F487546
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 987 | 363 | 1974 | 173 |
Family's Representative Sequence
| Representative Sequence | 3300025903|Ga0207680_10014195|Ga0207680_100141951 |
| Length | 202 |
| Sequence | MADKKSLSDLGELTNPKPETPAAPETVAEAPAEAAPASSNGHGRRGREEPVDDHGVSTQGPQIQAVLREQQLDKYGRAYATGRRKDAIARVWLKPGSGKIVINGREQEVYFARPTLRLVINQPFGVADREGQYDVVATVVGGGLSGQAGAVLHGIAQALTRYEPALRTAVKQAGFLTRDPRAVERKKYGRAKARRSFQFSKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 10 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 13 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 14 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 15 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 16 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 17 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 24 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 112 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 117 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 185 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 193 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 194 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 196 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 197 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 198 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 199 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 201 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 202 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 203 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 204 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 205 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 206 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 213 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 214 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 215 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 218 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 219 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 220 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 221 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 222 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 223 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 224 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 225 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 226 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 227 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 228 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 229 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 230 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 231 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 232 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 233 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 234 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 235 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 236 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 237 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 238 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 239 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 240 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 241 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 242 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 243 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 244 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 245 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 246 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 247 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 267 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 268 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 269 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 270 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 271 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 274 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 275 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 276 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 277 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 278 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 279 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 280 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 281 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 282 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 283 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 284 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 304 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 308 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 309 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 310 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 311 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 312 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 313 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 339 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 340 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 341 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 342 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 343 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 344 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 345 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 346 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 347 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 348 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 349 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 350 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 351 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 352 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 353 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 354 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 355 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 356 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 357 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 358 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 359 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 360 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 361 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 362 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 363 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.21 |
| Metatranscriptomes | 4.15 |
| Isolates | 2.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.3 |
| Bulb | 0 |
| Endosphere | 4.05 |
| Nodule | 0.3 |
| Rhizoplane | 2.13 |
| Rhizosphere | 90.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207680_10014195 | 3300025903 | Bacteria | 4114 |
| 2 | JGI24736J21556_1003734 | 3300001904 | Bacteria | 2629 |
| 3 | JGI24741J21665_1001830 | 3300001915 | Bacteria | 5817 |
| 4 | JGI24741J21665_1004391 | 3300001915 | Bacteria | 3141 |
| 5 | JGI24752J21851_1000513 | 3300001976 | Bacteria | 5186 |
| 6 | JGI24740J21852_10005440 | 3300001979 | Bacteria | 5384 |
| 7 | JGI24740J21852_10009791 | 3300001979 | Bacteria | 3730 |
| 8 | JGI24739J22299_10003657 | 3300001989 | Bacteria | 5870 |
| 9 | JGI24739J22299_10005383 | 3300001989 | Bacteria | 4870 |
| 10 | JGI24739J22299_10009938 | 3300001989 | Bacteria | 3537 |
| 11 | JGI24739J22299_10012840 | 3300001989 | Bacteria | 3068 |
| 12 | JGI24737J22298_10001271 | 3300001990 | Bacteria | 8934 |
| 13 | JGI24737J22298_10002912 | 3300001990 | Bacteria | 6068 |
| 14 | JGI24737J22298_10009792 | 3300001990 | Bacteria | 3175 |
| 15 | JGI24735J21928_10000660 | 3300002067 | Bacteria | 12211 |
| 16 | JGI24735J21928_10001758 | 3300002067 | Bacteria | 7627 |
| 17 | JGI24735J21928_10004561 | 3300002067 | Bacteria | 4652 |
| 18 | JGI24735J21928_10012094 | 3300002067 | Bacteria | 2730 |
| 19 | JGI24735J21928_10018039 | 3300002067 | Bacteria | 2178 |
| 20 | JGI24750J21931_1000683 | 3300002070 | Bacteria | 4930 |
| 21 | JGI24748J21848_1000097 | 3300002074 | Bacteria | 23021 |
| 22 | JGI24738J21930_10002354 | 3300002075 | Bacteria | 4977 |
| 23 | JGI24738J21930_10003267 | 3300002075 | Bacteria | 4124 |
| 24 | JGI24749J21850_1002384 | 3300002076 | Bacteria | 2645 |
| 25 | JGI24034J26672_10000060 | 3300002239 | Bacteria | 41095 |
| 26 | JGI24742J22300_10002857 | 3300002244 | Bacteria | 2791 |
| 27 | JGI24751J29686_10050051 | 3300002459 | Bacteria | 862 |
| 28 | JGI25153J46596_10000119 | 3300003215 | Bacteria | 89604 |
| 29 | Ga0055525_1000070 | 3300003759 | Bacteria | 183047 |
| 30 | Ga0055542_1000851 | 3300003762 | Bacteria | 21391 |
| 31 | Ga0055542_1005577 | 3300003762 | Bacteria | 2817 |
| 32 | Ga0055529_1000520 | 3300003763 | Bacteria | 33667 |
| 33 | Ga0055536_1007886 | 3300003781 | Bacteria | 4678 |
| 34 | Ga0055536_1016223 | 3300003781 | Bacteria | 2501 |
| 35 | Ga0055530_10000439 | 3300003791 | Bacteria | 36986 |
| 36 | Ga0055531_10001489 | 3300003794 | Bacteria | 17211 |
| 37 | Ga0055531_10009036 | 3300003794 | Bacteria | 5149 |
| 38 | Ga0065712_10343166 | 3300005290 | Bacteria | 777 |
| 39 | Ga0065715_10000371 | 3300005293 | Bacteria | 20233 |
| 40 | Ga0065715_10244864 | 3300005293 | Bacteria | 1170 |
| 41 | Ga0070658_10000260 | 3300005327 | Bacteria | 46341 |
| 42 | Ga0070658_10003994 | 3300005327 | Bacteria | 12091 |
| 43 | Ga0070658_10006053 | 3300005327 | Bacteria | 9810 |
| 44 | Ga0070658_10030280 | 3300005327 | Bacteria | 4349 |
| 45 | Ga0070658_10038119 | 3300005327 | Bacteria | 3876 |
| 46 | Ga0070658_10061547 | 3300005327 | Bacteria | 3059 |
| 47 | Ga0070658_10091140 | 3300005327 | Bacteria | 2512 |
| 48 | Ga0070658_10100004 | 3300005327 | Bacteria | 2397 |
| 49 | Ga0070658_10183892 | 3300005327 | Bacteria | 1759 |
| 50 | Ga0070676_10017837 | 3300005328 | Bacteria | 3929 |
| 51 | Ga0070683_100001172 | 3300005329 | Bacteria | 19853 |
| 52 | Ga0070683_100012447 | 3300005329 | Bacteria | 7395 |
| 53 | Ga0070683_100121427 | 3300005329 | Bacteria | 2468 |
| 54 | Ga0070683_100136450 | 3300005329 | Bacteria | 2323 |
| 55 | Ga0070683_100843792 | 3300005329 | Bacteria | 879 |
| 56 | Ga0070690_100000338 | 3300005330 | Bacteria | 24029 |
| 57 | Ga0070690_100003699 | 3300005330 | Bacteria | 8419 |
| 58 | Ga0070670_100003815 | 3300005331 | Bacteria | 12558 |
| 59 | Ga0070670_100009337 | 3300005331 | Bacteria | 8372 |
| 60 | Ga0070670_100020739 | 3300005331 | Bacteria | 5651 |
| 61 | Ga0070670_100039742 | 3300005331 | Bacteria | 4045 |
| 62 | Ga0070670_100045964 | 3300005331 | Bacteria | 3754 |
| 63 | Ga0070670_100051871 | 3300005331 | Bacteria | 3522 |
| 64 | Ga0070670_100180876 | 3300005331 | Bacteria | 1831 |
| 65 | Ga0070670_100323451 | 3300005331 | Bacteria | 1352 |
| 66 | Ga0070670_100357062 | 3300005331 | Bacteria | 1284 |
| 67 | Ga0070670_100481894 | 3300005331 | Bacteria | 1102 |
| 68 | Ga0070677_10030570 | 3300005333 | Bacteria | 2051 |
| 69 | Ga0070677_10128195 | 3300005333 | Bacteria | 1155 |
| 70 | Ga0068869_100249383 | 3300005334 | Bacteria | 1417 |
| 71 | Ga0070666_10000069 | 3300005335 | Bacteria | 75768 |
| 72 | Ga0070666_10000864 | 3300005335 | Bacteria | 18346 |
| 73 | Ga0070666_10040196 | 3300005335 | Bacteria | 3121 |
| 74 | Ga0070680_100000214 | 3300005336 | Bacteria | 38156 |
| 75 | Ga0070680_100001291 | 3300005336 | Bacteria | 18115 |
| 76 | Ga0070680_100005688 | 3300005336 | Bacteria | 9454 |
| 77 | Ga0070680_100109545 | 3300005336 | Bacteria | 2298 |
| 78 | Ga0068868_100003747 | 3300005338 | Bacteria | 10618 |
| 79 | Ga0070660_100012070 | 3300005339 | Bacteria | 6166 |
| 80 | Ga0070660_100030281 | 3300005339 | Bacteria | 4060 |
| 81 | Ga0070660_100038076 | 3300005339 | Bacteria | 3649 |
| 82 | Ga0070660_100038599 | 3300005339 | Bacteria | 3626 |
| 83 | Ga0070660_100093272 | 3300005339 | Bacteria | 2377 |
| 84 | Ga0070660_100101560 | 3300005339 | Bacteria | 2279 |
| 85 | Ga0070660_100130554 | 3300005339 | Bacteria | 2010 |
| 86 | Ga0070660_100190464 | 3300005339 | Bacteria | 1661 |
| 87 | Ga0070660_100200999 | 3300005339 | Bacteria | 1616 |
| 88 | Ga0070660_100289490 | 3300005339 | Bacteria | 1341 |
| 89 | Ga0070660_100392622 | 3300005339 | Bacteria | 1146 |
| 90 | Ga0070660_100811013 | 3300005339 | Bacteria | 787 |
| 91 | Ga0070689_100119603 | 3300005340 | Bacteria | 2103 |
| 92 | Ga0070661_100000439 | 3300005344 | Bacteria | 31883 |
| 93 | Ga0070661_100005256 | 3300005344 | Bacteria | 8915 |
| 94 | Ga0070661_100277354 | 3300005344 | Bacteria | 1300 |
| 95 | Ga0070661_100283179 | 3300005344 | Bacteria | 1286 |
| 96 | Ga0070661_100450033 | 3300005344 | Bacteria | 1024 |
| 97 | Ga0070661_100743615 | 3300005344 | Bacteria | 801 |
| 98 | Ga0070668_100000008 | 3300005347 | Bacteria | 137948 |
