F487547

General Info

Members Datasets Scaffolds Average Seq Length
987 385 1974 162

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100860822|Ga0307408_1008608222
Length 196
Sequence MASICAATLPRAPWTECRHELLSDETVDPPEGDLPLGRAETTPRREAVATSEPEQEFEGLDVDSPLVGIIMGSKSDMDTMQKAAAELNDRGIRNEVRVMSAHRDPDVVADYCKNAHMRGLKVIIAGAGLAAALPGVAAAHTDLPVIGVPLTSSNSVAGGLDAMLAIAQMPPGVPVACVAVNGARNAAILAAKIINA

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
131 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
132 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
198 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
199 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
200 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
201 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
202 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
203 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
208 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
209 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
210 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
211 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
212 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
213 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
214 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
215 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
216 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
217 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
218 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
219 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
224 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
225 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
227 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
228 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
229 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
230 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
231 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
232 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
233 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
234 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
235 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
236 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
237 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
238 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
239 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
240 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
241 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
242 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
243 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
244 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
245 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
246 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
247 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
248 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
249 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
250 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
251 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
252 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
253 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
254 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
255 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
256 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
257 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
258 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
259 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
260 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
261 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
262 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
263 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
264 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
265 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
266 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
267 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
268 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
269 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
270 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
271 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
272 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
273 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
274 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
275 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
276 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
277 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
278 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
279 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
280 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
281 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
282 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
283 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
284 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
285 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
286 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
287 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
288 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
289 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
290 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
291 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
292 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
293 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
294 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
295 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
296 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
297 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
298 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
299 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
300 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
301 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
302 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
303 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
304 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
305 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
306 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
307 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
308 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
309 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
310 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
311 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
312 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
313 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
314 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
315 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
316 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
317 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
318 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
319 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
320 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
321 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
322 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
323 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
324 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
325 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
326 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
327 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
328 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
329 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
330 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
331 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
332 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
333 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
348 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
349 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
350 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
351 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
352 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
353 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
354 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
355 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
356 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
357 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
358 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
359 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
360 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
361 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
362 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
365 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
366 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
367 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
368 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
369 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
370 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
371 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
372 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
373 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
374 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
375 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
376 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
377 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
378 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
379 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
380 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
381 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
382 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
383 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
384 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
385 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.71
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.74
Nodule 0
Rhizoplane 10.33
Rhizosphere 84.8
Stem 0
Stem Tuber 0
Unclassified 3.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100860822 3300031548 Bacteria 827
2 LJQas_1000528 3300000549 Bacteria 6308
3 JGI24746J21847_1000506 3300001977 Bacteria 5853
4 JGI24034J26672_10000575 3300002239 Bacteria 4690
