ga0495635_0038666_1929_3059 369
811 3300046675 Ga0495657_0005001 Ga0495657_0005001_6816_7946 369
812 3300046689 Ga0495613_0019804 Ga0495613_0019804_2493_3623 369
813 3300046809 Ga0495600_0029931 Ga0495600_0029931_2365_3495 369
814 3300047315 Ga0495581_0002333 Ga0495581_0002333_7222_8352 369
815 3300047317 Ga0495604_0002431 Ga0495604_0002431_6092_7222 369
816 3300047319 Ga0495674_0006537 Ga0495674_0006537_4292_5422 369
817 3300047444 Ga0495675_0012238 Ga0495675_0012238_1929_3059 369
818 3300047673 Ga0495593_0029698 Ga0495593_0029698_184_1314 369
819 3300053077 Ga0495601_0003728 Ga0495601_0003728_927_2057 369
820 3300053085 Ga0495619_0014049 Ga0495619_0014049_2631_3761 369
821 3300059605 Ga0587106_009639 Ga0587106_009639_20_1150 369
822 iso_pu_bacteria 2939660829 2939662854 369
823 3300025927 Ga0207687_10031080 Ga0207687_100310802 370
824 3300048907 Ga0496104_0048561 Ga0496104_0048561_53_1237 370
825 3300048911 Ga0496108_0005434 Ga0496108_0005434_2122_3306 370
826 3300048912 Ga0496109_0026425 Ga0496109_0026425_750_1934 370
827 3300048917 Ga0496114_0007977 Ga0496114_0007977_5628_6812 370
828 3300020075 Ga0206349_1184325 Ga0206349_11843252 371
829 3300020076 Ga0206355_1062620 Ga0206355_10626202 371
830 3300020080 Ga0206350_10033714 Ga0206350_100337142 371
831 3300022467 Ga0224712_10001460 Ga0224712_100014602 371
832 3300046535 Ga0495586_0016311 Ga0495586_0016311_615_1733 372
833 iso_pu_bacteria 2862281513 2862283216 374
834 iso_pu_bacteria 2867428634 2867428734 374
835 iso_pu_bacteria 2877676314 2877677883 374
836 iso_pu_bacteria 2912715099 2912716141 374
837 iso_pu_bacteria 2919468124 2919471022 374
838 iso_pu_bacteria 3006493962 3006501694 374
839 3300046455 Ga0495603_0003057 Ga0495603_0003057_2278_3405 375
840 3300046459 Ga0495629_0001210 Ga0495629_0001210_3633_4760 375
841 3300046499 Ga0495594_0002955 Ga0495594_0002955_6965_8092 375
842 3300046557 Ga0495622_0028187 Ga0495622_0028187_1401_2528 375
843 3300047321 Ga0495676_0009639 Ga0495676_0009639_3933_5060 375
844 3300046499 Ga0495594_0037228 Ga0495594_0037228_760_1905 376
845 3300046501 Ga0495607_0095019 Ga0495607_0095019_67_1212 376
846 3300047447 Ga0495685_019655 Ga0495685_019655_311_1456 376
847 iso_pu_bacteria 2547132111 2547412090 377
848 iso_pu_bacteria 2616644814 2616693496 377
849 iso_pu_bacteria 2643221647 2644266456 377
850 iso_pu_bacteria 2643221678 2644438026 377
851 iso_pu_bacteria 2784132148 2784591821 377
852 iso_pu_bacteria 2784746768 2785372807 377
853 iso_pu_bacteria 2786546132 2786675166 377
854 iso_pu_bacteria 2808606359 2808845168 377
855 iso_pu_bacteria 2808606375 2808914763 377
856 iso_pu_bacteria 2808606448 2809235441 377
857 iso_pu_bacteria 2946064051 2946071133 377
858 iso_pu_bacteria 2947224130 2947225598 377
859 iso_pu_bacteria 2954380949 2954382673 377
860 iso_pu_bacteria 2954673503 2954680209 377
861 iso_pu_bacteria 2954682443 2954683942 377
862 iso_pu_bacteria 2954691527 2954693496 377
863 iso_pu_bacteria 2954701450 2954708590 377
864 iso_pu_bacteria 2954711539 2954713159 377
865 iso_pu_bacteria 2954721474 2954723119 377
866 iso_pu_bacteria 2954731030 2954738710 377
867 iso_pu_bacteria 2954740390 2954742026 377
868 iso_pu_bacteria 2954749733 2954757568 377
869 iso_pu_bacteria 2954759201 2954761004 377
870 iso_pu_bacteria 8023623736 8023631573 377
871 iso_pu_bacteria 2954002825 2954009773 378
872 iso_pu_bacteria 2990059506 2990065445 378
873 3300041512 Ga0451853_2434871 Ga0451853_2434871_321_1463 380
874 3300001989 JGI24739J22299_10019090 JGI24739J22299_100190902 381