| 99 | Ga0070668_100007591 | 3300005347 | Bacteria | 8050 |
| 100 | Ga0070668_100020865 | 3300005347 | Bacteria | 4949 |
| 101 | Ga0070668_100049232 | 3300005347 | Bacteria | 3242 |
| 102 | Ga0070668_100199898 | 3300005347 | Bacteria | 1641 |
| 103 | Ga0070669_100000167 | 3300005353 | Bacteria | 57589 |
| 104 | Ga0070669_100012384 | 3300005353 | Bacteria | 6049 |
| 105 | Ga0070669_100185277 | 3300005353 | Bacteria | 1630 |
| 106 | Ga0070675_100005044 | 3300005354 | Bacteria | 10077 |
| 107 | Ga0070675_100147880 | 3300005354 | Bacteria | 2013 |
| 108 | Ga0070671_100001745 | 3300005355 | Bacteria | 16513 |
| 109 | Ga0070671_100005913 | 3300005355 | Bacteria | 9750 |
| 110 | Ga0070671_100024458 | 3300005355 | Bacteria | 4944 |
| 111 | Ga0070671_100074951 | 3300005355 | Bacteria | 2827 |
| 112 | Ga0070671_100077123 | 3300005355 | Bacteria | 2785 |
| 113 | Ga0070671_100165826 | 3300005355 | Bacteria | 1868 |
| 114 | Ga0070674_100010846 | 3300005356 | Bacteria | 5527 |
| 115 | Ga0070674_100015654 | 3300005356 | Bacteria | 4740 |
| 116 | Ga0070674_100022676 | 3300005356 | Bacteria | 4051 |
| 117 | Ga0070673_100057122 | 3300005364 | Bacteria | 3083 |
| 118 | Ga0070673_100824393 | 3300005364 | Bacteria | 858 |
| 119 | Ga0070688_100001826 | 3300005365 | Bacteria | 10687 |
| 120 | Ga0070659_100005599 | 3300005366 | Bacteria | 9029 |
| 121 | Ga0070659_100005975 | 3300005366 | Bacteria | 8778 |
| 122 | Ga0070659_100059047 | 3300005366 | Bacteria | 3028 |
| 123 | Ga0070659_100276774 | 3300005366 | Bacteria | 1395 |
| 124 | Ga0070659_100576985 | 3300005366 | Bacteria | 965 |
| 125 | Ga0070659_100820854 | 3300005366 | Bacteria | 809 |
| 126 | Ga0070667_100000003 | 3300005367 | Bacteria | 447715 |
| 127 | Ga0070667_100001684 | 3300005367 | Bacteria | 19770 |
| 128 | Ga0070667_100326347 | 3300005367 | Bacteria | 1386 |
| 129 | Ga0070667_100904978 | 3300005367 | Bacteria | 821 |
| 130 | Ga0070714_100040209 | 3300005435 | Bacteria | 3940 |
| 131 | Ga0070714_100897049 | 3300005435 | Bacteria | 861 |
| 132 | Ga0070713_100012412 | 3300005436 | Bacteria | 6248 |
| 133 | Ga0070711_100035307 | 3300005439 | Bacteria | 3341 |
| 134 | Ga0070663_100003238 | 3300005455 | Bacteria | 9365 |
| 135 | Ga0070663_100008528 | 3300005455 | Bacteria | 6310 |
| 136 | Ga0070663_100034465 | 3300005455 | Bacteria | 3506 |
| 137 | Ga0070663_100051257 | 3300005455 | Bacteria | 2939 |
| 138 | Ga0070663_100052392 | 3300005455 | Bacteria | 2910 |
| 139 | Ga0070663_100155576 | 3300005455 | Bacteria | 1756 |
| 140 | Ga0070663_100170152 | 3300005455 | Bacteria | 1683 |
| 141 | Ga0070678_100010264 | 3300005456 | Bacteria | 5713 |
| 142 | Ga0070678_100275473 | 3300005456 | Bacteria | 1421 |
| 143 | Ga0070662_100000010 | 3300005457 | Bacteria | 142717 |
| 144 | Ga0070662_100057251 | 3300005457 | Bacteria | 2832 |
| 145 | Ga0070662_100066063 | 3300005457 | Bacteria | 2653 |
| 146 | Ga0070662_100072968 | 3300005457 | Bacteria | 2535 |
| 147 | Ga0070662_100078162 | 3300005457 | Bacteria | 2457 |
| 148 | Ga0070662_100131182 | 3300005457 | Bacteria | 1932 |
| 149 | Ga0070681_10019376 | 3300005458 | Bacteria | 6808 |
| 150 | Ga0070681_10027639 | 3300005458 | Bacteria | 5703 |
| 151 | Ga0070681_10033340 | 3300005458 | Bacteria | 5170 |
| 152 | Ga0070681_10230276 | 3300005458 | Bacteria | 1767 |
| 153 | Ga0070681_11340563 | 3300005458 | Bacteria | 639 |
| 154 | Ga0068867_100112159 | 3300005459 | Bacteria | 2096 |
| 155 | Ga0070685_10000036 | 3300005466 | Bacteria | 80641 |
| 156 | Ga0070684_100121829 | 3300005535 | Bacteria | 2346 |
| 157 | Ga0070684_100124631 | 3300005535 | Bacteria | 2320 |
| 158 | Ga0070684_100135556 | 3300005535 | Bacteria | 2224 |
| 159 | Ga0070684_100139018 | 3300005535 | Bacteria | 2195 |
| 160 | Ga0068853_100000396 | 3300005539 | Bacteria | 29782 |
| 161 | Ga0068853_100008993 | 3300005539 | Bacteria | 8044 |
| 162 | Ga0068853_100014321 | 3300005539 | Bacteria | 6490 |
| 163 | Ga0068853_100032220 | 3300005539 | Bacteria | 4439 |
| 164 | Ga0068853_100043193 | 3300005539 | Bacteria | 3856 |
| 165 | Ga0068853_100055351 | 3300005539 | Bacteria | 3419 |
| 166 | Ga0068853_100119686 | 3300005539 | Bacteria | 2347 |
| 167 | Ga0068853_100224704 | 3300005539 | Bacteria | 1716 |
| 168 | Ga0068853_100390259 | 3300005539 | Bacteria | 1301 |
| 169 | Ga0068853_100936963 | 3300005539 | Bacteria | 832 |
| 170 | Ga0068853_100949430 | 3300005539 | Bacteria | 827 |
| 171 | Ga0070686_100000045 | 3300005544 | Bacteria | 101988 |
| 172 | Ga0070695_100351387 | 3300005545 | Bacteria | 1105 |
| 173 | Ga0070696_100916339 | 3300005546 | Bacteria | 728 |
| 174 | Ga0070665_100000021 | 3300005548 | Bacteria | 389668 |
| 175 | Ga0070665_100000042 | 3300005548 | Bacteria | 292582 |
| 176 | Ga0070665_100000736 | 3300005548 | Bacteria | 43644 |
| 177 | Ga0070665_100070742 | 3300005548 | Bacteria | 3496 |
| 178 | Ga0068855_100001099 | 3300005563 | Bacteria | 33610 |
| 179 | Ga0068855_100020835 | 3300005563 | Bacteria | 7862 |
| 180 | Ga0068855_100078784 | 3300005563 | Bacteria | 3822 |
| 181 | Ga0068855_100129623 | 3300005563 | Bacteria | 2881 |
| 182 | Ga0068855_100352297 | 3300005563 | Bacteria | 1621 |
| 183 | Ga0068855_101094019 | 3300005563 | Bacteria | 833 |
| 184 | Ga0068855_101149205 | 3300005563 | Bacteria | 809 |
| 185 | Ga0070664_100000103 | 3300005564 | Bacteria | 54853 |
| 186 | Ga0070664_100013075 | 3300005564 | Bacteria | 6755 |
| 187 | Ga0070664_100037446 | 3300005564 | Bacteria | 4079 |
| 188 | Ga0070664_100040560 | 3300005564 | Bacteria | 3925 |
| 189 | Ga0070664_100086408 | 3300005564 | Bacteria | 2710 |
| 190 | Ga0070664_100097913 | 3300005564 | Bacteria | 2547 |
| 191 | Ga0070664_100488724 | 3300005564 | Bacteria | 1133 |
| 192 | Ga0070664_100834576 | 3300005564 | Bacteria | 862 |
| 193 | Ga0068857_100025650 | 3300005577 | Bacteria | 5189 |
| 194 | Ga0068857_100026615 | 3300005577 | Bacteria | 5098 |
| 195 | Ga0068857_100047101 | 3300005577 | Bacteria | 3827 |
| 196 | Ga0068857_100126580 | 3300005577 | Bacteria | 2302 |
| 197 | Ga0068857_100167466 | 3300005577 | Bacteria | 1996 |
| 198 | Ga0068857_100349310 | 3300005577 | Bacteria | 1369 |
| 199 | Ga0068857_100437383 | 3300005577 | Bacteria | 1221 |
| 200 | Ga0068854_100010204 | 3300005578 | Bacteria | 6087 |
| 201 | Ga0068854_100037927 | 3300005578 | Bacteria | 3386 |
| 202 | Ga0068854_100057613 | 3300005578 | Bacteria | 2803 |
| 203 | Ga0068854_100071990 | 3300005578 | Bacteria | 2530 |
| 204 | Ga0068854_100091284 | 3300005578 | Bacteria | 2266 |
| 205 | Ga0068854_100099837 | 3300005578 | Bacteria | 2174 |
| 206 | Ga0068854_100164250 | 3300005578 | Bacteria | 1722 |
| 207 | Ga0068854_100179862 | 3300005578 | Bacteria | 1651 |
| 208 | Ga0068854_100247276 | 3300005578 | Bacteria | 1422 |
| 209 | Ga0068854_100253342 | 3300005578 | Bacteria | 1406 |
| 210 | Ga0068856_100000101 | 3300005614 | Bacteria | 82391 |
| 211 | Ga0068856_100023054 | 3300005614 | Bacteria | 6053 |
| 212 | Ga0068856_100108127 | 3300005614 | Bacteria | 2777 |
| 213 | Ga0068856_100503090 | 3300005614 | Bacteria | 1233 |
| 214 | Ga0068852_100001412 | 3300005616 | Bacteria | 16199 |
| 215 | Ga0068852_100011679 | 3300005616 | Bacteria | 6624 |
| 216 | Ga0068852_100332454 | 3300005616 | Bacteria | 1479 |
| 217 | Ga0068852_100380602 | 3300005616 | Bacteria | 1384 |
| 218 | Ga0068852_100536918 | 3300005616 | Bacteria | 1168 |
| 219 | Ga0068852_100730729 | 3300005616 | Bacteria | 1001 |
| 220 | Ga0068859_100013033 | 3300005617 | Bacteria | 8353 |
| 221 | Ga0068859_100013138 | 3300005617 | Bacteria | 8320 |
| 222 | Ga0068859_100643218 | 3300005617 | Bacteria | 1153 |
| 223 | Ga0068864_100058119 | 3300005618 | Bacteria | 3342 |
| 224 | Ga0068864_100195361 | 3300005618 | Bacteria | 1856 |
| 225 | Ga0068861_100000107 | 3300005719 | Bacteria | 41725 |
| 226 | Ga0068861_100010533 | 3300005719 | Bacteria | 6419 |
| 227 | Ga0068861_100012293 | 3300005719 | Bacteria | 5971 |
| 228 | Ga0068861_100031809 | 3300005719 | Bacteria | 3880 |
| 229 | Ga0068851_10037677 | 3300005834 | Bacteria | 2425 |
| 230 | Ga0068851_10120463 | 3300005834 | Bacteria | 1410 |
| 231 | Ga0068863_100000239 | 3300005841 | Bacteria | 58509 |
| 232 | Ga0068863_100062483 | 3300005841 | Bacteria | 3522 |
| 233 | Ga0068863_100309029 | 3300005841 | Bacteria | 1534 |
| 234 | Ga0068858_100000278 | 3300005842 | Bacteria | 55142 |
| 235 | Ga0068858_100002704 | 3300005842 | Bacteria | 17877 |
| 236 | Ga0068858_100016556 | 3300005842 | Bacteria | 6925 |
| 237 | Ga0068858_100140436 | 3300005842 | Bacteria | 2267 |
| 238 | Ga0068858_100140629 | 3300005842 | Bacteria | 2266 |
| 239 | Ga0068860_100000045 | 3300005843 | Bacteria | 223252 |
| 240 | Ga0068860_100000182 | 3300005843 | Bacteria | 100888 |
| 241 | Ga0068860_100369824 | 3300005843 | Bacteria | 1414 |
| 242 | Ga0068862_100000392 | 3300005844 | Bacteria | 47165 |
| 243 | Ga0068862_100000449 | 3300005844 | Bacteria | 44685 |
| 244 | Ga0068862_100957338 | 3300005844 | Bacteria | 844 |
| 245 | Ga0081455_10000255 | 3300005937 | Bacteria | 69927 |
| 246 | Ga0081540_1076880 | 3300005983 | Bacteria | 1519 |
| 247 | Ga0081539_10016957 | 3300005985 | Bacteria | 5158 |
| 248 | Ga0070717_10028421 | 3300006028 | Bacteria | 4476 |
| 249 | Ga0070712_100101508 | 3300006175 | Bacteria | 2128 |
| 250 | Ga0097621_100238033 | 3300006237 | Bacteria | 1591 |
| 251 | Ga0075431_100009423 | 3300006847 | Bacteria | 9801 |
| 252 | Ga0068865_100067416 | 3300006881 | Bacteria | 2528 |
| 253 | Ga0097620_100007709 | 3300006931 | Bacteria | 10931 |
| 254 | Ga0097620_100013033 | 3300006931 | Bacteria | 8353 |
| 255 | Ga0097620_100013138 | 3300006931 | Bacteria | 8320 |
| 256 | Ga0097620_100643145 | 3300006931 | Bacteria | 1153 |
| 257 | Ga0097620_100870428 | 3300006931 | Bacteria | 986 |
| 258 | Ga0079104_1056582 | 3300006946 | Bacteria | 857 |
| 259 | Ga0105240_10023057 | 3300009093 | Bacteria | 8243 |
| 260 | Ga0105240_10152102 | 3300009093 | Bacteria | 2755 |
| 261 | Ga0105240_10583831 | 3300009093 | Bacteria | 1232 |
| 262 | Ga0105240_10984858 | 3300009093 | Bacteria | 903 |
| 263 | Ga0105247_10226231 | 3300009101 | Bacteria | 1268 |
| 264 | Ga0105243_10012004 | 3300009148 | Bacteria | 6549 |
| 265 | Ga0105243_11049821 | 3300009148 | Bacteria | 820 |
| 266 | Ga0105241_10006002 | 3300009174 | Bacteria | 8963 |
| 267 | Ga0105241_10370644 | 3300009174 | Bacteria | 1248 |
| 268 | Ga0105241_11051295 | 3300009174 | Bacteria | 764 |
| 269 | Ga0105248_10000673 | 3300009177 | Bacteria | 38736 |
| 270 | Ga0105248_10000724 | 3300009177 | Bacteria | 37195 |
| 271 | Ga0105248_10001313 | 3300009177 | Bacteria | 27695 |
| 272 | Ga0105248_10084221 | 3300009177 | Bacteria | 3576 |
| 273 | Ga0105248_12208234 | 3300009177 | Bacteria | 626 |
| 274 | Ga0105237_10009564 | 3300009545 | Bacteria | 10379 |
| 275 | Ga0105237_10038909 | 3300009545 | Bacteria | 4803 |
| 276 | Ga0105237_10106593 | 3300009545 | Bacteria | 2794 |
| 277 | Ga0105237_10167956 | 3300009545 | Bacteria | 2193 |
| 278 | Ga0105237_10481592 | 3300009545 | Bacteria | 1247 |
| 279 | Ga0105238_10020941 | 3300009551 | Bacteria | 6661 |
| 280 | Ga0105238_10126698 | 3300009551 | Bacteria | 2532 |
| 281 | Ga0105238_10134649 | 3300009551 | Bacteria | 2449 |
| 282 | Ga0105238_10430396 | 3300009551 | Bacteria | 1315 |
| 283 | Ga0105249_10000012 | 3300009553 | Bacteria | 292640 |
| 284 | Ga0105249_10050993 | 3300009553 | Bacteria | 3774 |
| 285 | Ga0105249_10065199 | 3300009553 | Bacteria | 3350 |
| 286 | Ga0105239_10188762 | 3300010375 | Bacteria | 2307 |
| 287 | Ga0105239_10921035 | 3300010375 | Bacteria | 1003 |
| 288 | Ga0105239_11200179 | 3300010375 | Bacteria | 874 |
| 289 | Ga0105239_12297840 | 3300010375 | Bacteria | 628 |
| 290 | Ga0157373_10018538 | 3300013100 | Bacteria | 5064 |
| 291 | Ga0157373_10061596 | 3300013100 | Bacteria | 2657 |
| 292 | Ga0157373_10204315 | 3300013100 | Bacteria | 1393 |
| 293 | Ga0157373_10229877 | 3300013100 | Bacteria | 1310 |
| 294 | Ga0157373_10279604 | 3300013100 | Bacteria | 1183 |
| 295 | Ga0157371_10000793 | 3300013102 | Bacteria | 36288 |
| 296 | Ga0157371_10003868 | 3300013102 | Bacteria | 13346 |
| 297 | Ga0157371_10012085 | 3300013102 | Bacteria | 6614 |
| 298 | Ga0157371_10034354 | 3300013102 | Bacteria | 3638 |
| 299 | Ga0157371_10308274 | 3300013102 | Bacteria | 1147 |
| 300 | Ga0157370_10048689 | 3300013104 | Bacteria | 4060 |
| 301 | Ga0157370_10065873 | 3300013104 | Bacteria | 3427 |
| 302 | Ga0157370_10941543 | 3300013104 | Bacteria | 783 |
| 303 | Ga0157369_10013876 | 3300013105 | Bacteria | 9101 |
| 304 | Ga0157369_10027781 | 3300013105 | Bacteria | 6267 |
| 305 | Ga0157369_10090726 | 3300013105 | Bacteria | 3262 |
| 306 | Ga0157369_10160087 | 3300013105 | Bacteria | 2376 |