5 JGI24751J29686_10026639 3300002459 Bacteria 1200
6 JGI25406J46586_10071554 3300003203 Bacteria 1087
7 JGI25406J46586_10165814 3300003203 Bacteria 644
8 JGI25407J50210_10032826 3300003373 Bacteria 1342
9 Ga0070658_10663830 3300005327 Bacteria 905
10 Ga0070676_10397618 3300005328 Bacteria 958
11 Ga0070683_100004421 3300005329 Bacteria 11587
12 Ga0070683_100005278 3300005329 Bacteria 10757
13 Ga0070683_100024596 3300005329 Bacteria 5396
14 Ga0070683_100519638 3300005329 Bacteria 1138
15 Ga0070683_100598868 3300005329 Bacteria 1055
16 Ga0070670_100174928 3300005331 Bacteria 1863
17 Ga0070677_10000027 3300005333 Bacteria 43465
18 Ga0068869_100030350 3300005334 Bacteria 3794
19 Ga0068869_100243450 3300005334 Bacteria 1434
20 Ga0070666_10015472 3300005335 Bacteria 4867
21 Ga0070666_10260970 3300005335 Bacteria 1228
22 Ga0070666_10335100 3300005335 Unclassified 1081
23 Ga0070680_100023287 3300005336 Bacteria 4939
24 Ga0070682_100000057 3300005337 Bacteria 108832
25 Ga0070682_100000802 3300005337 Bacteria 18420
26 Ga0070682_100177621 3300005337 Bacteria 1485
27 Ga0070682_100183136 3300005337 Bacteria 1465
28 Ga0068868_100000864 3300005338 Bacteria 20513
29 Ga0068868_100002371 3300005338 Bacteria 13043
30 Ga0068868_100062366 3300005338 Bacteria 2955
31 Ga0068868_100093514 3300005338 Bacteria 2424
32 Ga0070660_100102893 3300005339 Bacteria 2264
33 Ga0070689_100024077 3300005340 Bacteria 4565
34 Ga0070689_100055310 3300005340 Bacteria 3075
35 Ga0070691_10000553 3300005341 Bacteria 14202
36 Ga0070687_100074341 3300005343 Bacteria 1834
37 Ga0070687_100640851 3300005343 Bacteria 735
38 Ga0070661_100000031 3300005344 Bacteria 113816
39 Ga0070692_10009721 3300005345 Bacteria 4351
40 Ga0070692_10149828 3300005345 Bacteria 1328
41 Ga0070668_100022932 3300005347 Bacteria 4719
42 Ga0070669_100237228 3300005353 Bacteria 1447
43 Ga0070675_100000015 3300005354 Bacteria 201080
44 Ga0070674_100000003 3300005356 Bacteria 258221
45 Ga0070674_100000316 3300005356 Bacteria 23768
46 Ga0070674_100161769 3300005356 Bacteria 1699
47 Ga0070674_100168820 3300005356 Bacteria 1666
48 Ga0070674_100201223 3300005356 Bacteria 1538
49 Ga0070674_101566037 3300005356 Bacteria 593
50 Ga0070673_100014734 3300005364 Bacteria 5462
51 Ga0070673_100373080 3300005364 Bacteria 1271
52 Ga0070673_100567107 3300005364 Bacteria 1033
53 Ga0070688_100000534 3300005365 Bacteria 19212
54 Ga0070688_100002238 3300005365 Bacteria 9761
55 Ga0070688_100529261 3300005365 Unclassified 893
56 Ga0070659_100107304 3300005366 Bacteria 2252
57 Ga0070667_100150412 3300005367 Bacteria 2045
58 Ga0070667_100265017 3300005367 Bacteria 1539
59 Ga0070667_101992022 3300005367 Unclassified 547
60 Ga0070703_10116555 3300005406 Bacteria 963
61 Ga0070714_100035028 3300005435 Bacteria 4205
62 Ga0070713_100000040 3300005436 Bacteria 82527
63 Ga0070710_11144748 3300005437 Bacteria 573
64 Ga0070701_10266820 3300005438 Bacteria 1040
65 Ga0070711_100068062 3300005439 Bacteria 2500
66 Ga0070711_100095642 3300005439 Bacteria 2150
67 Ga0070700_100681518 3300005441 Bacteria 815
68 Ga0070694_100580189 3300005444 Bacteria 901
69 Ga0070663_100590765 3300005455 Unclassified 933
70 Ga0070678_100004739 3300005456 Bacteria 7751
71 Ga0070678_100045503 3300005456 Bacteria 3141
72 Ga0070678_100123891 3300005456 Bacteria 2042
73 Ga0070662_100000005 3300005457 Bacteria 183056
74 Ga0070681_10186330 3300005458 Bacteria 1996
75 Ga0070681_10232246 3300005458 Bacteria 1759
76 Ga0070681_10594513 3300005458 Bacteria 1021
77 Ga0068867_100000254 3300005459 Bacteria 35276
78 Ga0068867_100069223 3300005459 Bacteria 2635
79 Ga0070685_10000689 3300005466 Bacteria 18293
80 Ga0070685_10001213 3300005466 Bacteria 13716
81 Ga0070685_10023692 3300005466 Bacteria 3364
82 Ga0070685_10031748 3300005466 Bacteria 2954
83 Ga0070685_10082572 3300005466 Bacteria 1929
84 Ga0070685_10491339 3300005466 Bacteria 867
85 Ga0070706_100105033 3300005467 Bacteria 2628
86 Ga0070699_100692192 3300005518 Bacteria 931
87 Ga0070679_100000153 3300005530 Bacteria 55882
88 Ga0070684_100039878 3300005535 Bacteria 4041
89 Ga0070684_100297046 3300005535 Bacteria 1482
90 Ga0070684_100432169 3300005535 Bacteria 1216
91 Ga0070684_100640046 3300005535 Bacteria 989
92 Ga0070684_100792365 3300005535 Unclassified 886
93 Ga0070697_101134740 3300005536 Bacteria 696
94 Ga0068853_100005454 3300005539 Bacteria 9967
95 Ga0070672_100000007 3300005543 Bacteria 104699
96 Ga0070672_100271225 3300005543 Bacteria 1433
97 Ga0070686_100015611 3300005544 Bacteria 4404
98 Ga0070686_100074074 3300005544 Bacteria 2237
99 Ga0070686_100423316 3300005544 Bacteria 1018
100 Ga0070695_100704326 3300005545 Bacteria 802
101 Ga0070695_101092870 3300005545 Bacteria 652
102 Ga0070696_100205020 3300005546 Bacteria 1473
103 Ga0070693_100046061 3300005547 Bacteria 2475
104 Ga0070665_100000159 3300005548 Bacteria 122613
105 Ga0070665_100003550 3300005548 Bacteria 16555
106 Ga0070665_100004595 3300005548 Bacteria 14443
107 Ga0070665_100806546 3300005548 Bacteria 952
108 Ga0070665_101171220 3300005548 Bacteria 780
109 Ga0070665_101749338 3300005548 Bacteria 629
110 Ga0070704_100002311 3300005549 Bacteria 10668
111 Ga0070704_100194204 3300005549 Bacteria 1634
112 Ga0070704_100281438 3300005549 Bacteria 1378
113 Ga0070704_100313272 3300005549 Bacteria 1312
114 Ga0070704_100374492 3300005549 Bacteria 1208
115 Ga0068855_100485814 3300005563 Bacteria 1344
116 Ga0070664_100187226 3300005564 Bacteria 1843
117 Ga0068857_100246536 3300005577 Bacteria 1637
118 Ga0068854_100000371 3300005578 Bacteria 28637
119 Ga0068854_100067303 3300005578 Bacteria 2609
120 Ga0068854_100366795 3300005578 Bacteria 1183
121 Ga0068856_100002486 3300005614 Bacteria 18972
122 Ga0068856_100047894 3300005614 Bacteria 4212
123 Ga0068856_100082112 3300005614 Bacteria 3198
124 Ga0070702_100093761 3300005615 Bacteria 1826
125 Ga0070702_100216888 3300005615 Bacteria 1277
126 Ga0070702_100980639 3300005615 Bacteria 667
127 Ga0068852_100000103 3300005616 Bacteria 56542
128 Ga0068852_100230204 3300005616 Bacteria 1766
129 Ga0068852_100265134 3300005616 Bacteria 1651
130 Ga0068859_100181876 3300005617 Bacteria 2185
131 Ga0068859_100481255 3300005617 Bacteria 1337
132 Ga0068864_100000066 3300005618 Bacteria 116383
133 Ga0068866_10000002 3300005718 Bacteria 394090
134 Ga0068866_10000457 3300005718 Bacteria 18656
135 Ga0068866_10611905 3300005718 Bacteria 737
136 Ga0068861_100173829 3300005719 Bacteria 1787
137 Ga0068861_100716938 3300005719 Bacteria 931
138 Ga0068851_10016292 3300005834 Bacteria 3554
139 Ga0068851_10265522 3300005834 Bacteria 977
140 Ga0068870_10043765 3300005840 Bacteria 2336
141 Ga0068863_100000032 3300005841 Bacteria 172402
142 Ga0068858_100000043 3300005842 Bacteria 132444
143 Ga0068858_100000049 3300005842 Bacteria 122693
144 Ga0068858_100041610 3300005842 Bacteria 4260
145 Ga0068858_100178442 3300005842 Bacteria 2005
146 Ga0068858_100179560 3300005842 Bacteria 1998
147 Ga0068858_100653381 3300005842 Bacteria 1022
148 Ga0068860_100009747 3300005843 Bacteria 9536
149 Ga0068860_100036300 3300005843 Bacteria 4723
150 Ga0068860_101447335 3300005843 Bacteria 708
151 Ga0068860_101855181 3300005843 Bacteria 624
152 Ga0068862_100084251 3300005844 Bacteria 2762
153 Ga0068862_100097013 3300005844 Bacteria 2573
154 Ga0068862_102011356 3300005844 Bacteria 588
155 Ga0081455_10005275 3300005937 Bacteria 14201
156 Ga0081455_10009930 3300005937 Bacteria 9737
157 Ga0081455_10011084 3300005937 Bacteria 9077
158 Ga0081455_10029633 3300005937 Bacteria 4987
159 Ga0081455_10044620 3300005937 Bacteria 3865
160 Ga0081455_10068495 3300005937 Bacteria 2953
161 Ga0081455_10109091 3300005937 Bacteria 2203
162 Ga0081455_10110646 3300005937 Bacteria 2183
163 Ga0081455_10285274 3300005937 Bacteria 1191
164 Ga0081455_10343374 3300005937 Bacteria 1055
165 Ga0081455_10394449 3300005937 Unclassified 963
166 Ga0081455_10437480 3300005937 Unclassified 897
167 Ga0081455_10547397 3300005937 Bacteria 766
168 Ga0081538_10000135 3300005981 Bacteria 76510
169 Ga0081538_10000204 3300005981 Bacteria 65722
170 Ga0081538_10001004 3300005981 Bacteria 30038
171 Ga0081538_10035826 3300005981 Bacteria 3252
172 Ga0081538_10128546 3300005981 Bacteria 1197
173 Ga0081540_1000686 3300005983 Bacteria 31589
174 Ga0081540_1171445 3300005983 Bacteria 825
175 Ga0081539_10001602 3300005985 Bacteria 37290
176 Ga0081539_10028563 3300005985 Bacteria 3504
177 Ga0075365_10000180 3300006038 Bacteria 20608
178 Ga0075365_10005742 3300006038 Bacteria 6734
179 Ga0075365_10012257 3300006038 Bacteria 5082
180 Ga0075365_10023529 3300006038 Bacteria 3875
181 Ga0075365_10049013 3300006038 Bacteria 2782
182 Ga0075365_10078811 3300006038 Bacteria 2228
183 Ga0075365_10090970 3300006038 Bacteria 2078
184 Ga0075365_10265918 3300006038 Bacteria 1206
185 Ga0075365_10340651 3300006038 Bacteria 1057
186 Ga0075363_100155442 3300006048 Bacteria 1293
187 Ga0075363_100200801 3300006048 Bacteria 1139
188 Ga0075364_10371169 3300006051 Bacteria 976
189 Ga0075364_10398570 3300006051 Bacteria 939
190 Ga0075364_10488826 3300006051 Bacteria 841
191 Ga0075432_10190437 3300006058 Bacteria 807
192 Ga0070715_10000012 3300006163 Bacteria 173731
193 Ga0070715_10253564 3300006163 Bacteria 921
194 Ga0070712_100002001 3300006175 Bacteria 12481
195 Ga0070712_100368639 3300006175 Bacteria 1180
196 Ga0075367_10362043 3300006178 Bacteria 916
197 Ga0097621_100210577 3300006237 Bacteria 1691
198 Ga0068871_100310687 3300006358 Bacteria 1386
199 Ga0075428_100105390 3300006844 Bacteria 3075
200 Ga0075430_100001324 3300006846 Bacteria 19981
201 Ga0075430_100045670 3300006846 Bacteria 3699
202 Ga0075431_100011036 3300006847 Bacteria 9092
203 Ga0075431_100019567 3300006847 Bacteria 6907
204 Ga0075431_100070406 3300006847 Bacteria 3609
205 Ga0075431_100347497 3300006847 Bacteria 1492
206 Ga0075431_101182759 3300006847 Bacteria 728
207 Ga0075433_10001758 3300006852 Bacteria 16203
208 Ga0075433_10016159 3300006852 Bacteria 6140
209 Ga0075433_10132320 3300006852 Bacteria 2216
210 Ga0075433_10190229 3300006852 Bacteria 1826
211 Ga0075433_10191471 3300006852 Bacteria 1819
212 Ga0075434_100020110 3300006871 Bacteria 6469
213 Ga0075429_100008611 3300006880 Bacteria 8874
214 Ga0068865_100000001 3300006881 Bacteria 288199
215 Ga0075436_100071279 3300006914 Bacteria 2403
216 Ga0075436_100283802 3300006914 Bacteria 1184
217 Ga0097620_100181873 3300006931 Bacteria 2185
218 Ga0097620_100481269 3300006931 Bacteria 1337