875 3300001990 JGI24737J22298_10007983 JGI24737J22298_100079832 381
876 3300003578 Ga0006562J51391_1109412 Ga0006562J51391_11094122 381
877 3300005937 Ga0081455_10078077 Ga0081455_100780772 381
878 3300009011 Ga0105251_10027990 Ga0105251_100279902 381
879 3300011119 Ga0105246_10056793 Ga0105246_100567932 381
880 3300014497 Ga0182008_10002136 Ga0182008_100021368 381
881 3300015261 Ga0182006_1022929 Ga0182006_10229292 381
882 3300015262 Ga0182007_10001633 Ga0182007_100016337 381
883 3300015688 Ga0183367_1001 Ga0183367_1001731 381
884 3300025297 Ga0209758_1007794 Ga0209758_10077944 381
885 3300025302 Ga0207426_1021155 Ga0207426_10211552 381
886 3300028786 Ga0307517_10011680 Ga0307517_100116804 381
887 3300028794 Ga0307515_10000441 Ga0307515_1000044187 381
888 3300028794 Ga0307515_10031278 Ga0307515_100312786 381
889 3300030521 Ga0307511_10006319 Ga0307511_100063195 381
890 3300030522 Ga0307512_10108905 Ga0307512_101089052 381
891 3300031456 Ga0307513_10005869 Ga0307513_100058693 381
892 3300031507 Ga0307509_10018524 Ga0307509_100185245 381
893 3300031616 Ga0307508_10018977 Ga0307508_100189776 381
894 3300031730 Ga0307516_10073587 Ga0307516_100735872 381
895 3300033179 Ga0307507_10008958 Ga0307507_100089584 381
896 3300033180 Ga0307510_10040490 Ga0307510_100404902 381
897 3300037312 Ga0395899_0120682 Ga0395899_0120682_641_1786 381
898 3300037466 Ga0395898_0003419 Ga0395898_0003419_1612_2757 381
899 3300037466 Ga0395898_0057800 Ga0395898_0057800_1871_3016 381
900 3300041406 Ga0439439_0004773 Ga0439439_0004773_1599_2744 381
901 3300042005 Ga0439448_0001325 Ga0439448_0001325_4203_5375 381
902 3300042007 Ga0439449_0007501 Ga0439449_0007501_126_1271 381
903 3300042012 Ga0439455_0000095 Ga0439455_0000095_1004_2176 381
904 3300042014 Ga0439457_001850 Ga0439457_001850_5075_6220 381
905 3300042015 Ga0439462_0013318 Ga0439462_0013318_534_1679 381
906 3300042138 Ga0450903_000192 Ga0450903_000192_3338_4510 381
907 3300042157 Ga0439458_0001095 Ga0439458_0001095_4336_5508 381
908 3300044683 Ga0466965_0043039 Ga0466965_0043039_843_1988 381
909 3300044684 Ga0466966_0001295 Ga0466966_0001295_14301_15446 381
910 3300044693 Ga0466961_0010648 Ga0466961_0010648_1549_2694 381
911 3300044719 Ga0466971_0023066 Ga0466971_0023066_1389_2534 381
912 3300044765 Ga0466970_0008956 Ga0466970_0008956_1620_2768 381
913 3300044901 Ga0466960_0055713 Ga0466960_0055713_213_1358 381
914 3300046454 Ga0495592_0007118 Ga0495592_0007118_3786_4970 381
915 3300046454 Ga0495592_0011557 Ga0495592_0011557_277_1422 381
916 3300046455 Ga0495603_0024352 Ga0495603_0024352_2488_3633 381
917 3300046459 Ga0495629_0088010 Ga0495629_0088010_87_1232 381
918 3300046460 Ga0495638_0117677 Ga0495638_0117677_236_1381 381
919 3300046462 Ga0495651_0007103 Ga0495651_0007103_3531_4715 381
920 3300046473 Ga0495582_0010165 Ga0495582_0010165_2210_3394 381
921 3300046473 Ga0495582_0104995 Ga0495582_0104995_102_1247 381
922 3300046476 Ga0495662_0004079 Ga0495662_0004079_3402_4586 381
923 3300046477 Ga0495664_0004530 Ga0495664_0004530_3354_4538 381
924 3300046477 Ga0495664_0066158 Ga0495664_0066158_279_1424 381
925 3300046492 Ga0495585_0011522 Ga0495585_0011522_3012_4157 381
926 3300046499 Ga0495594_0027793 Ga0495594_0027793_1711_2856 381
927 3300046500 Ga0495596_0043390 Ga0495596_0043390_244_1389 381
928 3300046501 Ga0495607_0011764 Ga0495607_0011764_1327_2472 381
929 3300046507 Ga0495606_0010862 Ga0495606_0010862_4961_6106 381
930 3300046513 Ga0495616_0013790 Ga0495616_0013790_1246_2391 381
931 3300046514 Ga0495618_0012044 Ga0495618_0012044_2126_3271 381