| 307 | Ga0157369_10260929 | 3300013105 | Bacteria | 1807 |
| 308 | Ga0157369_10544464 | 3300013105 | Bacteria | 1200 |
| 309 | Ga0157369_10802314 | 3300013105 | Bacteria | 967 |
| 310 | Ga0157374_10009179 | 3300013296 | Bacteria | 8480 |
| 311 | Ga0157374_10192844 | 3300013296 | Bacteria | 1993 |
| 312 | Ga0163162_10672205 | 3300013306 | Bacteria | 1158 |
| 313 | Ga0163162_11143820 | 3300013306 | Bacteria | 882 |
| 314 | Ga0157372_10029659 | 3300013307 | Bacteria | 5975 |
| 315 | Ga0157372_10043572 | 3300013307 | Bacteria | 4969 |
| 316 | Ga0157372_10054730 | 3300013307 | Bacteria | 4453 |
| 317 | Ga0157372_10137761 | 3300013307 | Bacteria | 2811 |
| 318 | Ga0157372_10202905 | 3300013307 | Bacteria | 2297 |
| 319 | Ga0157372_10414911 | 3300013307 | Bacteria | 1569 |
| 320 | Ga0157372_10473246 | 3300013307 | Bacteria | 1460 |
| 321 | Ga0157372_10636137 | 3300013307 | Bacteria | 1243 |
| 322 | Ga0157372_11164737 | 3300013307 | Bacteria | 891 |
| 323 | Ga0157375_10072291 | 3300013308 | Bacteria | 3465 |
| 324 | Ga0157375_11949409 | 3300013308 | Bacteria | 698 |
| 325 | Ga0163163_10000580 | 3300014325 | Bacteria | 32211 |
| 326 | Ga0163163_10446996 | 3300014325 | Bacteria | 1352 |
| 327 | Ga0163163_10647595 | 3300014325 | Bacteria | 1120 |
| 328 | Ga0157380_10003947 | 3300014326 | Bacteria | 10238 |
| 329 | Ga0157380_10019291 | 3300014326 | Bacteria | 5082 |
| 330 | Ga0157380_10347308 | 3300014326 | Bacteria | 1387 |
| 331 | Ga0157380_10765458 | 3300014326 | Bacteria | 979 |
| 332 | Ga0157379_10001908 | 3300014968 | Bacteria | 17245 |
| 333 | Ga0183363_1008 | 3300015690 | Bacteria | 194027 |
| 334 | Ga0163161_10000202 | 3300017792 | Bacteria | 54518 |
| 335 | Ga0163161_10023353 | 3300017792 | Bacteria | 4363 |
| 336 | Ga0163161_10024583 | 3300017792 | Bacteria | 4257 |
| 337 | Ga0163161_10689802 | 3300017792 | Bacteria | 849 |
| 338 | Ga0197907_10010936 | 3300020069 | Bacteria | 1349 |
| 339 | Ga0206356_10680400 | 3300020070 | Bacteria | 1475 |
| 340 | Ga0206353_11575149 | 3300020082 | Bacteria | 943 |
| 341 | Ga0213875_10001046 | 3300021388 | Bacteria | 19467 |
| 342 | Ga0224712_10125141 | 3300022467 | Bacteria | 1117 |
| 343 | Ga0209147_100446 | 3300025229 | Bacteria | 26057 |
| 344 | Ga0209563_100053 | 3300025230 | Bacteria | 332370 |
| 345 | Ga0207425_1000146 | 3300025245 | Bacteria | 60712 |
| 346 | Ga0209646_1022374 | 3300025246 | Bacteria | 901 |
| 347 | Ga0209677_106508 | 3300025253 | Bacteria | 2747 |
| 348 | Ga0209148_1000061 | 3300025254 | Bacteria | 349575 |
| 349 | Ga0209148_1000159 | 3300025254 | Bacteria | 139560 |
| 350 | Ga0209129_1003315 | 3300025258 | Bacteria | 7103 |
| 351 | Ga0209233_1006578 | 3300025261 | Bacteria | 3736 |
| 352 | Ga0209565_1021095 | 3300025263 | Bacteria | 1366 |
| 353 | Ga0209455_1000045 | 3300025272 | Bacteria | 383329 |
| 354 | Ga0209675_1000075 | 3300025291 | Bacteria | 161623 |
| 355 | Ga0209676_1000081 | 3300025292 | Bacteria | 285297 |
| 356 | Ga0209676_1000554 | 3300025292 | Bacteria | 56925 |
| 357 | Ga0209025_1000431 | 3300025294 | Bacteria | 82934 |
| 358 | Ga0209025_1018162 | 3300025294 | Bacteria | 4011 |
| 359 | Ga0209564_1000437 | 3300025295 | Bacteria | 72058 |
| 360 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 361 | Ga0209758_1000328 | 3300025297 | Bacteria | 89656 |
| 362 | Ga0209050_1000017 | 3300025298 | Bacteria | 728928 |
| 363 | Ga0209050_1000474 | 3300025298 | Bacteria | 71192 |
| 364 | Ga0209050_1023196 | 3300025298 | Bacteria | 2191 |
| 365 | Ga0209050_1024209 | 3300025298 | Bacteria | 2109 |
| 366 | Ga0209257_1000206 | 3300025304 | Bacteria | 142184 |
| 367 | Ga0209257_1000456 | 3300025304 | Bacteria | 75804 |
| 368 | Ga0207697_10000725 | 3300025315 | Bacteria | 18735 |
| 369 | Ga0207656_10000858 | 3300025321 | Bacteria | 9930 |
| 370 | Ga0207656_10028534 | 3300025321 | Bacteria | 2291 |
| 371 | Ga0207656_10101812 | 3300025321 | Bacteria | 1317 |
| 372 | Ga0207682_10000649 | 3300025893 | Bacteria | 16245 |
| 373 | Ga0207680_10000012 | 3300025903 | Bacteria | 293810 |
| 374 | Ga0207680_10035968 | 3300025903 | Bacteria | 2848 |
| 375 | Ga0207647_10001900 | 3300025904 | Bacteria | 16010 |
| 376 | Ga0207647_10030536 | 3300025904 | Bacteria | 3474 |
| 377 | Ga0207647_10047167 | 3300025904 | Bacteria | 2681 |
| 378 | Ga0207647_10083436 | 3300025904 | Bacteria | 1914 |
| 379 | Ga0207647_10094886 | 3300025904 | Bacteria | 1776 |
| 380 | Ga0207647_10158003 | 3300025904 | Bacteria | 1323 |
| 381 | Ga0207647_10614692 | 3300025904 | Bacteria | 598 |
| 382 | Ga0207699_10670858 | 3300025906 | Bacteria | 758 |
| 383 | Ga0207645_10020635 | 3300025907 | Bacteria | 4310 |
| 384 | Ga0207645_10123752 | 3300025907 | Bacteria | 1680 |
| 385 | Ga0207643_10202943 | 3300025908 | Bacteria | 1208 |
| 386 | Ga0207643_10249079 | 3300025908 | Bacteria | 1094 |
| 387 | Ga0207705_10000025 | 3300025909 | Bacteria | 259826 |
| 388 | Ga0207705_10000113 | 3300025909 | Bacteria | 90567 |
| 389 | Ga0207705_10000309 | 3300025909 | Bacteria | 45040 |
| 390 | Ga0207705_10005374 | 3300025909 | Bacteria | 9578 |
| 391 | Ga0207705_10020922 | 3300025909 | Bacteria | 4667 |
| 392 | Ga0207705_10056282 | 3300025909 | Bacteria | 2835 |
| 393 | Ga0207705_10065548 | 3300025909 | Bacteria | 2626 |
| 394 | Ga0207705_10109930 | 3300025909 | Bacteria | 2036 |
| 395 | Ga0207705_10114144 | 3300025909 | Bacteria | 1998 |
| 396 | Ga0207705_10132887 | 3300025909 | Bacteria | 1853 |
| 397 | Ga0207705_10135073 | 3300025909 | Bacteria | 1838 |
| 398 | Ga0207654_10000363 | 3300025911 | Bacteria | 26735 |
| 399 | Ga0207654_10001493 | 3300025911 | Bacteria | 12355 |
| 400 | Ga0207654_10205995 | 3300025911 | Bacteria | 1298 |
| 401 | Ga0207654_10471698 | 3300025911 | Bacteria | 883 |
| 402 | Ga0207707_10782054 | 3300025912 | Bacteria | 796 |
| 403 | Ga0207695_10009402 | 3300025913 | Bacteria | 12092 |
| 404 | Ga0207695_10009881 | 3300025913 | Bacteria | 11726 |
| 405 | Ga0207695_10020497 | 3300025913 | Bacteria | 7570 |
| 406 | Ga0207695_10105002 | 3300025913 | Bacteria | 2813 |
| 407 | Ga0207695_10125638 | 3300025913 | Bacteria | 2528 |
| 408 | Ga0207671_10000358 | 3300025914 | Bacteria | 65072 |
| 409 | Ga0207671_10008227 | 3300025914 | Bacteria | 8880 |
| 410 | Ga0207671_10033078 | 3300025914 | Bacteria | 3848 |
| 411 | Ga0207693_10003170 | 3300025915 | Bacteria | 14130 |
| 412 | Ga0207663_10074248 | 3300025916 | Bacteria | 2203 |
| 413 | Ga0207660_10000186 | 3300025917 | Bacteria | 39363 |
| 414 | Ga0207660_10001468 | 3300025917 | Bacteria | 15862 |
| 415 | Ga0207660_10007711 | 3300025917 | Bacteria | 6967 |
| 416 | Ga0207660_10017028 | 3300025917 | Bacteria | 4822 |
| 417 | Ga0207657_10000026 | 3300025919 | Bacteria | 143118 |
| 418 | Ga0207657_10003075 | 3300025919 | Bacteria | 17857 |
| 419 | Ga0207657_10008938 | 3300025919 | Bacteria | 10122 |
| 420 | Ga0207657_10009815 | 3300025919 | Bacteria | 9591 |
| 421 | Ga0207657_10016201 | 3300025919 | Bacteria | 7195 |
| 422 | Ga0207657_10020388 | 3300025919 | Bacteria | 6265 |
| 423 | Ga0207657_10030743 | 3300025919 | Bacteria | 4870 |
| 424 | Ga0207657_10091390 | 3300025919 | Bacteria | 2538 |
| 425 | Ga0207657_10092054 | 3300025919 | Bacteria | 2527 |
| 426 | Ga0207657_10096733 | 3300025919 | Bacteria | 2455 |
| 427 | Ga0207657_10134231 | 3300025919 | Bacteria | 2026 |
| 428 | Ga0207657_10146278 | 3300025919 | Bacteria | 1927 |
| 429 | Ga0207649_10000228 | 3300025920 | Bacteria | 45916 |
| 430 | Ga0207649_10000594 | 3300025920 | Bacteria | 24526 |
| 431 | Ga0207649_10002596 | 3300025920 | Bacteria | 10029 |
| 432 | Ga0207649_10029009 | 3300025920 | Bacteria | 3264 |
| 433 | Ga0207649_10038867 | 3300025920 | Bacteria | 2883 |
| 434 | Ga0207649_10040236 | 3300025920 | Bacteria | 2840 |
| 435 | Ga0207649_10379584 | 3300025920 | Bacteria | 1053 |
| 436 | Ga0207649_10467803 | 3300025920 | Bacteria | 954 |
| 437 | Ga0207649_10665470 | 3300025920 | Bacteria | 805 |
| 438 | Ga0207652_10006821 | 3300025921 | Bacteria | 9200 |
| 439 | Ga0207681_10000076 | 3300025923 | Bacteria | 89353 |
| 440 | Ga0207681_10009875 | 3300025923 | Bacteria | 5839 |
| 441 | Ga0207681_10046204 | 3300025923 | Bacteria | 2928 |
| 442 | Ga0207681_10363601 | 3300025923 | Bacteria | 1161 |
| 443 | Ga0207681_10778803 | 3300025923 | Bacteria | 798 |
| 444 | Ga0207694_10000667 | 3300025924 | Bacteria | 30806 |
| 445 | Ga0207694_10006827 | 3300025924 | Bacteria | 8668 |
| 446 | Ga0207694_10020884 | 3300025924 | Bacteria | 4958 |
| 447 | Ga0207694_10036529 | 3300025924 | Bacteria | 3771 |
| 448 | Ga0207694_10103449 | 3300025924 | Bacteria | 2258 |
| 449 | Ga0207650_10001585 | 3300025925 | Bacteria | 16226 |
| 450 | Ga0207650_10009316 | 3300025925 | Bacteria | 6710 |
| 451 | Ga0207650_10046015 | 3300025925 | Bacteria | 3212 |
| 452 | Ga0207650_10091162 | 3300025925 | Bacteria | 2329 |
| 453 | Ga0207650_10118898 | 3300025925 | Bacteria | 2055 |
| 454 | Ga0207650_10120719 | 3300025925 | Bacteria | 2040 |
| 455 | Ga0207650_10437949 | 3300025925 | Bacteria | 1086 |
| 456 | Ga0207650_11253445 | 3300025925 | Bacteria | 631 |
| 457 | Ga0207659_10014152 | 3300025926 | Bacteria | 5137 |
| 458 | Ga0207659_10380499 | 3300025926 | Bacteria | 1177 |
| 459 | Ga0207700_10130869 | 3300025928 | Bacteria | 2048 |
| 460 | Ga0207664_10158040 | 3300025929 | Bacteria | 1931 |
| 461 | Ga0207664_10681097 | 3300025929 | Bacteria | 924 |
| 462 | Ga0207644_10000254 | 3300025931 | Bacteria | 36059 |
| 463 | Ga0207644_10000294 | 3300025931 | Bacteria | 32960 |
| 464 | Ga0207644_10009075 | 3300025931 | Bacteria | 6521 |
| 465 | Ga0207644_10029626 | 3300025931 | Bacteria | 3799 |
| 466 | Ga0207644_10259739 | 3300025931 | Bacteria | 1388 |
| 467 | Ga0207644_10292533 | 3300025931 | Bacteria | 1310 |
| 468 | Ga0207690_10000036 | 3300025932 | Bacteria | 143853 |
| 469 | Ga0207690_10000498 | 3300025932 | Bacteria | 25393 |
| 470 | Ga0207690_10001936 | 3300025932 | Bacteria | 12689 |
| 471 | Ga0207690_10294300 | 3300025932 | Bacteria | 1268 |
| 472 | Ga0207690_10516791 | 3300025932 | Bacteria | 967 |
| 473 | Ga0207706_10000031 | 3300025933 | Bacteria | 143109 |
| 474 | Ga0207706_10000463 | 3300025933 | Bacteria | 43338 |
| 475 | Ga0207706_10004389 | 3300025933 | Bacteria | 13261 |
| 476 | Ga0207706_10009977 | 3300025933 | Bacteria | 8705 |
| 477 | Ga0207706_10090465 | 3300025933 | Bacteria | 2691 |
| 478 | Ga0207706_10192208 | 3300025933 | Bacteria | 1791 |
| 479 | Ga0207706_10193626 | 3300025933 | Bacteria | 1784 |
| 480 | Ga0207706_10266948 | 3300025933 | Bacteria | 1494 |
| 481 | Ga0207706_10379599 | 3300025933 | Bacteria | 1227 |
| 482 | Ga0207706_10448117 | 3300025933 | Bacteria | 1117 |
| 483 | Ga0207709_10000047 | 3300025935 | Bacteria | 238649 |
| 484 | Ga0207709_10366903 | 3300025935 | Bacteria | 1092 |
| 485 | Ga0207670_10091254 | 3300025936 | Bacteria | 2154 |
| 486 | Ga0207670_10489015 | 3300025936 | Bacteria | 998 |
| 487 | Ga0207669_10001404 | 3300025937 | Bacteria | 10240 |
| 488 | Ga0207669_10003273 | 3300025937 | Bacteria | 7001 |
| 489 | Ga0207669_10139472 | 3300025937 | Bacteria | 1680 |
| 490 | Ga0207669_10445601 | 3300025937 | Bacteria | 1025 |
| 491 | Ga0207704_10421232 | 3300025938 | Bacteria | 1059 |
| 492 | Ga0207704_11201969 | 3300025938 | Bacteria | 646 |
| 493 | Ga0207691_10043137 | 3300025940 | Bacteria | 4157 |
| 494 | Ga0207691_10481158 | 3300025940 | Bacteria | 1055 |
| 495 | Ga0207711_10000956 | 3300025941 | Bacteria | 27669 |
| 496 | Ga0207711_10002871 | 3300025941 | Bacteria | 15108 |
| 497 | Ga0207711_10031665 | 3300025941 | Bacteria | 4466 |
| 498 | Ga0207711_10037874 | 3300025941 | Bacteria | 4099 |
| 499 | Ga0207711_10154777 | 3300025941 | Bacteria | 2071 |
| 500 | Ga0207711_10416481 | 3300025941 | Bacteria | 1249 |
| 501 | Ga0207689_10037163 | 3300025942 | Bacteria | 4041 |
| 502 | Ga0207661_10001385 | 3300025944 | Bacteria | 16276 |
| 503 | Ga0207661_10014727 | 3300025944 | Bacteria | 5737 |
| 504 | Ga0207661_10048274 | 3300025944 | Bacteria | 3382 |
| 505 | Ga0207661_10188262 | 3300025944 | Bacteria | 1808 |
| 506 | Ga0207679_10000093 | 3300025945 | Bacteria | 78331 |
| 507 | Ga0207679_10011706 | 3300025945 | Bacteria | 5695 |
| 508 | Ga0207679_10040198 | 3300025945 | Bacteria | 3346 |
| 509 | Ga0207679_10112459 | 3300025945 | Bacteria | 2152 |
| 510 | Ga0207679_10145871 | 3300025945 | Bacteria | 1919 |
| 511 | Ga0207679_10262225 | 3300025945 | Bacteria | 1474 |
| 512 | Ga0207679_10744536 | 3300025945 | Bacteria | 891 |
| 513 | Ga0207667_10000001 | 3300025949 | Bacteria | 1178522 |
| 514 | Ga0207667_10003819 | 3300025949 | Bacteria | 18527 |
| 515 | Ga0207667_10008760 | 3300025949 | Bacteria | 11985 |
| 516 | Ga0207667_10016498 | 3300025949 | Bacteria | 8344 |