219 Ga0075435_100205637 3300007076 Bacteria 1669
220 Ga0075435_100701507 3300007076 Bacteria 880
221 Ga0105240_11025594 3300009093 Bacteria 881
222 Ga0111539_10008366 3300009094 Bacteria 13164
223 Ga0111539_10016386 3300009094 Bacteria 9190
224 Ga0111539_10095657 3300009094 Bacteria 3489
225 Ga0111539_10350303 3300009094 Bacteria 1719
226 Ga0111539_11248138 3300009094 Bacteria 863
227 Ga0105245_10000091 3300009098 Bacteria 89925
228 Ga0105245_10000340 3300009098 Bacteria 44025
229 Ga0105245_10002874 3300009098 Bacteria 15463
230 Ga0105245_10005187 3300009098 Bacteria 11441
231 Ga0105245_10023351 3300009098 Bacteria 5428
232 Ga0105245_10435543 3300009098 Bacteria 1317
233 Ga0105245_10465616 3300009098 Bacteria 1275
234 Ga0105245_10863877 3300009098 Unclassified 945
235 Ga0105245_12403065 3300009098 Bacteria 580
236 Ga0105247_10001345 3300009101 Bacteria 17864
237 Ga0105247_10045449 3300009101 Bacteria 2694
238 Ga0105247_10193065 3300009101 Bacteria 1364
239 Ga0105247_10423716 3300009101 Bacteria 954
240 Ga0105247_10559578 3300009101 Bacteria 842
241 Ga0105247_11393335 3300009101 Bacteria 567
242 Ga0114129_10013966 3300009147 Bacteria 11444
243 Ga0114129_10041143 3300009147 Bacteria 6514
244 Ga0114129_10052844 3300009147 Bacteria 5701
245 Ga0114129_10061521 3300009147 Bacteria 5247
246 Ga0114129_10230323 3300009147 Bacteria 2495
247 Ga0114129_11025191 3300009147 Bacteria 1038
248 Ga0114129_11281874 3300009147 Bacteria 909
249 Ga0114129_11294070 3300009147 Bacteria 904
250 Ga0114129_12245933 3300009147 Bacteria 656
251 Ga0105243_10013134 3300009148 Bacteria 6259
252 Ga0105243_10102834 3300009148 Bacteria 2375
253 Ga0105243_10104004 3300009148 Bacteria 2362
254 Ga0105243_10123078 3300009148 Bacteria 2190
255 Ga0105243_10334879 3300009148 Bacteria 1384
256 Ga0105243_10401099 3300009148 Bacteria 1274
257 Ga0105243_10422461 3300009148 Unclassified 1244
258 Ga0105241_10475723 3300009174 Bacteria 1109
259 Ga0105242_10001420 3300009176 Bacteria 18882
260 Ga0105242_10057966 3300009176 Bacteria 3173
261 Ga0105242_10393544 3300009176 Bacteria 1291
262 Ga0105242_11727381 3300009176 Bacteria 663
263 Ga0105248_10000506 3300009177 Bacteria 44311
264 Ga0105248_10256203 3300009177 Bacteria 1970
265 Ga0105248_10492942 3300009177 Bacteria 1381
266 Ga0105248_10582178 3300009177 Bacteria 1263
267 Ga0105237_10121799 3300009545 Bacteria 2603
268 Ga0105237_10129753 3300009545 Bacteria 2515
269 Ga0105238_10000028 3300009551 Bacteria 188361
270 Ga0105238_10037990 3300009551 Bacteria 4892
271 Ga0105238_10402405 3300009551 Bacteria 1362
272 Ga0105238_10414425 3300009551 Bacteria 1341
273 Ga0105238_10429035 3300009551 Bacteria 1317
274 Ga0105249_10000073 3300009553 Bacteria 145660
275 Ga0105249_10007327 3300009553 Bacteria 9616
276 Ga0105249_10060909 3300009553 Bacteria 3463
277 Ga0105249_10075632 3300009553 Bacteria 3119
278 Ga0105249_10080516 3300009553 Bacteria 3026
279 Ga0105249_10701097 3300009553 Bacteria 1072
280 Ga0105239_10244006 3300010375 Bacteria 2016
281 Ga0105239_11183635 3300010375 Bacteria 881
282 Ga0105239_11206606 3300010375 Bacteria 872
283 Ga0105246_10195700 3300011119 Bacteria 1568
284 Ga0105246_10266248 3300011119 Bacteria 1368
285 Ga0105246_10334851 3300011119 Bacteria 1235
286 Ga0157371_10002665 3300013102 Bacteria 16879
287 Ga0157371_10036579 3300013102 Bacteria 3515
288 Ga0157370_10015146 3300013104 Bacteria 7854
289 Ga0157370_10029574 3300013104 Bacteria 5373
290 Ga0157369_10414972 3300013105 Bacteria 1396
291 Ga0157374_10125138 3300013296 Bacteria 2485
292 Ga0157378_10016506 3300013297 Bacteria 6467
293 Ga0157378_10193802 3300013297 Bacteria 1918
294 Ga0157378_10709855 3300013297 Bacteria 1026
295 Ga0163162_10142956 3300013306 Bacteria 2507
296 Ga0163162_10727512 3300013306 Bacteria 1113
297 Ga0163162_10830584 3300013306 Bacteria 1040
298 Ga0163162_11914823 3300013306 Bacteria 679
299 Ga0157372_10000121 3300013307 Bacteria 83548
300 Ga0157372_10102593 3300013307 Bacteria 3268
301 Ga0157372_10102848 3300013307 Bacteria 3264
302 Ga0157375_10003805 3300013308 Bacteria 13081
303 Ga0157375_10018619 3300013308 Bacteria 6301
304 Ga0157375_10129622 3300013308 Bacteria 2640
305 Ga0157375_10154763 3300013308 Bacteria 2431
306 Ga0157375_11219189 3300013308 Bacteria 883
307 Ga0163163_11189309 3300014325 Bacteria 825
308 Ga0157380_10000400 3300014326 Bacteria 26203
309 Ga0157380_10019156 3300014326 Bacteria 5097
310 Ga0157380_12078162 3300014326 Bacteria 631
311 Ga0157379_10011086 3300014968 Bacteria 7859
312 Ga0157379_10193354 3300014968 Bacteria 1839
313 Ga0157379_10604517 3300014968 Bacteria 1024
314 Ga0157379_11572935 3300014968 Bacteria 641
315 Ga0157376_10287318 3300014969 Bacteria 1551
316 Ga0163161_10000073 3300017792 Bacteria 102053
317 Ga0163161_10271207 3300017792 Bacteria 1328
318 Ga0163161_10320715 3300017792 Bacteria 1225
319 Ga0197907_11003200 3300020069 Bacteria 1030
320 Ga0206356_10604718 3300020070 Bacteria 1744
321 Ga0206354_10017965 3300020081 Bacteria 1277
322 Ga0206354_10281469 3300020081 Bacteria 622
323 Ga0206353_10760314 3300020082 Bacteria 3837
324 Ga0213873_10041676 3300021358 Bacteria 1185
325 Ga0213876_10017769 3300021384 Bacteria 3753
326 Ga0224712_10092910 3300022467 Bacteria 1267
327 Ga0224712_10270126 3300022467 Bacteria 789
328 Ga0207656_10002474 3300025321 Bacteria 6236
329 Ga0207656_10009876 3300025321 Bacteria 3554
330 Ga0207656_10160895 3300025321 Bacteria 1068
331 Ga0207682_10000003 3300025893 Bacteria 128548
332 Ga0207642_10000001 3300025899 Bacteria 714030
333 Ga0207642_10000003 3300025899 Bacteria 650651
334 Ga0207642_10000004 3300025899 Bacteria 407822
335 Ga0207642_10000389 3300025899 Bacteria 13175
336 Ga0207710_10000112 3300025900 Bacteria 103005
337 Ga0207710_10147856 3300025900 Bacteria 1138
338 Ga0207710_10495459 3300025900 Bacteria 634
339 Ga0207688_10039754 3300025901 Bacteria 2613
340 Ga0207680_10001025 3300025903 Bacteria 13185
341 Ga0207680_10154479 3300025903 Bacteria 1533
342 Ga0207685_10000001 3300025905 Bacteria 604473
343 Ga0207645_10258226 3300025907 Bacteria 1154
344 Ga0207645_10504252 3300025907 Bacteria 819
345 Ga0207643_10016033 3300025908 Bacteria 4082
346 Ga0207705_10575650 3300025909 Bacteria 875
347 Ga0207654_10299095 3300025911 Bacteria 1094
348 Ga0207707_10048787 3300025912 Bacteria 3688
349 Ga0207695_10953926 3300025913 Bacteria 737
350 Ga0207693_10000001 3300025915 Bacteria 469535
351 Ga0207693_10002935 3300025915 Bacteria 14759
352 Ga0207693_10011889 3300025915 Bacteria 7038
353 Ga0207663_10043081 3300025916 Bacteria 2761
354 Ga0207663_10050424 3300025916 Bacteria 2586
355 Ga0207660_10172358 3300025917 Bacteria 1676
356 Ga0207660_10840515 3300025917 Bacteria 749
357 Ga0207662_10031842 3300025918 Bacteria 3065
358 Ga0207662_10206928 3300025918 Bacteria 1272
359 Ga0207657_10052488 3300025919 Bacteria 3538
360 Ga0207649_10000021 3300025920 Bacteria 209660
361 Ga0207649_10355235 3300025920 Bacteria 1086
362 Ga0207649_10690387 3300025920 Bacteria 791
363 Ga0207652_10001404 3300025921 Bacteria 21354
364 Ga0207652_10446245 3300025921 Bacteria 1166
365 Ga0207646_11169495 3300025922 Bacteria 675
366 Ga0207681_10080412 3300025923 Bacteria 2299
367 Ga0207681_11054389 3300025923 Unclassified 682
368 Ga0207694_10000008 3300025924 Bacteria 484902
369 Ga0207694_10181668 3300025924 Bacteria 1706
370 Ga0207694_10504585 3300025924 Bacteria 1013
371 Ga0207650_10156560 3300025925 Bacteria 1802
372 Ga0207659_10000094 3300025926 Bacteria 51695
373 Ga0207687_10000012 3300025927 Bacteria 370729
374 Ga0207687_10000042 3300025927 Bacteria 108169
375 Ga0207687_10001586 3300025927 Bacteria 15645
376 Ga0207687_10003941 3300025927 Bacteria 9937
377 Ga0207687_10016098 3300025927 Bacteria 4908
378 Ga0207687_10273513 3300025927 Bacteria 1351
379 Ga0207687_10330135 3300025927 Bacteria 1237
380 Ga0207687_10580791 3300025927 Bacteria 943
381 Ga0207687_10661411 3300025927 Bacteria 884
382 Ga0207700_10000032 3300025928 Bacteria 125088
383 Ga0207664_10003709 3300025929 Bacteria 10243
384 Ga0207644_10055977 3300025931 Bacteria 2845
385 Ga0207690_10001272 3300025932 Bacteria 15951
386 Ga0207690_10744706 3300025932 Bacteria 807
387 Ga0207706_10000006 3300025933 Bacteria 216994
388 Ga0207686_10012361 3300025934 Bacteria 4694
389 Ga0207686_10138659 3300025934 Bacteria 1678
390 Ga0207686_10185978 3300025934 Bacteria 1477
391 Ga0207709_10012145 3300025935 Bacteria 4747
392 Ga0207709_10031084 3300025935 Bacteria 3114
393 Ga0207709_10093073 3300025935 Bacteria 1975
394 Ga0207670_10039494 3300025936 Bacteria 3091
395 Ga0207670_10307009 3300025936 Bacteria 1244
396 Ga0207669_10000016 3300025937 Bacteria 124532
397 Ga0207669_10000023 3300025937 Bacteria 96638
398 Ga0207669_10188325 3300025937 Bacteria 1486
399 Ga0207669_10190543 3300025937 Bacteria 1479
400 Ga0207669_10452186 3300025937 Bacteria 1018
401 Ga0207669_10553006 3300025937 Bacteria 929
402 Ga0207669_10921495 3300025937 Bacteria 731
403 Ga0207704_10000012 3300025938 Bacteria 178319
404 Ga0207704_10868985 3300025938 Bacteria 757
405 Ga0207665_10109152 3300025939 Bacteria 1942
406 Ga0207665_10508763 3300025939 Unclassified 931
407 Ga0207691_10000140 3300025940 Bacteria 66462
408 Ga0207691_10086172 3300025940 Bacteria 2818
409 Ga0207711_10000085 3300025941 Bacteria 99467
410 Ga0207711_10954105 3300025941 Bacteria 796
411 Ga0207689_10024231 3300025942 Bacteria 5092
412 Ga0207689_10180196 3300025942 Bacteria 1742
413 Ga0207661_10000784 3300025944 Bacteria 20686
414 Ga0207661_10007312 3300025944 Bacteria 7854
415 Ga0207661_10013420 3300025944 Bacteria 5984
416 Ga0207661_10029192 3300025944 Bacteria 4233
417 Ga0207661_10154133 3300025944 Bacteria 1988
418 Ga0207661_10274312 3300025944 Bacteria 1506
419 Ga0207661_10398015 3300025944 Bacteria 1248
420 Ga0207661_10825237 3300025944 Bacteria 853
421 Ga0207661_11164889 3300025944 Bacteria 709
422 Ga0207679_10023481 3300025945 Bacteria 4218
423 Ga0207679_10510398 3300025945 Bacteria 1074
424 Ga0207651_10008848 3300025960 Bacteria 5466
425 Ga0207651_10082886 3300025960 Bacteria 2317
426 Ga0207712_10000003 3300025961 Bacteria 615314
427 Ga0207712_10133852 3300025961 Bacteria 1893
428 Ga0207712_10136772 3300025961 Bacteria 1875
429 Ga0207712_10738529 3300025961 Bacteria 862
430 Ga0207668_10132948 3300025972 Bacteria 1902
431 Ga0207668_10185970 3300025972 Bacteria 1642
432 Ga0207668_10874805 3300025972 Bacteria 799
433 Ga0207668_11063320 3300025972 Bacteria 725
