F487546

General Info

Members Datasets Scaffolds Average Seq Length
987 363 1974 173

Family's Representative Sequence

Representative Sequence 3300025903|Ga0207680_10014195|Ga0207680_100141951
Length 202
Sequence MADKKSLSDLGELTNPKPETPAAPETVAEAPAEAAPASSNGHGRRGREEPVDDHGVSTQGPQIQAVLREQQLDKYGRAYATGRRKDAIARVWLKPGSGKIVINGREQEVYFARPTLRLVINQPFGVADREGQYDVVATVVGGGLSGQAGAVLHGIAQALTRYEPALRTAVKQAGFLTRDPRAVERKKYGRAKARRSFQFSKR

Samples

Sample ID Description Type Environment
1 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
15 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
49 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
112 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
116 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
117 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
120 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
121 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
126 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
185 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
196 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
197 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
198 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
199 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
200 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
203 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
204 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
205 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
206 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
207 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
208 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
209 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
212 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
214 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
215 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
218 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
219 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
220 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
221 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
222 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
223 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
224 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
225 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
226 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
227 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
228 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
229 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
230 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
231 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
232 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
233 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
234 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
235 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
236 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
237 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
238 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
239 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
240 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
241 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
242 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
243 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
244 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
245 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
246 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
247 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
248 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
249 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
250 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
251 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
252 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
253 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
254 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
255 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
256 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
257 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
258 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
259 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
260 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
261 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
262 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
263 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
264 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
265 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
266 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
267 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
268 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
269 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
270 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
271 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
272 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
275 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
276 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
277 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
278 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
279 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
280 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
281 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
282 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
283 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
284 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
288 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
302 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
303 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
304 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
306 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
307 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
308 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
309 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
310 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
311 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
312 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
313 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
339 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
340 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
341 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
342 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
343 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
344 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
345 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
346 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
347 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
348 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
349 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
350 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
351 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
352 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
353 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
354 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
355 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
356 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
357 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
358 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
359 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
360 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
361 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
362 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
363 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.21
Metatranscriptomes 4.15
Isolates 2.63