| 517 | Ga0207667_10116955 | 3300025949 | Bacteria | 2747 |
| 518 | Ga0207667_10479282 | 3300025949 | Bacteria | 1263 |
| 519 | Ga0207667_10930824 | 3300025949 | Bacteria | 859 |
| 520 | Ga0207667_11089459 | 3300025949 | Bacteria | 782 |
| 521 | Ga0207667_11208576 | 3300025949 | Bacteria | 735 |
| 522 | Ga0207712_10000021 | 3300025961 | Bacteria | 292649 |
| 523 | Ga0207712_10015715 | 3300025961 | Bacteria | 4888 |
| 524 | Ga0207712_10133053 | 3300025961 | Bacteria | 1898 |
| 525 | Ga0207668_10000480 | 3300025972 | Bacteria | 24978 |
| 526 | Ga0207668_10046466 | 3300025972 | Bacteria | 2966 |
| 527 | Ga0207668_10154101 | 3300025972 | Bacteria | 1783 |
| 528 | Ga0207668_10340755 | 3300025972 | Bacteria | 1250 |
| 529 | Ga0207640_10003839 | 3300025981 | Bacteria | 8107 |
| 530 | Ga0207640_10010560 | 3300025981 | Bacteria | 5208 |
| 531 | Ga0207640_10025944 | 3300025981 | Bacteria | 3554 |
| 532 | Ga0207640_10028754 | 3300025981 | Bacteria | 3403 |
| 533 | Ga0207640_10095869 | 3300025981 | Bacteria | 2067 |
| 534 | Ga0207640_10111622 | 3300025981 | Bacteria | 1939 |
| 535 | Ga0207640_10391295 | 3300025981 | Bacteria | 1129 |
| 536 | Ga0207640_10455623 | 3300025981 | Bacteria | 1055 |
| 537 | Ga0207640_10546706 | 3300025981 | Bacteria | 972 |
| 538 | Ga0207640_11098012 | 3300025981 | Bacteria | 704 |
| 539 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 540 | Ga0207658_10000936 | 3300025986 | Bacteria | 24076 |
| 541 | Ga0207658_10003747 | 3300025986 | Bacteria | 10705 |
| 542 | Ga0207658_10053655 | 3300025986 | Bacteria | 2980 |
| 543 | Ga0207658_10376411 | 3300025986 | Bacteria | 1242 |
| 544 | Ga0207677_10120313 | 3300026023 | Bacteria | 1974 |
| 545 | Ga0207703_10000587 | 3300026035 | Bacteria | 37079 |
| 546 | Ga0207703_10004856 | 3300026035 | Bacteria | 10938 |
| 547 | Ga0207703_10008434 | 3300026035 | Bacteria | 8145 |
| 548 | Ga0207703_10106943 | 3300026035 | Bacteria | 2381 |
| 549 | Ga0207639_10001448 | 3300026041 | Bacteria | 15976 |
| 550 | Ga0207639_10002653 | 3300026041 | Bacteria | 12006 |
| 551 | Ga0207639_10002879 | 3300026041 | Bacteria | 11560 |
| 552 | Ga0207639_10017154 | 3300026041 | Bacteria | 5131 |
| 553 | Ga0207639_10024716 | 3300026041 | Bacteria | 4352 |
| 554 | Ga0207639_10037183 | 3300026041 | Bacteria | 3614 |
| 555 | Ga0207639_10051214 | 3300026041 | Bacteria | 3140 |
| 556 | Ga0207639_10161027 | 3300026041 | Bacteria | 1891 |
| 557 | Ga0207639_10818689 | 3300026041 | Bacteria | 868 |
| 558 | Ga0207678_10008204 | 3300026067 | Bacteria | 9207 |
| 559 | Ga0207678_10011522 | 3300026067 | Bacteria | 7769 |
| 560 | Ga0207678_10011562 | 3300026067 | Bacteria | 7752 |
| 561 | Ga0207678_10017323 | 3300026067 | Bacteria | 6324 |
| 562 | Ga0207678_10079060 | 3300026067 | Bacteria | 2816 |
| 563 | Ga0207678_10094520 | 3300026067 | Bacteria | 2554 |
| 564 | Ga0207678_10097402 | 3300026067 | Bacteria | 2514 |
| 565 | Ga0207678_10137527 | 3300026067 | Bacteria | 2084 |
| 566 | Ga0207708_10166878 | 3300026075 | Bacteria | 1741 |
| 567 | Ga0207708_10359911 | 3300026075 | Bacteria | 1196 |
| 568 | Ga0207702_10000353 | 3300026078 | Bacteria | 52560 |
| 569 | Ga0207702_10000963 | 3300026078 | Bacteria | 29605 |
| 570 | Ga0207702_10003254 | 3300026078 | Bacteria | 15003 |
| 571 | Ga0207702_10031113 | 3300026078 | Bacteria | 4448 |
| 572 | Ga0207702_10436237 | 3300026078 | Bacteria | 1269 |
| 573 | Ga0207641_10000589 | 3300026088 | Bacteria | 39950 |
| 574 | Ga0207641_10017753 | 3300026088 | Bacteria | 5829 |
| 575 | Ga0207641_10207702 | 3300026088 | Bacteria | 1809 |
| 576 | Ga0207648_10079457 | 3300026089 | Bacteria | 2861 |
| 577 | Ga0207648_10359804 | 3300026089 | Bacteria | 1313 |
| 578 | Ga0207648_11142938 | 3300026089 | Bacteria | 731 |
| 579 | Ga0207676_10000921 | 3300026095 | Bacteria | 22753 |
| 580 | Ga0207676_10036689 | 3300026095 | Bacteria | 3732 |
| 581 | Ga0207674_10009710 | 3300026116 | Bacteria | 10969 |
| 582 | Ga0207674_10015944 | 3300026116 | Bacteria | 8232 |
| 583 | Ga0207674_10018633 | 3300026116 | Bacteria | 7540 |
| 584 | Ga0207674_10108795 | 3300026116 | Bacteria | 2748 |
| 585 | Ga0207674_10124858 | 3300026116 | Bacteria | 2540 |
| 586 | Ga0207674_10185300 | 3300026116 | Bacteria | 2032 |
| 587 | Ga0207674_10324607 | 3300026116 | Bacteria | 1489 |
| 588 | Ga0207674_10584636 | 3300026116 | Bacteria | 1079 |
| 589 | Ga0207674_10961208 | 3300026116 | Bacteria | 823 |
| 590 | Ga0207675_100000317 | 3300026118 | Bacteria | 45991 |
| 591 | Ga0207675_100003402 | 3300026118 | Bacteria | 15538 |
| 592 | Ga0207675_100020505 | 3300026118 | Bacteria | 6161 |
| 593 | Ga0207675_100046136 | 3300026118 | Bacteria | 4070 |
| 594 | Ga0207683_10498428 | 3300026121 | Bacteria | 1125 |
| 595 | Ga0207698_10001652 | 3300026142 | Bacteria | 13008 |
| 596 | Ga0207698_10003330 | 3300026142 | Bacteria | 9666 |
| 597 | Ga0207698_10003733 | 3300026142 | Bacteria | 9200 |
| 598 | Ga0207698_10008213 | 3300026142 | Bacteria | 6586 |
| 599 | Ga0207698_10011430 | 3300026142 | Bacteria | 5757 |
| 600 | Ga0207698_10027408 | 3300026142 | Bacteria | 4044 |
| 601 | Ga0207698_10055506 | 3300026142 | Bacteria | 3054 |
| 602 | Ga0207698_10174954 | 3300026142 | Bacteria | 1894 |
| 603 | Ga0207698_10237893 | 3300026142 | Bacteria | 1657 |
| 604 | Ga0207698_10370511 | 3300026142 | Bacteria | 1359 |
| 605 | Ga0207698_10515516 | 3300026142 | Bacteria | 1166 |
| 606 | Ga0209281_1044830 | 3300027111 | Bacteria | 727 |
| 607 | Ga0209968_1051459 | 3300027526 | Bacteria | 716 |
| 608 | Ga0209970_1013435 | 3300027614 | Bacteria | 1358 |
| 609 | Ga0209983_1044476 | 3300027665 | Bacteria | 965 |
| 610 | Ga0209974_10003691 | 3300027876 | Bacteria | 5500 |
| 611 | Ga0209974_10004663 | 3300027876 | Bacteria | 4874 |
| 612 | Ga0209974_10076568 | 3300027876 | Bacteria | 1146 |
| 613 | Ga0268266_10000015 | 3300028379 | Bacteria | 630629 |
| 614 | Ga0268266_10000054 | 3300028379 | Bacteria | 292717 |
| 615 | Ga0268266_10000370 | 3300028379 | Bacteria | 69264 |
| 616 | Ga0268266_10026889 | 3300028379 | Bacteria | 4895 |
| 617 | Ga0268266_10720543 | 3300028379 | Bacteria | 962 |
| 618 | Ga0268265_10000278 | 3300028380 | Bacteria | 58293 |
| 619 | Ga0268265_10000684 | 3300028380 | Bacteria | 33416 |
| 620 | Ga0268265_10087634 | 3300028380 | Bacteria | 2477 |
| 621 | Ga0268265_10267811 | 3300028380 | Bacteria | 1522 |
| 622 | Ga0268264_10000074 | 3300028381 | Bacteria | 259555 |
| 623 | Ga0268264_10000101 | 3300028381 | Bacteria | 225109 |
| 624 | Ga0268264_10250794 | 3300028381 | Bacteria | 1644 |
| 625 | Ga0265325_10040778 | 3300031241 | Bacteria | 2437 |
| 626 | Ga0307408_100030751 | 3300031548 | Bacteria | 3731 |
| 627 | Ga0307408_100526236 | 3300031548 | Bacteria | 1039 |
| 628 | Ga0307408_100666880 | 3300031548 | Bacteria | 931 |
| 629 | Ga0307405_10081664 | 3300031731 | Bacteria | 2113 |
| 630 | Ga0307405_10177726 | 3300031731 | Bacteria | 1525 |
| 631 | Ga0307405_10184596 | 3300031731 | Bacteria | 1500 |
| 632 | Ga0307405_10255564 | 3300031731 | Bacteria | 1306 |
| 633 | Ga0307405_10279681 | 3300031731 | Bacteria | 1255 |
| 634 | Ga0307405_10376730 | 3300031731 | Bacteria | 1103 |
| 635 | Ga0307405_10706175 | 3300031731 | Bacteria | 835 |
| 636 | Ga0307405_11156635 | 3300031731 | Bacteria | 667 |
| 637 | Ga0307413_10005227 | 3300031824 | Bacteria | 5759 |
| 638 | Ga0307413_10011429 | 3300031824 | Bacteria | 4365 |
| 639 | Ga0307413_10017225 | 3300031824 | Bacteria | 3758 |
| 640 | Ga0307413_10096088 | 3300031824 | Bacteria | 1944 |
| 641 | Ga0307413_10238620 | 3300031824 | Bacteria | 1340 |
| 642 | Ga0307413_10251893 | 3300031824 | Bacteria | 1310 |
| 643 | Ga0307413_10477770 | 3300031824 | Bacteria | 995 |
| 644 | Ga0307413_10523625 | 3300031824 | Bacteria | 956 |
| 645 | Ga0307413_10596503 | 3300031824 | Bacteria | 903 |
| 646 | Ga0307413_10751871 | 3300031824 | Bacteria | 815 |
| 647 | Ga0307413_10861096 | 3300031824 | Bacteria | 766 |
| 648 | Ga0307413_11250621 | 3300031824 | Bacteria | 647 |
| 649 | Ga0307410_10000171 | 3300031852 | Bacteria | 23683 |
| 650 | Ga0307410_10000714 | 3300031852 | Bacteria | 13891 |
| 651 | Ga0307410_10003256 | 3300031852 | Bacteria | 8107 |
| 652 | Ga0307410_10011673 | 3300031852 | Bacteria | 5037 |
| 653 | Ga0307410_10039894 | 3300031852 | Bacteria | 3086 |
| 654 | Ga0307410_10047498 | 3300031852 | Bacteria | 2869 |
| 655 | Ga0307410_10096242 | 3300031852 | Bacteria | 2112 |
| 656 | Ga0307410_10251093 | 3300031852 | Bacteria | 1375 |
| 657 | Ga0307410_10426779 | 3300031852 | Bacteria | 1076 |
| 658 | Ga0307410_10905519 | 3300031852 | Bacteria | 756 |
| 659 | Ga0307406_10026407 | 3300031901 | Bacteria | 3487 |
| 660 | Ga0307406_10062967 | 3300031901 | Bacteria | 2401 |
| 661 | Ga0307406_10091778 | 3300031901 | Bacteria | 2046 |
| 662 | Ga0307406_10138152 | 3300031901 | Bacteria | 1721 |
| 663 | Ga0307406_10144722 | 3300031901 | Bacteria | 1687 |
| 664 | Ga0307406_10198244 | 3300031901 | Bacteria | 1475 |
| 665 | Ga0307406_10237855 | 3300031901 | Bacteria | 1364 |
| 666 | Ga0307406_10369982 | 3300031901 | Bacteria | 1126 |
| 667 | Ga0307406_10407555 | 3300031901 | Bacteria | 1079 |
| 668 | Ga0307406_10513730 | 3300031901 | Bacteria | 973 |
| 669 | Ga0307406_10793752 | 3300031901 | Bacteria | 798 |
| 670 | Ga0307406_11499766 | 3300031901 | Bacteria | 593 |
| 671 | Ga0307407_10001776 | 3300031903 | Bacteria | 8057 |
| 672 | Ga0307407_10051911 | 3300031903 | Bacteria | 2352 |
| 673 | Ga0307407_10174451 | 3300031903 | Bacteria | 1419 |
| 674 | Ga0307407_10204977 | 3300031903 | Bacteria | 1324 |
| 675 | Ga0307407_10337107 | 3300031903 | Bacteria | 1063 |
| 676 | Ga0307407_10414531 | 3300031903 | Bacteria | 969 |
| 677 | Ga0307407_10417728 | 3300031903 | Bacteria | 966 |
| 678 | Ga0307412_10018619 | 3300031911 | Bacteria | 4184 |
| 679 | Ga0307412_10023079 | 3300031911 | Bacteria | 3824 |
| 680 | Ga0307412_10028656 | 3300031911 | Bacteria | 3487 |
| 681 | Ga0307412_10323097 | 3300031911 | Bacteria | 1228 |
| 682 | Ga0307412_10462975 | 3300031911 | Bacteria | 1047 |
| 683 | Ga0307412_10691674 | 3300031911 | Bacteria | 874 |
| 684 | Ga0307412_10872797 | 3300031911 | Bacteria | 786 |
| 685 | Ga0307409_100013575 | 3300031995 | Bacteria | 5251 |
| 686 | Ga0307409_100027063 | 3300031995 | Bacteria | 4057 |
| 687 | Ga0307409_100049902 | 3300031995 | Bacteria | 3193 |
| 688 | Ga0307409_100118712 | 3300031995 | Bacteria | 2234 |
| 689 | Ga0307409_100183598 | 3300031995 | Bacteria | 1854 |
| 690 | Ga0307409_100247933 | 3300031995 | Bacteria | 1626 |
| 691 | Ga0307409_100354109 | 3300031995 | Bacteria | 1386 |
| 692 | Ga0307409_100615236 | 3300031995 | Bacteria | 1075 |
| 693 | Ga0307409_100804946 | 3300031995 | Bacteria | 947 |
| 694 | Ga0307409_100871658 | 3300031995 | Bacteria | 912 |
| 695 | Ga0307409_101279147 | 3300031995 | Bacteria | 758 |
| 696 | Ga0307416_100066041 | 3300032002 | Bacteria | 2976 |
| 697 | Ga0307416_100139367 | 3300032002 | Bacteria | 2201 |
| 698 | Ga0307416_100310140 | 3300032002 | Bacteria | 1574 |
| 699 | Ga0307416_100327107 | 3300032002 | Bacteria | 1538 |
| 700 | Ga0307416_100343547 | 3300032002 | Bacteria | 1507 |
| 701 | Ga0307416_100808924 | 3300032002 | Bacteria | 1033 |
| 702 | Ga0307416_100814294 | 3300032002 | Bacteria | 1030 |
| 703 | Ga0307416_100967947 | 3300032002 | Bacteria | 953 |
| 704 | Ga0307416_101017378 | 3300032002 | Bacteria | 932 |
| 705 | Ga0307416_101169828 | 3300032002 | Bacteria | 874 |
| 706 | Ga0307416_101746907 | 3300032002 | Bacteria | 726 |
| 707 | Ga0307416_101942736 | 3300032002 | Bacteria | 691 |
| 708 | Ga0307416_102165352 | 3300032002 | Bacteria | 657 |
| 709 | Ga0307414_10000070 | 3300032004 | Bacteria | 96231 |
| 710 | Ga0307414_10005824 | 3300032004 | Bacteria | 6815 |
| 711 | Ga0307414_10025523 | 3300032004 | Bacteria | 3787 |
| 712 | Ga0307414_10029337 | 3300032004 | Bacteria | 3579 |
| 713 | Ga0307414_10089709 | 3300032004 | Bacteria | 2279 |
| 714 | Ga0307414_10097696 | 3300032004 | Bacteria | 2201 |
| 715 | Ga0307414_10187540 | 3300032004 | Bacteria | 1670 |
| 716 | Ga0307414_10280625 | 3300032004 | Bacteria | 1399 |
| 717 | Ga0307414_10337586 | 3300032004 | Bacteria | 1288 |
| 718 | Ga0307414_10406014 | 3300032004 | Bacteria | 1184 |
| 719 | Ga0307414_10554670 | 3300032004 | Bacteria | 1024 |
| 720 | Ga0307414_10573572 | 3300032004 | Bacteria | 1008 |
| 721 | Ga0307414_11443468 | 3300032004 | Bacteria | 640 |
| 722 | Ga0307411_10001039 | 3300032005 | Bacteria | 10736 |
| 723 | Ga0307411_10002793 | 3300032005 | Bacteria | 7861 |
| 724 | Ga0307411_10010109 | 3300032005 | Bacteria | 5009 |
| 725 | Ga0307411_10048286 | 3300032005 | Bacteria | 2758 |
| 726 | Ga0307411_10066476 | 3300032005 | Bacteria | 2422 |