434 Ga0207668_11767335 3300025972 Bacteria 558
435 Ga0207640_10000270 3300025981 Bacteria 35099
436 Ga0207640_10499382 3300025981 Bacteria 1013
437 Ga0207640_11341219 3300025981 Archaea 640
438 Ga0207658_10075507 3300025986 Bacteria 2564
439 Ga0207658_10217427 3300025986 Bacteria 1605
440 Ga0207677_10000760 3300026023 Bacteria 18586
441 Ga0207677_10002075 3300026023 Bacteria 10548
442 Ga0207677_10109248 3300026023 Bacteria 2056
443 Ga0207703_10000053 3300026035 Bacteria 143924
444 Ga0207703_10000132 3300026035 Bacteria 90163
445 Ga0207703_10031133 3300026035 Bacteria 4216
446 Ga0207703_10068265 3300026035 Bacteria 2929
447 Ga0207703_10130764 3300026035 Bacteria 2167
448 Ga0207703_10781066 3300026035 Unclassified 911
449 Ga0207639_10001498 3300026041 Bacteria 15725
450 Ga0207639_10569911 3300026041 Bacteria 1041
451 Ga0207678_10059792 3300026067 Bacteria 3279
452 Ga0207678_11755392 3300026067 Bacteria 544
453 Ga0207708_10046046 3300026075 Bacteria 3323
454 Ga0207708_10049604 3300026075 Bacteria 3197
455 Ga0207702_10000332 3300026078 Bacteria 54147
456 Ga0207702_10005812 3300026078 Bacteria 10730
457 Ga0207702_10056840 3300026078 Bacteria 3323
458 Ga0207641_10000071 3300026088 Bacteria 151812
459 Ga0207641_10239994 3300026088 Bacteria 1688
460 Ga0207648_10110678 3300026089 Bacteria 2411
461 Ga0207676_10000038 3300026095 Bacteria 171492
462 Ga0207676_10265327 3300026095 Bacteria 1552
463 Ga0207674_10124152 3300026116 Bacteria 2547
464 Ga0207675_100146309 3300026118 Bacteria 2247
465 Ga0207675_101085713 3300026118 Bacteria 820
466 Ga0207683_10063056 3300026121 Bacteria 3265
467 Ga0207683_10156357 3300026121 Bacteria 2059
468 Ga0207698_10000009 3300026142 Bacteria 281300
469 Ga0207698_10012457 3300026142 Bacteria 5567
470 Ga0207698_10178161 3300026142 Bacteria 1880
471 Ga0207698_10578855 3300026142 Bacteria 1104
472 Ga0207428_10029736 3300027907 Bacteria 4523
473 Ga0207428_10040972 3300027907 Bacteria 3751
474 Ga0207428_10113550 3300027907 Bacteria 2082
475 Ga0207428_10126704 3300027907 Bacteria 1955
476 Ga0268266_10000023 3300028379 Bacteria 501899
477 Ga0268266_10001388 3300028379 Bacteria 29082
478 Ga0268266_10001442 3300028379 Bacteria 28308
479 Ga0268266_10215563 3300028379 Bacteria 1762
480 Ga0268266_10219388 3300028379 Bacteria 1747
481 Ga0268266_10292207 3300028379 Bacteria 1518
482 Ga0268266_10321398 3300028379 Bacteria 1449
483 Ga0268266_10557788 3300028379 Bacteria 1098
484 Ga0268266_11034754 3300028379 Unclassified 794
485 Ga0268265_10120653 3300028380 Bacteria 2159
486 Ga0268265_10697654 3300028380 Bacteria 980
487 Ga0268265_10914133 3300028380 Unclassified 862
488 Ga0268265_11724613 3300028380 Bacteria 632
489 Ga0268264_10002363 3300028381 Bacteria 16641
490 Ga0268264_10077884 3300028381 Bacteria 2825
491 Ga0268264_10177645 3300028381 Bacteria 1931
492 Ga0307511_10137879 3300030521 Bacteria 1445
493 Ga0307408_101355843 3300031548 Bacteria 668
494 Ga0316579_10102806 3300031691 Bacteria 1369
495 Ga0307405_10329116 3300031731 Bacteria 1170
496 Ga0307413_10230678 3300031824 Bacteria 1359
497 Ga0307413_11379752 3300031824 Bacteria 619
498 Ga0307410_10524040 3300031852 Bacteria 978
499 Ga0307410_10739662 3300031852 Bacteria 832
500 Ga0307406_10070979 3300031901 Bacteria 2281
501 Ga0307409_101025834 3300031995 Bacteria 844
502 Ga0307409_101219561 3300031995 Bacteria 776
503 Ga0307416_100661673 3300032002 Bacteria 1130
504 Ga0307414_11238516 3300032004 Bacteria 691
505 Ga0307411_10197561 3300032005 Bacteria 1542
506 Ga0307415_100012565 3300032126 Bacteria 4900
507 Ga0307415_100601707 3300032126 Bacteria 978
508 Ga0316583_10219556 3300032133 Bacteria 659
509 Ga0373939_0128858 3300035114 Bacteria 901
510 Ga0373945_0290247 3300035116 Bacteria 699
511 Ga0373954_0149067 3300035118 Bacteria 1143
512 Ga0373956_0200078 3300035119 Unclassified 947
513 Ga0373957_0097788 3300035120 Unclassified 1173
514 Ga0373960_0083927 3300035121 Bacteria 1008
515 Ga0373943_0047960 3300035170 Bacteria 2091
516 Ga0373955_0124753 3300035172 Bacteria 1499
517 Ga0373942_0103743 3300035207 Bacteria 872
518 Ga0316574_0120286 3300035398 Bacteria 1686
519 Ga0373935_0398012 3300035692 Bacteria 989
520 Ga0373933_0710249 3300035724 Bacteria 661
521 Ga0373947_0248629 3300035725 Bacteria 1175
522 Ga0373937_0027900 3300036401 Bacteria 5108
523 Ga0373937_0042483 3300036401 Bacteria 4148
524 Ga0316582_0811424 3300036647 Bacteria 641
525 Ga0316584_0293899 3300036712 Bacteria 1178
526 Ga0373925_0472415 3300037068 Bacteria 1028
527 Ga0373925_1531738 3300037068 Bacteria 545
528 Ga0395899_0047858 3300037312 Bacteria 3183
529 Ga0395900_0021354 3300037418 Bacteria 6618
530 Ga0395900_0183072 3300037418 Bacteria 2128
531 Ga0395900_0353044 3300037418 Bacteria 1444
532 Ga0395900_0413270 3300037418 Bacteria 1311
533 Ga0395900_0913769 3300037418 Unclassified 801
534 Ga0395900_0975764 3300037418 Bacteria 768
535 Ga0395898_0016278 3300037466 Bacteria 7610
536 Ga0395898_0079042 3300037466 Bacteria 3173
537 Ga0395898_0324326 3300037466 Bacteria 1469
538 Ga0395898_0396725 3300037466 Bacteria 1315
539 Ga0395898_0631227 3300037466 Bacteria 1014
540 Ga0395898_0664614 3300037466 Bacteria 984
541 Ga0395898_0707116 3300037466 Bacteria 949
542 Ga0395898_0850155 3300037466 Unclassified 852
543 Ga0395898_0871284 3300037466 Bacteria 839
544 Ga0395905_0004196 3300037471 Bacteria 15081
545 Ga0395905_0225709 3300037471 Bacteria 1752
546 Ga0395905_0266977 3300037471 Bacteria 1597
547 Ga0395905_0335759 3300037471 Bacteria 1402
548 Ga0395901_0018076 3300038443 Bacteria 7195
549 Ga0395901_0080123 3300038443 Bacteria 3409
550 Ga0395901_0264625 3300038443 Bacteria 1789
551 Ga0395901_0904343 3300038443 Unclassified 864
552 Ga0436365_0700522 3300039437 Bacteria 9909
553 Ga0436362_0361016 3300039453 Bacteria 2104
554 Ga0451789_0190937 3300041443 Bacteria 648
555 Ga0451793_1567316 3300041452 Unclassified 813
556 Ga0451833_0127813 3300041491 Bacteria 728
557 Ga0451849_1383452 3300041505 Archaea 745
558 Ga0439448_0128192 3300042005 Bacteria 873
559 Ga0466963_0000406 3300044694 Bacteria 19714
560 Ga0466963_0019056 3300044694 Bacteria 4297
561 Ga0466963_0037755 3300044694 Bacteria 3157
562 Ga0466963_0895737 3300044694 Bacteria 625
563 Ga0466964_0014541 3300044706 Bacteria 2993
564 Ga0466964_0193517 3300044706 Unclassified 972
565 Ga0466964_0355324 3300044706 Unclassified 754
566 Ga0466957_0580411 3300044842 Bacteria 783
567 Ga0466957_0610028 3300044842 Unclassified 764
568 Ga0466960_0187516 3300044901 Bacteria 1124
569 Ga0466958_0201290 3300045836 Bacteria 1267
570 Ga0466967_0000007 3300045976 Bacteria 135597
571 Ga0466967_0003720 3300045976 Bacteria 10051
572 Ga0466967_0032948 3300045976 Bacteria 4381
573 Ga0466967_0061173 3300045976 Bacteria 3340
574 Ga0466967_0612912 3300045976 Bacteria 1075
575 Ga0466967_1544001 3300045976 Bacteria 661
576 Ga0495592_0031293 3300046454 Bacteria 4022
577 Ga0495592_0090252 3300046454 Bacteria 2199
578 Ga0495592_0095353 3300046454 Bacteria 2128
579 Ga0495603_0004170 3300046455 Bacteria 8615
580 Ga0495590_0056589 3300046457 Bacteria 1371
581 Ga0495590_0140401 3300046457 Bacteria 872
582 Ga0495629_0001388 3300046459 Bacteria 19109
583 Ga0495629_0011366 3300046459 Bacteria 6467
584 Ga0495629_0705603 3300046459 Unclassified 670
585 Ga0495638_0134391 3300046460 Bacteria 1450
586 Ga0495641_0000012 3300046461 Bacteria 144818
587 Ga0495641_0010457 3300046461 Bacteria 5374
588 Ga0495641_0062434 3300046461 Bacteria 1680
589 Ga0495651_0024433 3300046462 Bacteria 4701
590 Ga0495651_0082512 3300046462 Bacteria 2425
591 Ga0495651_0140463 3300046462 Bacteria 1752
592 Ga0495651_0192718 3300046462 Bacteria 1433
593 Ga0495651_0404847 3300046462 Unclassified 890
594 Ga0495653_0030121 3300046463 Bacteria 4326
595 Ga0495653_0520267 3300046463 Unclassified 739
596 Ga0495582_0000007 3300046473 Bacteria 139882
597 Ga0495582_0184405 3300046473 Bacteria 1189
598 Ga0495582_0753780 3300046473 Bacteria 563
599 Ga0495639_0292651 3300046475 Bacteria 811
600 Ga0495662_0004180 3300046476 Bacteria 7274
601 Ga0495662_0067271 3300046476 Bacteria 1733
602 Ga0495584_0242898 3300046491 Bacteria 916
603 Ga0495584_0388473 3300046491 Bacteria 709
604 Ga0495585_0272377 3300046492 Bacteria 839
605 Ga0495585_0626687 3300046492 Unclassified 505
606 Ga0495594_0095786 3300046499 Bacteria 1667
607 Ga0495596_0062448 3300046500 Bacteria 1450
608 Ga0495596_0093303 3300046500 Bacteria 1169
609 Ga0495596_0232560 3300046500 Bacteria 716
610 Ga0495606_0000082 3300046507 Bacteria 159585
611 Ga0495608_0000063 3300046511 Bacteria 83763
612 Ga0495608_0005393 3300046511 Bacteria 9135
613 Ga0495608_0027929 3300046511 Bacteria 3836
614 Ga0495608_0063068 3300046511 Bacteria 2433
615 Ga0495608_0100014 3300046511 Bacteria 1870
616 Ga0495616_0160838 3300046513 Bacteria 1010
617 Ga0495616_0327538 3300046513 Bacteria 642
618 Ga0495618_0000003 3300046514 Bacteria 256269
619 Ga0495618_0483003 3300046514 Bacteria 749
620 Ga0495620_0000113 3300046515 Bacteria 64629
621 Ga0495628_0036556 3300046516 Bacteria 3940
622 Ga0495628_0054751 3300046516 Bacteria 3144
623 Ga0495628_0103973 3300046516 Bacteria 2189
624 Ga0495628_0104012 3300046516 Bacteria 2189
625 Ga0495628_0111898 3300046516 Bacteria 2099
626 Ga0495628_0469037 3300046516 Bacteria 912
627 Ga0495630_0000007 3300046517 Bacteria 376915
628 Ga0495630_0000477 3300046517 Bacteria 29945
629 Ga0495630_0447058 3300046517 Bacteria 990
630 Ga0495644_0089288 3300046523 Bacteria 1163
631 Ga0495663_0077994 3300046525 Unclassified 1063
632 Ga0495652_0001430 3300046529 Bacteria 26465
633 Ga0495652_0155110 3300046529 Bacteria 1784
634 Ga0495640_0004409 3300046533 Bacteria 11236
635 Ga0495640_0006935 3300046533 Bacteria 8922
636 Ga0495640_0145828 3300046533 Bacteria 1523
637 Ga0495586_0001272 3300046535 Bacteria 14120
638 Ga0495586_0276550 3300046535 Bacteria 960
639 Ga0495587_0071367 3300046536 Bacteria 2020
640 Ga0495587_0106533 3300046536 Bacteria 1612
641 Ga0495598_0053928 3300046537 Bacteria 1219
642 Ga0495621_0000679 3300046539 Bacteria 8584
643 Ga0495645_0004980 3300046543 Bacteria 9098
644 Ga0495645_0013041 3300046543 Bacteria 5869
645 Ga0495645_0457661 3300046543 Bacteria 804
646 Ga0495667_0090823 3300046559 Bacteria 1978
647 Ga0495656_0299579 3300046615 Bacteria 824
648 Ga0495634_0000125 3300046642 Bacteria 65586
649 Ga0495634_0000828 3300046642 Bacteria 29940
650 Ga0495634_0010756 3300046642 Bacteria 6693
651 Ga0495634_0082549 3300046642 Bacteria 2100