Biome Distribution

Category Percentage (%)
Aerial Root 0.3
Bulb 0
Endosphere 4.05
Nodule 0.3
Rhizoplane 2.13
Rhizosphere 90.37
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207680_10014195 3300025903 Bacteria 4114
2 JGI24736J21556_1003734 3300001904 Bacteria 2629
3 JGI24741J21665_1001830 3300001915 Bacteria 5817
4 JGI24741J21665_1004391 3300001915 Bacteria 3141
5 JGI24752J21851_1000513 3300001976 Bacteria 5186
6 JGI24740J21852_10005440 3300001979 Bacteria 5384
7 JGI24740J21852_10009791 3300001979 Bacteria 3730
8 JGI24739J22299_10003657 3300001989 Bacteria 5870
9 JGI24739J22299_10005383 3300001989 Bacteria 4870
10 JGI24739J22299_10009938 3300001989 Bacteria 3537
11 JGI24739J22299_10012840 3300001989 Bacteria 3068
12 JGI24737J22298_10001271 3300001990 Bacteria 8934
13 JGI24737J22298_10002912 3300001990 Bacteria 6068
14 JGI24737J22298_10009792 3300001990 Bacteria 3175
15 JGI24735J21928_10000660 3300002067 Bacteria 12211
16 JGI24735J21928_10001758 3300002067 Bacteria 7627
17 JGI24735J21928_10004561 3300002067 Bacteria 4652
18 JGI24735J21928_10012094 3300002067 Bacteria 2730
19 JGI24735J21928_10018039 3300002067 Bacteria 2178
20 JGI24750J21931_1000683 3300002070 Bacteria 4930
21 JGI24748J21848_1000097 3300002074 Bacteria 23021
22 JGI24738J21930_10002354 3300002075 Bacteria 4977
23 JGI24738J21930_10003267 3300002075 Bacteria 4124
24 JGI24749J21850_1002384 3300002076 Bacteria 2645
25 JGI24034J26672_10000060 3300002239 Bacteria 41095
26 JGI24742J22300_10002857 3300002244 Bacteria 2791
27 JGI24751J29686_10050051 3300002459 Bacteria 862
28 JGI25153J46596_10000119 3300003215 Bacteria 89604
29 Ga0055525_1000070 3300003759 Bacteria 183047
30 Ga0055542_1000851 3300003762 Bacteria 21391
31 Ga0055542_1005577 3300003762 Bacteria 2817
32 Ga0055529_1000520 3300003763 Bacteria 33667
33 Ga0055536_1007886 3300003781 Bacteria 4678
34 Ga0055536_1016223 3300003781 Bacteria 2501
35 Ga0055530_10000439 3300003791 Bacteria 36986
36 Ga0055531_10001489 3300003794 Bacteria 17211
37 Ga0055531_10009036 3300003794 Bacteria 5149
38 Ga0065712_10343166 3300005290 Bacteria 777
39 Ga0065715_10000371 3300005293 Bacteria 20233
40 Ga0065715_10244864 3300005293 Bacteria 1170
41 Ga0070658_10000260 3300005327 Bacteria 46341
42 Ga0070658_10003994 3300005327 Bacteria 12091
43 Ga0070658_10006053 3300005327 Bacteria 9810
44 Ga0070658_10030280 3300005327 Bacteria 4349
45 Ga0070658_10038119 3300005327 Bacteria 3876
46 Ga0070658_10061547 3300005327 Bacteria 3059
47 Ga0070658_10091140 3300005327 Bacteria 2512
48 Ga0070658_10100004 3300005327 Bacteria 2397
49 Ga0070658_10183892 3300005327 Bacteria 1759
50 Ga0070676_10017837 3300005328 Bacteria 3929
51 Ga0070683_100001172 3300005329 Bacteria 19853
52 Ga0070683_100012447 3300005329 Bacteria 7395
53 Ga0070683_100121427 3300005329 Bacteria 2468
54 Ga0070683_100136450 3300005329 Bacteria 2323
55 Ga0070683_100843792 3300005329 Bacteria 879
56 Ga0070690_100000338 3300005330 Bacteria 24029
57 Ga0070690_100003699 3300005330 Bacteria 8419
58 Ga0070670_100003815 3300005331 Bacteria 12558
59 Ga0070670_100009337 3300005331 Bacteria 8372
60 Ga0070670_100020739 3300005331 Bacteria 5651
61 Ga0070670_100039742 3300005331 Bacteria 4045
62 Ga0070670_100045964 3300005331 Bacteria 3754
63 Ga0070670_100051871 3300005331 Bacteria 3522
64 Ga0070670_100180876 3300005331 Bacteria 1831
65 Ga0070670_100323451 3300005331 Bacteria 1352
66 Ga0070670_100357062 3300005331 Bacteria 1284
67 Ga0070670_100481894 3300005331 Bacteria 1102
68 Ga0070677_10030570 3300005333 Bacteria 2051
69 Ga0070677_10128195 3300005333 Bacteria 1155
70 Ga0068869_100249383 3300005334 Bacteria 1417
71 Ga0070666_10000069 3300005335 Bacteria 75768
72 Ga0070666_10000864 3300005335 Bacteria 18346
73 Ga0070666_10040196 3300005335 Bacteria 3121
74 Ga0070680_100000214 3300005336 Bacteria 38156
75 Ga0070680_100001291 3300005336 Bacteria 18115
76 Ga0070680_100005688 3300005336 Bacteria 9454
77 Ga0070680_100109545 3300005336 Bacteria 2298
78 Ga0068868_100003747 3300005338 Bacteria 10618
79 Ga0070660_100012070 3300005339 Bacteria 6166
80 Ga0070660_100030281 3300005339 Bacteria 4060
81 Ga0070660_100038076 3300005339 Bacteria 3649
82 Ga0070660_100038599 3300005339 Bacteria 3626
83 Ga0070660_100093272 3300005339 Bacteria 2377
84 Ga0070660_100101560 3300005339 Bacteria 2279
85 Ga0070660_100130554 3300005339 Bacteria 2010
86 Ga0070660_100190464 3300005339 Bacteria 1661
87 Ga0070660_100200999 3300005339 Bacteria 1616
88 Ga0070660_100289490 3300005339 Bacteria 1341
89 Ga0070660_100392622 3300005339 Bacteria 1146
90 Ga0070660_100811013 3300005339 Bacteria 787
91 Ga0070689_100119603 3300005340 Bacteria 2103
92 Ga0070661_100000439 3300005344 Bacteria 31883
93 Ga0070661_100005256 3300005344 Bacteria 8915
94 Ga0070661_100277354 3300005344 Bacteria 1300
95 Ga0070661_100283179 3300005344 Bacteria 1286
96 Ga0070661_100450033 3300005344 Bacteria 1024
97 Ga0070661_100743615 3300005344 Bacteria 801
98 Ga0070668_100000008 3300005347 Bacteria 137948
99 Ga0070668_100007591 3300005347 Bacteria 8050
100 Ga0070668_100020865 3300005347 Bacteria 4949
101 Ga0070668_100049232 3300005347 Bacteria 3242
102 Ga0070668_100199898 3300005347 Bacteria 1641
103 Ga0070669_100000167 3300005353 Bacteria 57589
104 Ga0070669_100012384 3300005353 Bacteria 6049
105 Ga0070669_100185277 3300005353 Bacteria 1630
106 Ga0070675_100005044 3300005354 Bacteria 10077
107 Ga0070675_100147880 3300005354 Bacteria 2013
108 Ga0070671_100001745 3300005355 Bacteria 16513
109 Ga0070671_100005913 3300005355 Bacteria 9750
110 Ga0070671_100024458 3300005355 Bacteria 4944
111 Ga0070671_100074951 3300005355 Bacteria 2827
112 Ga0070671_100077123 3300005355 Bacteria 2785
113 Ga0070671_100165826 3300005355 Bacteria 1868
114 Ga0070674_100010846 3300005356 Bacteria 5527
115 Ga0070674_100015654 3300005356 Bacteria 4740
116 Ga0070674_100022676 3300005356 Bacteria 4051
117 Ga0070673_100057122 3300005364 Bacteria 3083
118 Ga0070673_100824393 3300005364 Bacteria 858
119 Ga0070688_100001826 3300005365 Bacteria 10687
120 Ga0070659_100005599 3300005366 Bacteria 9029
121 Ga0070659_100005975 3300005366 Bacteria 8778
122 Ga0070659_100059047 3300005366 Bacteria 3028
123 Ga0070659_100276774 3300005366 Bacteria 1395
124 Ga0070659_100576985 3300005366 Bacteria 965
125 Ga0070659_100820854 3300005366 Bacteria 809
126 Ga0070667_100000003 3300005367 Bacteria 447715
127 Ga0070667_100001684 3300005367 Bacteria 19770
128 Ga0070667_100326347 3300005367 Bacteria 1386
129 Ga0070667_100904978 3300005367 Bacteria 821
130 Ga0070714_100040209 3300005435 Bacteria 3940
131 Ga0070714_100897049 3300005435 Bacteria 861
132 Ga0070713_100012412 3300005436 Bacteria 6248
133 Ga0070711_100035307 3300005439 Bacteria 3341
134 Ga0070663_100003238 3300005455 Bacteria 9365
135 Ga0070663_100008528 3300005455 Bacteria 6310
136 Ga0070663_100034465 3300005455 Bacteria 3506
137 Ga0070663_100051257 3300005455 Bacteria 2939
138 Ga0070663_100052392 3300005455 Bacteria 2910
139 Ga0070663_100155576 3300005455 Bacteria 1756
140 Ga0070663_100170152 3300005455 Bacteria 1683
141 Ga0070678_100010264 3300005456 Bacteria 5713
142 Ga0070678_100275473 3300005456 Bacteria 1421
143 Ga0070662_100000010 3300005457 Bacteria 142717
144 Ga0070662_100057251 3300005457 Bacteria 2832
145 Ga0070662_100066063 3300005457 Bacteria 2653
146 Ga0070662_100072968 3300005457 Bacteria 2535
147 Ga0070662_100078162 3300005457 Bacteria 2457
148 Ga0070662_100131182 3300005457 Bacteria 1932
149 Ga0070681_10019376 3300005458 Bacteria 6808
150 Ga0070681_10027639 3300005458 Bacteria 5703
151 Ga0070681_10033340 3300005458 Bacteria 5170
152 Ga0070681_10230276 3300005458 Bacteria 1767
153 Ga0070681_11340563 3300005458 Bacteria 639
154 Ga0068867_100112159 3300005459 Bacteria 2096
155 Ga0070685_10000036 3300005466 Bacteria 80641
156 Ga0070684_100121829 3300005535 Bacteria 2346
157 Ga0070684_100124631 3300005535 Bacteria 2320
158 Ga0070684_100135556 3300005535 Bacteria 2224
159 Ga0070684_100139018 3300005535 Bacteria 2195
160 Ga0068853_100000396 3300005539 Bacteria 29782
161 Ga0068853_100008993 3300005539 Bacteria 8044
162 Ga0068853_100014321 3300005539 Bacteria 6490
163 Ga0068853_100032220 3300005539 Bacteria 4439
164 Ga0068853_100043193 3300005539 Bacteria 3856
165 Ga0068853_100055351 3300005539 Bacteria 3419
166 Ga0068853_100119686 3300005539 Bacteria 2347
167 Ga0068853_100224704 3300005539 Bacteria 1716
168 Ga0068853_100390259 3300005539 Bacteria 1301
169 Ga0068853_100936963 3300005539 Bacteria 832
170 Ga0068853_100949430 3300005539 Bacteria 827
171 Ga0070686_100000045 3300005544 Bacteria 101988
172 Ga0070695_100351387 3300005545 Bacteria 1105
173 Ga0070696_100916339 3300005546 Bacteria 728
174 Ga0070665_100000021 3300005548 Bacteria 389668
175 Ga0070665_100000042 3300005548 Bacteria 292582
176 Ga0070665_100000736 3300005548 Bacteria 43644
177 Ga0070665_100070742 3300005548 Bacteria 3496
178 Ga0068855_100001099 3300005563 Bacteria 33610
179 Ga0068855_100020835 3300005563 Bacteria 7862
180 Ga0068855_100078784 3300005563 Bacteria 3822
181 Ga0068855_100129623 3300005563 Bacteria 2881
182 Ga0068855_100352297 3300005563 Bacteria 1621
183 Ga0068855_101094019 3300005563 Bacteria 833
184 Ga0068855_101149205 3300005563 Bacteria 809
185 Ga0070664_100000103 3300005564 Bacteria 54853
186 Ga0070664_100013075 3300005564 Bacteria 6755
187 Ga0070664_100037446 3300005564 Bacteria 4079
188 Ga0070664_100040560 3300005564 Bacteria 3925
189 Ga0070664_100086408 3300005564 Bacteria 2710
190 Ga0070664_100097913 3300005564 Bacteria 2547
191 Ga0070664_100488724 3300005564 Bacteria 1133
192 Ga0070664_100834576 3300005564 Bacteria 862
193 Ga0068857_100025650 3300005577 Bacteria 5189
194 Ga0068857_100026615 3300005577 Bacteria 5098
195 Ga0068857_100047101 3300005577 Bacteria 3827
196 Ga0068857_100126580 3300005577 Bacteria 2302
197 Ga0068857_100167466 3300005577 Bacteria 1996
198 Ga0068857_100349310 3300005577 Bacteria 1369
199 Ga0068857_100437383 3300005577 Bacteria 1221
200 Ga0068854_100010204 3300005578 Bacteria 6087
201 Ga0068854_100037927 3300005578 Bacteria 3386
202 Ga0068854_100057613 3300005578 Bacteria 2803
203 Ga0068854_100071990 3300005578 Bacteria 2530
204 Ga0068854_100091284 3300005578 Bacteria 2266
205 Ga0068854_100099837 3300005578 Bacteria 2174
206 Ga0068854_100164250 3300005578 Bacteria 1722
207 Ga0068854_100179862 3300005578 Bacteria 1651
208 Ga0068854_100247276 3300005578 Bacteria 1422
209 Ga0068854_100253342 3300005578 Bacteria 1406
210 Ga0068856_100000101 3300005614 Bacteria 82391
211 Ga0068856_100023054 3300005614 Bacteria 6053
212 Ga0068856_100108127 3300005614 Bacteria 2777
213 Ga0068856_100503090 3300005614 Bacteria 1233
214 Ga0068852_100001412 3300005616 Bacteria 16199
215 Ga0068852_100011679 3300005616 Bacteria 6624
216 Ga0068852_100332454 3300005616 Bacteria 1479
217 Ga0068852_100380602 3300005616 Bacteria 1384
218 Ga0068852_100536918 3300005616 Bacteria 1168
219 Ga0068852_100730729 3300005616 Bacteria 1001
220 Ga0068859_100013033 3300005617 Bacteria 8353
221 Ga0068859_100013138 3300005617 Bacteria 8320
222 Ga0068859_100643218 3300005617 Bacteria 1153
223 Ga0068864_100058119 3300005618 Bacteria 3342
224 Ga0068864_100195361 3300005618 Bacteria 1856
225 Ga0068861_100000107 3300005719 Bacteria 41725
226 Ga0068861_100010533 3300005719 Bacteria 6419
227 Ga0068861_100012293 3300005719 Bacteria 5971
228 Ga0068861_100031809 3300005719 Bacteria 3880
229 Ga0068851_10037677 3300005834 Bacteria 2425
230 Ga0068851_10120463 3300005834 Bacteria 1410
231 Ga0068863_100000239 3300005841 Bacteria 58509
232 Ga0068863_100062483 3300005841 Bacteria 3522
233 Ga0068863_100309029 3300005841 Bacteria 1534
234 Ga0068858_100000278 3300005842 Bacteria 55142
235 Ga0068858_100002704 3300005842 Bacteria 17877
236 Ga0068858_100016556 3300005842 Bacteria 6925
237 Ga0068858_100140436 3300005842 Bacteria 2267
238 Ga0068858_100140629 3300005842 Bacteria 2266