| 727 | Ga0307411_10082801 | 3300032005 | Bacteria | 2214 |
| 728 | Ga0307411_10118736 | 3300032005 | Bacteria | 1908 |
| 729 | Ga0307411_10140883 | 3300032005 | Bacteria | 1778 |
| 730 | Ga0307411_10143600 | 3300032005 | Bacteria | 1763 |
| 731 | Ga0307411_10199142 | 3300032005 | Bacteria | 1536 |
| 732 | Ga0307411_10290861 | 3300032005 | Bacteria | 1305 |
| 733 | Ga0307411_10406056 | 3300032005 | Bacteria | 1127 |
| 734 | Ga0307411_10435721 | 3300032005 | Bacteria | 1092 |
| 735 | Ga0307411_10552820 | 3300032005 | Bacteria | 982 |
| 736 | Ga0307415_100063723 | 3300032126 | Bacteria | 2562 |
| 737 | Ga0307415_100146487 | 3300032126 | Bacteria | 1811 |
| 738 | Ga0307415_100249373 | 3300032126 | Bacteria | 1441 |
| 739 | Ga0307415_100479673 | 3300032126 | Bacteria | 1082 |
| 740 | Ga0307415_100853746 | 3300032126 | Bacteria | 835 |
| 741 | Ga0307415_101191142 | 3300032126 | Bacteria | 717 |
| 742 | Ga0373928_0079319 | 3300035084 | Bacteria | 825 |
| 743 | Ga0373945_0081564 | 3300035116 | Bacteria | 1240 |
| 744 | Ga0373954_0166962 | 3300035118 | Bacteria | 1077 |
| 745 | Ga0373956_0081265 | 3300035119 | Bacteria | 1487 |
| 746 | Ga0373960_0009951 | 3300035121 | Bacteria | 2314 |
| 747 | Ga0373955_0002343 | 3300035172 | Bacteria | 8255 |
| 748 | Ga0373942_0055009 | 3300035207 | Bacteria | 1126 |
| 749 | Ga0373935_0060866 | 3300035692 | Bacteria | 2416 |
| 750 | Ga0373927_0456006 | 3300035695 | Bacteria | 844 |
| 751 | Ga0373933_0219165 | 3300035724 | Bacteria | 1220 |
| 752 | Ga0373937_0013140 | 3300036401 | Bacteria | 7291 |
| 753 | Ga0373925_0033233 | 3300037068 | Bacteria | 3802 |
| 754 | Ga0395899_0071044 | 3300037312 | Bacteria | 2548 |
| 755 | Ga0395899_0082795 | 3300037312 | Bacteria | 2333 |
| 756 | Ga0395899_0285119 | 3300037312 | Bacteria | 1122 |
| 757 | Ga0395899_0319422 | 3300037312 | Bacteria | 1046 |
| 758 | Ga0395899_0383874 | 3300037312 | Bacteria | 933 |
| 759 | Ga0395900_0000530 | 3300037418 | Bacteria | 53919 |
| 760 | Ga0395900_0005218 | 3300037418 | Bacteria | 13629 |
| 761 | Ga0395900_0077026 | 3300037418 | Bacteria | 3426 |
| 762 | Ga0395900_0114158 | 3300037418 | Bacteria | 2772 |
| 763 | Ga0395900_0349808 | 3300037418 | Bacteria | 1451 |
| 764 | Ga0395900_0358049 | 3300037418 | Bacteria | 1431 |
| 765 | Ga0395900_0999911 | 3300037418 | Bacteria | 756 |
| 766 | Ga0395900_1243184 | 3300037418 | Bacteria | 659 |
| 767 | Ga0395898_0049804 | 3300037466 | Bacteria | 4103 |
| 768 | Ga0395898_0197677 | 3300037466 | Bacteria | 1920 |
| 769 | Ga0395898_0699830 | 3300037466 | Bacteria | 955 |
| 770 | Ga0395898_0783112 | 3300037466 | Bacteria | 894 |
| 771 | Ga0395905_0001285 | 3300037471 | Bacteria | 30925 |
| 772 | Ga0395905_0011013 | 3300037471 | Bacteria | 8751 |
| 773 | Ga0395905_0022072 | 3300037471 | Bacteria | 6021 |
| 774 | Ga0395905_0028153 | 3300037471 | Bacteria | 5296 |
| 775 | Ga0395905_0133063 | 3300037471 | Bacteria | 2339 |
| 776 | Ga0395905_0273127 | 3300037471 | Bacteria | 1576 |
| 777 | Ga0395905_0293259 | 3300037471 | Bacteria | 1513 |
| 778 | Ga0395905_0346302 | 3300037471 | Bacteria | 1377 |
| 779 | Ga0395905_0355367 | 3300037471 | Bacteria | 1357 |
| 780 | Ga0395905_1073163 | 3300037471 | Bacteria | 708 |
| 781 | Ga0395905_1130855 | 3300037471 | Bacteria | 686 |
| 782 | Ga0436364_0986946 | 3300037853 | Bacteria | 208509 |
| 783 | Ga0395901_0001493 | 3300038443 | Bacteria | 24325 |
| 784 | Ga0395901_0002214 | 3300038443 | Bacteria | 19825 |
| 785 | Ga0395901_0012559 | 3300038443 | Bacteria | 8595 |
| 786 | Ga0395901_0043255 | 3300038443 | Bacteria | 4673 |
| 787 | Ga0395901_0085433 | 3300038443 | Bacteria | 3299 |
| 788 | Ga0395901_0207392 | 3300038443 | Bacteria | 2052 |
| 789 | Ga0395901_0283402 | 3300038443 | Bacteria | 1721 |
| 790 | Ga0395901_0285656 | 3300038443 | Bacteria | 1713 |
| 791 | Ga0395901_0360187 | 3300038443 | Bacteria | 1500 |
| 792 | Ga0395901_0399999 | 3300038443 | Bacteria | 1411 |
| 793 | Ga0395901_0928287 | 3300038443 | Bacteria | 850 |
| 794 | Ga0395901_1204279 | 3300038443 | Bacteria | 723 |
| 795 | Ga0395901_1268889 | 3300038443 | Bacteria | 700 |
| 796 | Ga0237819_02700 | 3300038705 | Bacteria | 3428 |
| 797 | Ga0237816_03377 | 3300039145 | Bacteria | 1172 |
| 798 | Ga0436365_0309933 | 3300039437 | Bacteria | 3193 |
| 799 | Ga0436365_1077224 | 3300039437 | Bacteria | 2291 |
| 800 | Ga0439439_0046363 | 3300041406 | Bacteria | 1135 |
| 801 | Ga0439453_0075515 | 3300041408 | Bacteria | 719 |
| 802 | Ga0439461_0011930 | 3300041410 | Bacteria | 1619 |
| 803 | Ga0439465_0003226 | 3300041413 | Bacteria | 5320 |
| 804 | Ga0439465_0043772 | 3300041413 | Bacteria | 1453 |
| 805 | Ga0439431_0000173 | 3300041997 | Bacteria | 12361 |
| 806 | Ga0439437_025904 | 3300042000 | Bacteria | 724 |
| 807 | Ga0439442_004433 | 3300042002 | Bacteria | 2789 |
| 808 | Ga0439445_0000243 | 3300042004 | Bacteria | 10302 |
| 809 | Ga0439445_0000812 | 3300042004 | Bacteria | 6582 |
| 810 | Ga0439448_0003857 | 3300042005 | Bacteria | 4194 |
| 811 | Ga0439446_0050764 | 3300042156 | Bacteria | 1238 |
| 812 | Ga0439458_0024488 | 3300042157 | Bacteria | 1411 |
| 813 | Ga0439434_0002056 | 3300042435 | Bacteria | 5816 |
| 814 | Ga0439435_0027753 | 3300042436 | Bacteria | 1517 |
| 815 | Ga0466969_0236731 | 3300044656 | Bacteria | 829 |
| 816 | Ga0466969_0251425 | 3300044656 | Bacteria | 801 |
| 817 | Ga0466966_0035830 | 3300044684 | Bacteria | 3205 |
| 818 | Ga0466961_0039764 | 3300044693 | Bacteria | 3014 |
| 819 | Ga0466961_0088685 | 3300044693 | Bacteria | 1954 |
| 820 | Ga0466961_0098840 | 3300044693 | Bacteria | 1840 |
| 821 | Ga0466963_0038902 | 3300044694 | Bacteria | 3113 |
| 822 | Ga0466963_0148953 | 3300044694 | Bacteria | 1624 |
| 823 | Ga0466963_0526717 | 3300044694 | Bacteria | 834 |
| 824 | Ga0466963_0723809 | 3300044694 | Bacteria | 702 |
| 825 | Ga0466957_0005363 | 3300044842 | Bacteria | 7197 |
| 826 | Ga0466957_0082355 | 3300044842 | Bacteria | 2006 |
| 827 | Ga0466957_0213041 | 3300044842 | Bacteria | 1273 |
| 828 | Ga0466957_0535453 | 3300044842 | Bacteria | 815 |
| 829 | Ga0466957_0559442 | 3300044842 | Bacteria | 797 |
| 830 | Ga0466959_0053738 | 3300045049 | Bacteria | 2944 |
| 831 | Ga0466959_0079949 | 3300045049 | Bacteria | 2357 |
| 832 | Ga0466959_0574090 | 3300045049 | Bacteria | 759 |
| 833 | Ga0466958_0052142 | 3300045836 | Bacteria | 2479 |
| 834 | Ga0466958_0078077 | 3300045836 | Bacteria | 2034 |
| 835 | Ga0466967_0020236 | 3300045976 | Bacteria | 5373 |
| 836 | Ga0466967_0114012 | 3300045976 | Bacteria | 2488 |
| 837 | Ga0466967_0269427 | 3300045976 | Bacteria | 1631 |
| 838 | Ga0466967_0704415 | 3300045976 | Bacteria | 1000 |
| 839 | Ga0466967_0958256 | 3300045976 | Bacteria | 851 |
| 840 | Ga0495627_000459 | 3300046453 | Bacteria | 35376 |
| 841 | Ga0495584_0009212 | 3300046491 | Bacteria | 5091 |
| 842 | Ga0495585_0012251 | 3300046492 | Bacteria | 5052 |
| 843 | Ga0495632_0026424 | 3300046519 | Bacteria | 3056 |
| 844 | Ga0495643_0003241 | 3300046522 | Bacteria | 12056 |
| 845 | Ga0495648_0282321 | 3300046524 | Bacteria | 786 |
| 846 | Ga0495642_0015044 | 3300046528 | Bacteria | 3004 |
| 847 | Ga0495642_0179917 | 3300046528 | Bacteria | 920 |
| 848 | Ga0495621_0003173 | 3300046539 | Bacteria | 4503 |
| 849 | Ga0495621_0008245 | 3300046539 | Bacteria | 3117 |
| 850 | Ga0495621_0087584 | 3300046539 | Bacteria | 1169 |
| 851 | Ga0495621_0178644 | 3300046539 | Bacteria | 846 |
| 852 | Ga0495633_0060359 | 3300046558 | Bacteria | 1777 |
| 853 | Ga0495668_0015140 | 3300046616 | Bacteria | 4510 |
| 854 | Ga0495668_0046817 | 3300046616 | Bacteria | 2402 |
| 855 | Ga0495625_0000936 | 3300046660 | Bacteria | 39185 |
| 856 | Ga0495625_0009545 | 3300046660 | Bacteria | 8105 |
| 857 | Ga0495659_0057924 | 3300046664 | Bacteria | 1424 |
| 858 | Ga0495669_0013865 | 3300046684 | Bacteria | 3440 |
| 859 | Ga0495670_0116035 | 3300046691 | Bacteria | 1388 |
| 860 | Ga0495670_0255562 | 3300046691 | Bacteria | 934 |
| 861 | Ga0495677_0003064 | 3300047445 | Bacteria | 6498 |
| 862 | Ga0495686_0001794 | 3300047472 | Bacteria | 21743 |
| 863 | Ga0495602_0029261 | 3300048088 | Bacteria | 5251 |
| 864 | Ga0496100_0275118 | 3300048903 | Bacteria | 1253 |
| 865 | Ga0496100_0897532 | 3300048903 | Bacteria | 696 |
| 866 | Ga0496101_0275504 | 3300048904 | Bacteria | 1314 |
| 867 | Ga0496103_0000845 | 3300048906 | Bacteria | 22406 |
| 868 | Ga0496104_0159246 | 3300048907 | Bacteria | 2166 |
| 869 | Ga0496105_0199747 | 3300048908 | Bacteria | 1632 |
| 870 | Ga0496106_0427811 | 3300048909 | Bacteria | 1064 |
| 871 | Ga0496107_0096609 | 3300048910 | Bacteria | 2162 |
| 872 | Ga0496107_0651174 | 3300048910 | Bacteria | 777 |
| 873 | Ga0496108_0823506 | 3300048911 | Bacteria | 800 |
| 874 | Ga0496109_0299371 | 3300048912 | Bacteria | 1516 |
| 875 | Ga0496109_0701222 | 3300048912 | Bacteria | 950 |
| 876 | Ga0496109_0769235 | 3300048912 | Bacteria | 901 |
| 877 | Ga0496110_0847415 | 3300048913 | Bacteria | 819 |
| 878 | Ga0496111_0513647 | 3300048914 | Bacteria | 881 |
| 879 | Ga0496112_0291079 | 3300048915 | Bacteria | 1579 |
| 880 | Ga0496114_0000023 | 3300048917 | Bacteria | 219092 |
| 881 | Ga0496114_0003594 | 3300048917 | Bacteria | 11915 |
| 882 | Ga0496115_0186991 | 3300048918 | Bacteria | 1712 |
| 883 | Ga0496116_0023413 | 3300048919 | Bacteria | 4600 |
| 884 | Ga0496116_0070792 | 3300048919 | Bacteria | 2212 |
| 885 | Ga0496117_0012001 | 3300048920 | Bacteria | 7696 |
| 886 | Ga0496117_0347519 | 3300048920 | Bacteria | 767 |
| 887 | Ga0496118_0072196 | 3300048921 | Bacteria | 2480 |
| 888 | Ga0496121_0001586 | 3300048924 | Bacteria | 37825 |
| 889 | Ga0496121_0444627 | 3300048924 | Bacteria | 837 |
| 890 | Ga0496123_0138980 | 3300048926 | Bacteria | 1331 |
| 891 | Ga0496124_0013815 | 3300048927 | Bacteria | 7853 |
| 892 | Ga0501306_028879 | 3300049127 | Bacteria | 815 |
| 893 | Ga0501308_006973 | 3300049128 | Bacteria | 1173 |
| 894 | Ga0501309_032742 | 3300049129 | Bacteria | 772 |
| 895 | Ga0495678_056299 | 3300049459 | Bacteria | 1496 |
| 896 | Ga0501312_039374 | 3300049528 | Bacteria | 768 |
| 897 | Ga0501312_100428 | 3300049528 | Bacteria | 542 |
| 898 | Ga0501315_010886 | 3300049531 | Bacteria | 1102 |
| 899 | Ga0501324_010942 | 3300049540 | Bacteria | 833 |
| 900 | Ga0501031_0100697 | 3300049568 | Bacteria | 1885 |
| 901 | Ga0501032_0007617 | 3300049569 | Bacteria | 7897 |
| 902 | Ga0501033_0011285 | 3300049570 | Bacteria | 6840 |
| 903 | Ga0501033_0047406 | 3300049570 | Bacteria | 3195 |
| 904 | Ga0501034_0124569 | 3300049571 | Bacteria | 2562 |
| 905 | Ga0501034_0254305 | 3300049571 | Bacteria | 1701 |
| 906 | Ga0501036_0052934 | 3300049572 | Bacteria | 3437 |
| 907 | Ga0501037_0022098 | 3300049573 | Bacteria | 4707 |
| 908 | Ga0501039_0108807 | 3300049575 | Bacteria | 2166 |
| 909 | Ga0501039_0231692 | 3300049575 | Bacteria | 1452 |
| 910 | Ga0501039_1295760 | 3300049575 | Bacteria | 562 |
| 911 | Ga0501043_0087084 | 3300049579 | Bacteria | 2454 |
| 912 | Ga0501043_0580192 | 3300049579 | Bacteria | 830 |
| 913 | Ga0501046_0067285 | 3300049580 | Bacteria | 2790 |
| 914 | Ga0501047_0118418 | 3300049581 | Bacteria | 2530 |
| 915 | Ga0501047_0613345 | 3300049581 | Bacteria | 909 |
| 916 | Ga0501070_0060865 | 3300049586 | Bacteria | 3129 |
| 917 | Ga0501074_0479843 | 3300049590 | Bacteria | 881 |
| 918 | Ga0501223_010894 | 3300049663 | Bacteria | 1826 |
| 919 | Ga0501035_0005503 | 3300049822 | Bacteria | 11965 |
| 920 | Ga0501035_0325484 | 3300049822 | Bacteria | 1291 |
| 921 | Ga0501044_0006511 | 3300049823 | Bacteria | 12903 |
| 922 | Ga0501044_0334551 | 3300049823 | Bacteria | 1436 |
| 923 | Ga0501044_0645655 | 3300049823 | Bacteria | 948 |
| 924 | nmdc:mga06r32_4582_c1 | 3300050510 | Bacteria | 12394 |
| 925 | nmdc:mga06r32_472908_c1 | 3300050510 | Bacteria | 1232 |
| 926 | Ga0500641_0004071 | 3300053096 | Bacteria | 5161 |
| 927 | Ga0500618_054292 | 3300053125 | Bacteria | 904 |
| 928 | Ga0500658_0025713 | 3300053134 | Bacteria | 2263 |
| 929 | Ga0500559_0336235 | 3300053136 | Bacteria | 707 |
| 930 | Ga0500568_0001466 | 3300053139 | Bacteria | 15125 |
| 931 | Ga0500616_0022236 | 3300053153 | Bacteria | 3543 |
| 932 | Ga0587084_011320 | 3300059477 | Bacteria | 1187 |
| 933 | Ga0587070_029253 | 3300059491 | Bacteria | 987 |
| 934 | Ga0587073_0048839 | 3300059492 | Bacteria | 952 |
| 935 | Ga0587077_019801 | 3300059493 | Bacteria | 1176 |
| 936 | Ga0587086_013147 | 3300059507 | Bacteria | 1039 |
| 937 | Ga0587088_001796 | 3300059508 | Bacteria | 2307 |
| 938 | Ga0587090_013077 | 3300059510 | Bacteria | 1194 |
| 939 | Ga0587090_017019 | 3300059510 | Bacteria | 1093 |
| 940 | Ga0587090_018228 | 3300059510 | Bacteria | 1070 |
| 941 | Ga0587091_019636 | 3300059511 | Bacteria | 1164 |