652 Ga0495634_0171893 3300046642 Bacteria 1361
653 Ga0495634_0575152 3300046642 Unclassified 655
654 Ga0495635_0000009 3300046663 Bacteria 259024
655 Ga0495635_0047675 3300046663 Bacteria 2954
656 Ga0495635_0231854 3300046663 Bacteria 1247
657 Ga0495635_0324906 3300046663 Bacteria 1029
658 Ga0495659_0162657 3300046664 Bacteria 902
659 Ga0495588_0000602 3300046674 Bacteria 16922
660 Ga0495657_0000084 3300046675 Bacteria 83088
661 Ga0495657_0010956 3300046675 Bacteria 6800
662 Ga0495657_0023623 3300046675 Bacteria 4390
663 Ga0495599_0136910 3300046678 Bacteria 1520
664 Ga0495599_0335927 3300046678 Bacteria 907
665 Ga0495647_0000014 3300046681 Bacteria 87792
666 Ga0495647_0005014 3300046681 Bacteria 4334
667 Ga0495647_0011161 3300046681 Bacteria 3073
668 Ga0495647_0276770 3300046681 Bacteria 752
669 Ga0495658_0000007 3300046683 Bacteria 139822
670 Ga0495658_0050093 3300046683 Bacteria 2361
671 Ga0495658_0185227 3300046683 Bacteria 1293
672 Ga0495669_0000213 3300046684 Bacteria 35060
673 Ga0495669_0020171 3300046684 Bacteria 2882
674 Ga0495669_0136595 3300046684 Bacteria 1156
675 Ga0495613_0000003 3300046689 Bacteria 248826
676 Ga0495613_0000310 3300046689 Bacteria 44162
677 Ga0495613_0088978 3300046689 Bacteria 2237
678 Ga0495624_0000002 3300046690 Bacteria 189957
679 Ga0495624_0000256 3300046690 Bacteria 42059
680 Ga0495624_0228619 3300046690 Bacteria 1127
681 Ga0495624_0364848 3300046690 Bacteria 868
682 Ga0495670_0103637 3300046691 Bacteria 1467
683 Ga0495649_0034365 3300046694 Bacteria 2789
684 Ga0495589_0230893 3300046794 Bacteria 868
685 Ga0495600_0003063 3300046809 Bacteria 9768
686 Ga0495600_0033862 3300046809 Bacteria 3317
687 Ga0495600_0096189 3300046809 Bacteria 1931
688 Ga0495600_0099370 3300046809 Bacteria 1897
689 Ga0495600_0537082 3300046809 Bacteria 716
690 Ga0495660_0076596 3300046810 Bacteria 1762
691 Ga0495660_0504488 3300046810 Unclassified 517
692 Ga0495581_0160050 3300047315 Bacteria 1316
693 Ga0495604_0000084 3300047317 Bacteria 82199
694 Ga0495604_0043452 3300047317 Bacteria 3518
695 Ga0495674_0000027 3300047319 Bacteria 132744
696 Ga0495672_0046414 3300047320 Bacteria 2591
697 Ga0495672_0125585 3300047320 Bacteria 1357
698 Ga0495676_0001046 3300047321 Bacteria 23385
699 Ga0495676_0049017 3300047321 Bacteria 3400
700 Ga0495676_0314114 3300047321 Bacteria 1054
701 Ga0495680_0000255 3300047322 Bacteria 58745
702 Ga0495680_0000256 3300047322 Bacteria 58661
703 Ga0495680_0081114 3300047322 Bacteria 2450
704 Ga0495680_0318445 3300047322 Bacteria 1089
705 Ga0495675_0000067 3300047444 Bacteria 71740
706 Ga0495675_0070636 3300047444 Bacteria 2204
707 Ga0495679_108621 3300047446 Bacteria 765
708 Ga0495685_060990 3300047447 Bacteria 1271
709 Ga0495673_0078838 3300047469 Bacteria 1368
710 Ga0495684_0092105 3300047471 Bacteria 2296
711 Ga0495686_0010031 3300047472 Bacteria 6766
712 Ga0495686_0048752 3300047472 Bacteria 2669
713 Ga0495593_0087797 3300047673 Bacteria 1603
714 Ga0495593_0119025 3300047673 Bacteria 1345
715 Ga0495602_0000008 3300048088 Bacteria 260157
716 Ga0495602_0349526 3300048088 Bacteria 1067
717 Ga0495614_0287428 3300048089 Bacteria 758
718 Ga0495626_0147357 3300048091 Bacteria 995
719 Ga0496100_0000016 3300048903 Bacteria 166058
720 Ga0496100_1358508 3300048903 Bacteria 561
721 Ga0496101_0000038 3300048904 Bacteria 166058
722 Ga0496101_0002799 3300048904 Bacteria 10699
723 Ga0496101_0058412 3300048904 Bacteria 2793
724 Ga0496101_0372709 3300048904 Bacteria 1123
725 Ga0496101_0601350 3300048904 Bacteria 869
726 Ga0496101_0765465 3300048904 Bacteria 762
727 Ga0496101_0848246 3300048904 Bacteria 720
728 Ga0496101_0860645 3300048904 Bacteria 714
729 Ga0496102_0005397 3300048905 Bacteria 10856
730 Ga0496102_0025633 3300048905 Bacteria 5252
731 Ga0496102_0194530 3300048905 Bacteria 1911
732 Ga0496102_0354963 3300048905 Bacteria 1380
733 Ga0496102_0980740 3300048905 Bacteria 766
734 Ga0496103_0001687 3300048906 Bacteria 14446
735 Ga0496103_0014666 3300048906 Bacteria 4657
736 Ga0496103_0050586 3300048906 Bacteria 2570
737 Ga0496103_0138108 3300048906 Bacteria 1558
738 Ga0496103_0544670 3300048906 Bacteria 741
739 Ga0496104_0000003 3300048907 Bacteria 669219
740 Ga0496104_0000007 3300048907 Bacteria 524804
741 Ga0496104_0000147 3300048907 Bacteria 65131
742 Ga0496104_0036798 3300048907 Bacteria 4576
743 Ga0496104_0074338 3300048907 Bacteria 3236
744 Ga0496105_0000002 3300048908 Bacteria 753215
745 Ga0496105_0000008 3300048908 Bacteria 335652
746 Ga0496105_0000988 3300048908 Bacteria 19603
747 Ga0496105_0024847 3300048908 Bacteria 4869
748 Ga0496105_0026744 3300048908 Bacteria 4709
749 Ga0496105_0086229 3300048908 Bacteria 2594
750 Ga0496106_0000013 3300048909 Bacteria 202263
751 Ga0496106_0000027 3300048909 Bacteria 149560
752 Ga0496106_0048080 3300048909 Bacteria 3212
753 Ga0496106_0071587 3300048909 Bacteria 2650
754 Ga0496106_0076379 3300048909 Bacteria 2567
755 Ga0496106_0616846 3300048909 Bacteria 868
756 Ga0496107_0000003 3300048910 Bacteria 304038
757 Ga0496107_0034892 3300048910 Bacteria 3605
758 Ga0496107_0051851 3300048910 Bacteria 2960
759 Ga0496107_0094312 3300048910 Bacteria 2190
760 Ga0496107_0306002 3300048910 Bacteria 1183
761 Ga0496108_0000002 3300048911 Bacteria 700890
762 Ga0496108_0000216 3300048911 Bacteria 52702
763 Ga0496108_0000254 3300048911 Bacteria 46564
764 Ga0496108_0002779 3300048911 Bacteria 14026
765 Ga0496108_0010108 3300048911 Bacteria 7655
766 Ga0496108_0019207 3300048911 Bacteria 5610
767 Ga0496108_0079609 3300048911 Bacteria 2774
768 Ga0496108_0249765 3300048911 Bacteria 1543
769 Ga0496108_0374770 3300048911 Bacteria 1243
770 Ga0496108_0381682 3300048911 Bacteria 1230
771 Ga0496108_0839740 3300048911 Unclassified 791
772 Ga0496109_0000001 3300048912 Bacteria 700852
773 Ga0496109_0000046 3300048912 Bacteria 131025
774 Ga0496109_0000085 3300048912 Bacteria 95437
775 Ga0496109_0000321 3300048912 Bacteria 45109
776 Ga0496109_0129770 3300048912 Bacteria 2352
777 Ga0496109_0170671 3300048912 Bacteria 2040
778 Ga0496109_0199975 3300048912 Bacteria 1878
779 Ga0496109_0212228 3300048912 Bacteria 1820
780 Ga0496109_0323286 3300048912 Bacteria 1456
781 Ga0496109_0999829 3300048912 Bacteria 774
782 Ga0496110_0000004 3300048913 Bacteria 122867
783 Ga0496110_0006148 3300048913 Bacteria 9468
784 Ga0496110_0047435 3300048913 Bacteria 3761
785 Ga0496110_0066142 3300048913 Bacteria 3196
786 Ga0496110_0142170 3300048913 Bacteria 2169
787 Ga0496110_0143405 3300048913 Bacteria 2159
788 Ga0496110_0702373 3300048913 Bacteria 913
789 Ga0496110_1042929 3300048913 Bacteria 725
790 Ga0496111_0000002 3300048914 Bacteria 135794
791 Ga0496111_0000644 3300048914 Bacteria 18422
792 Ga0496111_0010486 3300048914 Bacteria 6221
793 Ga0496111_0012361 3300048914 Bacteria 5777
794 Ga0496111_0035437 3300048914 Bacteria 3566
795 Ga0496111_0072352 3300048914 Bacteria 2509
796 Ga0496111_0133809 3300048914 Bacteria 1836
797 Ga0496111_0204669 3300048914 Bacteria 1467
798 Ga0496111_0490988 3300048914 Bacteria 904
799 Ga0496112_0000539 3300048915 Bacteria 25967
800 Ga0496112_0002982 3300048915 Bacteria 13811
801 Ga0496112_0009876 3300048915 Bacteria 8626
802 Ga0496112_0106817 3300048915 Bacteria 2769
803 Ga0496112_0256448 3300048915 Bacteria 1699
804 Ga0496112_1321111 3300048915 Bacteria 636
805 Ga0496113_0000012 3300048916 Bacteria 81903
806 Ga0496113_0005984 3300048916 Bacteria 7655
807 Ga0496113_0018250 3300048916 Bacteria 4884
808 Ga0496113_0028851 3300048916 Bacteria 3997
809 Ga0496113_0043034 3300048916 Bacteria 3340
810 Ga0496113_0049342 3300048916 Bacteria 3134
811 Ga0496113_0167441 3300048916 Bacteria 1739
812 Ga0496113_0353712 3300048916 Bacteria 1178
813 Ga0496114_0013938 3300048917 Bacteria 6446
814 Ga0496114_0034256 3300048917 Bacteria 4188
815 Ga0496114_0625873 3300048917 Bacteria 948
816 Ga0496115_0070655 3300048918 Bacteria 2830
817 Ga0496115_0702504 3300048918 Bacteria 795
818 Ga0496115_0858722 3300048918 Bacteria 702
819 Ga0496117_0007101 3300048920 Bacteria 11070
820 Ga0496117_0050346 3300048920 Bacteria 2954
821 Ga0496118_0005481 3300048921 Bacteria 14399
822 Ga0496118_0336440 3300048921 Bacteria 811
823 Ga0496119_0002987 3300048922 Bacteria 17953
824 Ga0496119_0013469 3300048922 Bacteria 6508
825 Ga0496120_0001095 3300048923 Bacteria 35373
826 Ga0496121_0011630 3300048924 Bacteria 9732
827 Ga0496121_0022888 3300048924 Bacteria 6039
828 Ga0496124_0131915 3300048927 Bacteria 1984
829 Ga0496124_0339272 3300048927 Bacteria 1068
830 Ga0496125_0044847 3300048928 Bacteria 3731
831 Ga0496125_0104642 3300048928 Bacteria 2072
832 Ga0496125_0139856 3300048928 Bacteria 1685
833 Ga0496126_0137633 3300048929 Bacteria 2105
834 Ga0496126_0212423 3300048929 Bacteria 1628
835 Ga0501031_0051779 3300049568 Bacteria 2675
836 Ga0501031_0263255 3300049568 Unclassified 1120
837 Ga0501031_0365053 3300049568 Bacteria 934
838 Ga0501032_0359357 3300049569 Bacteria 938
839 Ga0501034_0272633 3300049571 Bacteria 1633
840 Ga0501034_0471595 3300049571 Bacteria 1171
841 Ga0501036_0169598 3300049572 Bacteria 1839
842 Ga0501036_0306887 3300049572 Bacteria 1327
843 Ga0501036_0399100 3300049572 Bacteria 1147
844 Ga0501037_0391835 3300049573 Bacteria 953
845 Ga0501038_0002086 3300049574 Bacteria 18534
846 Ga0501038_0243544 3300049574 Bacteria 1427
847 Ga0501039_0033485 3300049575 Bacteria 3962
848 Ga0501039_0074638 3300049575 Bacteria 2636
849 Ga0501039_0552765 3300049575 Bacteria 903
850 Ga0501039_0576216 3300049575 Bacteria 883
851 Ga0501040_0055297 3300049576 Bacteria 2721
852 Ga0501040_0186593 3300049576 Bacteria 1471
853 Ga0501040_0219932 3300049576 Bacteria 1351
854 Ga0501041_0227767 3300049577 Bacteria 1170
855 Ga0501041_0426737 3300049577 Archaea 841
856 Ga0501042_0020276 3300049578 Bacteria 4626
857 Ga0501042_0090625 3300049578 Bacteria 2195
858 Ga0501042_0103541 3300049578 Bacteria 2048
859 Ga0501042_0317273 3300049578 Bacteria 1126
860 Ga0501042_0640125 3300049578 Bacteria 773
861 Ga0501042_0989538 3300049578 Bacteria 613
862 Ga0501043_0123822 3300049579 Bacteria 2027
863 Ga0501043_0402565 3300049579 Bacteria 1034
864 Ga0501046_0120997 3300049580 Bacteria 1991
865 Ga0501046_0999677 3300049580 Bacteria 581
866 Ga0501047_0051981 3300049581 Bacteria 3960
867 Ga0501047_0305516 3300049581 Bacteria 1432
868 Ga0501047_0418482 3300049581 Bacteria 1171
869 Ga0501047_1036311 3300049581 Bacteria 634
870 Ga0501048_0008530 3300049582 Bacteria 7748
871 Ga0501048_0088046 3300049582 Bacteria 2190