239 Ga0068860_100000045 3300005843 Bacteria 223252
240 Ga0068860_100000182 3300005843 Bacteria 100888
241 Ga0068860_100369824 3300005843 Bacteria 1414
242 Ga0068862_100000392 3300005844 Bacteria 47165
243 Ga0068862_100000449 3300005844 Bacteria 44685
244 Ga0068862_100957338 3300005844 Bacteria 844
245 Ga0081455_10000255 3300005937 Bacteria 69927
246 Ga0081540_1076880 3300005983 Bacteria 1519
247 Ga0081539_10016957 3300005985 Bacteria 5158
248 Ga0070717_10028421 3300006028 Bacteria 4476
249 Ga0070712_100101508 3300006175 Bacteria 2128
250 Ga0097621_100238033 3300006237 Bacteria 1591
251 Ga0075431_100009423 3300006847 Bacteria 9801
252 Ga0068865_100067416 3300006881 Bacteria 2528
253 Ga0097620_100007709 3300006931 Bacteria 10931
254 Ga0097620_100013033 3300006931 Bacteria 8353
255 Ga0097620_100013138 3300006931 Bacteria 8320
256 Ga0097620_100643145 3300006931 Bacteria 1153
257 Ga0097620_100870428 3300006931 Bacteria 986
258 Ga0079104_1056582 3300006946 Bacteria 857
259 Ga0105240_10023057 3300009093 Bacteria 8243
260 Ga0105240_10152102 3300009093 Bacteria 2755
261 Ga0105240_10583831 3300009093 Bacteria 1232
262 Ga0105240_10984858 3300009093 Bacteria 903
263 Ga0105247_10226231 3300009101 Bacteria 1268
264 Ga0105243_10012004 3300009148 Bacteria 6549
265 Ga0105243_11049821 3300009148 Bacteria 820
266 Ga0105241_10006002 3300009174 Bacteria 8963
267 Ga0105241_10370644 3300009174 Bacteria 1248
268 Ga0105241_11051295 3300009174 Bacteria 764
269 Ga0105248_10000673 3300009177 Bacteria 38736
270 Ga0105248_10000724 3300009177 Bacteria 37195
271 Ga0105248_10001313 3300009177 Bacteria 27695
272 Ga0105248_10084221 3300009177 Bacteria 3576
273 Ga0105248_12208234 3300009177 Bacteria 626
274 Ga0105237_10009564 3300009545 Bacteria 10379
275 Ga0105237_10038909 3300009545 Bacteria 4803
276 Ga0105237_10106593 3300009545 Bacteria 2794
277 Ga0105237_10167956 3300009545 Bacteria 2193
278 Ga0105237_10481592 3300009545 Bacteria 1247
279 Ga0105238_10020941 3300009551 Bacteria 6661
280 Ga0105238_10126698 3300009551 Bacteria 2532
281 Ga0105238_10134649 3300009551 Bacteria 2449
282 Ga0105238_10430396 3300009551 Bacteria 1315
283 Ga0105249_10000012 3300009553 Bacteria 292640
284 Ga0105249_10050993 3300009553 Bacteria 3774
285 Ga0105249_10065199 3300009553 Bacteria 3350
286 Ga0105239_10188762 3300010375 Bacteria 2307
287 Ga0105239_10921035 3300010375 Bacteria 1003
288 Ga0105239_11200179 3300010375 Bacteria 874
289 Ga0105239_12297840 3300010375 Bacteria 628
290 Ga0157373_10018538 3300013100 Bacteria 5064
291 Ga0157373_10061596 3300013100 Bacteria 2657
292 Ga0157373_10204315 3300013100 Bacteria 1393
293 Ga0157373_10229877 3300013100 Bacteria 1310
294 Ga0157373_10279604 3300013100 Bacteria 1183
295 Ga0157371_10000793 3300013102 Bacteria 36288
296 Ga0157371_10003868 3300013102 Bacteria 13346
297 Ga0157371_10012085 3300013102 Bacteria 6614
298 Ga0157371_10034354 3300013102 Bacteria 3638
299 Ga0157371_10308274 3300013102 Bacteria 1147
300 Ga0157370_10048689 3300013104 Bacteria 4060
301 Ga0157370_10065873 3300013104 Bacteria 3427
302 Ga0157370_10941543 3300013104 Bacteria 783
303 Ga0157369_10013876 3300013105 Bacteria 9101
304 Ga0157369_10027781 3300013105 Bacteria 6267
305 Ga0157369_10090726 3300013105 Bacteria 3262
306 Ga0157369_10160087 3300013105 Bacteria 2376
307 Ga0157369_10260929 3300013105 Bacteria 1807
308 Ga0157369_10544464 3300013105 Bacteria 1200
309 Ga0157369_10802314 3300013105 Bacteria 967
310 Ga0157374_10009179 3300013296 Bacteria 8480
311 Ga0157374_10192844 3300013296 Bacteria 1993
312 Ga0163162_10672205 3300013306 Bacteria 1158
313 Ga0163162_11143820 3300013306 Bacteria 882
314 Ga0157372_10029659 3300013307 Bacteria 5975
315 Ga0157372_10043572 3300013307 Bacteria 4969
316 Ga0157372_10054730 3300013307 Bacteria 4453
317 Ga0157372_10137761 3300013307 Bacteria 2811
318 Ga0157372_10202905 3300013307 Bacteria 2297
319 Ga0157372_10414911 3300013307 Bacteria 1569
320 Ga0157372_10473246 3300013307 Bacteria 1460
321 Ga0157372_10636137 3300013307 Bacteria 1243
322 Ga0157372_11164737 3300013307 Bacteria 891
323 Ga0157375_10072291 3300013308 Bacteria 3465
324 Ga0157375_11949409 3300013308 Bacteria 698
325 Ga0163163_10000580 3300014325 Bacteria 32211
326 Ga0163163_10446996 3300014325 Bacteria 1352
327 Ga0163163_10647595 3300014325 Bacteria 1120
328 Ga0157380_10003947 3300014326 Bacteria 10238
329 Ga0157380_10019291 3300014326 Bacteria 5082
330 Ga0157380_10347308 3300014326 Bacteria 1387
331 Ga0157380_10765458 3300014326 Bacteria 979
332 Ga0157379_10001908 3300014968 Bacteria 17245
333 Ga0183363_1008 3300015690 Bacteria 194027
334 Ga0163161_10000202 3300017792 Bacteria 54518
335 Ga0163161_10023353 3300017792 Bacteria 4363
336 Ga0163161_10024583 3300017792 Bacteria 4257
337 Ga0163161_10689802 3300017792 Bacteria 849
338 Ga0197907_10010936 3300020069 Bacteria 1349
339 Ga0206356_10680400 3300020070 Bacteria 1475
340 Ga0206353_11575149 3300020082 Bacteria 943
341 Ga0213875_10001046 3300021388 Bacteria 19467
342 Ga0224712_10125141 3300022467 Bacteria 1117
343 Ga0209147_100446 3300025229 Bacteria 26057
344 Ga0209563_100053 3300025230 Bacteria 332370
345 Ga0207425_1000146 3300025245 Bacteria 60712
346 Ga0209646_1022374 3300025246 Bacteria 901
347 Ga0209677_106508 3300025253 Bacteria 2747
348 Ga0209148_1000061 3300025254 Bacteria 349575
349 Ga0209148_1000159 3300025254 Bacteria 139560
350 Ga0209129_1003315 3300025258 Bacteria 7103
351 Ga0209233_1006578 3300025261 Bacteria 3736
352 Ga0209565_1021095 3300025263 Bacteria 1366
353 Ga0209455_1000045 3300025272 Bacteria 383329
354 Ga0209675_1000075 3300025291 Bacteria 161623
355 Ga0209676_1000081 3300025292 Bacteria 285297
356 Ga0209676_1000554 3300025292 Bacteria 56925
357 Ga0209025_1000431 3300025294 Bacteria 82934
358 Ga0209025_1018162 3300025294 Bacteria 4011
359 Ga0209564_1000437 3300025295 Bacteria 72058
360 Ga0209758_1000002 3300025297 Bacteria 1400310
361 Ga0209758_1000328 3300025297 Bacteria 89656
362 Ga0209050_1000017 3300025298 Bacteria 728928
363 Ga0209050_1000474 3300025298 Bacteria 71192
364 Ga0209050_1023196 3300025298 Bacteria 2191
365 Ga0209050_1024209 3300025298 Bacteria 2109
366 Ga0209257_1000206 3300025304 Bacteria 142184
367 Ga0209257_1000456 3300025304 Bacteria 75804
368 Ga0207697_10000725 3300025315 Bacteria 18735
369 Ga0207656_10000858 3300025321 Bacteria 9930
370 Ga0207656_10028534 3300025321 Bacteria 2291
371 Ga0207656_10101812 3300025321 Bacteria 1317
372 Ga0207682_10000649 3300025893 Bacteria 16245
373 Ga0207680_10000012 3300025903 Bacteria 293810
374 Ga0207680_10035968 3300025903 Bacteria 2848
375 Ga0207647_10001900 3300025904 Bacteria 16010
376 Ga0207647_10030536 3300025904 Bacteria 3474
377 Ga0207647_10047167 3300025904 Bacteria 2681
378 Ga0207647_10083436 3300025904 Bacteria 1914
379 Ga0207647_10094886 3300025904 Bacteria 1776
380 Ga0207647_10158003 3300025904 Bacteria 1323
381 Ga0207647_10614692 3300025904 Bacteria 598
382 Ga0207699_10670858 3300025906 Bacteria 758
383 Ga0207645_10020635 3300025907 Bacteria 4310
384 Ga0207645_10123752 3300025907 Bacteria 1680
385 Ga0207643_10202943 3300025908 Bacteria 1208
386 Ga0207643_10249079 3300025908 Bacteria 1094
387 Ga0207705_10000025 3300025909 Bacteria 259826
388 Ga0207705_10000113 3300025909 Bacteria 90567
389 Ga0207705_10000309 3300025909 Bacteria 45040
390 Ga0207705_10005374 3300025909 Bacteria 9578
391 Ga0207705_10020922 3300025909 Bacteria 4667
392 Ga0207705_10056282 3300025909 Bacteria 2835
393 Ga0207705_10065548 3300025909 Bacteria 2626
394 Ga0207705_10109930 3300025909 Bacteria 2036
395 Ga0207705_10114144 3300025909 Bacteria 1998
396 Ga0207705_10132887 3300025909 Bacteria 1853
397 Ga0207705_10135073 3300025909 Bacteria 1838
398 Ga0207654_10000363 3300025911 Bacteria 26735
399 Ga0207654_10001493 3300025911 Bacteria 12355
400 Ga0207654_10205995 3300025911 Bacteria 1298
401 Ga0207654_10471698 3300025911 Bacteria 883
402 Ga0207707_10782054 3300025912 Bacteria 796
403 Ga0207695_10009402 3300025913 Bacteria 12092
404 Ga0207695_10009881 3300025913 Bacteria 11726
405 Ga0207695_10020497 3300025913 Bacteria 7570
406 Ga0207695_10105002 3300025913 Bacteria 2813
407 Ga0207695_10125638 3300025913 Bacteria 2528
408 Ga0207671_10000358 3300025914 Bacteria 65072
409 Ga0207671_10008227 3300025914 Bacteria 8880
410 Ga0207671_10033078 3300025914 Bacteria 3848
411 Ga0207693_10003170 3300025915 Bacteria 14130
412 Ga0207663_10074248 3300025916 Bacteria 2203
413 Ga0207660_10000186 3300025917 Bacteria 39363
414 Ga0207660_10001468 3300025917 Bacteria 15862
415 Ga0207660_10007711 3300025917 Bacteria 6967
416 Ga0207660_10017028 3300025917 Bacteria 4822
417 Ga0207657_10000026 3300025919 Bacteria 143118
418 Ga0207657_10003075 3300025919 Bacteria 17857
419 Ga0207657_10008938 3300025919 Bacteria 10122
420 Ga0207657_10009815 3300025919 Bacteria 9591
421 Ga0207657_10016201 3300025919 Bacteria 7195
422 Ga0207657_10020388 3300025919 Bacteria 6265
423 Ga0207657_10030743 3300025919 Bacteria 4870
424 Ga0207657_10091390 3300025919 Bacteria 2538
425 Ga0207657_10092054 3300025919 Bacteria 2527
426 Ga0207657_10096733 3300025919 Bacteria 2455
427 Ga0207657_10134231 3300025919 Bacteria 2026
428 Ga0207657_10146278 3300025919 Bacteria 1927
429 Ga0207649_10000228 3300025920 Bacteria 45916
430 Ga0207649_10000594 3300025920 Bacteria 24526
431 Ga0207649_10002596 3300025920 Bacteria 10029
432 Ga0207649_10029009 3300025920 Bacteria 3264
433 Ga0207649_10038867 3300025920 Bacteria 2883
434 Ga0207649_10040236 3300025920 Bacteria 2840
435 Ga0207649_10379584 3300025920 Bacteria 1053
436 Ga0207649_10467803 3300025920 Bacteria 954
437 Ga0207649_10665470 3300025920 Bacteria 805
438 Ga0207652_10006821 3300025921 Bacteria 9200
439 Ga0207681_10000076 3300025923 Bacteria 89353
440 Ga0207681_10009875 3300025923 Bacteria 5839
441 Ga0207681_10046204 3300025923 Bacteria 2928
442 Ga0207681_10363601 3300025923 Bacteria 1161
443 Ga0207681_10778803 3300025923 Bacteria 798
444 Ga0207694_10000667 3300025924 Bacteria 30806
445 Ga0207694_10006827 3300025924 Bacteria 8668
446 Ga0207694_10020884 3300025924 Bacteria 4958
447 Ga0207694_10036529 3300025924 Bacteria 3771
448 Ga0207694_10103449 3300025924 Bacteria 2258
449 Ga0207650_10001585 3300025925 Bacteria 16226
450 Ga0207650_10009316 3300025925 Bacteria 6710
451 Ga0207650_10046015 3300025925 Bacteria 3212
452 Ga0207650_10091162 3300025925 Bacteria 2329
453 Ga0207650_10118898 3300025925 Bacteria 2055
454 Ga0207650_10120719 3300025925 Bacteria 2040
455 Ga0207650_10437949 3300025925 Bacteria 1086
456 Ga0207650_11253445 3300025925 Bacteria 631
457 Ga0207659_10014152 3300025926 Bacteria 5137
458 Ga0207659_10380499 3300025926 Bacteria 1177
459 Ga0207700_10130869 3300025928 Bacteria 2048
460 Ga0207664_10158040 3300025929 Bacteria 1931
461 Ga0207664_10681097 3300025929 Bacteria 924
462 Ga0207644_10000254 3300025931 Bacteria 36059
463 Ga0207644_10000294 3300025931 Bacteria 32960
464 Ga0207644_10009075 3300025931 Bacteria 6521
465 Ga0207644_10029626 3300025931 Bacteria 3799
466 Ga0207644_10259739 3300025931 Bacteria 1388
467 Ga0207644_10292533 3300025931 Bacteria 1310
468 Ga0207690_10000036 3300025932 Bacteria 143853
469 Ga0207690_10000498 3300025932 Bacteria 25393
470 Ga0207690_10001936 3300025932 Bacteria 12689
471 Ga0207690_10294300 3300025932 Bacteria 1268
472 Ga0207690_10516791 3300025932 Bacteria 967
473 Ga0207706_10000031 3300025933 Bacteria 143109
474 Ga0207706_10000463 3300025933 Bacteria 43338
475 Ga0207706_10004389 3300025933 Bacteria 13261
476 Ga0207706_10009977 3300025933 Bacteria 8705
477 Ga0207706_10090465 3300025933 Bacteria 2691
478 Ga0207706_10192208 3300025933 Bacteria 1791
479 Ga0207706_10193626 3300025933 Bacteria 1784
480 Ga0207706_10266948 3300025933 Bacteria 1494
481 Ga0207706_10379599 3300025933 Bacteria 1227
482 Ga0207706_10448117 3300025933 Bacteria 1117
483 Ga0207709_10000047 3300025935 Bacteria 238649
484 Ga0207709_10366903 3300025935 Bacteria 1092