| 942 | Ga0587094_010727 | 3300059513 | Bacteria | 1195 |
| 943 | Ga0587106_010692 | 3300059605 | Bacteria | 1195 |
| 944 | Ga0587125_006577 | 3300059607 | Bacteria | 1103 |
| 945 | Ga0587099_003514 | 3300059622 | Bacteria | 1305 |
| 946 | Ga0587101_009247 | 3300059623 | Bacteria | 1212 |
| 947 | Ga0587115_010896 | 3300059626 | Bacteria | 1139 |
| 948 | Ga0587128_008469 | 3300059630 | Bacteria | 1331 |
| 949 | Ga0587062_012097 | 3300059639 | Bacteria | 1101 |
| 950 | Ga0587069_013685 | 3300059642 | Bacteria | 1120 |
| 951 | Ga0587072_023667 | 3300059643 | Bacteria | 1105 |
| 952 | Ga0587075_013004 | 3300059644 | Bacteria | 1139 |
| 953 | Ga0587078_007611 | 3300059646 | Bacteria | 1201 |
| 954 | Ga0587079_020078 | 3300059647 | Bacteria | 1189 |
| 955 | Ga0587102_004406 | 3300059649 | Bacteria | 1201 |
| 956 | Ga0587110_003733 | 3300059654 | Bacteria | 1290 |
| 957 | Ga0587071_016598 | 3300060344 | Bacteria | 1305 |
| 958 | Ga0587071_028054 | 3300060344 | Bacteria | 1070 |
| 959 | Ga0587111_0025777 | 3300060346 | Bacteria | 1167 |
| 960 | Ga0587111_0032304 | 3300060346 | Bacteria | 1076 |
| 961 | Ga0587111_0054815 | 3300060346 | Bacteria | 890 |
| 962 | 2514589766 | 2513237351 | Bacteria | 6968952 |
| 963 | 2600201227 | 2599185354 | Bacteria | 4398675 |
| 964 | 2600225415 | 2599185359 | Bacteria | 4772316 |
| 965 | 2643834330 | 2643221563 | Bacteria | 4726935 |
| 966 | 2644055255 | 2643221608 | Bacteria | 4724829 |
| 967 | 2738710386 | 2738541275 | Bacteria | 4830863 |
| 968 | 2738848811 | 2738541301 | Bacteria | 4834102 |
| 969 | 2738864540 | 2738541304 | Bacteria | 4833665 |
| 970 | 2739297058 | 2738543022 | Bacteria | 4835059 |
| 971 | 2739358736 | 2738543033 | Bacteria | 4833336 |
| 972 | 2778126616 | 2775507255 | Bacteria | 3945731 |
| 973 | 2819551044 | 2818991438 | Bacteria | 5793701 |
| 974 | 2819713727 | 2818991466 | Bacteria | 4748179 |
| 975 | 2830079226 | 2830075706 | Bacteria | 3855215 |
| 976 | 2852654322 | 2852653556 | Bacteria | 4050083 |
| 977 | 2852684248 | 2852680915 | Bacteria | 4100189 |
| 978 | 2879166947 | 2879163058 | Bacteria | 4223965 |
| 979 | 2885429955 | 2885429604 | Bacteria | 3642894 |
| 980 | 2928027938 | 2928027323 | Bacteria | 4382488 |
| 981 | 2928100484 | 2928100450 | Bacteria | 4837635 |
| 982 | 2928960548 | 2928959182 | Bacteria | 4725774 |
| 983 | 2928969883 | 2928968154 | Bacteria | 4633371 |
| 984 | 2984558685 | 2984555340 | Bacteria | 4247089 |
| 985 | 2984566812 | 2984564862 | Bacteria | 4339992 |
| 986 | 2993357997 | 2993356040 | Bacteria | 4247105 |
| 987 | 8057101923 | 8057101203 | Bacteria | 5034064 |
| 988 | Ga0207680_10014195 | |||
| 989 | JGI24736J21556_1003734 | |||
| 990 | JGI24741J21665_1001830 | |||
| 991 | JGI24741J21665_1004391 | |||
| 992 | JGI24752J21851_1000513 | |||
| 993 | JGI24740J21852_10005440 | |||
| 994 | JGI24740J21852_10009791 | |||
| 995 | JGI24739J22299_10003657 | |||
| 996 | JGI24739J22299_10005383 | |||
| 997 | JGI24739J22299_10009938 | |||
| 998 | JGI24739J22299_10012840 | |||
| 999 | JGI24737J22298_10001271 | |||
| 1000 | JGI24737J22298_10002912 | |||
| 1001 | JGI24737J22298_10009792 | |||
| 1002 | JGI24735J21928_10000660 | |||
| 1003 | JGI24735J21928_10001758 | |||
| 1004 | JGI24735J21928_10004561 | |||
| 1005 | JGI24735J21928_10012094 | |||
| 1006 | JGI24735J21928_10018039 | |||
| 1007 | JGI24750J21931_1000683 | |||
| 1008 | JGI24748J21848_1000097 | |||
| 1009 | JGI24738J21930_10002354 | |||
| 1010 | JGI24738J21930_10003267 | |||
| 1011 | JGI24749J21850_1002384 | |||
| 1012 | JGI24034J26672_10000060 | |||
| 1013 | JGI24742J22300_10002857 | |||
| 1014 | JGI24751J29686_10050051 | |||
| 1015 | JGI25153J46596_10000119 | |||
| 1016 | Ga0055525_1000070 | |||
| 1017 | Ga0055542_1000851 | |||
| 1018 | Ga0055542_1005577 | |||
| 1019 | Ga0055529_1000520 | |||
| 1020 | Ga0055536_1007886 | |||
| 1021 | Ga0055536_1016223 | |||
| 1022 | Ga0055530_10000439 | |||
| 1023 | Ga0055531_10001489 | |||
| 1024 | Ga0055531_10009036 | |||
| 1025 | Ga0065712_10343166 | |||
| 1026 | Ga0065715_10000371 | |||
| 1027 | Ga0065715_10244864 | |||
| 1028 | Ga0070658_10000260 | |||
| 1029 | Ga0070658_10003994 | |||
| 1030 | Ga0070658_10006053 | |||
| 1031 | Ga0070658_10030280 | |||
| 1032 | Ga0070658_10038119 | |||
| 1033 | Ga0070658_10061547 | |||
| 1034 | Ga0070658_10091140 | |||
| 1035 | Ga0070658_10100004 | |||
| 1036 | Ga0070658_10183892 | |||
| 1037 | Ga0070676_10017837 | |||
| 1038 | Ga0070683_100001172 | |||
| 1039 | Ga0070683_100012447 | |||
| 1040 | Ga0070683_100121427 | |||
| 1041 | Ga0070683_100136450 | |||
| 1042 | Ga0070683_100843792 | |||
| 1043 | Ga0070690_100000338 | |||
| 1044 | Ga0070690_100003699 | |||
| 1045 | Ga0070670_100003815 | |||
| 1046 | Ga0070670_100009337 | |||
| 1047 | Ga0070670_100020739 | |||
| 1048 | Ga0070670_100039742 | |||
| 1049 | Ga0070670_100045964 | |||
| 1050 | Ga0070670_100051871 | |||
| 1051 | Ga0070670_100180876 | |||
| 1052 | Ga0070670_100323451 | |||
| 1053 | Ga0070670_100357062 | |||
| 1054 | Ga0070670_100481894 | |||
| 1055 | Ga0070677_10030570 | |||
| 1056 | Ga0070677_10128195 | |||
| 1057 | Ga0068869_100249383 | |||
| 1058 | Ga0070666_10000069 | |||
| 1059 | Ga0070666_10000864 | |||
| 1060 | Ga0070666_10040196 | |||
| 1061 | Ga0070680_100000214 | |||
| 1062 | Ga0070680_100001291 | |||
| 1063 | Ga0070680_100005688 | |||
| 1064 | Ga0070680_100109545 | |||
| 1065 | Ga0068868_100003747 | |||
| 1066 | Ga0070660_100012070 | |||
| 1067 | Ga0070660_100030281 | |||
| 1068 | Ga0070660_100038076 | |||
| 1069 | Ga0070660_100038599 | |||
| 1070 | Ga0070660_100093272 | |||
| 1071 | Ga0070660_100101560 | |||
| 1072 | Ga0070660_100130554 | |||
| 1073 | Ga0070660_100190464 | |||
| 1074 | Ga0070660_100200999 | |||
| 1075 | Ga0070660_100289490 | |||
| 1076 | Ga0070660_100392622 | |||
| 1077 | Ga0070660_100811013 | |||
| 1078 | Ga0070689_100119603 | |||
| 1079 | Ga0070661_100000439 | |||
| 1080 | Ga0070661_100005256 | |||
| 1081 | Ga0070661_100277354 | |||
| 1082 | Ga0070661_100283179 | |||
| 1083 | Ga0070661_100450033 | |||
| 1084 | Ga0070661_100743615 | |||
| 1085 | Ga0070668_100000008 | |||
| 1086 | Ga0070668_100007591 | |||
| 1087 | Ga0070668_100020865 | |||
| 1088 | Ga0070668_100049232 | |||
| 1089 | Ga0070668_100199898 | |||
| 1090 | Ga0070669_100000167 | |||
| 1091 | Ga0070669_100012384 | |||
| 1092 | Ga0070669_100185277 | |||
| 1093 | Ga0070675_100005044 | |||
| 1094 | Ga0070675_100147880 | |||
| 1095 | Ga0070671_100001745 | |||
| 1096 | Ga0070671_100005913 | |||
| 1097 | Ga0070671_100024458 | |||
| 1098 | Ga0070671_100074951 | |||
| 1099 | Ga0070671_100077123 | |||
| 1100 | Ga0070671_100165826 | |||
| 1101 | Ga0070674_100010846 | |||
| 1102 | Ga0070674_100015654 | |||
| 1103 | Ga0070674_100022676 | |||
| 1104 | Ga0070673_100057122 | |||
| 1105 | Ga0070673_100824393 | |||
| 1106 | Ga0070688_100001826 | |||
| 1107 | Ga0070659_100005599 | |||
| 1108 | Ga0070659_100005975 | |||
| 1109 | Ga0070659_100059047 | |||
| 1110 | Ga0070659_100276774 | |||
| 1111 | Ga0070659_100576985 | |||
| 1112 | Ga0070659_100820854 | |||
| 1113 | Ga0070667_100000003 | |||
| 1114 | Ga0070667_100001684 | |||
| 1115 | Ga0070667_100326347 | |||
| 1116 | Ga0070667_100904978 | |||
| 1117 | Ga0070714_100040209 | |||
| 1118 | Ga0070714_100897049 | |||
| 1119 | Ga0070713_100012412 | |||
| 1120 | Ga0070711_100035307 | |||
| 1121 | Ga0070663_100003238 | |||
| 1122 | Ga0070663_100008528 | |||
| 1123 | Ga0070663_100034465 | |||
| 1124 | Ga0070663_100051257 | |||
| 1125 | Ga0070663_100052392 | |||
| 1126 | Ga0070663_100155576 | |||
| 1127 | Ga0070663_100170152 | |||
| 1128 | Ga0070678_100010264 | |||
| 1129 | Ga0070678_100275473 | |||
| 1130 | Ga0070662_100000010 | |||
| 1131 | Ga0070662_100057251 | |||
| 1132 | Ga0070662_100066063 | |||
| 1133 | Ga0070662_100072968 | |||
| 1134 | Ga0070662_100078162 | |||
| 1135 | Ga0070662_100131182 | |||
| 1136 | Ga0070681_10019376 | |||
| 1137 | Ga0070681_10027639 | |||
| 1138 | Ga0070681_10033340 | |||
| 1139 | Ga0070681_10230276 | |||
| 1140 | Ga0070681_11340563 | |||
| 1141 | Ga0068867_100112159 | |||
| 1142 | Ga0070685_10000036 | |||
| 1143 | Ga0070684_100121829 | |||
| 1144 | Ga0070684_100124631 | |||
| 1145 | Ga0070684_100135556 | |||
| 1146 | Ga0070684_100139018 | |||
| 1147 | Ga0068853_100000396 | |||
| 1148 | Ga0068853_100008993 | |||
| 1149 | Ga0068853_100014321 | |||
| 1150 | Ga0068853_100032220 | |||
| 1151 | Ga0068853_100043193 | |||
| 1152 | Ga0068853_100055351 | |||
| 1153 | Ga0068853_100119686 | |||
| 1154 | Ga0068853_100224704 | |||
| 1155 | Ga0068853_100390259 | |||
| 1156 | Ga0068853_100936963 | |||
| 1157 | Ga0068853_100949430 | |||
| 1158 | Ga0070686_100000045 | |||
| 1159 | Ga0070695_100351387 | |||
| 1160 | Ga0070696_100916339 | |||
| 1161 | Ga0070665_100000021 | |||
| 1162 | Ga0070665_100000042 | |||
| 1163 | Ga0070665_100000736 | |||
| 1164 | Ga0070665_100070742 | |||
| 1165 | Ga0068855_100001099 | |||
| 1166 | Ga0068855_100020835 | |||
| 1167 | Ga0068855_100078784 | |||
| 1168 | Ga0068855_100129623 | |||
| 1169 | Ga0068855_100352297 | |||
| 1170 | Ga0068855_101094019 | |||
| 1171 | Ga0068855_101149205 | |||
| 1172 | Ga0070664_100000103 | |||
| 1173 | Ga0070664_100013075 | |||
| 1174 | Ga0070664_100037446 | |||
| 1175 | Ga0070664_100040560 | |||
| 1176 | Ga0070664_100086408 | |||
| 1177 | Ga0070664_100097913 | |||
| 1178 | Ga0070664_100488724 | |||
| 1179 | Ga0070664_100834576 | |||
| 1180 | Ga0068857_100025650 | |||
| 1181 | Ga0068857_100026615 | |||
| 1182 | Ga0068857_100047101 | |||
| 1183 | Ga0068857_100126580 | |||
| 1184 | Ga0068857_100167466 | |||
| 1185 | Ga0068857_100349310 | |||
| 1186 | Ga0068857_100437383 | |||
| 1187 | Ga0068854_100010204 | |||
| 1188 | Ga0068854_100037927 | |||
| 1189 | Ga0068854_100057613 | |||
| 1190 | Ga0068854_100071990 | |||
| 1191 | Ga0068854_100091284 | |||
| 1192 | Ga0068854_100099837 | |||
| 1193 | Ga0068854_100164250 | |||
| 1194 | Ga0068854_100179862 | |||
| 1195 | Ga0068854_100247276 | |||
| 1196 | Ga0068854_100253342 | |||
| 1197 | Ga0068856_100000101 | |||
| 1198 | Ga0068856_100023054 | |||
| 1199 | Ga0068856_100108127 | |||
| 1200 | Ga0068856_100503090 | |||
| 1201 | Ga0068852_100001412 | |||
| 1202 | Ga0068852_100011679 | |||
| 1203 | Ga0068852_100332454 | |||
| 1204 | Ga0068852_100380602 | |||
| 1205 | Ga0068852_100536918 | |||
| 1206 | Ga0068852_100730729 | |||
| 1207 | Ga0068859_100013033 | |||
| 1208 | Ga0068859_100013138 | |||
| 1209 | Ga0068859_100643218 | |||
| 1210 | Ga0068864_100058119 | |||
| 1211 | Ga0068864_100195361 | |||
| 1212 | Ga0068861_100000107 | |||
| 1213 | Ga0068861_100010533 | |||
| 1214 | Ga0068861_100012293 | |||
| 1215 | Ga0068861_100031809 | |||
| 1216 | Ga0068851_10037677 | |||
| 1217 | Ga0068851_10120463 | |||
| 1218 | Ga0068863_100000239 | |||
| 1219 | Ga0068863_100062483 | |||
| 1220 | Ga0068863_100309029 | |||
| 1221 | Ga0068858_100000278 | |||
| 1222 | Ga0068858_100002704 | |||
| 1223 | Ga0068858_100016556 | |||
| 1224 | Ga0068858_100140436 | |||
| 1225 | Ga0068858_100140629 | |||
| 1226 | Ga0068860_100000045 | |||
| 1227 | Ga0068860_100000182 | |||
| 1228 | Ga0068860_100369824 | |||
| 1229 | Ga0068862_100000392 | |||
| 1230 | Ga0068862_100000449 | |||
| 1231 | Ga0068862_100957338 | |||
| 1232 | Ga0081455_10000255 | |||
| 1233 | Ga0081540_1076880 | |||
| 1234 | Ga0081539_10016957 | |||
| 1235 | Ga0070717_10028421 | |||
| 1236 | Ga0070712_100101508 | |||
| 1237 | Ga0097621_100238033 | |||
| 1238 | Ga0075431_100009423 | |||
| 1239 | Ga0068865_100067416 | |||
| 1240 | Ga0097620_100007709 | |||
| 1241 | Ga0097620_100013033 | |||
| 1242 | Ga0097620_100013138 | |||
| 1243 | Ga0097620_100643145 | |||
| 1244 | Ga0097620_100870428 | |||
| 1245 | Ga0079104_1056582 | |||
| 1246 | Ga0105240_10023057 | |||
| 1247 | Ga0105240_10152102 | |||
| 1248 | Ga0105240_10583831 | |||
| 1249 | Ga0105240_10984858 | |||
| 1250 | Ga0105247_10226231 | |||
| 1251 | Ga0105243_10012004 | |||
| 1252 | Ga0105243_11049821 | |||
| 1253 | Ga0105241_10006002 | |||
| 1254 | Ga0105241_10370644 | |||
| 1255 | Ga0105241_11051295 | |||
| 1256 | Ga0105248_10000673 | |||
| 1257 | Ga0105248_10000724 | |||
| 1258 | Ga0105248_10001313 | |||
| 1259 | Ga0105248_10084221 | |||
| 1260 | Ga0105248_12208234 | |||
| 1261 | Ga0105237_10009564 | |||
| 1262 | Ga0105237_10038909 | |||
| 1263 | Ga0105237_10106593 | |||
| 1264 | Ga0105237_10167956 | |||
| 1265 | Ga0105237_10481592 | |||
| 1266 | Ga0105238_10020941 | |||
| 1267 | Ga0105238_10126698 | |||
| 1268 | Ga0105238_10134649 | |||
| 1269 | Ga0105238_10430396 | |||
| 1270 | Ga0105249_10000012 | |||
| 1271 | Ga0105249_10050993 | |||
| 1272 | Ga0105249_10065199 | |||
| 1273 | Ga0105239_10188762 | |||