872 Ga0501048_0326761 3300049582 Bacteria 1093
873 Ga0501067_0003029 3300049583 Bacteria 9283
874 Ga0501067_0193611 3300049583 Bacteria 1133
875 Ga0501067_0307059 3300049583 Bacteria 883
876 Ga0501067_0380033 3300049583 Bacteria 787
877 Ga0501068_0298701 3300049584 Bacteria 1031
878 Ga0501069_0035960 3300049585 Bacteria 2729
879 Ga0501069_0138787 3300049585 Bacteria 1394
880 Ga0501070_0065913 3300049586 Bacteria 2999
881 Ga0501070_0174961 3300049586 Bacteria 1767
882 Ga0501071_0013125 3300049587 Bacteria 5639
883 Ga0501071_0226155 3300049587 Bacteria 1409
884 Ga0501071_0377482 3300049587 Bacteria 1081
885 Ga0501071_1171743 3300049587 Bacteria 594
886 Ga0501071_1193892 3300049587 Bacteria 588
887 Ga0501072_0018459 3300049588 Bacteria 5373
888 Ga0501072_0038791 3300049588 Bacteria 3738
889 Ga0501072_0275263 3300049588 Bacteria 1339
890 Ga0501073_0121469 3300049589 Bacteria 1810
891 Ga0501074_0026425 3300049590 Bacteria 4210
892 Ga0501074_0122651 3300049590 Bacteria 1859
893 Ga0501074_0471970 3300049590 Bacteria 889
894 Ga0501075_0000170 3300049591 Bacteria 33818
895 Ga0501075_0721178 3300049591 Bacteria 759
896 Ga0501075_1124881 3300049591 Bacteria 596
897 Ga0501076_0016885 3300049592 Bacteria 5543
898 Ga0501076_0166709 3300049592 Bacteria 1795
899 Ga0501076_0218717 3300049592 Bacteria 1557
900 Ga0501076_0319220 3300049592 Bacteria 1274
901 Ga0501077_0307141 3300049593 Bacteria 1011
902 Ga0501079_0013899 3300049741 Bacteria 6142
903 Ga0501079_0118954 3300049741 Bacteria 2054
904 Ga0501079_0498773 3300049741 Bacteria 957
905 Ga0501080_1196246 3300049742 Unclassified 653
906 Ga0501081_0037530 3300049743 Bacteria 3306
907 Ga0501081_0176682 3300049743 Bacteria 1543
908 Ga0501081_0382392 3300049743 Bacteria 1040
909 Ga0501081_1241151 3300049743 Bacteria 565
910 Ga0501083_0068703 3300049744 Bacteria 2357
911 Ga0501083_0407402 3300049744 Unclassified 885
912 Ga0501035_0152248 3300049822 Bacteria 2006
913 Ga0501044_0282410 3300049823 Bacteria 1593
914 Ga0501044_0302710 3300049823 Bacteria 1527
915 Ga0501044_0652956 3300049823 Bacteria 941
916 Ga0501045_0057132 3300049824 Bacteria 2855
917 Ga0501045_0088010 3300049824 Bacteria 2294
918 Ga0501045_0142479 3300049824 Bacteria 1782
919 Ga0501045_0229920 3300049824 Bacteria 1381
920 Ga0501045_0465642 3300049824 Bacteria 939
921 Ga0501045_0494108 3300049824 Bacteria 909
922 nmdc:mga03n38_110084_c1 3300050490 Bacteria 1340
923 nmdc:mga00v17_502276_c1 3300050491 Unclassified 786
924 nmdc:mga00v17_515867_c1 3300050491 Bacteria 774
925 nmdc:mga0yw44_136463_c1 3300050492 Bacteria 1592
926 nmdc:mga0yw44_14146_c1 3300050492 Bacteria 4225
927 nmdc:mga0yw44_236709_c1 3300050492 Bacteria 1213
928 nmdc:mga0yw44_289477_c1 3300050492 Bacteria 1096
929 nmdc:mga0yw44_4178_c1 3300050492 Bacteria 6568
930 nmdc:mga0yw44_69374_c1 3300050492 Bacteria 2183
931 nmdc:mga0yw44_8746_c1 3300050492 Bacteria 5065
932 nmdc:mga0yw44_96717_c1 3300050492 Bacteria 1875
933 nmdc:mga05p37_1265375_c1 3300050507 Bacteria 755
934 nmdc:mga05p37_13588_c1 3300050507 Bacteria 9758
935 nmdc:mga05p37_268605_c1 3300050507 Bacteria 2039
936 nmdc:mga05p37_28044_c1 3300050507 Bacteria 2413
937 nmdc:mga05p37_554091_c1 3300050507 Bacteria 1308
938 nmdc:mga09592_8684_c1 3300050508 Bacteria 8266
939 nmdc:mga0qj67_30495_c1 3300050509 Bacteria 4199
940 nmdc:mga06r32_166766_c1 3300050510 Bacteria 2186
941 nmdc:mga06r32_21065_c1 3300050510 Bacteria 6014
942 nmdc:mga06r32_258346_c1 3300050510 Bacteria 1730
943 nmdc:mga06r32_529255_c1 3300050510 Bacteria 1154
944 nmdc:mga06r32_97959_c1 3300050510 Bacteria 2874
945 nmdc:mga08y16_1131440_c1 3300050511 Bacteria 757
946 nmdc:mga08y16_22469_c1 3300050511 Bacteria 6658
947 nmdc:mga08y16_50599_c1 3300050511 Bacteria 4348
948 nmdc:mga0n895_102613_c1 3300050512 Bacteria 2871
949 nmdc:mga0n895_242366_c1 3300050512 Bacteria 1830
950 nmdc:mga0n895_311350_c1 3300050512 Bacteria 1596
951 nmdc:mga0rr50_62733_c1 3300050513 Bacteria 2805
952 nmdc:mga08x19_130895_c1 3300050514 Bacteria 1687
953 nmdc:mga08x19_395299_c1 3300050514 Bacteria 969
954 nmdc:mga0a205_10759_c2 3300050515 Bacteria 2248
955 nmdc:mga0a205_12_c2 3300050515 Bacteria 69190
956 nmdc:mga0a205_156791_c1 3300050515 Bacteria 2175
957 nmdc:mga0a205_244153_c1 3300050515 Bacteria 1676
958 Ga0495601_0000073 3300053077 Bacteria 55911
959 Ga0495601_0000080 3300053077 Bacteria 51518
960 Ga0495601_0004476 3300053077 Bacteria 8076
961 Ga0495601_0023491 3300053077 Bacteria 3788
962 Ga0495601_0499084 3300053077 Bacteria 785
963 Ga0495612_0000410 3300053078 Bacteria 17077
964 Ga0495612_0001984 3300053078 Bacteria 8425
965 Ga0495612_0067334 3300053078 Bacteria 1489
966 Ga0495612_0183661 3300053078 Bacteria 919
967 Ga0495655_0001122 3300053083 Bacteria 4140
968 Ga0495595_0000001 3300053084 Bacteria 495226
969 Ga0495595_0000069 3300053084 Bacteria 50835
970 Ga0495595_0032654 3300053084 Bacteria 2345
971 Ga0495595_0035624 3300053084 Bacteria 2254
972 Ga0495595_0717977 3300053084 Unclassified 512
973 Ga0495619_0000024 3300053085 Bacteria 180821
974 Ga0495619_0000065 3300053085 Bacteria 83763
975 Ga0495619_0000479 3300053085 Bacteria 26801
976 Ga0495619_0001018 3300053085 Bacteria 18364
977 Ga0495619_0001209 3300053085 Bacteria 16929
978 Ga0495619_0001424 3300053085 Bacteria 15727
979 Ga0495619_0003660 3300053085 Bacteria 9908
980 Ga0495619_0013290 3300053085 Bacteria 5186
981 Ga0500614_000272 3300053123 Bacteria 13406
982 Ga0501084_0067497 3300054114 Bacteria 2993
983 Ga0501084_0354701 3300054114 Bacteria 1239
984 Ga0501082_0105363 3300060353 Bacteria 2439
985 Ga0501082_0126485 3300060353 Bacteria 2216
986 Ga0530510_0004092 3300061734 Bacteria 10063
987 Ga0530510_0750660 3300061734 Bacteria 744
988 Ga0307408_100860822
989 LJQas_1000528
990 JGI24746J21847_1000506
991 JGI24034J26672_10000575
992 JGI24751J29686_10026639
993 JGI25406J46586_10071554
994 JGI25406J46586_10165814
995 JGI25407J50210_10032826
996 Ga0070658_10663830
997 Ga0070676_10397618
998 Ga0070683_100004421
999 Ga0070683_100005278
1000 Ga0070683_100024596
1001 Ga0070683_100519638
1002 Ga0070683_100598868
1003 Ga0070670_100174928
1004 Ga0070677_10000027
1005 Ga0068869_100030350
1006 Ga0068869_100243450
1007 Ga0070666_10015472
1008 Ga0070666_10260970
1009 Ga0070666_10335100
1010 Ga0070680_100023287
1011 Ga0070682_100000057
1012 Ga0070682_100000802
1013 Ga0070682_100177621
1014 Ga0070682_100183136
1015 Ga0068868_100000864
1016 Ga0068868_100002371
1017 Ga0068868_100062366
1018 Ga0068868_100093514
1019 Ga0070660_100102893
1020 Ga0070689_100024077
1021 Ga0070689_100055310
1022 Ga0070691_10000553
1023 Ga0070687_100074341
1024 Ga0070687_100640851
1025 Ga0070661_100000031
1026 Ga0070692_10009721
1027 Ga0070692_10149828
1028 Ga0070668_100022932
1029 Ga0070669_100237228
1030 Ga0070675_100000015
1031 Ga0070674_100000003
1032 Ga0070674_100000316
1033 Ga0070674_100161769
1034 Ga0070674_100168820
1035 Ga0070674_100201223
1036 Ga0070674_101566037
1037 Ga0070673_100014734
1038 Ga0070673_100373080
1039 Ga0070673_100567107
1040 Ga0070688_100000534
1041 Ga0070688_100002238
1042 Ga0070688_100529261
1043 Ga0070659_100107304
1044 Ga0070667_100150412
1045 Ga0070667_100265017
1046 Ga0070667_101992022
1047 Ga0070703_10116555
1048 Ga0070714_100035028
1049 Ga0070713_100000040
1050 Ga0070710_11144748
1051 Ga0070701_10266820
1052 Ga0070711_100068062
1053 Ga0070711_100095642
1054 Ga0070700_100681518
1055 Ga0070694_100580189
1056 Ga0070663_100590765
1057 Ga0070678_100004739
1058 Ga0070678_100045503
1059 Ga0070678_100123891
1060 Ga0070662_100000005
1061 Ga0070681_10186330
1062 Ga0070681_10232246
1063 Ga0070681_10594513
1064 Ga0068867_100000254
1065 Ga0068867_100069223
1066 Ga0070685_10000689
1067 Ga0070685_10001213
1068 Ga0070685_10023692
1069 Ga0070685_10031748
1070 Ga0070685_10082572
1071 Ga0070685_10491339
1072 Ga0070706_100105033
1073 Ga0070699_100692192
1074 Ga0070679_100000153
1075 Ga0070684_100039878
1076 Ga0070684_100297046
1077 Ga0070684_100432169
1078 Ga0070684_100640046
1079 Ga0070684_100792365
1080 Ga0070697_101134740
1081 Ga0068853_100005454
1082 Ga0070672_100000007
1083 Ga0070672_100271225
1084 Ga0070686_100015611
1085 Ga0070686_100074074
1086 Ga0070686_100423316
1087 Ga0070695_100704326
1088 Ga0070695_101092870
1089 Ga0070696_100205020
1090 Ga0070693_100046061
1091 Ga0070665_100000159
1092 Ga0070665_100003550
1093 Ga0070665_100004595
1094 Ga0070665_100806546
1095 Ga0070665_101171220
1096 Ga0070665_101749338
1097 Ga0070704_100002311
1098 Ga0070704_100194204
1099 Ga0070704_100281438
1100 Ga0070704_100313272
1101 Ga0070704_100374492
1102 Ga0068855_100485814
1103 Ga0070664_100187226
1104 Ga0068857_100246536
1105 Ga0068854_100000371
1106 Ga0068854_100067303
1107 Ga0068854_100366795
1108 Ga0068856_100002486
1109 Ga0068856_100047894
1110 Ga0068856_100082112
1111 Ga0070702_100093761
1112 Ga0070702_100216888
1113 Ga0070702_100980639
1114 Ga0068852_100000103
1115 Ga0068852_100230204
1116 Ga0068852_100265134
1117 Ga0068859_100181876
1118 Ga0068859_100481255
1119 Ga0068864_100000066
1120 Ga0068866_10000002
1121 Ga0068866_10000457
1122 Ga0068866_10611905
1123 Ga0068861_100173829
1124 Ga0068861_100716938
1125 Ga0068851_10016292
1126 Ga0068851_10265522
1127 Ga0068870_10043765
1128 Ga0068863_100000032
1129 Ga0068858_100000043
1130 Ga0068858_100000049
1131 Ga0068858_100041610
1132 Ga0068858_100178442
1133 Ga0068858_100179560
1134 Ga0068858_100653381
1135 Ga0068860_100009747
1136 Ga0068860_100036300
1137 Ga0068860_101447335
1138 Ga0068860_101855181
1139 Ga0068862_100084251
1140 Ga0068862_100097013
1141 Ga0068862_102011356
1142 Ga0081455_10005275
1143 Ga0081455_10009930
1144 Ga0081455_10011084
1145 Ga0081455_10029633
1146 Ga0081455_10044620
1147 Ga0081455_10068495
1148 Ga0081455_10109091
1149 Ga0081455_10110646
1150 Ga0081455_10285274
1151 Ga0081455_10343374
1152 Ga0081455_10394449
1153 Ga0081455_10437480
1154 Ga0081455_10547397
1155 Ga0081538_10000135
1156 Ga0081538_10000204
1157 Ga0081538_10001004
1158 Ga0081538_10035826
1159 Ga0081538_10128546
1160 Ga0081540_1000686
1161 Ga0081540_1171445
1162 Ga0081539_10001602
1163 Ga0081539_10028563
1164 Ga0075365_10000180
1165 Ga0075365_10005742
1166 Ga0075365_10012257
1167 Ga0075365_10023529
1168 Ga0075365_10049013
1169 Ga0075365_10078811
1170 Ga0075365_10090970
1171 Ga0075365_10265918
1172 Ga0075365_10340651
1173 Ga0075363_100155442
1174 Ga0075363_100200801
1175 Ga0075364_10371169
1176 Ga0075364_10398570
1177 Ga0075364_10488826
1178 Ga0075432_10190437
1179 Ga0070715_10000012