932 3300046514 Ga0495618_0030256 Ga0495618_0030256_703_1887 381
933 3300046515 Ga0495620_0023636 Ga0495620_0023636_1507_2652 381
934 3300046516 Ga0495628_0043335 Ga0495628_0043335_46_1191 381
935 3300046517 Ga0495630_0028340 Ga0495630_0028340_2687_3871 381
936 3300046524 Ga0495648_0054949 Ga0495648_0054949_77_1222 381
937 3300046526 Ga0495666_0019935 Ga0495666_0019935_853_2037 381
938 3300046526 Ga0495666_0060342 Ga0495666_0060342_39_1184 381
939 3300046529 Ga0495652_0027446 Ga0495652_0027446_728_1873 381
940 3300046530 Ga0495654_0029806 Ga0495654_0029806_1462_2607 381
941 3300046533 Ga0495640_0043870 Ga0495640_0043870_108_1292 381
942 3300046536 Ga0495587_0002646 Ga0495587_0002646_7573_8757 381
943 3300046538 Ga0495609_0017410 Ga0495609_0017410_696_1841 381
944 3300046543 Ga0495645_0014863 Ga0495645_0014863_1844_3028 381
945 3300046558 Ga0495633_0021607 Ga0495633_0021607_1908_3053 381
946 3300046616 Ga0495668_0010883 Ga0495668_0010883_1379_2524 381
947 3300046642 Ga0495634_0009383 Ga0495634_0009383_5853_7037 381
948 3300046660 Ga0495625_0007615 Ga0495625_0007615_635_1819 381
949 3300046660 Ga0495625_0094048 Ga0495625_0094048_808_1953 381
950 3300046663 Ga0495635_0000520 Ga0495635_0000520_17921_19105 381
951 3300046663 Ga0495635_0021076 Ga0495635_0021076_520_1665 381
952 3300046665 Ga0495661_0042422 Ga0495661_0042422_644_1789 381
953 3300046675 Ga0495657_0003233 Ga0495657_0003233_8221_9405 381
954 3300046675 Ga0495657_0045310 Ga0495657_0045310_1112_2257 381
955 3300046680 Ga0495646_0004975 Ga0495646_0004975_3362_4546 381
956 3300046689 Ga0495613_0011991 Ga0495613_0011991_1808_2992 381
957 3300046692 Ga0495671_0080989 Ga0495671_0080989_326_1471 381
958 3300046809 Ga0495600_0021087 Ga0495600_0021087_347_1531 381
959 3300046810 Ga0495660_0139356 Ga0495660_0139356_37_1182 381
960 3300047315 Ga0495581_0017993 Ga0495581_0017993_1834_3018 381
961 3300047315 Ga0495581_0018769 Ga0495581_0018769_1814_2959 381
962 3300047317 Ga0495604_0019901 Ga0495604_0019901_4003_5187 381
963 3300047318 Ga0495636_0024114 Ga0495636_0024114_276_1421 381
964 3300047319 Ga0495674_0135421 Ga0495674_0135421_87_1232 381
965 3300047321 Ga0495676_0002779 Ga0495676_0002779_4007_5191 381
966 3300047321 Ga0495676_0007323 Ga0495676_0007323_465_1610 381
967 3300047322 Ga0495680_0014414 Ga0495680_0014414_3330_4475 381
968 3300047443 Ga0495687_004847 Ga0495687_004847_4495_5709 381
969 3300047444 Ga0495675_0068701 Ga0495675_0068701_643_1788 381
970 3300047470 Ga0495681_0006380 Ga0495681_0006380_3131_4315 381
971 3300047470 Ga0495681_0062301 Ga0495681_0062301_453_1598 381
972 3300047471 Ga0495684_0019913 Ga0495684_0019913_1762_2946 381
973 3300047471 Ga0495684_0123910 Ga0495684_0123910_561_1706 381
974 3300047472 Ga0495686_0016525 Ga0495686_0016525_249_1394 381
975 3300047673 Ga0495593_0000873 Ga0495593_0000873_12811_13995 381
976 3300047673 Ga0495593_0085041 Ga0495593_0085041_176_1321 381
977 3300048088 Ga0495602_0032202 Ga0495602_0032202_55_1239 381
978 3300048089 Ga0495614_0037764 Ga0495614_0037764_591_1736 381
979 3300048091 Ga0495626_0057035 Ga0495626_0057035_275_1420 381
980 3300048912 Ga0496109_0187329 Ga0496109_0187329_690_1859 381
981 3300049459 Ga0495678_020853 Ga0495678_020853_1125_2270 381
982 3300050490 nmdc:mga03n38_11880_c1 nmdc:mga03n38_11880_c1_1944_3116 381
983 3300053085 Ga0495619_0181060 Ga0495619_0181060_20_1204 381
984 3300053092 Ga0500583_0050301 Ga0500583_0050301_169_1314 381
985 3300053095 Ga0500640_004273 Ga0500640_004273_194_1378 381
986 3300053122 Ga0500608_093215 Ga0500608_093215_178_1362 381