485 Ga0207670_10091254 3300025936 Bacteria 2154
486 Ga0207670_10489015 3300025936 Bacteria 998
487 Ga0207669_10001404 3300025937 Bacteria 10240
488 Ga0207669_10003273 3300025937 Bacteria 7001
489 Ga0207669_10139472 3300025937 Bacteria 1680
490 Ga0207669_10445601 3300025937 Bacteria 1025
491 Ga0207704_10421232 3300025938 Bacteria 1059
492 Ga0207704_11201969 3300025938 Bacteria 646
493 Ga0207691_10043137 3300025940 Bacteria 4157
494 Ga0207691_10481158 3300025940 Bacteria 1055
495 Ga0207711_10000956 3300025941 Bacteria 27669
496 Ga0207711_10002871 3300025941 Bacteria 15108
497 Ga0207711_10031665 3300025941 Bacteria 4466
498 Ga0207711_10037874 3300025941 Bacteria 4099
499 Ga0207711_10154777 3300025941 Bacteria 2071
500 Ga0207711_10416481 3300025941 Bacteria 1249
501 Ga0207689_10037163 3300025942 Bacteria 4041
502 Ga0207661_10001385 3300025944 Bacteria 16276
503 Ga0207661_10014727 3300025944 Bacteria 5737
504 Ga0207661_10048274 3300025944 Bacteria 3382
505 Ga0207661_10188262 3300025944 Bacteria 1808
506 Ga0207679_10000093 3300025945 Bacteria 78331
507 Ga0207679_10011706 3300025945 Bacteria 5695
508 Ga0207679_10040198 3300025945 Bacteria 3346
509 Ga0207679_10112459 3300025945 Bacteria 2152
510 Ga0207679_10145871 3300025945 Bacteria 1919
511 Ga0207679_10262225 3300025945 Bacteria 1474
512 Ga0207679_10744536 3300025945 Bacteria 891
513 Ga0207667_10000001 3300025949 Bacteria 1178522
514 Ga0207667_10003819 3300025949 Bacteria 18527
515 Ga0207667_10008760 3300025949 Bacteria 11985
516 Ga0207667_10016498 3300025949 Bacteria 8344
517 Ga0207667_10116955 3300025949 Bacteria 2747
518 Ga0207667_10479282 3300025949 Bacteria 1263
519 Ga0207667_10930824 3300025949 Bacteria 859
520 Ga0207667_11089459 3300025949 Bacteria 782
521 Ga0207667_11208576 3300025949 Bacteria 735
522 Ga0207712_10000021 3300025961 Bacteria 292649
523 Ga0207712_10015715 3300025961 Bacteria 4888
524 Ga0207712_10133053 3300025961 Bacteria 1898
525 Ga0207668_10000480 3300025972 Bacteria 24978
526 Ga0207668_10046466 3300025972 Bacteria 2966
527 Ga0207668_10154101 3300025972 Bacteria 1783
528 Ga0207668_10340755 3300025972 Bacteria 1250
529 Ga0207640_10003839 3300025981 Bacteria 8107
530 Ga0207640_10010560 3300025981 Bacteria 5208
531 Ga0207640_10025944 3300025981 Bacteria 3554
532 Ga0207640_10028754 3300025981 Bacteria 3403
533 Ga0207640_10095869 3300025981 Bacteria 2067
534 Ga0207640_10111622 3300025981 Bacteria 1939
535 Ga0207640_10391295 3300025981 Bacteria 1129
536 Ga0207640_10455623 3300025981 Bacteria 1055
537 Ga0207640_10546706 3300025981 Bacteria 972
538 Ga0207640_11098012 3300025981 Bacteria 704
539 Ga0207658_10000002 3300025986 Bacteria 1364188
540 Ga0207658_10000936 3300025986 Bacteria 24076
541 Ga0207658_10003747 3300025986 Bacteria 10705
542 Ga0207658_10053655 3300025986 Bacteria 2980
543 Ga0207658_10376411 3300025986 Bacteria 1242
544 Ga0207677_10120313 3300026023 Bacteria 1974
545 Ga0207703_10000587 3300026035 Bacteria 37079
546 Ga0207703_10004856 3300026035 Bacteria 10938
547 Ga0207703_10008434 3300026035 Bacteria 8145
548 Ga0207703_10106943 3300026035 Bacteria 2381
549 Ga0207639_10001448 3300026041 Bacteria 15976
550 Ga0207639_10002653 3300026041 Bacteria 12006
551 Ga0207639_10002879 3300026041 Bacteria 11560
552 Ga0207639_10017154 3300026041 Bacteria 5131
553 Ga0207639_10024716 3300026041 Bacteria 4352
554 Ga0207639_10037183 3300026041 Bacteria 3614
555 Ga0207639_10051214 3300026041 Bacteria 3140
556 Ga0207639_10161027 3300026041 Bacteria 1891
557 Ga0207639_10818689 3300026041 Bacteria 868
558 Ga0207678_10008204 3300026067 Bacteria 9207
559 Ga0207678_10011522 3300026067 Bacteria 7769
560 Ga0207678_10011562 3300026067 Bacteria 7752
561 Ga0207678_10017323 3300026067 Bacteria 6324
562 Ga0207678_10079060 3300026067 Bacteria 2816
563 Ga0207678_10094520 3300026067 Bacteria 2554
564 Ga0207678_10097402 3300026067 Bacteria 2514
565 Ga0207678_10137527 3300026067 Bacteria 2084
566 Ga0207708_10166878 3300026075 Bacteria 1741
567 Ga0207708_10359911 3300026075 Bacteria 1196
568 Ga0207702_10000353 3300026078 Bacteria 52560
569 Ga0207702_10000963 3300026078 Bacteria 29605
570 Ga0207702_10003254 3300026078 Bacteria 15003
571 Ga0207702_10031113 3300026078 Bacteria 4448
572 Ga0207702_10436237 3300026078 Bacteria 1269
573 Ga0207641_10000589 3300026088 Bacteria 39950
574 Ga0207641_10017753 3300026088 Bacteria 5829
575 Ga0207641_10207702 3300026088 Bacteria 1809
576 Ga0207648_10079457 3300026089 Bacteria 2861
577 Ga0207648_10359804 3300026089 Bacteria 1313
578 Ga0207648_11142938 3300026089 Bacteria 731
579 Ga0207676_10000921 3300026095 Bacteria 22753
580 Ga0207676_10036689 3300026095 Bacteria 3732
581 Ga0207674_10009710 3300026116 Bacteria 10969
582 Ga0207674_10015944 3300026116 Bacteria 8232
583 Ga0207674_10018633 3300026116 Bacteria 7540
584 Ga0207674_10108795 3300026116 Bacteria 2748
585 Ga0207674_10124858 3300026116 Bacteria 2540
586 Ga0207674_10185300 3300026116 Bacteria 2032
587 Ga0207674_10324607 3300026116 Bacteria 1489
588 Ga0207674_10584636 3300026116 Bacteria 1079
589 Ga0207674_10961208 3300026116 Bacteria 823
590 Ga0207675_100000317 3300026118 Bacteria 45991
591 Ga0207675_100003402 3300026118 Bacteria 15538
592 Ga0207675_100020505 3300026118 Bacteria 6161
593 Ga0207675_100046136 3300026118 Bacteria 4070
594 Ga0207683_10498428 3300026121 Bacteria 1125
595 Ga0207698_10001652 3300026142 Bacteria 13008
596 Ga0207698_10003330 3300026142 Bacteria 9666
597 Ga0207698_10003733 3300026142 Bacteria 9200
598 Ga0207698_10008213 3300026142 Bacteria 6586
599 Ga0207698_10011430 3300026142 Bacteria 5757
600 Ga0207698_10027408 3300026142 Bacteria 4044
601 Ga0207698_10055506 3300026142 Bacteria 3054
602 Ga0207698_10174954 3300026142 Bacteria 1894
603 Ga0207698_10237893 3300026142 Bacteria 1657
604 Ga0207698_10370511 3300026142 Bacteria 1359
605 Ga0207698_10515516 3300026142 Bacteria 1166
606 Ga0209281_1044830 3300027111 Bacteria 727
607 Ga0209968_1051459 3300027526 Bacteria 716
608 Ga0209970_1013435 3300027614 Bacteria 1358
609 Ga0209983_1044476 3300027665 Bacteria 965
610 Ga0209974_10003691 3300027876 Bacteria 5500
611 Ga0209974_10004663 3300027876 Bacteria 4874
612 Ga0209974_10076568 3300027876 Bacteria 1146
613 Ga0268266_10000015 3300028379 Bacteria 630629
614 Ga0268266_10000054 3300028379 Bacteria 292717
615 Ga0268266_10000370 3300028379 Bacteria 69264
616 Ga0268266_10026889 3300028379 Bacteria 4895
617 Ga0268266_10720543 3300028379 Bacteria 962
618 Ga0268265_10000278 3300028380 Bacteria 58293
619 Ga0268265_10000684 3300028380 Bacteria 33416
620 Ga0268265_10087634 3300028380 Bacteria 2477
621 Ga0268265_10267811 3300028380 Bacteria 1522
622 Ga0268264_10000074 3300028381 Bacteria 259555
623 Ga0268264_10000101 3300028381 Bacteria 225109
624 Ga0268264_10250794 3300028381 Bacteria 1644
625 Ga0265325_10040778 3300031241 Bacteria 2437
626 Ga0307408_100030751 3300031548 Bacteria 3731
627 Ga0307408_100526236 3300031548 Bacteria 1039
628 Ga0307408_100666880 3300031548 Bacteria 931
629 Ga0307405_10081664 3300031731 Bacteria 2113
630 Ga0307405_10177726 3300031731 Bacteria 1525
631 Ga0307405_10184596 3300031731 Bacteria 1500
632 Ga0307405_10255564 3300031731 Bacteria 1306
633 Ga0307405_10279681 3300031731 Bacteria 1255
634 Ga0307405_10376730 3300031731 Bacteria 1103
635 Ga0307405_10706175 3300031731 Bacteria 835
636 Ga0307405_11156635 3300031731 Bacteria 667
637 Ga0307413_10005227 3300031824 Bacteria 5759
638 Ga0307413_10011429 3300031824 Bacteria 4365
639 Ga0307413_10017225 3300031824 Bacteria 3758
640 Ga0307413_10096088 3300031824 Bacteria 1944
641 Ga0307413_10238620 3300031824 Bacteria 1340
642 Ga0307413_10251893 3300031824 Bacteria 1310
643 Ga0307413_10477770 3300031824 Bacteria 995
644 Ga0307413_10523625 3300031824 Bacteria 956
645 Ga0307413_10596503 3300031824 Bacteria 903
646 Ga0307413_10751871 3300031824 Bacteria 815
647 Ga0307413_10861096 3300031824 Bacteria 766
648 Ga0307413_11250621 3300031824 Bacteria 647
649 Ga0307410_10000171 3300031852 Bacteria 23683
650 Ga0307410_10000714 3300031852 Bacteria 13891
651 Ga0307410_10003256 3300031852 Bacteria 8107
652 Ga0307410_10011673 3300031852 Bacteria 5037
653 Ga0307410_10039894 3300031852 Bacteria 3086
654 Ga0307410_10047498 3300031852 Bacteria 2869
655 Ga0307410_10096242 3300031852 Bacteria 2112
656 Ga0307410_10251093 3300031852 Bacteria 1375
657 Ga0307410_10426779 3300031852 Bacteria 1076
658 Ga0307410_10905519 3300031852 Bacteria 756
659 Ga0307406_10026407 3300031901 Bacteria 3487
660 Ga0307406_10062967 3300031901 Bacteria 2401
661 Ga0307406_10091778 3300031901 Bacteria 2046
662 Ga0307406_10138152 3300031901 Bacteria 1721
663 Ga0307406_10144722 3300031901 Bacteria 1687
664 Ga0307406_10198244 3300031901 Bacteria 1475
665 Ga0307406_10237855 3300031901 Bacteria 1364
666 Ga0307406_10369982 3300031901 Bacteria 1126
667 Ga0307406_10407555 3300031901 Bacteria 1079
668 Ga0307406_10513730 3300031901 Bacteria 973
669 Ga0307406_10793752 3300031901 Bacteria 798
670 Ga0307406_11499766 3300031901 Bacteria 593
671 Ga0307407_10001776 3300031903 Bacteria 8057
672 Ga0307407_10051911 3300031903 Bacteria 2352
673 Ga0307407_10174451 3300031903 Bacteria 1419
674 Ga0307407_10204977 3300031903 Bacteria 1324
675 Ga0307407_10337107 3300031903 Bacteria 1063
676 Ga0307407_10414531 3300031903 Bacteria 969
677 Ga0307407_10417728 3300031903 Bacteria 966
678 Ga0307412_10018619 3300031911 Bacteria 4184
679 Ga0307412_10023079 3300031911 Bacteria 3824
680 Ga0307412_10028656 3300031911 Bacteria 3487
681 Ga0307412_10323097 3300031911 Bacteria 1228
682 Ga0307412_10462975 3300031911 Bacteria 1047
683 Ga0307412_10691674 3300031911 Bacteria 874
684 Ga0307412_10872797 3300031911 Bacteria 786
685 Ga0307409_100013575 3300031995 Bacteria 5251
686 Ga0307409_100027063 3300031995 Bacteria 4057
687 Ga0307409_100049902 3300031995 Bacteria 3193
688 Ga0307409_100118712 3300031995 Bacteria 2234
689 Ga0307409_100183598 3300031995 Bacteria 1854
690 Ga0307409_100247933 3300031995 Bacteria 1626
691 Ga0307409_100354109 3300031995 Bacteria 1386
692 Ga0307409_100615236 3300031995 Bacteria 1075
693 Ga0307409_100804946 3300031995 Bacteria 947
694 Ga0307409_100871658 3300031995 Bacteria 912
695 Ga0307409_101279147 3300031995 Bacteria 758
696 Ga0307416_100066041 3300032002 Bacteria 2976
697 Ga0307416_100139367 3300032002 Bacteria 2201
698 Ga0307416_100310140 3300032002 Bacteria 1574
699 Ga0307416_100327107 3300032002 Bacteria 1538
700 Ga0307416_100343547 3300032002 Bacteria 1507
701 Ga0307416_100808924 3300032002 Bacteria 1033
702 Ga0307416_100814294 3300032002 Bacteria 1030
703 Ga0307416_100967947 3300032002 Bacteria 953
704 Ga0307416_101017378 3300032002 Bacteria 932
705 Ga0307416_101169828 3300032002 Bacteria 874
706 Ga0307416_101746907 3300032002 Bacteria 726
707 Ga0307416_101942736 3300032002 Bacteria 691
708 Ga0307416_102165352 3300032002 Bacteria 657
709 Ga0307414_10000070 3300032004 Bacteria 96231
710 Ga0307414_10005824 3300032004 Bacteria 6815
711 Ga0307414_10025523 3300032004 Bacteria 3787
712 Ga0307414_10029337 3300032004 Bacteria 3579
713 Ga0307414_10089709 3300032004 Bacteria 2279
714 Ga0307414_10097696 3300032004 Bacteria 2201
715 Ga0307414_10187540 3300032004 Bacteria 1670
716 Ga0307414_10280625 3300032004 Bacteria 1399
717 Ga0307414_10337586 3300032004 Bacteria 1288
718 Ga0307414_10406014 3300032004 Bacteria 1184
719 Ga0307414_10554670 3300032004 Bacteria 1024
720 Ga0307414_10573572 3300032004 Bacteria 1008
721 Ga0307414_11443468 3300032004 Bacteria 640
722 Ga0307411_10001039 3300032005 Bacteria 10736
723 Ga0307411_10002793 3300032005 Bacteria 7861
724 Ga0307411_10010109 3300032005 Bacteria 5009
725 Ga0307411_10048286 3300032005 Bacteria 2758
726 Ga0307411_10066476 3300032005 Bacteria 2422
727 Ga0307411_10082801 3300032005 Bacteria 2214
728 Ga0307411_10118736 3300032005 Bacteria 1908
729 Ga0307411_10140883 3300032005 Bacteria 1778