1180 Ga0070715_10253564
1181 Ga0070712_100002001
1182 Ga0070712_100368639
1183 Ga0075367_10362043
1184 Ga0097621_100210577
1185 Ga0068871_100310687
1186 Ga0075428_100105390
1187 Ga0075430_100001324
1188 Ga0075430_100045670
1189 Ga0075431_100011036
1190 Ga0075431_100019567
1191 Ga0075431_100070406
1192 Ga0075431_100347497
1193 Ga0075431_101182759
1194 Ga0075433_10001758
1195 Ga0075433_10016159
1196 Ga0075433_10132320
1197 Ga0075433_10190229
1198 Ga0075433_10191471
1199 Ga0075434_100020110
1200 Ga0075429_100008611
1201 Ga0068865_100000001
1202 Ga0075436_100071279
1203 Ga0075436_100283802
1204 Ga0097620_100181873
1205 Ga0097620_100481269
1206 Ga0075435_100205637
1207 Ga0075435_100701507
1208 Ga0105240_11025594
1209 Ga0111539_10008366
1210 Ga0111539_10016386
1211 Ga0111539_10095657
1212 Ga0111539_10350303
1213 Ga0111539_11248138
1214 Ga0105245_10000091
1215 Ga0105245_10000340
1216 Ga0105245_10002874
1217 Ga0105245_10005187
1218 Ga0105245_10023351
1219 Ga0105245_10435543
1220 Ga0105245_10465616
1221 Ga0105245_10863877
1222 Ga0105245_12403065
1223 Ga0105247_10001345
1224 Ga0105247_10045449
1225 Ga0105247_10193065
1226 Ga0105247_10423716
1227 Ga0105247_10559578
1228 Ga0105247_11393335
1229 Ga0114129_10013966
1230 Ga0114129_10041143
1231 Ga0114129_10052844
1232 Ga0114129_10061521
1233 Ga0114129_10230323
1234 Ga0114129_11025191
1235 Ga0114129_11281874
1236 Ga0114129_11294070
1237 Ga0114129_12245933
1238 Ga0105243_10013134
1239 Ga0105243_10102834
1240 Ga0105243_10104004
1241 Ga0105243_10123078
1242 Ga0105243_10334879
1243 Ga0105243_10401099
1244 Ga0105243_10422461
1245 Ga0105241_10475723
1246 Ga0105242_10001420
1247 Ga0105242_10057966
1248 Ga0105242_10393544
1249 Ga0105242_11727381
1250 Ga0105248_10000506
1251 Ga0105248_10256203
1252 Ga0105248_10492942
1253 Ga0105248_10582178
1254 Ga0105237_10121799
1255 Ga0105237_10129753
1256 Ga0105238_10000028
1257 Ga0105238_10037990
1258 Ga0105238_10402405
1259 Ga0105238_10414425
1260 Ga0105238_10429035
1261 Ga0105249_10000073
1262 Ga0105249_10007327
1263 Ga0105249_10060909
1264 Ga0105249_10075632
1265 Ga0105249_10080516
1266 Ga0105249_10701097
1267 Ga0105239_10244006
1268 Ga0105239_11183635
1269 Ga0105239_11206606
1270 Ga0105246_10195700
1271 Ga0105246_10266248
1272 Ga0105246_10334851
1273 Ga0157371_10002665
1274 Ga0157371_10036579
1275 Ga0157370_10015146
1276 Ga0157370_10029574
1277 Ga0157369_10414972
1278 Ga0157374_10125138
1279 Ga0157378_10016506
1280 Ga0157378_10193802
1281 Ga0157378_10709855
1282 Ga0163162_10142956
1283 Ga0163162_10727512
1284 Ga0163162_10830584
1285 Ga0163162_11914823
1286 Ga0157372_10000121
1287 Ga0157372_10102593
1288 Ga0157372_10102848
1289 Ga0157375_10003805
1290 Ga0157375_10018619
1291 Ga0157375_10129622
1292 Ga0157375_10154763
1293 Ga0157375_11219189
1294 Ga0163163_11189309
1295 Ga0157380_10000400
1296 Ga0157380_10019156
1297 Ga0157380_12078162
1298 Ga0157379_10011086
1299 Ga0157379_10193354
1300 Ga0157379_10604517
1301 Ga0157379_11572935
1302 Ga0157376_10287318
1303 Ga0163161_10000073
1304 Ga0163161_10271207
1305 Ga0163161_10320715
1306 Ga0197907_11003200
1307 Ga0206356_10604718
1308 Ga0206354_10017965
1309 Ga0206354_10281469
1310 Ga0206353_10760314
1311 Ga0213873_10041676
1312 Ga0213876_10017769
1313 Ga0224712_10092910
1314 Ga0224712_10270126
1315 Ga0207656_10002474
1316 Ga0207656_10009876
1317 Ga0207656_10160895
1318 Ga0207682_10000003
1319 Ga0207642_10000001
1320 Ga0207642_10000003
1321 Ga0207642_10000004
1322 Ga0207642_10000389
1323 Ga0207710_10000112
1324 Ga0207710_10147856
1325 Ga0207710_10495459
1326 Ga0207688_10039754
1327 Ga0207680_10001025
1328 Ga0207680_10154479
1329 Ga0207685_10000001
1330 Ga0207645_10258226
1331 Ga0207645_10504252
1332 Ga0207643_10016033
1333 Ga0207705_10575650
1334 Ga0207654_10299095
1335 Ga0207707_10048787
1336 Ga0207695_10953926
1337 Ga0207693_10000001
1338 Ga0207693_10002935
1339 Ga0207693_10011889
1340 Ga0207663_10043081
1341 Ga0207663_10050424
1342 Ga0207660_10172358
1343 Ga0207660_10840515
1344 Ga0207662_10031842
1345 Ga0207662_10206928
1346 Ga0207657_10052488
1347 Ga0207649_10000021
1348 Ga0207649_10355235
1349 Ga0207649_10690387
1350 Ga0207652_10001404
1351 Ga0207652_10446245
1352 Ga0207646_11169495
1353 Ga0207681_10080412
1354 Ga0207681_11054389
1355 Ga0207694_10000008
1356 Ga0207694_10181668
1357 Ga0207694_10504585
1358 Ga0207650_10156560
1359 Ga0207659_10000094
1360 Ga0207687_10000012
1361 Ga0207687_10000042
1362 Ga0207687_10001586
1363 Ga0207687_10003941
1364 Ga0207687_10016098
1365 Ga0207687_10273513
1366 Ga0207687_10330135
1367 Ga0207687_10580791
1368 Ga0207687_10661411
1369 Ga0207700_10000032
1370 Ga0207664_10003709
1371 Ga0207644_10055977
1372 Ga0207690_10001272
1373 Ga0207690_10744706
1374 Ga0207706_10000006
1375 Ga0207686_10012361
1376 Ga0207686_10138659
1377 Ga0207686_10185978
1378 Ga0207709_10012145
1379 Ga0207709_10031084
1380 Ga0207709_10093073
1381 Ga0207670_10039494
1382 Ga0207670_10307009
1383 Ga0207669_10000016
1384 Ga0207669_10000023
1385 Ga0207669_10188325
1386 Ga0207669_10190543
1387 Ga0207669_10452186
1388 Ga0207669_10553006
1389 Ga0207669_10921495
1390 Ga0207704_10000012
1391 Ga0207704_10868985
1392 Ga0207665_10109152
1393 Ga0207665_10508763
1394 Ga0207691_10000140
1395 Ga0207691_10086172
1396 Ga0207711_10000085
1397 Ga0207711_10954105
1398 Ga0207689_10024231
1399 Ga0207689_10180196
1400 Ga0207661_10000784
1401 Ga0207661_10007312
1402 Ga0207661_10013420
1403 Ga0207661_10029192
1404 Ga0207661_10154133
1405 Ga0207661_10274312
1406 Ga0207661_10398015
1407 Ga0207661_10825237
1408 Ga0207661_11164889
1409 Ga0207679_10023481
1410 Ga0207679_10510398
1411 Ga0207651_10008848
1412 Ga0207651_10082886
1413 Ga0207712_10000003
1414 Ga0207712_10133852
1415 Ga0207712_10136772
1416 Ga0207712_10738529
1417 Ga0207668_10132948
1418 Ga0207668_10185970
1419 Ga0207668_10874805
1420 Ga0207668_11063320
1421 Ga0207668_11767335
1422 Ga0207640_10000270
1423 Ga0207640_10499382
1424 Ga0207640_11341219
1425 Ga0207658_10075507
1426 Ga0207658_10217427
1427 Ga0207677_10000760
1428 Ga0207677_10002075
1429 Ga0207677_10109248
1430 Ga0207703_10000053
1431 Ga0207703_10000132
1432 Ga0207703_10031133
1433 Ga0207703_10068265
1434 Ga0207703_10130764
1435 Ga0207703_10781066
1436 Ga0207639_10001498
1437 Ga0207639_10569911
1438 Ga0207678_10059792
1439 Ga0207678_11755392
1440 Ga0207708_10046046
1441 Ga0207708_10049604
1442 Ga0207702_10000332
1443 Ga0207702_10005812
1444 Ga0207702_10056840
1445 Ga0207641_10000071
1446 Ga0207641_10239994
1447 Ga0207648_10110678
1448 Ga0207676_10000038
1449 Ga0207676_10265327
1450 Ga0207674_10124152
1451 Ga0207675_100146309
1452 Ga0207675_101085713
1453 Ga0207683_10063056
1454 Ga0207683_10156357
1455 Ga0207698_10000009
1456 Ga0207698_10012457
1457 Ga0207698_10178161
1458 Ga0207698_10578855
1459 Ga0207428_10029736
1460 Ga0207428_10040972
1461 Ga0207428_10113550
1462 Ga0207428_10126704
1463 Ga0268266_10000023
1464 Ga0268266_10001388
1465 Ga0268266_10001442
1466 Ga0268266_10215563
1467 Ga0268266_10219388
1468 Ga0268266_10292207
1469 Ga0268266_10321398
1470 Ga0268266_10557788
1471 Ga0268266_11034754
1472 Ga0268265_10120653
1473 Ga0268265_10697654
1474 Ga0268265_10914133
1475 Ga0268265_11724613
1476 Ga0268264_10002363
1477 Ga0268264_10077884
1478 Ga0268264_10177645
1479 Ga0307511_10137879
1480 Ga0307408_101355843
1481 Ga0316579_10102806
1482 Ga0307405_10329116
1483 Ga0307413_10230678
1484 Ga0307413_11379752
1485 Ga0307410_10524040
1486 Ga0307410_10739662
1487 Ga0307406_10070979
1488 Ga0307409_101025834
1489 Ga0307409_101219561
1490 Ga0307416_100661673
1491 Ga0307414_11238516
1492 Ga0307411_10197561
1493 Ga0307415_100012565
1494 Ga0307415_100601707
1495 Ga0316583_10219556
1496 Ga0373939_0128858
1497 Ga0373945_0290247
1498 Ga0373954_0149067
1499 Ga0373956_0200078
1500 Ga0373957_0097788
1501 Ga0373960_0083927
1502 Ga0373943_0047960
1503 Ga0373955_0124753
1504 Ga0373942_0103743
1505 Ga0316574_0120286
1506 Ga0373935_0398012
1507 Ga0373933_0710249
1508 Ga0373947_0248629
1509 Ga0373937_0027900
1510 Ga0373937_0042483
1511 Ga0316582_0811424
1512 Ga0316584_0293899
1513 Ga0373925_0472415
1514 Ga0373925_1531738
1515 Ga0395899_0047858
1516 Ga0395900_0021354
1517 Ga0395900_0183072
1518 Ga0395900_0353044
1519 Ga0395900_0413270
1520 Ga0395900_0913769
1521 Ga0395900_0975764
1522 Ga0395898_0016278
1523 Ga0395898_0079042
1524 Ga0395898_0324326
1525 Ga0395898_0396725
1526 Ga0395898_0631227
1527 Ga0395898_0664614
1528 Ga0395898_0707116
1529 Ga0395898_0850155
1530 Ga0395898_0871284
1531 Ga0395905_0004196
1532 Ga0395905_0225709
1533 Ga0395905_0266977
1534 Ga0395905_0335759
1535 Ga0395901_0018076
1536 Ga0395901_0080123
1537 Ga0395901_0264625
1538 Ga0395901_0904343
1539 Ga0436365_0700522
1540 Ga0436362_0361016
1541 Ga0451789_0190937
1542 Ga0451793_1567316
1543 Ga0451833_0127813
1544 Ga0451849_1383452
1545 Ga0439448_0128192
1546 Ga0466963_0000406
1547 Ga0466963_0019056
1548 Ga0466963_0037755
1549 Ga0466963_0895737
1550 Ga0466964_0014541
1551 Ga0466964_0193517
1552 Ga0466964_0355324
1553 Ga0466957_0580411
1554 Ga0466957_0610028
1555 Ga0466960_0187516
1556 Ga0466958_0201290
1557 Ga0466967_0000007
1558 Ga0466967_0003720
1559 Ga0466967_0032948
1560 Ga0466967_0061173
1561 Ga0466967_0612912
1562 Ga0466967_1544001
1563 Ga0495592_0031293
1564 Ga0495592_0090252
1565 Ga0495592_0095353
1566 Ga0495603_0004170
1567 Ga0495590_0056589
1568 Ga0495590_0140401
1569 Ga0495629_0001388
1570 Ga0495629_0011366
1571 Ga0495629_0705603
1572 Ga0495638_0134391
1573 Ga0495641_0000012
1574 Ga0495641_0010457
1575 Ga0495641_0062434
1576 Ga0495651_0024433
1577 Ga0495651_0082512
1578 Ga0495651_0140463
1579 Ga0495651_0192718
1580 Ga0495651_0404847
1581 Ga0495653_0030121
1582 Ga0495653_0520267
1583 Ga0495582_0000007
1584 Ga0495582_0184405
1585 Ga0495582_0753780
1586 Ga0495639_0292651
1587 Ga0495662_0004180
1588 Ga0495662_0067271
1589 Ga0495584_0242898
1590 Ga0495584_0388473
1591 Ga0495585_0272377
1592 Ga0495585_0626687
1593 Ga0495594_0095786
1594 Ga0495596_0062448
1595 Ga0495596_0093303
1596 Ga0495596_0232560
1597 Ga0495606_0000082
1598 Ga0495608_0000063
1599 Ga0495608_0005393
1600 Ga0495608_0027929
1601 Ga0495608_0063068
1602 Ga0495608_0100014
1603 Ga0495616_0160838
1604 Ga0495616_0327538
1605 Ga0495618_0000003
1606 Ga0495618_0483003
1607 Ga0495620_0000113
1608 Ga0495628_0036556
1609 Ga0495628_0054751
1610 Ga0495628_0103973
1611 Ga0495628_0104012
1612 Ga0495628_0111898
1613 Ga0495628_0469037
1614 Ga0495630_0000007
1615 Ga0495630_0000477