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00923

TAL_FSA

Transaldolase/Fructose-6-phosphate aldolase

11

356

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7oey-assembly1.cif.gz_B neisseria gonnorhoeae variant e93q at 1.35 angstrom resolution 0.9771 13 368
7bbw-assembly2.cif.gz_B neisseria gonorrhoeae transaldolase, variant c38s 0.9765 14 368
7bbx-assembly1.cif.gz_A neisseria gonorrhoeae transaldolase, variant k8a 0.9748 13 368
7odq-assembly1.cif.gz_A neisseria gonorrhoeae transaldolase at 5.4 mgy dose 0.974 13 368
7oey-assembly1.cif.gz_B neisseria gonnorhoeae variant e93q at 1.35 angstrom resolution 0.9689 13 368
ID Description Score Start End Superfamily
af_B4FRC9_66_421_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9728 13 370 3.20.20.70
3clmA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9722 13 368 3.20.20.70
af_K7L4A2_15_219_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9719 58 260 3.20.20.70
af_I1JM01_1_306_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9699 74 370 3.20.20.70
3r5eA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9644 12 372 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A505D201-F1-model_v4 Transaldolase (EC 2.2.1.2) 1.002 97 295 GO:0004801
GO:0005737
GO:0005975
GO:0006098
AF-A0A2S9G7Y1-F1-model_v4 Transaldolase (EC 2.2.1.2) 0.9999 84 163 GO:0004801
GO:0005737
GO:0005975
GO:0006098
AF-A0A6G3XGD8-F1-model_v4 transaldolase (EC 2.2.1.2) 0.9998 100 180 GO:0004801
GO:0005737
GO:0005975
GO:0006098
AF-A0A2W6E122-F1-model_v4 Transaldolase (EC 2.2.1.2) 0.9992 169 374 GO:0004801
GO:0005737
GO:0005975
GO:0006098
AF-A0A6G3XK19-F1-model_v4 Transaldolase (EC 2.2.1.2) 0.9984 215 306 GO:0004801
GO:0005737
GO:0005975
GO:0006098

Feature Viewer

pLDDT pTM Quality
95 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map