730 Ga0307411_10143600 3300032005 Bacteria 1763
731 Ga0307411_10199142 3300032005 Bacteria 1536
732 Ga0307411_10290861 3300032005 Bacteria 1305
733 Ga0307411_10406056 3300032005 Bacteria 1127
734 Ga0307411_10435721 3300032005 Bacteria 1092
735 Ga0307411_10552820 3300032005 Bacteria 982
736 Ga0307415_100063723 3300032126 Bacteria 2562
737 Ga0307415_100146487 3300032126 Bacteria 1811
738 Ga0307415_100249373 3300032126 Bacteria 1441
739 Ga0307415_100479673 3300032126 Bacteria 1082
740 Ga0307415_100853746 3300032126 Bacteria 835
741 Ga0307415_101191142 3300032126 Bacteria 717
742 Ga0373928_0079319 3300035084 Bacteria 825
743 Ga0373945_0081564 3300035116 Bacteria 1240
744 Ga0373954_0166962 3300035118 Bacteria 1077
745 Ga0373956_0081265 3300035119 Bacteria 1487
746 Ga0373960_0009951 3300035121 Bacteria 2314
747 Ga0373955_0002343 3300035172 Bacteria 8255
748 Ga0373942_0055009 3300035207 Bacteria 1126
749 Ga0373935_0060866 3300035692 Bacteria 2416
750 Ga0373927_0456006 3300035695 Bacteria 844
751 Ga0373933_0219165 3300035724 Bacteria 1220
752 Ga0373937_0013140 3300036401 Bacteria 7291
753 Ga0373925_0033233 3300037068 Bacteria 3802
754 Ga0395899_0071044 3300037312 Bacteria 2548
755 Ga0395899_0082795 3300037312 Bacteria 2333
756 Ga0395899_0285119 3300037312 Bacteria 1122
757 Ga0395899_0319422 3300037312 Bacteria 1046
758 Ga0395899_0383874 3300037312 Bacteria 933
759 Ga0395900_0000530 3300037418 Bacteria 53919
760 Ga0395900_0005218 3300037418 Bacteria 13629
761 Ga0395900_0077026 3300037418 Bacteria 3426
762 Ga0395900_0114158 3300037418 Bacteria 2772
763 Ga0395900_0349808 3300037418 Bacteria 1451
764 Ga0395900_0358049 3300037418 Bacteria 1431
765 Ga0395900_0999911 3300037418 Bacteria 756
766 Ga0395900_1243184 3300037418 Bacteria 659
767 Ga0395898_0049804 3300037466 Bacteria 4103
768 Ga0395898_0197677 3300037466 Bacteria 1920
769 Ga0395898_0699830 3300037466 Bacteria 955
770 Ga0395898_0783112 3300037466 Bacteria 894
771 Ga0395905_0001285 3300037471 Bacteria 30925
772 Ga0395905_0011013 3300037471 Bacteria 8751
773 Ga0395905_0022072 3300037471 Bacteria 6021
774 Ga0395905_0028153 3300037471 Bacteria 5296
775 Ga0395905_0133063 3300037471 Bacteria 2339
776 Ga0395905_0273127 3300037471 Bacteria 1576
777 Ga0395905_0293259 3300037471 Bacteria 1513
778 Ga0395905_0346302 3300037471 Bacteria 1377
779 Ga0395905_0355367 3300037471 Bacteria 1357
780 Ga0395905_1073163 3300037471 Bacteria 708
781 Ga0395905_1130855 3300037471 Bacteria 686
782 Ga0436364_0986946 3300037853 Bacteria 208509
783 Ga0395901_0001493 3300038443 Bacteria 24325
784 Ga0395901_0002214 3300038443 Bacteria 19825
785 Ga0395901_0012559 3300038443 Bacteria 8595
786 Ga0395901_0043255 3300038443 Bacteria 4673
787 Ga0395901_0085433 3300038443 Bacteria 3299
788 Ga0395901_0207392 3300038443 Bacteria 2052
789 Ga0395901_0283402 3300038443 Bacteria 1721
790 Ga0395901_0285656 3300038443 Bacteria 1713
791 Ga0395901_0360187 3300038443 Bacteria 1500
792 Ga0395901_0399999 3300038443 Bacteria 1411
793 Ga0395901_0928287 3300038443 Bacteria 850
794 Ga0395901_1204279 3300038443 Bacteria 723
795 Ga0395901_1268889 3300038443 Bacteria 700
796 Ga0237819_02700 3300038705 Bacteria 3428
797 Ga0237816_03377 3300039145 Bacteria 1172
798 Ga0436365_0309933 3300039437 Bacteria 3193
799 Ga0436365_1077224 3300039437 Bacteria 2291
800 Ga0439439_0046363 3300041406 Bacteria 1135
801 Ga0439453_0075515 3300041408 Bacteria 719
802 Ga0439461_0011930 3300041410 Bacteria 1619
803 Ga0439465_0003226 3300041413 Bacteria 5320
804 Ga0439465_0043772 3300041413 Bacteria 1453
805 Ga0439431_0000173 3300041997 Bacteria 12361
806 Ga0439437_025904 3300042000 Bacteria 724
807 Ga0439442_004433 3300042002 Bacteria 2789
808 Ga0439445_0000243 3300042004 Bacteria 10302
809 Ga0439445_0000812 3300042004 Bacteria 6582
810 Ga0439448_0003857 3300042005 Bacteria 4194
811 Ga0439446_0050764 3300042156 Bacteria 1238
812 Ga0439458_0024488 3300042157 Bacteria 1411
813 Ga0439434_0002056 3300042435 Bacteria 5816
814 Ga0439435_0027753 3300042436 Bacteria 1517
815 Ga0466969_0236731 3300044656 Bacteria 829
816 Ga0466969_0251425 3300044656 Bacteria 801
817 Ga0466966_0035830 3300044684 Bacteria 3205
818 Ga0466961_0039764 3300044693 Bacteria 3014
819 Ga0466961_0088685 3300044693 Bacteria 1954
820 Ga0466961_0098840 3300044693 Bacteria 1840
821 Ga0466963_0038902 3300044694 Bacteria 3113
822 Ga0466963_0148953 3300044694 Bacteria 1624
823 Ga0466963_0526717 3300044694 Bacteria 834
824 Ga0466963_0723809 3300044694 Bacteria 702
825 Ga0466957_0005363 3300044842 Bacteria 7197
826 Ga0466957_0082355 3300044842 Bacteria 2006
827 Ga0466957_0213041 3300044842 Bacteria 1273
828 Ga0466957_0535453 3300044842 Bacteria 815
829 Ga0466957_0559442 3300044842 Bacteria 797
830 Ga0466959_0053738 3300045049 Bacteria 2944
831 Ga0466959_0079949 3300045049 Bacteria 2357
832 Ga0466959_0574090 3300045049 Bacteria 759
833 Ga0466958_0052142 3300045836 Bacteria 2479
834 Ga0466958_0078077 3300045836 Bacteria 2034
835 Ga0466967_0020236 3300045976 Bacteria 5373
836 Ga0466967_0114012 3300045976 Bacteria 2488
837 Ga0466967_0269427 3300045976 Bacteria 1631
838 Ga0466967_0704415 3300045976 Bacteria 1000
839 Ga0466967_0958256 3300045976 Bacteria 851
840 Ga0495627_000459 3300046453 Bacteria 35376
841 Ga0495584_0009212 3300046491 Bacteria 5091
842 Ga0495585_0012251 3300046492 Bacteria 5052
843 Ga0495632_0026424 3300046519 Bacteria 3056
844 Ga0495643_0003241 3300046522 Bacteria 12056
845 Ga0495648_0282321 3300046524 Bacteria 786
846 Ga0495642_0015044 3300046528 Bacteria 3004
847 Ga0495642_0179917 3300046528 Bacteria 920
848 Ga0495621_0003173 3300046539 Bacteria 4503
849 Ga0495621_0008245 3300046539 Bacteria 3117
850 Ga0495621_0087584 3300046539 Bacteria 1169
851 Ga0495621_0178644 3300046539 Bacteria 846
852 Ga0495633_0060359 3300046558 Bacteria 1777
853 Ga0495668_0015140 3300046616 Bacteria 4510
854 Ga0495668_0046817 3300046616 Bacteria 2402
855 Ga0495625_0000936 3300046660 Bacteria 39185
856 Ga0495625_0009545 3300046660 Bacteria 8105
857 Ga0495659_0057924 3300046664 Bacteria 1424
858 Ga0495669_0013865 3300046684 Bacteria 3440
859 Ga0495670_0116035 3300046691 Bacteria 1388
860 Ga0495670_0255562 3300046691 Bacteria 934
861 Ga0495677_0003064 3300047445 Bacteria 6498
862 Ga0495686_0001794 3300047472 Bacteria 21743
863 Ga0495602_0029261 3300048088 Bacteria 5251
864 Ga0496100_0275118 3300048903 Bacteria 1253
865 Ga0496100_0897532 3300048903 Bacteria 696
866 Ga0496101_0275504 3300048904 Bacteria 1314
867 Ga0496103_0000845 3300048906 Bacteria 22406
868 Ga0496104_0159246 3300048907 Bacteria 2166
869 Ga0496105_0199747 3300048908 Bacteria 1632
870 Ga0496106_0427811 3300048909 Bacteria 1064
871 Ga0496107_0096609 3300048910 Bacteria 2162
872 Ga0496107_0651174 3300048910 Bacteria 777
873 Ga0496108_0823506 3300048911 Bacteria 800
874 Ga0496109_0299371 3300048912 Bacteria 1516
875 Ga0496109_0701222 3300048912 Bacteria 950
876 Ga0496109_0769235 3300048912 Bacteria 901
877 Ga0496110_0847415 3300048913 Bacteria 819
878 Ga0496111_0513647 3300048914 Bacteria 881
879 Ga0496112_0291079 3300048915 Bacteria 1579
880 Ga0496114_0000023 3300048917 Bacteria 219092
881 Ga0496114_0003594 3300048917 Bacteria 11915
882 Ga0496115_0186991 3300048918 Bacteria 1712
883 Ga0496116_0023413 3300048919 Bacteria 4600
884 Ga0496116_0070792 3300048919 Bacteria 2212
885 Ga0496117_0012001 3300048920 Bacteria 7696
886 Ga0496117_0347519 3300048920 Bacteria 767
887 Ga0496118_0072196 3300048921 Bacteria 2480
888 Ga0496121_0001586 3300048924 Bacteria 37825
889 Ga0496121_0444627 3300048924 Bacteria 837
890 Ga0496123_0138980 3300048926 Bacteria 1331
891 Ga0496124_0013815 3300048927 Bacteria 7853
892 Ga0501306_028879 3300049127 Bacteria 815
893 Ga0501308_006973 3300049128 Bacteria 1173
894 Ga0501309_032742 3300049129 Bacteria 772
895 Ga0495678_056299 3300049459 Bacteria 1496
896 Ga0501312_039374 3300049528 Bacteria 768
897 Ga0501312_100428 3300049528 Bacteria 542
898 Ga0501315_010886 3300049531 Bacteria 1102
899 Ga0501324_010942 3300049540 Bacteria 833
900 Ga0501031_0100697 3300049568 Bacteria 1885
901 Ga0501032_0007617 3300049569 Bacteria 7897
902 Ga0501033_0011285 3300049570 Bacteria 6840
903 Ga0501033_0047406 3300049570 Bacteria 3195
904 Ga0501034_0124569 3300049571 Bacteria 2562
905 Ga0501034_0254305 3300049571 Bacteria 1701
906 Ga0501036_0052934 3300049572 Bacteria 3437
907 Ga0501037_0022098 3300049573 Bacteria 4707
908 Ga0501039_0108807 3300049575 Bacteria 2166
909 Ga0501039_0231692 3300049575 Bacteria 1452
910 Ga0501039_1295760 3300049575 Bacteria 562
911 Ga0501043_0087084 3300049579 Bacteria 2454
912 Ga0501043_0580192 3300049579 Bacteria 830
913 Ga0501046_0067285 3300049580 Bacteria 2790
914 Ga0501047_0118418 3300049581 Bacteria 2530
915 Ga0501047_0613345 3300049581 Bacteria 909
916 Ga0501070_0060865 3300049586 Bacteria 3129
917 Ga0501074_0479843 3300049590 Bacteria 881
918 Ga0501223_010894 3300049663 Bacteria 1826
919 Ga0501035_0005503 3300049822 Bacteria 11965
920 Ga0501035_0325484 3300049822 Bacteria 1291
921 Ga0501044_0006511 3300049823 Bacteria 12903
922 Ga0501044_0334551 3300049823 Bacteria 1436
923 Ga0501044_0645655 3300049823 Bacteria 948
924 nmdc:mga06r32_4582_c1 3300050510 Bacteria 12394
925 nmdc:mga06r32_472908_c1 3300050510 Bacteria 1232
926 Ga0500641_0004071 3300053096 Bacteria 5161
927 Ga0500618_054292 3300053125 Bacteria 904
928 Ga0500658_0025713 3300053134 Bacteria 2263
929 Ga0500559_0336235 3300053136 Bacteria 707
930 Ga0500568_0001466 3300053139 Bacteria 15125
931 Ga0500616_0022236 3300053153 Bacteria 3543
932 Ga0587084_011320 3300059477 Bacteria 1187
933 Ga0587070_029253 3300059491 Bacteria 987
934 Ga0587073_0048839 3300059492 Bacteria 952
935 Ga0587077_019801 3300059493 Bacteria 1176
936 Ga0587086_013147 3300059507 Bacteria 1039
937 Ga0587088_001796 3300059508 Bacteria 2307
938 Ga0587090_013077 3300059510 Bacteria 1194
939 Ga0587090_017019 3300059510 Bacteria 1093
940 Ga0587090_018228 3300059510 Bacteria 1070
941 Ga0587091_019636 3300059511 Bacteria 1164
942 Ga0587094_010727 3300059513 Bacteria 1195
943 Ga0587106_010692 3300059605 Bacteria 1195
944 Ga0587125_006577 3300059607 Bacteria 1103
945 Ga0587099_003514 3300059622 Bacteria 1305
946 Ga0587101_009247 3300059623 Bacteria 1212
947 Ga0587115_010896 3300059626 Bacteria 1139
948 Ga0587128_008469 3300059630 Bacteria 1331
949 Ga0587062_012097 3300059639 Bacteria 1101
950 Ga0587069_013685 3300059642 Bacteria 1120
951 Ga0587072_023667 3300059643 Bacteria 1105
952 Ga0587075_013004 3300059644 Bacteria 1139
953 Ga0587078_007611 3300059646 Bacteria 1201
954 Ga0587079_020078 3300059647 Bacteria 1189
955 Ga0587102_004406 3300059649 Bacteria 1201
956 Ga0587110_003733 3300059654 Bacteria 1290
957 Ga0587071_016598 3300060344 Bacteria 1305
958 Ga0587071_028054 3300060344 Bacteria 1070
959 Ga0587111_0025777 3300060346 Bacteria 1167
960 Ga0587111_0032304 3300060346 Bacteria 1076
961 Ga0587111_0054815 3300060346 Bacteria 890
962 2514589766 2513237351 Bacteria 6968952
963 2600201227 2599185354 Bacteria 4398675
964 2600225415 2599185359 Bacteria 4772316
965 2643834330 2643221563 Bacteria 4726935
966 2644055255 2643221608 Bacteria 4724829
967 2738710386 2738541275 Bacteria 4830863
968 2738848811 2738541301 Bacteria 4834102
969 2738864540 2738541304 Bacteria 4833665
970 2739297058 2738543022 Bacteria 4835059
971 2739358736 2738543033 Bacteria 4833336
972 2778126616 2775507255 Bacteria 3945731
973 2819551044 2818991438 Bacteria 5793701
974 2819713727 2818991466 Bacteria 4748179
975 2830079226 2830075706 Bacteria 3855215
976 2852654322 2852653556 Bacteria 4050083
977 2852684248 2852680915 Bacteria 4100189
978 2879166947 2879163058 Bacteria 4223965
979 2885429955 2885429604 Bacteria 3642894
980 2928027938 2928027323 Bacteria 4382488
981 2928100484 2928100450 Bacteria 4837635
982 2928960548 2928959182 Bacteria 4725774
983 2928969883 2928968154 Bacteria 4633371
984 2984558685 2984555340 Bacteria 4247089