| 1274 | Ga0105239_10921035 | |||
| 1275 | Ga0105239_11200179 | |||
| 1276 | Ga0105239_12297840 | |||
| 1277 | Ga0157373_10018538 | |||
| 1278 | Ga0157373_10061596 | |||
| 1279 | Ga0157373_10204315 | |||
| 1280 | Ga0157373_10229877 | |||
| 1281 | Ga0157373_10279604 | |||
| 1282 | Ga0157371_10000793 | |||
| 1283 | Ga0157371_10003868 | |||
| 1284 | Ga0157371_10012085 | |||
| 1285 | Ga0157371_10034354 | |||
| 1286 | Ga0157371_10308274 | |||
| 1287 | Ga0157370_10048689 | |||
| 1288 | Ga0157370_10065873 | |||
| 1289 | Ga0157370_10941543 | |||
| 1290 | Ga0157369_10013876 | |||
| 1291 | Ga0157369_10027781 | |||
| 1292 | Ga0157369_10090726 | |||
| 1293 | Ga0157369_10160087 | |||
| 1294 | Ga0157369_10260929 | |||
| 1295 | Ga0157369_10544464 | |||
| 1296 | Ga0157369_10802314 | |||
| 1297 | Ga0157374_10009179 | |||
| 1298 | Ga0157374_10192844 | |||
| 1299 | Ga0163162_10672205 | |||
| 1300 | Ga0163162_11143820 | |||
| 1301 | Ga0157372_10029659 | |||
| 1302 | Ga0157372_10043572 | |||
| 1303 | Ga0157372_10054730 | |||
| 1304 | Ga0157372_10137761 | |||
| 1305 | Ga0157372_10202905 | |||
| 1306 | Ga0157372_10414911 | |||
| 1307 | Ga0157372_10473246 | |||
| 1308 | Ga0157372_10636137 | |||
| 1309 | Ga0157372_11164737 | |||
| 1310 | Ga0157375_10072291 | |||
| 1311 | Ga0157375_11949409 | |||
| 1312 | Ga0163163_10000580 | |||
| 1313 | Ga0163163_10446996 | |||
| 1314 | Ga0163163_10647595 | |||
| 1315 | Ga0157380_10003947 | |||
| 1316 | Ga0157380_10019291 | |||
| 1317 | Ga0157380_10347308 | |||
| 1318 | Ga0157380_10765458 | |||
| 1319 | Ga0157379_10001908 | |||
| 1320 | Ga0183363_1008 | |||
| 1321 | Ga0163161_10000202 | |||
| 1322 | Ga0163161_10023353 | |||
| 1323 | Ga0163161_10024583 | |||
| 1324 | Ga0163161_10689802 | |||
| 1325 | Ga0197907_10010936 | |||
| 1326 | Ga0206356_10680400 | |||
| 1327 | Ga0206353_11575149 | |||
| 1328 | Ga0213875_10001046 | |||
| 1329 | Ga0224712_10125141 | |||
| 1330 | Ga0209147_100446 | |||
| 1331 | Ga0209563_100053 | |||
| 1332 | Ga0207425_1000146 | |||
| 1333 | Ga0209646_1022374 | |||
| 1334 | Ga0209677_106508 | |||
| 1335 | Ga0209148_1000061 | |||
| 1336 | Ga0209148_1000159 | |||
| 1337 | Ga0209129_1003315 | |||
| 1338 | Ga0209233_1006578 | |||
| 1339 | Ga0209565_1021095 | |||
| 1340 | Ga0209455_1000045 | |||
| 1341 | Ga0209675_1000075 | |||
| 1342 | Ga0209676_1000081 | |||
| 1343 | Ga0209676_1000554 | |||
| 1344 | Ga0209025_1000431 | |||
| 1345 | Ga0209025_1018162 | |||
| 1346 | Ga0209564_1000437 | |||
| 1347 | Ga0209758_1000002 | |||
| 1348 | Ga0209758_1000328 | |||
| 1349 | Ga0209050_1000017 | |||
| 1350 | Ga0209050_1000474 | |||
| 1351 | Ga0209050_1023196 | |||
| 1352 | Ga0209050_1024209 | |||
| 1353 | Ga0209257_1000206 | |||
| 1354 | Ga0209257_1000456 | |||
| 1355 | Ga0207697_10000725 | |||
| 1356 | Ga0207656_10000858 | |||
| 1357 | Ga0207656_10028534 | |||
| 1358 | Ga0207656_10101812 | |||
| 1359 | Ga0207682_10000649 | |||
| 1360 | Ga0207680_10000012 | |||
| 1361 | Ga0207680_10035968 | |||
| 1362 | Ga0207647_10001900 | |||
| 1363 | Ga0207647_10030536 | |||
| 1364 | Ga0207647_10047167 | |||
| 1365 | Ga0207647_10083436 | |||
| 1366 | Ga0207647_10094886 | |||
| 1367 | Ga0207647_10158003 | |||
| 1368 | Ga0207647_10614692 | |||
| 1369 | Ga0207699_10670858 | |||
| 1370 | Ga0207645_10020635 | |||
| 1371 | Ga0207645_10123752 | |||
| 1372 | Ga0207643_10202943 | |||
| 1373 | Ga0207643_10249079 | |||
| 1374 | Ga0207705_10000025 | |||
| 1375 | Ga0207705_10000113 | |||
| 1376 | Ga0207705_10000309 | |||
| 1377 | Ga0207705_10005374 | |||
| 1378 | Ga0207705_10020922 | |||
| 1379 | Ga0207705_10056282 | |||
| 1380 | Ga0207705_10065548 | |||
| 1381 | Ga0207705_10109930 | |||
| 1382 | Ga0207705_10114144 | |||
| 1383 | Ga0207705_10132887 | |||
| 1384 | Ga0207705_10135073 | |||
| 1385 | Ga0207654_10000363 | |||
| 1386 | Ga0207654_10001493 | |||
| 1387 | Ga0207654_10205995 | |||
| 1388 | Ga0207654_10471698 | |||
| 1389 | Ga0207707_10782054 | |||
| 1390 | Ga0207695_10009402 | |||
| 1391 | Ga0207695_10009881 | |||
| 1392 | Ga0207695_10020497 | |||
| 1393 | Ga0207695_10105002 | |||
| 1394 | Ga0207695_10125638 | |||
| 1395 | Ga0207671_10000358 | |||
| 1396 | Ga0207671_10008227 | |||
| 1397 | Ga0207671_10033078 | |||
| 1398 | Ga0207693_10003170 | |||
| 1399 | Ga0207663_10074248 | |||
| 1400 | Ga0207660_10000186 | |||
| 1401 | Ga0207660_10001468 | |||
| 1402 | Ga0207660_10007711 | |||
| 1403 | Ga0207660_10017028 | |||
| 1404 | Ga0207657_10000026 | |||
| 1405 | Ga0207657_10003075 | |||
| 1406 | Ga0207657_10008938 | |||
| 1407 | Ga0207657_10009815 | |||
| 1408 | Ga0207657_10016201 | |||
| 1409 | Ga0207657_10020388 | |||
| 1410 | Ga0207657_10030743 | |||
| 1411 | Ga0207657_10091390 | |||
| 1412 | Ga0207657_10092054 | |||
| 1413 | Ga0207657_10096733 | |||
| 1414 | Ga0207657_10134231 | |||
| 1415 | Ga0207657_10146278 | |||
| 1416 | Ga0207649_10000228 | |||
| 1417 | Ga0207649_10000594 | |||
| 1418 | Ga0207649_10002596 | |||
| 1419 | Ga0207649_10029009 | |||
| 1420 | Ga0207649_10038867 | |||
| 1421 | Ga0207649_10040236 | |||
| 1422 | Ga0207649_10379584 | |||
| 1423 | Ga0207649_10467803 | |||
| 1424 | Ga0207649_10665470 | |||
| 1425 | Ga0207652_10006821 | |||
| 1426 | Ga0207681_10000076 | |||
| 1427 | Ga0207681_10009875 | |||
| 1428 | Ga0207681_10046204 | |||
| 1429 | Ga0207681_10363601 | |||
| 1430 | Ga0207681_10778803 | |||
| 1431 | Ga0207694_10000667 | |||
| 1432 | Ga0207694_10006827 | |||
| 1433 | Ga0207694_10020884 | |||
| 1434 | Ga0207694_10036529 | |||
| 1435 | Ga0207694_10103449 | |||
| 1436 | Ga0207650_10001585 | |||
| 1437 | Ga0207650_10009316 | |||
| 1438 | Ga0207650_10046015 | |||
| 1439 | Ga0207650_10091162 | |||
| 1440 | Ga0207650_10118898 | |||
| 1441 | Ga0207650_10120719 | |||
| 1442 | Ga0207650_10437949 | |||
| 1443 | Ga0207650_11253445 | |||
| 1444 | Ga0207659_10014152 | |||
| 1445 | Ga0207659_10380499 | |||
| 1446 | Ga0207700_10130869 | |||
| 1447 | Ga0207664_10158040 | |||
| 1448 | Ga0207664_10681097 | |||
| 1449 | Ga0207644_10000254 | |||
| 1450 | Ga0207644_10000294 | |||
| 1451 | Ga0207644_10009075 | |||
| 1452 | Ga0207644_10029626 | |||
| 1453 | Ga0207644_10259739 | |||
| 1454 | Ga0207644_10292533 | |||
| 1455 | Ga0207690_10000036 | |||
| 1456 | Ga0207690_10000498 | |||
| 1457 | Ga0207690_10001936 | |||
| 1458 | Ga0207690_10294300 | |||
| 1459 | Ga0207690_10516791 | |||
| 1460 | Ga0207706_10000031 | |||
| 1461 | Ga0207706_10000463 | |||
| 1462 | Ga0207706_10004389 | |||
| 1463 | Ga0207706_10009977 | |||
| 1464 | Ga0207706_10090465 | |||
| 1465 | Ga0207706_10192208 | |||
| 1466 | Ga0207706_10193626 | |||
| 1467 | Ga0207706_10266948 | |||
| 1468 | Ga0207706_10379599 | |||
| 1469 | Ga0207706_10448117 | |||
| 1470 | Ga0207709_10000047 | |||
| 1471 | Ga0207709_10366903 | |||
| 1472 | Ga0207670_10091254 | |||
| 1473 | Ga0207670_10489015 | |||
| 1474 | Ga0207669_10001404 | |||
| 1475 | Ga0207669_10003273 | |||
| 1476 | Ga0207669_10139472 | |||
| 1477 | Ga0207669_10445601 | |||
| 1478 | Ga0207704_10421232 | |||
| 1479 | Ga0207704_11201969 | |||
| 1480 | Ga0207691_10043137 | |||
| 1481 | Ga0207691_10481158 | |||
| 1482 | Ga0207711_10000956 | |||
| 1483 | Ga0207711_10002871 | |||
| 1484 | Ga0207711_10031665 | |||
| 1485 | Ga0207711_10037874 | |||
| 1486 | Ga0207711_10154777 | |||
| 1487 | Ga0207711_10416481 | |||
| 1488 | Ga0207689_10037163 | |||
| 1489 | Ga0207661_10001385 | |||
| 1490 | Ga0207661_10014727 | |||
| 1491 | Ga0207661_10048274 | |||
| 1492 | Ga0207661_10188262 | |||
| 1493 | Ga0207679_10000093 | |||
| 1494 | Ga0207679_10011706 | |||
| 1495 | Ga0207679_10040198 | |||
| 1496 | Ga0207679_10112459 | |||
| 1497 | Ga0207679_10145871 | |||
| 1498 | Ga0207679_10262225 | |||
| 1499 | Ga0207679_10744536 | |||
| 1500 | Ga0207667_10000001 | |||
| 1501 | Ga0207667_10003819 | |||
| 1502 | Ga0207667_10008760 | |||
| 1503 | Ga0207667_10016498 | |||
| 1504 | Ga0207667_10116955 | |||
| 1505 | Ga0207667_10479282 | |||
| 1506 | Ga0207667_10930824 | |||
| 1507 | Ga0207667_11089459 | |||
| 1508 | Ga0207667_11208576 | |||
| 1509 | Ga0207712_10000021 | |||
| 1510 | Ga0207712_10015715 | |||
| 1511 | Ga0207712_10133053 | |||
| 1512 | Ga0207668_10000480 | |||
| 1513 | Ga0207668_10046466 | |||
| 1514 | Ga0207668_10154101 | |||
| 1515 | Ga0207668_10340755 | |||
| 1516 | Ga0207640_10003839 | |||
| 1517 | Ga0207640_10010560 | |||
| 1518 | Ga0207640_10025944 | |||
| 1519 | Ga0207640_10028754 | |||
| 1520 | Ga0207640_10095869 | |||
| 1521 | Ga0207640_10111622 | |||
| 1522 | Ga0207640_10391295 | |||
| 1523 | Ga0207640_10455623 | |||
| 1524 | Ga0207640_10546706 | |||
| 1525 | Ga0207640_11098012 | |||
| 1526 | Ga0207658_10000002 | |||
| 1527 | Ga0207658_10000936 | |||
| 1528 | Ga0207658_10003747 | |||
| 1529 | Ga0207658_10053655 | |||
| 1530 | Ga0207658_10376411 | |||
| 1531 | Ga0207677_10120313 | |||
| 1532 | Ga0207703_10000587 | |||
| 1533 | Ga0207703_10004856 | |||
| 1534 | Ga0207703_10008434 | |||
| 1535 | Ga0207703_10106943 | |||
| 1536 | Ga0207639_10001448 | |||
| 1537 | Ga0207639_10002653 | |||
| 1538 | Ga0207639_10002879 | |||
| 1539 | Ga0207639_10017154 | |||
| 1540 | Ga0207639_10024716 | |||
| 1541 | Ga0207639_10037183 | |||
| 1542 | Ga0207639_10051214 | |||
| 1543 | Ga0207639_10161027 | |||
| 1544 | Ga0207639_10818689 | |||
| 1545 | Ga0207678_10008204 | |||
| 1546 | Ga0207678_10011522 | |||
| 1547 | Ga0207678_10011562 | |||
| 1548 | Ga0207678_10017323 | |||
| 1549 | Ga0207678_10079060 | |||
| 1550 | Ga0207678_10094520 | |||
| 1551 | Ga0207678_10097402 | |||
| 1552 | Ga0207678_10137527 | |||
| 1553 | Ga0207708_10166878 | |||
| 1554 | Ga0207708_10359911 | |||
| 1555 | Ga0207702_10000353 | |||
| 1556 | Ga0207702_10000963 | |||
| 1557 | Ga0207702_10003254 | |||
| 1558 | Ga0207702_10031113 | |||
| 1559 | Ga0207702_10436237 | |||
| 1560 | Ga0207641_10000589 | |||
| 1561 | Ga0207641_10017753 | |||
| 1562 | Ga0207641_10207702 | |||
| 1563 | Ga0207648_10079457 | |||
| 1564 | Ga0207648_10359804 | |||
| 1565 | Ga0207648_11142938 | |||
| 1566 | Ga0207676_10000921 | |||
| 1567 | Ga0207676_10036689 | |||
| 1568 | Ga0207674_10009710 | |||
| 1569 | Ga0207674_10015944 | |||
| 1570 | Ga0207674_10018633 | |||
| 1571 | Ga0207674_10108795 | |||
| 1572 | Ga0207674_10124858 | |||
| 1573 | Ga0207674_10185300 | |||
| 1574 | Ga0207674_10324607 | |||
| 1575 | Ga0207674_10584636 | |||
| 1576 | Ga0207674_10961208 | |||
| 1577 | Ga0207675_100000317 | |||
| 1578 | Ga0207675_100003402 | |||
| 1579 | Ga0207675_100020505 | |||
| 1580 | Ga0207675_100046136 | |||
| 1581 | Ga0207683_10498428 | |||
| 1582 | Ga0207698_10001652 | |||
| 1583 | Ga0207698_10003330 | |||
| 1584 | Ga0207698_10003733 | |||
| 1585 | Ga0207698_10008213 | |||
| 1586 | Ga0207698_10011430 | |||
| 1587 | Ga0207698_10027408 | |||
| 1588 | Ga0207698_10055506 | |||
| 1589 | Ga0207698_10174954 | |||
| 1590 | Ga0207698_10237893 | |||
| 1591 | Ga0207698_10370511 | |||
| 1592 | Ga0207698_10515516 | |||
| 1593 | Ga0209281_1044830 | |||
| 1594 | Ga0209968_1051459 | |||
| 1595 | Ga0209970_1013435 | |||
| 1596 | Ga0209983_1044476 | |||
| 1597 | Ga0209974_10003691 | |||
| 1598 | Ga0209974_10004663 | |||
| 1599 | Ga0209974_10076568 | |||
| 1600 | Ga0268266_10000015 | |||
| 1601 | Ga0268266_10000054 | |||
| 1602 | Ga0268266_10000370 | |||
| 1603 | Ga0268266_10026889 | |||
| 1604 | Ga0268266_10720543 | |||
| 1605 | Ga0268265_10000278 | |||
| 1606 | Ga0268265_10000684 | |||
| 1607 | Ga0268265_10087634 | |||
| 1608 | Ga0268265_10267811 | |||
| 1609 | Ga0268264_10000074 | |||
| 1610 | Ga0268264_10000101 | |||
| 1611 | Ga0268264_10250794 | |||
| 1612 | Ga0265325_10040778 | |||
| 1613 | Ga0307408_100030751 | |||
| 1614 | Ga0307408_100526236 | |||
| 1615 | Ga0307408_100666880 | |||
| 1616 | Ga0307405_10081664 | |||
| 1617 | Ga0307405_10177726 | |||
| 1618 | Ga0307405_10184596 | |||
| 1619 | Ga0307405_10255564 | |||
| 1620 | Ga0307405_10279681 | |||
| 1621 | Ga0307405_10376730 | |||
| 1622 | Ga0307405_10706175 | |||
| 1623 | Ga0307405_11156635 | |||
| 1624 | Ga0307413_10005227 | |||
| 1625 | Ga0307413_10011429 | |||
| 1626 | Ga0307413_10017225 | |||
| 1627 | Ga0307413_10096088 | |||
| 1628 | Ga0307413_10238620 | |||
| 1629 | Ga0307413_10251893 | |||
| 1630 | Ga0307413_10477770 | |||
| 1631 | Ga0307413_10523625 | |||
| 1632 | Ga0307413_10596503 | |||
| 1633 | Ga0307413_10751871 | |||
| 1634 | Ga0307413_10861096 | |||
| 1635 | Ga0307413_11250621 | |||
| 1636 | Ga0307410_10000171 | |||
| 1637 | Ga0307410_10000714 | |||
| 1638 | Ga0307410_10003256 | |||
| 1639 | Ga0307410_10011673 | |||
| 1640 | Ga0307410_10039894 | |||
| 1641 | Ga0307410_10047498 | |||
| 1642 | Ga0307410_10096242 | |||
| 1643 | Ga0307410_10251093 | |||
| 1644 | Ga0307410_10426779 | |||
| 1645 | Ga0307410_10905519 | |||
| 1646 | Ga0307406_10026407 | |||