1616 Ga0495630_0447058
1617 Ga0495644_0089288
1618 Ga0495663_0077994
1619 Ga0495652_0001430
1620 Ga0495652_0155110
1621 Ga0495640_0004409
1622 Ga0495640_0006935
1623 Ga0495640_0145828
1624 Ga0495586_0001272
1625 Ga0495586_0276550
1626 Ga0495587_0071367
1627 Ga0495587_0106533
1628 Ga0495598_0053928
1629 Ga0495621_0000679
1630 Ga0495645_0004980
1631 Ga0495645_0013041
1632 Ga0495645_0457661
1633 Ga0495667_0090823
1634 Ga0495656_0299579
1635 Ga0495634_0000125
1636 Ga0495634_0000828
1637 Ga0495634_0010756
1638 Ga0495634_0082549
1639 Ga0495634_0171893
1640 Ga0495634_0575152
1641 Ga0495635_0000009
1642 Ga0495635_0047675
1643 Ga0495635_0231854
1644 Ga0495635_0324906
1645 Ga0495659_0162657
1646 Ga0495588_0000602
1647 Ga0495657_0000084
1648 Ga0495657_0010956
1649 Ga0495657_0023623
1650 Ga0495599_0136910
1651 Ga0495599_0335927
1652 Ga0495647_0000014
1653 Ga0495647_0005014
1654 Ga0495647_0011161
1655 Ga0495647_0276770
1656 Ga0495658_0000007
1657 Ga0495658_0050093
1658 Ga0495658_0185227
1659 Ga0495669_0000213
1660 Ga0495669_0020171
1661 Ga0495669_0136595
1662 Ga0495613_0000003
1663 Ga0495613_0000310
1664 Ga0495613_0088978
1665 Ga0495624_0000002
1666 Ga0495624_0000256
1667 Ga0495624_0228619
1668 Ga0495624_0364848
1669 Ga0495670_0103637
1670 Ga0495649_0034365
1671 Ga0495589_0230893
1672 Ga0495600_0003063
1673 Ga0495600_0033862
1674 Ga0495600_0096189
1675 Ga0495600_0099370
1676 Ga0495600_0537082
1677 Ga0495660_0076596
1678 Ga0495660_0504488
1679 Ga0495581_0160050
1680 Ga0495604_0000084
1681 Ga0495604_0043452
1682 Ga0495674_0000027
1683 Ga0495672_0046414
1684 Ga0495672_0125585
1685 Ga0495676_0001046
1686 Ga0495676_0049017
1687 Ga0495676_0314114
1688 Ga0495680_0000255
1689 Ga0495680_0000256
1690 Ga0495680_0081114
1691 Ga0495680_0318445
1692 Ga0495675_0000067
1693 Ga0495675_0070636
1694 Ga0495679_108621
1695 Ga0495685_060990
1696 Ga0495673_0078838
1697 Ga0495684_0092105
1698 Ga0495686_0010031
1699 Ga0495686_0048752
1700 Ga0495593_0087797
1701 Ga0495593_0119025
1702 Ga0495602_0000008
1703 Ga0495602_0349526
1704 Ga0495614_0287428
1705 Ga0495626_0147357
1706 Ga0496100_0000016
1707 Ga0496100_1358508
1708 Ga0496101_0000038
1709 Ga0496101_0002799
1710 Ga0496101_0058412
1711 Ga0496101_0372709
1712 Ga0496101_0601350
1713 Ga0496101_0765465
1714 Ga0496101_0848246
1715 Ga0496101_0860645
1716 Ga0496102_0005397
1717 Ga0496102_0025633
1718 Ga0496102_0194530
1719 Ga0496102_0354963
1720 Ga0496102_0980740
1721 Ga0496103_0001687
1722 Ga0496103_0014666
1723 Ga0496103_0050586
1724 Ga0496103_0138108
1725 Ga0496103_0544670
1726 Ga0496104_0000003
1727 Ga0496104_0000007
1728 Ga0496104_0000147
1729 Ga0496104_0036798
1730 Ga0496104_0074338
1731 Ga0496105_0000002
1732 Ga0496105_0000008
1733 Ga0496105_0000988
1734 Ga0496105_0024847
1735 Ga0496105_0026744
1736 Ga0496105_0086229
1737 Ga0496106_0000013
1738 Ga0496106_0000027
1739 Ga0496106_0048080
1740 Ga0496106_0071587
1741 Ga0496106_0076379
1742 Ga0496106_0616846
1743 Ga0496107_0000003
1744 Ga0496107_0034892
1745 Ga0496107_0051851
1746 Ga0496107_0094312
1747 Ga0496107_0306002
1748 Ga0496108_0000002
1749 Ga0496108_0000216
1750 Ga0496108_0000254
1751 Ga0496108_0002779
1752 Ga0496108_0010108
1753 Ga0496108_0019207
1754 Ga0496108_0079609
1755 Ga0496108_0249765
1756 Ga0496108_0374770
1757 Ga0496108_0381682
1758 Ga0496108_0839740
1759 Ga0496109_0000001
1760 Ga0496109_0000046
1761 Ga0496109_0000085
1762 Ga0496109_0000321
1763 Ga0496109_0129770
1764 Ga0496109_0170671
1765 Ga0496109_0199975
1766 Ga0496109_0212228
1767 Ga0496109_0323286
1768 Ga0496109_0999829
1769 Ga0496110_0000004
1770 Ga0496110_0006148
1771 Ga0496110_0047435
1772 Ga0496110_0066142
1773 Ga0496110_0142170
1774 Ga0496110_0143405
1775 Ga0496110_0702373
1776 Ga0496110_1042929
1777 Ga0496111_0000002
1778 Ga0496111_0000644
1779 Ga0496111_0010486
1780 Ga0496111_0012361
1781 Ga0496111_0035437
1782 Ga0496111_0072352
1783 Ga0496111_0133809
1784 Ga0496111_0204669
1785 Ga0496111_0490988
1786 Ga0496112_0000539
1787 Ga0496112_0002982
1788 Ga0496112_0009876
1789 Ga0496112_0106817
1790 Ga0496112_0256448
1791 Ga0496112_1321111
1792 Ga0496113_0000012
1793 Ga0496113_0005984
1794 Ga0496113_0018250
1795 Ga0496113_0028851
1796 Ga0496113_0043034
1797 Ga0496113_0049342
1798 Ga0496113_0167441
1799 Ga0496113_0353712
1800 Ga0496114_0013938
1801 Ga0496114_0034256
1802 Ga0496114_0625873
1803 Ga0496115_0070655
1804 Ga0496115_0702504
1805 Ga0496115_0858722
1806 Ga0496117_0007101
1807 Ga0496117_0050346
1808 Ga0496118_0005481
1809 Ga0496118_0336440
1810 Ga0496119_0002987
1811 Ga0496119_0013469
1812 Ga0496120_0001095
1813 Ga0496121_0011630
1814 Ga0496121_0022888
1815 Ga0496124_0131915
1816 Ga0496124_0339272
1817 Ga0496125_0044847
1818 Ga0496125_0104642
1819 Ga0496125_0139856
1820 Ga0496126_0137633
1821 Ga0496126_0212423
1822 Ga0501031_0051779
1823 Ga0501031_0263255
1824 Ga0501031_0365053
1825 Ga0501032_0359357
1826 Ga0501034_0272633
1827 Ga0501034_0471595
1828 Ga0501036_0169598
1829 Ga0501036_0306887
1830 Ga0501036_0399100
1831 Ga0501037_0391835
1832 Ga0501038_0002086
1833 Ga0501038_0243544
1834 Ga0501039_0033485
1835 Ga0501039_0074638
1836 Ga0501039_0552765
1837 Ga0501039_0576216
1838 Ga0501040_0055297
1839 Ga0501040_0186593
1840 Ga0501040_0219932
1841 Ga0501041_0227767
1842 Ga0501041_0426737
1843 Ga0501042_0020276
1844 Ga0501042_0090625
1845 Ga0501042_0103541
1846 Ga0501042_0317273
1847 Ga0501042_0640125
1848 Ga0501042_0989538
1849 Ga0501043_0123822
1850 Ga0501043_0402565
1851 Ga0501046_0120997
1852 Ga0501046_0999677
1853 Ga0501047_0051981
1854 Ga0501047_0305516
1855 Ga0501047_0418482
1856 Ga0501047_1036311
1857 Ga0501048_0008530
1858 Ga0501048_0088046
1859 Ga0501048_0326761
1860 Ga0501067_0003029
1861 Ga0501067_0193611
1862 Ga0501067_0307059
1863 Ga0501067_0380033
1864 Ga0501068_0298701
1865 Ga0501069_0035960
1866 Ga0501069_0138787
1867 Ga0501070_0065913
1868 Ga0501070_0174961
1869 Ga0501071_0013125
1870 Ga0501071_0226155
1871 Ga0501071_0377482
1872 Ga0501071_1171743
1873 Ga0501071_1193892
1874 Ga0501072_0018459
1875 Ga0501072_0038791
1876 Ga0501072_0275263
1877 Ga0501073_0121469
1878 Ga0501074_0026425
1879 Ga0501074_0122651
1880 Ga0501074_0471970
1881 Ga0501075_0000170
1882 Ga0501075_0721178
1883 Ga0501075_1124881
1884 Ga0501076_0016885
1885 Ga0501076_0166709
1886 Ga0501076_0218717
1887 Ga0501076_0319220
1888 Ga0501077_0307141
1889 Ga0501079_0013899
1890 Ga0501079_0118954
1891 Ga0501079_0498773
1892 Ga0501080_1196246
1893 Ga0501081_0037530
1894 Ga0501081_0176682
1895 Ga0501081_0382392
1896 Ga0501081_1241151
1897 Ga0501083_0068703
1898 Ga0501083_0407402
1899 Ga0501035_0152248
1900 Ga0501044_0282410
1901 Ga0501044_0302710
1902 Ga0501044_0652956
1903 Ga0501045_0057132
1904 Ga0501045_0088010
1905 Ga0501045_0142479
1906 Ga0501045_0229920
1907 Ga0501045_0465642
1908 Ga0501045_0494108
1909 nmdc:mga03n38_110084_c1
1910 nmdc:mga00v17_502276_c1
1911 nmdc:mga00v17_515867_c1
1912 nmdc:mga0yw44_136463_c1
1913 nmdc:mga0yw44_14146_c1
1914 nmdc:mga0yw44_236709_c1
1915 nmdc:mga0yw44_289477_c1
1916 nmdc:mga0yw44_4178_c1
1917 nmdc:mga0yw44_69374_c1
1918 nmdc:mga0yw44_8746_c1
1919 nmdc:mga0yw44_96717_c1
1920 nmdc:mga05p37_1265375_c1
1921 nmdc:mga05p37_13588_c1
1922 nmdc:mga05p37_268605_c1
1923 nmdc:mga05p37_28044_c1
1924 nmdc:mga05p37_554091_c1
1925 nmdc:mga09592_8684_c1
1926 nmdc:mga0qj67_30495_c1
1927 nmdc:mga06r32_166766_c1
1928 nmdc:mga06r32_21065_c1
1929 nmdc:mga06r32_258346_c1
1930 nmdc:mga06r32_529255_c1
1931 nmdc:mga06r32_97959_c1
1932 nmdc:mga08y16_1131440_c1
1933 nmdc:mga08y16_22469_c1
1934 nmdc:mga08y16_50599_c1
1935 nmdc:mga0n895_102613_c1
1936 nmdc:mga0n895_242366_c1
1937 nmdc:mga0n895_311350_c1
1938 nmdc:mga0rr50_62733_c1
1939 nmdc:mga08x19_130895_c1
1940 nmdc:mga08x19_395299_c1
1941 nmdc:mga0a205_10759_c2
1942 nmdc:mga0a205_12_c2
1943 nmdc:mga0a205_156791_c1
1944 nmdc:mga0a205_244153_c1
1945 Ga0495601_0000073
1946 Ga0495601_0000080
1947 Ga0495601_0004476
1948 Ga0495601_0023491
1949 Ga0495601_0499084
1950 Ga0495612_0000410
1951 Ga0495612_0001984
1952 Ga0495612_0067334
1953 Ga0495612_0183661
1954 Ga0495655_0001122
1955 Ga0495595_0000001
1956 Ga0495595_0000069
1957 Ga0495595_0032654
1958 Ga0495595_0035624
1959 Ga0495595_0717977
1960 Ga0495619_0000024
1961 Ga0495619_0000065
1962 Ga0495619_0000479
1963 Ga0495619_0001018
1964 Ga0495619_0001209
1965 Ga0495619_0001424
1966 Ga0495619_0003660
1967 Ga0495619_0013290
1968 Ga0500614_000272
1969 Ga0501084_0067497
1970 Ga0501084_0354701
1971 Ga0501082_0105363
1972 Ga0501082_0126485
1973 Ga0530510_0004092
1974 Ga0530510_0750660

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00731

AIRC

AIR carboxylase

66

196

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o4v-assembly1.cif.gz_A crystal structure of the catalytic subunit of a phosphoribosylaminoimidazole mutase (tm0446) from thermotoga maritima at 1.77 a resolution 0.9507 28 157
4ay4-assembly1.cif.gz_D crystal structure of bacillus anthracis pure 0.9496 27 157
2fw9-assembly1.cif.gz_B structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h59f from the acidophilic bacterium acetobacter aceti, at ph 8 0.9494 27 157
2fwb-assembly1.cif.gz_B structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h89f from the acidophilic bacterium acetobacter aceti, at ph 8 0.9492 27 157
4zjy-assembly1.cif.gz_B structure of acetobacter aceti pure-s57n 0.9492 27 157
ID Description Score Start End Superfamily
af_Q9SJ42_1_162_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.955 34 157 3.40.50.1970
5cvtB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9431 27 157 3.40.50.1970
2ywxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9405 30 157 3.40.50.1970
af_Q2FZJ5_1_139_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9244 50 157 3.40.50.1970
4ja0C02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9126 29 159 3.40.50.1970
ID Description Score Start End GO Terms
AF-A0A3C0XMX6-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) 0.9859 27 141 GO:0006189
GO:0034023
AF-A0A7X8GA15-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) 0.9781 27 157 GO:0004638
GO:0006189
GO:0034023
AF-A0A7W0U9B4-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) 0.9776 34 159 GO:0006189
GO:0016020
GO:0034023
AF-A0A1Q3U5Y5-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) 0.9776 27 157 GO:0006189
GO:0034023
AF-A0A7V4HB36-F1-model_v4 5-(Carboxyamino)imidazole ribonucleotide mutase (EC 4.1.1.21, EC 5.4.99.18) 0.9762 27 156 GO:0004638
GO:0006189
GO:0034023

Map