985 2984566812 2984564862 Bacteria 4339992
986 2993357997 2993356040 Bacteria 4247105
987 8057101923 8057101203 Bacteria 5034064
988 Ga0207680_10014195
989 JGI24736J21556_1003734
990 JGI24741J21665_1001830
991 JGI24741J21665_1004391
992 JGI24752J21851_1000513
993 JGI24740J21852_10005440
994 JGI24740J21852_10009791
995 JGI24739J22299_10003657
996 JGI24739J22299_10005383
997 JGI24739J22299_10009938
998 JGI24739J22299_10012840
999 JGI24737J22298_10001271
1000 JGI24737J22298_10002912
1001 JGI24737J22298_10009792
1002 JGI24735J21928_10000660
1003 JGI24735J21928_10001758
1004 JGI24735J21928_10004561
1005 JGI24735J21928_10012094
1006 JGI24735J21928_10018039
1007 JGI24750J21931_1000683
1008 JGI24748J21848_1000097
1009 JGI24738J21930_10002354
1010 JGI24738J21930_10003267
1011 JGI24749J21850_1002384
1012 JGI24034J26672_10000060
1013 JGI24742J22300_10002857
1014 JGI24751J29686_10050051
1015 JGI25153J46596_10000119
1016 Ga0055525_1000070
1017 Ga0055542_1000851
1018 Ga0055542_1005577
1019 Ga0055529_1000520
1020 Ga0055536_1007886
1021 Ga0055536_1016223
1022 Ga0055530_10000439
1023 Ga0055531_10001489
1024 Ga0055531_10009036
1025 Ga0065712_10343166
1026 Ga0065715_10000371
1027 Ga0065715_10244864
1028 Ga0070658_10000260
1029 Ga0070658_10003994
1030 Ga0070658_10006053
1031 Ga0070658_10030280
1032 Ga0070658_10038119
1033 Ga0070658_10061547
1034 Ga0070658_10091140
1035 Ga0070658_10100004
1036 Ga0070658_10183892
1037 Ga0070676_10017837
1038 Ga0070683_100001172
1039 Ga0070683_100012447
1040 Ga0070683_100121427
1041 Ga0070683_100136450
1042 Ga0070683_100843792
1043 Ga0070690_100000338
1044 Ga0070690_100003699
1045 Ga0070670_100003815
1046 Ga0070670_100009337
1047 Ga0070670_100020739
1048 Ga0070670_100039742
1049 Ga0070670_100045964
1050 Ga0070670_100051871
1051 Ga0070670_100180876
1052 Ga0070670_100323451
1053 Ga0070670_100357062
1054 Ga0070670_100481894
1055 Ga0070677_10030570
1056 Ga0070677_10128195
1057 Ga0068869_100249383
1058 Ga0070666_10000069
1059 Ga0070666_10000864
1060 Ga0070666_10040196
1061 Ga0070680_100000214
1062 Ga0070680_100001291
1063 Ga0070680_100005688
1064 Ga0070680_100109545
1065 Ga0068868_100003747
1066 Ga0070660_100012070
1067 Ga0070660_100030281
1068 Ga0070660_100038076
1069 Ga0070660_100038599
1070 Ga0070660_100093272
1071 Ga0070660_100101560
1072 Ga0070660_100130554
1073 Ga0070660_100190464
1074 Ga0070660_100200999
1075 Ga0070660_100289490
1076 Ga0070660_100392622
1077 Ga0070660_100811013
1078 Ga0070689_100119603
1079 Ga0070661_100000439
1080 Ga0070661_100005256
1081 Ga0070661_100277354
1082 Ga0070661_100283179
1083 Ga0070661_100450033
1084 Ga0070661_100743615
1085 Ga0070668_100000008
1086 Ga0070668_100007591
1087 Ga0070668_100020865
1088 Ga0070668_100049232
1089 Ga0070668_100199898
1090 Ga0070669_100000167
1091 Ga0070669_100012384
1092 Ga0070669_100185277
1093 Ga0070675_100005044
1094 Ga0070675_100147880
1095 Ga0070671_100001745
1096 Ga0070671_100005913
1097 Ga0070671_100024458
1098 Ga0070671_100074951
1099 Ga0070671_100077123
1100 Ga0070671_100165826
1101 Ga0070674_100010846
1102 Ga0070674_100015654
1103 Ga0070674_100022676
1104 Ga0070673_100057122
1105 Ga0070673_100824393
1106 Ga0070688_100001826
1107 Ga0070659_100005599
1108 Ga0070659_100005975
1109 Ga0070659_100059047
1110 Ga0070659_100276774
1111 Ga0070659_100576985
1112 Ga0070659_100820854
1113 Ga0070667_100000003
1114 Ga0070667_100001684
1115 Ga0070667_100326347
1116 Ga0070667_100904978
1117 Ga0070714_100040209
1118 Ga0070714_100897049
1119 Ga0070713_100012412
1120 Ga0070711_100035307
1121 Ga0070663_100003238
1122 Ga0070663_100008528
1123 Ga0070663_100034465
1124 Ga0070663_100051257
1125 Ga0070663_100052392
1126 Ga0070663_100155576
1127 Ga0070663_100170152
1128 Ga0070678_100010264
1129 Ga0070678_100275473
1130 Ga0070662_100000010
1131 Ga0070662_100057251
1132 Ga0070662_100066063
1133 Ga0070662_100072968
1134 Ga0070662_100078162
1135 Ga0070662_100131182
1136 Ga0070681_10019376
1137 Ga0070681_10027639
1138 Ga0070681_10033340
1139 Ga0070681_10230276
1140 Ga0070681_11340563
1141 Ga0068867_100112159
1142 Ga0070685_10000036
1143 Ga0070684_100121829
1144 Ga0070684_100124631
1145 Ga0070684_100135556
1146 Ga0070684_100139018
1147 Ga0068853_100000396
1148 Ga0068853_100008993
1149 Ga0068853_100014321
1150 Ga0068853_100032220
1151 Ga0068853_100043193
1152 Ga0068853_100055351
1153 Ga0068853_100119686
1154 Ga0068853_100224704
1155 Ga0068853_100390259
1156 Ga0068853_100936963
1157 Ga0068853_100949430
1158 Ga0070686_100000045
1159 Ga0070695_100351387
1160 Ga0070696_100916339
1161 Ga0070665_100000021
1162 Ga0070665_100000042
1163 Ga0070665_100000736
1164 Ga0070665_100070742
1165 Ga0068855_100001099
1166 Ga0068855_100020835
1167 Ga0068855_100078784
1168 Ga0068855_100129623
1169 Ga0068855_100352297
1170 Ga0068855_101094019
1171 Ga0068855_101149205
1172 Ga0070664_100000103
1173 Ga0070664_100013075
1174 Ga0070664_100037446
1175 Ga0070664_100040560
1176 Ga0070664_100086408
1177 Ga0070664_100097913
1178 Ga0070664_100488724
1179 Ga0070664_100834576
1180 Ga0068857_100025650
1181 Ga0068857_100026615
1182 Ga0068857_100047101
1183 Ga0068857_100126580
1184 Ga0068857_100167466
1185 Ga0068857_100349310
1186 Ga0068857_100437383
1187 Ga0068854_100010204
1188 Ga0068854_100037927
1189 Ga0068854_100057613
1190 Ga0068854_100071990
1191 Ga0068854_100091284
1192 Ga0068854_100099837
1193 Ga0068854_100164250
1194 Ga0068854_100179862
1195 Ga0068854_100247276
1196 Ga0068854_100253342
1197 Ga0068856_100000101
1198 Ga0068856_100023054
1199 Ga0068856_100108127
1200 Ga0068856_100503090
1201 Ga0068852_100001412
1202 Ga0068852_100011679
1203 Ga0068852_100332454
1204 Ga0068852_100380602
1205 Ga0068852_100536918
1206 Ga0068852_100730729
1207 Ga0068859_100013033
1208 Ga0068859_100013138
1209 Ga0068859_100643218
1210 Ga0068864_100058119
1211 Ga0068864_100195361
1212 Ga0068861_100000107
1213 Ga0068861_100010533
1214 Ga0068861_100012293
1215 Ga0068861_100031809
1216 Ga0068851_10037677
1217 Ga0068851_10120463
1218 Ga0068863_100000239
1219 Ga0068863_100062483
1220 Ga0068863_100309029
1221 Ga0068858_100000278
1222 Ga0068858_100002704
1223 Ga0068858_100016556
1224 Ga0068858_100140436
1225 Ga0068858_100140629
1226 Ga0068860_100000045
1227 Ga0068860_100000182
1228 Ga0068860_100369824
1229 Ga0068862_100000392
1230 Ga0068862_100000449
1231 Ga0068862_100957338
1232 Ga0081455_10000255
1233 Ga0081540_1076880
1234 Ga0081539_10016957
1235 Ga0070717_10028421
1236 Ga0070712_100101508
1237 Ga0097621_100238033
1238 Ga0075431_100009423
1239 Ga0068865_100067416
1240 Ga0097620_100007709
1241 Ga0097620_100013033
1242 Ga0097620_100013138
1243 Ga0097620_100643145
1244 Ga0097620_100870428
1245 Ga0079104_1056582
1246 Ga0105240_10023057
1247 Ga0105240_10152102
1248 Ga0105240_10583831
1249 Ga0105240_10984858
1250 Ga0105247_10226231
1251 Ga0105243_10012004
1252 Ga0105243_11049821
1253 Ga0105241_10006002
1254 Ga0105241_10370644
1255 Ga0105241_11051295
1256 Ga0105248_10000673
1257 Ga0105248_10000724
1258 Ga0105248_10001313
1259 Ga0105248_10084221
1260 Ga0105248_12208234
1261 Ga0105237_10009564
1262 Ga0105237_10038909
1263 Ga0105237_10106593
1264 Ga0105237_10167956
1265 Ga0105237_10481592
1266 Ga0105238_10020941
1267 Ga0105238_10126698
1268 Ga0105238_10134649
1269 Ga0105238_10430396
1270 Ga0105249_10000012
1271 Ga0105249_10050993
1272 Ga0105249_10065199
1273 Ga0105239_10188762
1274 Ga0105239_10921035
1275 Ga0105239_11200179
1276 Ga0105239_12297840
1277 Ga0157373_10018538
1278 Ga0157373_10061596
1279 Ga0157373_10204315
1280 Ga0157373_10229877
1281 Ga0157373_10279604
1282 Ga0157371_10000793
1283 Ga0157371_10003868
1284 Ga0157371_10012085
1285 Ga0157371_10034354
1286 Ga0157371_10308274
1287 Ga0157370_10048689
1288 Ga0157370_10065873
1289 Ga0157370_10941543
1290 Ga0157369_10013876
1291 Ga0157369_10027781
1292 Ga0157369_10090726
1293 Ga0157369_10160087
1294 Ga0157369_10260929
1295 Ga0157369_10544464
1296 Ga0157369_10802314
1297 Ga0157374_10009179
1298 Ga0157374_10192844
1299 Ga0163162_10672205
1300 Ga0163162_11143820
1301 Ga0157372_10029659
1302 Ga0157372_10043572
1303 Ga0157372_10054730
1304 Ga0157372_10137761
1305 Ga0157372_10202905
1306 Ga0157372_10414911
1307 Ga0157372_10473246
1308 Ga0157372_10636137
1309 Ga0157372_11164737
1310 Ga0157375_10072291
1311 Ga0157375_11949409
1312 Ga0163163_10000580
1313 Ga0163163_10446996
1314 Ga0163163_10647595
1315 Ga0157380_10003947
1316 Ga0157380_10019291
1317 Ga0157380_10347308
1318 Ga0157380_10765458
1319 Ga0157379_10001908
1320 Ga0183363_1008
1321 Ga0163161_10000202
1322 Ga0163161_10023353
1323 Ga0163161_10024583
1324 Ga0163161_10689802
1325 Ga0197907_10010936
1326 Ga0206356_10680400
1327 Ga0206353_11575149
1328 Ga0213875_10001046
1329 Ga0224712_10125141
1330 Ga0209147_100446
1331 Ga0209563_100053
1332 Ga0207425_1000146
1333 Ga0209646_1022374
1334 Ga0209677_106508
1335 Ga0209148_1000061
1336 Ga0209148_1000159
1337 Ga0209129_1003315
1338 Ga0209233_1006578
1339 Ga0209565_1021095
1340 Ga0209455_1000045
1341 Ga0209675_1000075
1342 Ga0209676_1000081
1343 Ga0209676_1000554
1344 Ga0209025_1000431
1345 Ga0209025_1018162
1346 Ga0209564_1000437
1347 Ga0209758_1000002
1348 Ga0209758_1000328
1349 Ga0209050_1000017
1350 Ga0209050_1000474
1351 Ga0209050_1023196
1352 Ga0209050_1024209
1353 Ga0209257_1000206
1354 Ga0209257_1000456
1355 Ga0207697_10000725
1356 Ga0207656_10000858
1357 Ga0207656_10028534
1358 Ga0207656_10101812
1359 Ga0207682_10000649
1360 Ga0207680_10000012
1361 Ga0207680_10035968
1362 Ga0207647_10001900
1363 Ga0207647_10030536
1364 Ga0207647_10047167
1365 Ga0207647_10083436
1366 Ga0207647_10094886
1367 Ga0207647_10158003
1368 Ga0207647_10614692
1369 Ga0207699_10670858
1370 Ga0207645_10020635
1371 Ga0207645_10123752
1372 Ga0207643_10202943
1373 Ga0207643_10249079
1374 Ga0207705_10000025
1375 Ga0207705_10000113
1376 Ga0207705_10000309
1377 Ga0207705_10005374
1378 Ga0207705_10020922
1379 Ga0207705_10056282
1380 Ga0207705_10065548
1381 Ga0207705_10109930
1382 Ga0207705_10114144
1383 Ga0207705_10132887
1384 Ga0207705_10135073
1385 Ga0207654_10000363
1386 Ga0207654_10001493
1387 Ga0207654_10205995
1388 Ga0207654_10471698
1389 Ga0207707_10782054
1390 Ga0207695_10009402
1391 Ga0207695_10009881
1392 Ga0207695_10020497
1393 Ga0207695_10105002
1394 Ga0207695_10125638
1395 Ga0207671_10000358
1396 Ga0207671_10008227
1397 Ga0207671_10033078
1398 Ga0207693_10003170
1399 Ga0207663_10074248
1400 Ga0207660_10000186
1401 Ga0207660_10001468
1402 Ga0207660_10007711
1403 Ga0207660_10017028
1404 Ga0207657_10000026
1405 Ga0207657_10003075
1406 Ga0207657_10008938
1407 Ga0207657_10009815
1408 Ga0207657_10016201
1409 Ga0207657_10020388
1410 Ga0207657_10030743
1411 Ga0207657_10091390
1412 Ga0207657_10092054
1413 Ga0207657_10096733
1414 Ga0207657_10134231
1415 Ga0207657_10146278
1416 Ga0207649_10000228
1417 Ga0207649_10000594
1418 Ga0207649_10002596
1419 Ga0207649_10029009
1420 Ga0207649_10038867
1421 Ga0207649_10040236
1422 Ga0207649_10379584
1423 Ga0207649_10467803
1424 Ga0207649_10665470
1425 Ga0207652_10006821
1426 Ga0207681_10000076
1427 Ga0207681_10009875
1428 Ga0207681_10046204
1429 Ga0207681_10363601
1430 Ga0207681_10778803
1431 Ga0207694_10000667
1432 Ga0207694_10006827
1433 Ga0207694_10020884
1434 Ga0207694_10036529
1435 Ga0207694_10103449
1436 Ga0207650_10001585
1437 Ga0207650_10009316
1438 Ga0207650_10046015
1439 Ga0207650_10091162
1440 Ga0207650_10118898
1441 Ga0207650_10120719
1442 Ga0207650_10437949
1443 Ga0207650_11253445
1444 Ga0207659_10014152
1445 Ga0207659_10380499
1446 Ga0207700_10130869
1447 Ga0207664_10158040
1448 Ga0207664_10681097
1449 Ga0207644_10000254
1450 Ga0207644_10000294
1451 Ga0207644_10009075
1452 Ga0207644_10029626
1453 Ga0207644_10259739
1454 Ga0207644_10292533
1455 Ga0207690_10000036
1456 Ga0207690_10000498
1457 Ga0207690_10001936
1458 Ga0207690_10294300
1459 Ga0207690_10516791
1460 Ga0207706_10000031
1461 Ga0207706_10000463
1462 Ga0207706_10004389
1463 Ga0207706_10009977