| 1647 | Ga0307406_10062967 | |||
| 1648 | Ga0307406_10091778 | |||
| 1649 | Ga0307406_10138152 | |||
| 1650 | Ga0307406_10144722 | |||
| 1651 | Ga0307406_10198244 | |||
| 1652 | Ga0307406_10237855 | |||
| 1653 | Ga0307406_10369982 | |||
| 1654 | Ga0307406_10407555 | |||
| 1655 | Ga0307406_10513730 | |||
| 1656 | Ga0307406_10793752 | |||
| 1657 | Ga0307406_11499766 | |||
| 1658 | Ga0307407_10001776 | |||
| 1659 | Ga0307407_10051911 | |||
| 1660 | Ga0307407_10174451 | |||
| 1661 | Ga0307407_10204977 | |||
| 1662 | Ga0307407_10337107 | |||
| 1663 | Ga0307407_10414531 | |||
| 1664 | Ga0307407_10417728 | |||
| 1665 | Ga0307412_10018619 | |||
| 1666 | Ga0307412_10023079 | |||
| 1667 | Ga0307412_10028656 | |||
| 1668 | Ga0307412_10323097 | |||
| 1669 | Ga0307412_10462975 | |||
| 1670 | Ga0307412_10691674 | |||
| 1671 | Ga0307412_10872797 | |||
| 1672 | Ga0307409_100013575 | |||
| 1673 | Ga0307409_100027063 | |||
| 1674 | Ga0307409_100049902 | |||
| 1675 | Ga0307409_100118712 | |||
| 1676 | Ga0307409_100183598 | |||
| 1677 | Ga0307409_100247933 | |||
| 1678 | Ga0307409_100354109 | |||
| 1679 | Ga0307409_100615236 | |||
| 1680 | Ga0307409_100804946 | |||
| 1681 | Ga0307409_100871658 | |||
| 1682 | Ga0307409_101279147 | |||
| 1683 | Ga0307416_100066041 | |||
| 1684 | Ga0307416_100139367 | |||
| 1685 | Ga0307416_100310140 | |||
| 1686 | Ga0307416_100327107 | |||
| 1687 | Ga0307416_100343547 | |||
| 1688 | Ga0307416_100808924 | |||
| 1689 | Ga0307416_100814294 | |||
| 1690 | Ga0307416_100967947 | |||
| 1691 | Ga0307416_101017378 | |||
| 1692 | Ga0307416_101169828 | |||
| 1693 | Ga0307416_101746907 | |||
| 1694 | Ga0307416_101942736 | |||
| 1695 | Ga0307416_102165352 | |||
| 1696 | Ga0307414_10000070 | |||
| 1697 | Ga0307414_10005824 | |||
| 1698 | Ga0307414_10025523 | |||
| 1699 | Ga0307414_10029337 | |||
| 1700 | Ga0307414_10089709 | |||
| 1701 | Ga0307414_10097696 | |||
| 1702 | Ga0307414_10187540 | |||
| 1703 | Ga0307414_10280625 | |||
| 1704 | Ga0307414_10337586 | |||
| 1705 | Ga0307414_10406014 | |||
| 1706 | Ga0307414_10554670 | |||
| 1707 | Ga0307414_10573572 | |||
| 1708 | Ga0307414_11443468 | |||
| 1709 | Ga0307411_10001039 | |||
| 1710 | Ga0307411_10002793 | |||
| 1711 | Ga0307411_10010109 | |||
| 1712 | Ga0307411_10048286 | |||
| 1713 | Ga0307411_10066476 | |||
| 1714 | Ga0307411_10082801 | |||
| 1715 | Ga0307411_10118736 | |||
| 1716 | Ga0307411_10140883 | |||
| 1717 | Ga0307411_10143600 | |||
| 1718 | Ga0307411_10199142 | |||
| 1719 | Ga0307411_10290861 | |||
| 1720 | Ga0307411_10406056 | |||
| 1721 | Ga0307411_10435721 | |||
| 1722 | Ga0307411_10552820 | |||
| 1723 | Ga0307415_100063723 | |||
| 1724 | Ga0307415_100146487 | |||
| 1725 | Ga0307415_100249373 | |||
| 1726 | Ga0307415_100479673 | |||
| 1727 | Ga0307415_100853746 | |||
| 1728 | Ga0307415_101191142 | |||
| 1729 | Ga0373928_0079319 | |||
| 1730 | Ga0373945_0081564 | |||
| 1731 | Ga0373954_0166962 | |||
| 1732 | Ga0373956_0081265 | |||
| 1733 | Ga0373960_0009951 | |||
| 1734 | Ga0373955_0002343 | |||
| 1735 | Ga0373942_0055009 | |||
| 1736 | Ga0373935_0060866 | |||
| 1737 | Ga0373927_0456006 | |||
| 1738 | Ga0373933_0219165 | |||
| 1739 | Ga0373937_0013140 | |||
| 1740 | Ga0373925_0033233 | |||
| 1741 | Ga0395899_0071044 | |||
| 1742 | Ga0395899_0082795 | |||
| 1743 | Ga0395899_0285119 | |||
| 1744 | Ga0395899_0319422 | |||
| 1745 | Ga0395899_0383874 | |||
| 1746 | Ga0395900_0000530 | |||
| 1747 | Ga0395900_0005218 | |||
| 1748 | Ga0395900_0077026 | |||
| 1749 | Ga0395900_0114158 | |||
| 1750 | Ga0395900_0349808 | |||
| 1751 | Ga0395900_0358049 | |||
| 1752 | Ga0395900_0999911 | |||
| 1753 | Ga0395900_1243184 | |||
| 1754 | Ga0395898_0049804 | |||
| 1755 | Ga0395898_0197677 | |||
| 1756 | Ga0395898_0699830 | |||
| 1757 | Ga0395898_0783112 | |||
| 1758 | Ga0395905_0001285 | |||
| 1759 | Ga0395905_0011013 | |||
| 1760 | Ga0395905_0022072 | |||
| 1761 | Ga0395905_0028153 | |||
| 1762 | Ga0395905_0133063 | |||
| 1763 | Ga0395905_0273127 | |||
| 1764 | Ga0395905_0293259 | |||
| 1765 | Ga0395905_0346302 | |||
| 1766 | Ga0395905_0355367 | |||
| 1767 | Ga0395905_1073163 | |||
| 1768 | Ga0395905_1130855 | |||
| 1769 | Ga0436364_0986946 | |||
| 1770 | Ga0395901_0001493 | |||
| 1771 | Ga0395901_0002214 | |||
| 1772 | Ga0395901_0012559 | |||
| 1773 | Ga0395901_0043255 | |||
| 1774 | Ga0395901_0085433 | |||
| 1775 | Ga0395901_0207392 | |||
| 1776 | Ga0395901_0283402 | |||
| 1777 | Ga0395901_0285656 | |||
| 1778 | Ga0395901_0360187 | |||
| 1779 | Ga0395901_0399999 | |||
| 1780 | Ga0395901_0928287 | |||
| 1781 | Ga0395901_1204279 | |||
| 1782 | Ga0395901_1268889 | |||
| 1783 | Ga0237819_02700 | |||
| 1784 | Ga0237816_03377 | |||
| 1785 | Ga0436365_0309933 | |||
| 1786 | Ga0436365_1077224 | |||
| 1787 | Ga0439439_0046363 | |||
| 1788 | Ga0439453_0075515 | |||
| 1789 | Ga0439461_0011930 | |||
| 1790 | Ga0439465_0003226 | |||
| 1791 | Ga0439465_0043772 | |||
| 1792 | Ga0439431_0000173 | |||
| 1793 | Ga0439437_025904 | |||
| 1794 | Ga0439442_004433 | |||
| 1795 | Ga0439445_0000243 | |||
| 1796 | Ga0439445_0000812 | |||
| 1797 | Ga0439448_0003857 | |||
| 1798 | Ga0439446_0050764 | |||
| 1799 | Ga0439458_0024488 | |||
| 1800 | Ga0439434_0002056 | |||
| 1801 | Ga0439435_0027753 | |||
| 1802 | Ga0466969_0236731 | |||
| 1803 | Ga0466969_0251425 | |||
| 1804 | Ga0466966_0035830 | |||
| 1805 | Ga0466961_0039764 | |||
| 1806 | Ga0466961_0088685 | |||
| 1807 | Ga0466961_0098840 | |||
| 1808 | Ga0466963_0038902 | |||
| 1809 | Ga0466963_0148953 | |||
| 1810 | Ga0466963_0526717 | |||
| 1811 | Ga0466963_0723809 | |||
| 1812 | Ga0466957_0005363 | |||
| 1813 | Ga0466957_0082355 | |||
| 1814 | Ga0466957_0213041 | |||
| 1815 | Ga0466957_0535453 | |||
| 1816 | Ga0466957_0559442 | |||
| 1817 | Ga0466959_0053738 | |||
| 1818 | Ga0466959_0079949 | |||
| 1819 | Ga0466959_0574090 | |||
| 1820 | Ga0466958_0052142 | |||
| 1821 | Ga0466958_0078077 | |||
| 1822 | Ga0466967_0020236 | |||
| 1823 | Ga0466967_0114012 | |||
| 1824 | Ga0466967_0269427 | |||
| 1825 | Ga0466967_0704415 | |||
| 1826 | Ga0466967_0958256 | |||
| 1827 | Ga0495627_000459 | |||
| 1828 | Ga0495584_0009212 | |||
| 1829 | Ga0495585_0012251 | |||
| 1830 | Ga0495632_0026424 | |||
| 1831 | Ga0495643_0003241 | |||
| 1832 | Ga0495648_0282321 | |||
| 1833 | Ga0495642_0015044 | |||
| 1834 | Ga0495642_0179917 | |||
| 1835 | Ga0495621_0003173 | |||
| 1836 | Ga0495621_0008245 | |||
| 1837 | Ga0495621_0087584 | |||
| 1838 | Ga0495621_0178644 | |||
| 1839 | Ga0495633_0060359 | |||
| 1840 | Ga0495668_0015140 | |||
| 1841 | Ga0495668_0046817 | |||
| 1842 | Ga0495625_0000936 | |||
| 1843 | Ga0495625_0009545 | |||
| 1844 | Ga0495659_0057924 | |||
| 1845 | Ga0495669_0013865 | |||
| 1846 | Ga0495670_0116035 | |||
| 1847 | Ga0495670_0255562 | |||
| 1848 | Ga0495677_0003064 | |||
| 1849 | Ga0495686_0001794 | |||
| 1850 | Ga0495602_0029261 | |||
| 1851 | Ga0496100_0275118 | |||
| 1852 | Ga0496100_0897532 | |||
| 1853 | Ga0496101_0275504 | |||
| 1854 | Ga0496103_0000845 | |||
| 1855 | Ga0496104_0159246 | |||
| 1856 | Ga0496105_0199747 | |||
| 1857 | Ga0496106_0427811 | |||
| 1858 | Ga0496107_0096609 | |||
| 1859 | Ga0496107_0651174 | |||
| 1860 | Ga0496108_0823506 | |||
| 1861 | Ga0496109_0299371 | |||
| 1862 | Ga0496109_0701222 | |||
| 1863 | Ga0496109_0769235 | |||
| 1864 | Ga0496110_0847415 | |||
| 1865 | Ga0496111_0513647 | |||
| 1866 | Ga0496112_0291079 | |||
| 1867 | Ga0496114_0000023 | |||
| 1868 | Ga0496114_0003594 | |||
| 1869 | Ga0496115_0186991 | |||
| 1870 | Ga0496116_0023413 | |||
| 1871 | Ga0496116_0070792 | |||
| 1872 | Ga0496117_0012001 | |||
| 1873 | Ga0496117_0347519 | |||
| 1874 | Ga0496118_0072196 | |||
| 1875 | Ga0496121_0001586 | |||
| 1876 | Ga0496121_0444627 | |||
| 1877 | Ga0496123_0138980 | |||
| 1878 | Ga0496124_0013815 | |||
| 1879 | Ga0501306_028879 | |||
| 1880 | Ga0501308_006973 | |||
| 1881 | Ga0501309_032742 | |||
| 1882 | Ga0495678_056299 | |||
| 1883 | Ga0501312_039374 | |||
| 1884 | Ga0501312_100428 | |||
| 1885 | Ga0501315_010886 | |||
| 1886 | Ga0501324_010942 | |||
| 1887 | Ga0501031_0100697 | |||
| 1888 | Ga0501032_0007617 | |||
| 1889 | Ga0501033_0011285 | |||
| 1890 | Ga0501033_0047406 | |||
| 1891 | Ga0501034_0124569 | |||
| 1892 | Ga0501034_0254305 | |||
| 1893 | Ga0501036_0052934 | |||
| 1894 | Ga0501037_0022098 | |||
| 1895 | Ga0501039_0108807 | |||
| 1896 | Ga0501039_0231692 | |||
| 1897 | Ga0501039_1295760 | |||
| 1898 | Ga0501043_0087084 | |||
| 1899 | Ga0501043_0580192 | |||
| 1900 | Ga0501046_0067285 | |||
| 1901 | Ga0501047_0118418 | |||
| 1902 | Ga0501047_0613345 | |||
| 1903 | Ga0501070_0060865 | |||
| 1904 | Ga0501074_0479843 | |||
| 1905 | Ga0501223_010894 | |||
| 1906 | Ga0501035_0005503 | |||
| 1907 | Ga0501035_0325484 | |||
| 1908 | Ga0501044_0006511 | |||
| 1909 | Ga0501044_0334551 | |||
| 1910 | Ga0501044_0645655 | |||
| 1911 | nmdc:mga06r32_4582_c1 | |||
| 1912 | nmdc:mga06r32_472908_c1 | |||
| 1913 | Ga0500641_0004071 | |||
| 1914 | Ga0500618_054292 | |||
| 1915 | Ga0500658_0025713 | |||
| 1916 | Ga0500559_0336235 | |||
| 1917 | Ga0500568_0001466 | |||
| 1918 | Ga0500616_0022236 | |||
| 1919 | Ga0587084_011320 | |||
| 1920 | Ga0587070_029253 | |||
| 1921 | Ga0587073_0048839 | |||
| 1922 | Ga0587077_019801 | |||
| 1923 | Ga0587086_013147 | |||
| 1924 | Ga0587088_001796 | |||
| 1925 | Ga0587090_013077 | |||
| 1926 | Ga0587090_017019 | |||
| 1927 | Ga0587090_018228 | |||
| 1928 | Ga0587091_019636 | |||
| 1929 | Ga0587094_010727 | |||
| 1930 | Ga0587106_010692 | |||
| 1931 | Ga0587125_006577 | |||
| 1932 | Ga0587099_003514 | |||
| 1933 | Ga0587101_009247 | |||
| 1934 | Ga0587115_010896 | |||
| 1935 | Ga0587128_008469 | |||
| 1936 | Ga0587062_012097 | |||
| 1937 | Ga0587069_013685 | |||
| 1938 | Ga0587072_023667 | |||
| 1939 | Ga0587075_013004 | |||
| 1940 | Ga0587078_007611 | |||
| 1941 | Ga0587079_020078 | |||
| 1942 | Ga0587102_004406 | |||
| 1943 | Ga0587110_003733 | |||
| 1944 | Ga0587071_016598 | |||
| 1945 | Ga0587071_028054 | |||
| 1946 | Ga0587111_0025777 | |||
| 1947 | Ga0587111_0032304 | |||
| 1948 | Ga0587111_0054815 | |||
| 1949 | 2514589766 | |||
| 1950 | 2600201227 | |||
| 1951 | 2600225415 | |||
| 1952 | 2643834330 | |||
| 1953 | 2644055255 | |||
| 1954 | 2738710386 | |||
| 1955 | 2738848811 | |||
| 1956 | 2738864540 | |||
| 1957 | 2739297058 | |||
| 1958 | 2739358736 | |||
| 1959 | 2778126616 | |||
| 1960 | 2819551044 | |||
| 1961 | 2819713727 | |||
| 1962 | 2830079226 | |||
| 1963 | 2852654322 | |||
| 1964 | 2852684248 | |||
| 1965 | 2879166947 | |||
| 1966 | 2885429955 | |||
| 1967 | 2928027938 | |||
| 1968 | 2928100484 | |||
| 1969 | 2928960548 | |||
| 1970 | 2928969883 | |||
| 1971 | 2984558685 | |||
| 1972 | 2984566812 | |||
| 1973 | 2993357997 | |||
| 1974 | 8057101923 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7m4u-assembly1.cif.gz_i | a. baumannii ribosome-eravacycline complex: 30s | 0.9661 | 50 | 152 |
| 8d8k-assembly1.cif.gz_I | yeast mitochondrial small subunit assembly intermediate (state 2) | 0.9639 | 40 | 151 |
| 8d8l-assembly1.cif.gz_I | yeast mitochondrial small subunit assembly intermediate (state 3) | 0.9639 | 40 | 151 |
| 4v48-assembly1.cif.gz_BI | real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome | 0.9621 | 50 | 146 |
| 5mrf-assembly1.cif.gz_II | structure of the yeast mitochondrial ribosome - class c | 0.96 | 40 | 151 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54CK4_214_339_3.30.230.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.9758 | 50 | 151 | 3.30.230.10 |
| af_Q8IHZ4_170_300_3.30.230.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.9633 | 48 | 151 | 3.30.230.10 |
| af_P34388_249_392_3.30.230.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.9307 | 49 | 151 | 3.30.230.10 |
| af_O94150_208_336_3.30.230.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.8739 | 48 | 174 | 3.30.230.10 |
| af_O14006_146_271_3.30.230.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.864 | 50 | 174 | 3.30.230.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4V1SYB7-F1-model_v4 | deleted | 0.9923 | 42 | 138 |
|
| AF-A0A1F7B3Z8-F1-model_v4 | Small ribosomal subunit protein uS9 | 0.9876 | 49 | 152 |
GO:0003723
GO:0003735 GO:0006412 GO:0022627 |
| AF-A0A359E0W0-F1-model_v4 | Small ribosomal subunit protein uS9 (30S ribosomal protein S9) | 0.9875 | 49 | 151 |
GO:0003723
GO:0003735 GO:0006412 GO:0022627 |
| AF-A0A2E8BEA7-F1-model_v4 | 30S ribosomal protein S9 | 0.9866 | 51 | 150 |
GO:0003723
GO:0003735 GO:0005737 GO:0006412 GO:0015935 |
| AF-F4NVL8-F1-model_v4 | Small ribosomal subunit protein uS9m (37S ribosomal protein S9, mitochondrial) | 0.9841 | 44 | 152 |
GO:0003723
GO:0003735 GO:0005763 GO:0006412 |