1464 Ga0207706_10090465
1465 Ga0207706_10192208
1466 Ga0207706_10193626
1467 Ga0207706_10266948
1468 Ga0207706_10379599
1469 Ga0207706_10448117
1470 Ga0207709_10000047
1471 Ga0207709_10366903
1472 Ga0207670_10091254
1473 Ga0207670_10489015
1474 Ga0207669_10001404
1475 Ga0207669_10003273
1476 Ga0207669_10139472
1477 Ga0207669_10445601
1478 Ga0207704_10421232
1479 Ga0207704_11201969
1480 Ga0207691_10043137
1481 Ga0207691_10481158
1482 Ga0207711_10000956
1483 Ga0207711_10002871
1484 Ga0207711_10031665
1485 Ga0207711_10037874
1486 Ga0207711_10154777
1487 Ga0207711_10416481
1488 Ga0207689_10037163
1489 Ga0207661_10001385
1490 Ga0207661_10014727
1491 Ga0207661_10048274
1492 Ga0207661_10188262
1493 Ga0207679_10000093
1494 Ga0207679_10011706
1495 Ga0207679_10040198
1496 Ga0207679_10112459
1497 Ga0207679_10145871
1498 Ga0207679_10262225
1499 Ga0207679_10744536
1500 Ga0207667_10000001
1501 Ga0207667_10003819
1502 Ga0207667_10008760
1503 Ga0207667_10016498
1504 Ga0207667_10116955
1505 Ga0207667_10479282
1506 Ga0207667_10930824
1507 Ga0207667_11089459
1508 Ga0207667_11208576
1509 Ga0207712_10000021
1510 Ga0207712_10015715
1511 Ga0207712_10133053
1512 Ga0207668_10000480
1513 Ga0207668_10046466
1514 Ga0207668_10154101
1515 Ga0207668_10340755
1516 Ga0207640_10003839
1517 Ga0207640_10010560
1518 Ga0207640_10025944
1519 Ga0207640_10028754
1520 Ga0207640_10095869
1521 Ga0207640_10111622
1522 Ga0207640_10391295
1523 Ga0207640_10455623
1524 Ga0207640_10546706
1525 Ga0207640_11098012
1526 Ga0207658_10000002
1527 Ga0207658_10000936
1528 Ga0207658_10003747
1529 Ga0207658_10053655
1530 Ga0207658_10376411
1531 Ga0207677_10120313
1532 Ga0207703_10000587
1533 Ga0207703_10004856
1534 Ga0207703_10008434
1535 Ga0207703_10106943
1536 Ga0207639_10001448
1537 Ga0207639_10002653
1538 Ga0207639_10002879
1539 Ga0207639_10017154
1540 Ga0207639_10024716
1541 Ga0207639_10037183
1542 Ga0207639_10051214
1543 Ga0207639_10161027
1544 Ga0207639_10818689
1545 Ga0207678_10008204
1546 Ga0207678_10011522
1547 Ga0207678_10011562
1548 Ga0207678_10017323
1549 Ga0207678_10079060
1550 Ga0207678_10094520
1551 Ga0207678_10097402
1552 Ga0207678_10137527
1553 Ga0207708_10166878
1554 Ga0207708_10359911
1555 Ga0207702_10000353
1556 Ga0207702_10000963
1557 Ga0207702_10003254
1558 Ga0207702_10031113
1559 Ga0207702_10436237
1560 Ga0207641_10000589
1561 Ga0207641_10017753
1562 Ga0207641_10207702
1563 Ga0207648_10079457
1564 Ga0207648_10359804
1565 Ga0207648_11142938
1566 Ga0207676_10000921
1567 Ga0207676_10036689
1568 Ga0207674_10009710
1569 Ga0207674_10015944
1570 Ga0207674_10018633
1571 Ga0207674_10108795
1572 Ga0207674_10124858
1573 Ga0207674_10185300
1574 Ga0207674_10324607
1575 Ga0207674_10584636
1576 Ga0207674_10961208
1577 Ga0207675_100000317
1578 Ga0207675_100003402
1579 Ga0207675_100020505
1580 Ga0207675_100046136
1581 Ga0207683_10498428
1582 Ga0207698_10001652
1583 Ga0207698_10003330
1584 Ga0207698_10003733
1585 Ga0207698_10008213
1586 Ga0207698_10011430
1587 Ga0207698_10027408
1588 Ga0207698_10055506
1589 Ga0207698_10174954
1590 Ga0207698_10237893
1591 Ga0207698_10370511
1592 Ga0207698_10515516
1593 Ga0209281_1044830
1594 Ga0209968_1051459
1595 Ga0209970_1013435
1596 Ga0209983_1044476
1597 Ga0209974_10003691
1598 Ga0209974_10004663
1599 Ga0209974_10076568
1600 Ga0268266_10000015
1601 Ga0268266_10000054
1602 Ga0268266_10000370
1603 Ga0268266_10026889
1604 Ga0268266_10720543
1605 Ga0268265_10000278
1606 Ga0268265_10000684
1607 Ga0268265_10087634
1608 Ga0268265_10267811
1609 Ga0268264_10000074
1610 Ga0268264_10000101
1611 Ga0268264_10250794
1612 Ga0265325_10040778
1613 Ga0307408_100030751
1614 Ga0307408_100526236
1615 Ga0307408_100666880
1616 Ga0307405_10081664
1617 Ga0307405_10177726
1618 Ga0307405_10184596
1619 Ga0307405_10255564
1620 Ga0307405_10279681
1621 Ga0307405_10376730
1622 Ga0307405_10706175
1623 Ga0307405_11156635
1624 Ga0307413_10005227
1625 Ga0307413_10011429
1626 Ga0307413_10017225
1627 Ga0307413_10096088
1628 Ga0307413_10238620
1629 Ga0307413_10251893
1630 Ga0307413_10477770
1631 Ga0307413_10523625
1632 Ga0307413_10596503
1633 Ga0307413_10751871
1634 Ga0307413_10861096
1635 Ga0307413_11250621
1636 Ga0307410_10000171
1637 Ga0307410_10000714
1638 Ga0307410_10003256
1639 Ga0307410_10011673
1640 Ga0307410_10039894
1641 Ga0307410_10047498
1642 Ga0307410_10096242
1643 Ga0307410_10251093
1644 Ga0307410_10426779
1645 Ga0307410_10905519
1646 Ga0307406_10026407
1647 Ga0307406_10062967
1648 Ga0307406_10091778
1649 Ga0307406_10138152
1650 Ga0307406_10144722
1651 Ga0307406_10198244
1652 Ga0307406_10237855
1653 Ga0307406_10369982
1654 Ga0307406_10407555
1655 Ga0307406_10513730
1656 Ga0307406_10793752
1657 Ga0307406_11499766
1658 Ga0307407_10001776
1659 Ga0307407_10051911
1660 Ga0307407_10174451
1661 Ga0307407_10204977
1662 Ga0307407_10337107
1663 Ga0307407_10414531
1664 Ga0307407_10417728
1665 Ga0307412_10018619
1666 Ga0307412_10023079
1667 Ga0307412_10028656
1668 Ga0307412_10323097
1669 Ga0307412_10462975
1670 Ga0307412_10691674
1671 Ga0307412_10872797
1672 Ga0307409_100013575
1673 Ga0307409_100027063
1674 Ga0307409_100049902
1675 Ga0307409_100118712
1676 Ga0307409_100183598
1677 Ga0307409_100247933
1678 Ga0307409_100354109
1679 Ga0307409_100615236
1680 Ga0307409_100804946
1681 Ga0307409_100871658
1682 Ga0307409_101279147
1683 Ga0307416_100066041
1684 Ga0307416_100139367
1685 Ga0307416_100310140
1686 Ga0307416_100327107
1687 Ga0307416_100343547
1688 Ga0307416_100808924
1689 Ga0307416_100814294
1690 Ga0307416_100967947
1691 Ga0307416_101017378
1692 Ga0307416_101169828
1693 Ga0307416_101746907
1694 Ga0307416_101942736
1695 Ga0307416_102165352
1696 Ga0307414_10000070
1697 Ga0307414_10005824
1698 Ga0307414_10025523
1699 Ga0307414_10029337
1700 Ga0307414_10089709
1701 Ga0307414_10097696
1702 Ga0307414_10187540
1703 Ga0307414_10280625
1704 Ga0307414_10337586
1705 Ga0307414_10406014
1706 Ga0307414_10554670
1707 Ga0307414_10573572
1708 Ga0307414_11443468
1709 Ga0307411_10001039
1710 Ga0307411_10002793
1711 Ga0307411_10010109
1712 Ga0307411_10048286
1713 Ga0307411_10066476
1714 Ga0307411_10082801
1715 Ga0307411_10118736
1716 Ga0307411_10140883
1717 Ga0307411_10143600
1718 Ga0307411_10199142
1719 Ga0307411_10290861
1720 Ga0307411_10406056
1721 Ga0307411_10435721
1722 Ga0307411_10552820
1723 Ga0307415_100063723
1724 Ga0307415_100146487
1725 Ga0307415_100249373
1726 Ga0307415_100479673
1727 Ga0307415_100853746
1728 Ga0307415_101191142
1729 Ga0373928_0079319
1730 Ga0373945_0081564
1731 Ga0373954_0166962
1732 Ga0373956_0081265
1733 Ga0373960_0009951
1734 Ga0373955_0002343
1735 Ga0373942_0055009
1736 Ga0373935_0060866
1737 Ga0373927_0456006
1738 Ga0373933_0219165
1739 Ga0373937_0013140
1740 Ga0373925_0033233
1741 Ga0395899_0071044
1742 Ga0395899_0082795
1743 Ga0395899_0285119
1744 Ga0395899_0319422
1745 Ga0395899_0383874
1746 Ga0395900_0000530
1747 Ga0395900_0005218
1748 Ga0395900_0077026
1749 Ga0395900_0114158
1750 Ga0395900_0349808
1751 Ga0395900_0358049
1752 Ga0395900_0999911
1753 Ga0395900_1243184
1754 Ga0395898_0049804
1755 Ga0395898_0197677
1756 Ga0395898_0699830
1757 Ga0395898_0783112
1758 Ga0395905_0001285
1759 Ga0395905_0011013
1760 Ga0395905_0022072
1761 Ga0395905_0028153
1762 Ga0395905_0133063
1763 Ga0395905_0273127
1764 Ga0395905_0293259
1765 Ga0395905_0346302
1766 Ga0395905_0355367
1767 Ga0395905_1073163
1768 Ga0395905_1130855
1769 Ga0436364_0986946
1770 Ga0395901_0001493
1771 Ga0395901_0002214
1772 Ga0395901_0012559
1773 Ga0395901_0043255
1774 Ga0395901_0085433
1775 Ga0395901_0207392
1776 Ga0395901_0283402
1777 Ga0395901_0285656
1778 Ga0395901_0360187
1779 Ga0395901_0399999
1780 Ga0395901_0928287
1781 Ga0395901_1204279
1782 Ga0395901_1268889
1783 Ga0237819_02700
1784 Ga0237816_03377
1785 Ga0436365_0309933
1786 Ga0436365_1077224
1787 Ga0439439_0046363
1788 Ga0439453_0075515
1789 Ga0439461_0011930
1790 Ga0439465_0003226
1791 Ga0439465_0043772
1792 Ga0439431_0000173
1793 Ga0439437_025904
1794 Ga0439442_004433
1795 Ga0439445_0000243
1796 Ga0439445_0000812
1797 Ga0439448_0003857
1798 Ga0439446_0050764
1799 Ga0439458_0024488
1800 Ga0439434_0002056
1801 Ga0439435_0027753
1802 Ga0466969_0236731
1803 Ga0466969_0251425
1804 Ga0466966_0035830
1805 Ga0466961_0039764
1806 Ga0466961_0088685
1807 Ga0466961_0098840
1808 Ga0466963_0038902
1809 Ga0466963_0148953
1810 Ga0466963_0526717
1811 Ga0466963_0723809
1812 Ga0466957_0005363
1813 Ga0466957_0082355
1814 Ga0466957_0213041
1815 Ga0466957_0535453
1816 Ga0466957_0559442
1817 Ga0466959_0053738
1818 Ga0466959_0079949
1819 Ga0466959_0574090
1820 Ga0466958_0052142
1821 Ga0466958_0078077
1822 Ga0466967_0020236
1823 Ga0466967_0114012
1824 Ga0466967_0269427
1825 Ga0466967_0704415
1826 Ga0466967_0958256
1827 Ga0495627_000459
1828 Ga0495584_0009212
1829 Ga0495585_0012251
1830 Ga0495632_0026424
1831 Ga0495643_0003241
1832 Ga0495648_0282321
1833 Ga0495642_0015044
1834 Ga0495642_0179917
1835 Ga0495621_0003173
1836 Ga0495621_0008245
1837 Ga0495621_0087584
1838 Ga0495621_0178644
1839 Ga0495633_0060359
1840 Ga0495668_0015140
1841 Ga0495668_0046817
1842 Ga0495625_0000936
1843 Ga0495625_0009545
1844 Ga0495659_0057924
1845 Ga0495669_0013865
1846 Ga0495670_0116035
1847 Ga0495670_0255562
1848 Ga0495677_0003064
1849 Ga0495686_0001794
1850 Ga0495602_0029261
1851 Ga0496100_0275118
1852 Ga0496100_0897532
1853 Ga0496101_0275504
1854 Ga0496103_0000845
1855 Ga0496104_0159246
1856 Ga0496105_0199747
1857 Ga0496106_0427811
1858 Ga0496107_0096609
1859 Ga0496107_0651174
1860 Ga0496108_0823506
1861 Ga0496109_0299371
1862 Ga0496109_0701222
1863 Ga0496109_0769235
1864 Ga0496110_0847415
1865 Ga0496111_0513647
1866 Ga0496112_0291079
1867 Ga0496114_0000023
1868 Ga0496114_0003594
1869 Ga0496115_0186991
1870 Ga0496116_0023413
1871 Ga0496116_0070792
1872 Ga0496117_0012001
1873 Ga0496117_0347519
1874 Ga0496118_0072196
1875 Ga0496121_0001586
1876 Ga0496121_0444627
1877 Ga0496123_0138980
1878 Ga0496124_0013815
1879 Ga0501306_028879
1880 Ga0501308_006973
1881 Ga0501309_032742
1882 Ga0495678_056299
1883 Ga0501312_039374
1884 Ga0501312_100428
1885 Ga0501315_010886
1886 Ga0501324_010942
1887 Ga0501031_0100697
1888 Ga0501032_0007617
1889 Ga0501033_0011285
1890 Ga0501033_0047406
1891 Ga0501034_0124569
1892 Ga0501034_0254305
1893 Ga0501036_0052934
1894 Ga0501037_0022098
1895 Ga0501039_0108807
1896 Ga0501039_0231692
1897 Ga0501039_1295760
1898 Ga0501043_0087084
1899 Ga0501043_0580192
1900 Ga0501046_0067285
1901 Ga0501047_0118418
1902 Ga0501047_0613345
1903 Ga0501070_0060865
1904 Ga0501074_0479843
1905 Ga0501223_010894
1906 Ga0501035_0005503
1907 Ga0501035_0325484
1908 Ga0501044_0006511
1909 Ga0501044_0334551
1910 Ga0501044_0645655
1911 nmdc:mga06r32_4582_c1
1912 nmdc:mga06r32_472908_c1
1913 Ga0500641_0004071
1914 Ga0500618_054292
1915 Ga0500658_0025713
1916 Ga0500559_0336235
1917 Ga0500568_0001466
1918 Ga0500616_0022236
1919 Ga0587084_011320
1920 Ga0587070_029253
1921 Ga0587073_0048839
1922 Ga0587077_019801
1923 Ga0587086_013147
1924 Ga0587088_001796
1925 Ga0587090_013077
1926 Ga0587090_017019
1927 Ga0587090_018228
1928 Ga0587091_019636
1929 Ga0587094_010727
1930 Ga0587106_010692
1931 Ga0587125_006577
1932 Ga0587099_003514
1933 Ga0587101_009247
1934 Ga0587115_010896
1935 Ga0587128_008469
1936 Ga0587062_012097
1937 Ga0587069_013685
1938 Ga0587072_023667
1939 Ga0587075_013004
1940 Ga0587078_007611
1941 Ga0587079_020078
1942 Ga0587102_004406
1943 Ga0587110_003733
1944 Ga0587071_016598
1945 Ga0587071_028054
1946 Ga0587111_0025777
1947 Ga0587111_0032304
1948 Ga0587111_0054815
1949 2514589766
1950 2600201227
1951 2600225415
1952 2643834330
1953 2644055255
1954 2738710386
1955 2738848811
1956 2738864540
1957 2739297058
1958 2739358736
1959 2778126616
1960 2819551044
1961 2819713727
1962 2830079226
1963 2852654322
1964 2852684248
1965 2879166947
1966 2885429955
1967 2928027938
1968 2928100484
1969 2928960548
1970 2928969883
1971 2984558685
1972 2984566812
1973 2993357997
1974 8057101923

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00380

Ribosomal_S9

Ribosomal protein S9/S16

82

202

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7m4u-assembly1.cif.gz_i a. baumannii ribosome-eravacycline complex: 30s 0.9661 50 152
8d8k-assembly1.cif.gz_I yeast mitochondrial small subunit assembly intermediate (state 2) 0.9639 40 151
8d8l-assembly1.cif.gz_I yeast mitochondrial small subunit assembly intermediate (state 3) 0.9639 40 151
4v48-assembly1.cif.gz_BI real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.9621 50 146
5mrf-assembly1.cif.gz_II structure of the yeast mitochondrial ribosome - class c 0.96 40 151
ID Description Score Start End Superfamily
af_Q54CK4_214_339_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9758 50 151 3.30.230.10
af_Q8IHZ4_170_300_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9633 48 151 3.30.230.10
af_P34388_249_392_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9307 49 151 3.30.230.10
af_O94150_208_336_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8739 48 174 3.30.230.10
af_O14006_146_271_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.864 50 174 3.30.230.10
ID Description Score Start End GO Terms
AF-A0A4V1SYB7-F1-model_v4 deleted 0.9923 42 138
AF-A0A1F7B3Z8-F1-model_v4 Small ribosomal subunit protein uS9 0.9876 49 152 GO:0003723
GO:0003735
GO:0006412
GO:0022627
AF-A0A359E0W0-F1-model_v4 Small ribosomal subunit protein uS9 (30S ribosomal protein S9) 0.9875 49 151 GO:0003723
GO:0003735
GO:0006412
GO:0022627
AF-A0A2E8BEA7-F1-model_v4 30S ribosomal protein S9 0.9866 51 150 GO:0003723
GO:0003735
GO:0005737
GO:0006412
GO:0015935
AF-F4NVL8-F1-model_v4 Small ribosomal subunit protein uS9m (37S ribosomal protein S9, mitochondrial) 0.9841 44 152 GO:0003723
GO:0003735
GO:0005763
GO:0006412

Map