F487547
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 987 | 385 | 1974 | 162 |
Family's Representative Sequence
| Representative Sequence | 3300031548|Ga0307408_100860822|Ga0307408_1008608222 |
| Length | 196 |
| Sequence | MASICAATLPRAPWTECRHELLSDETVDPPEGDLPLGRAETTPRREAVATSEPEQEFEGLDVDSPLVGIIMGSKSDMDTMQKAAAELNDRGIRNEVRVMSAHRDPDVVADYCKNAHMRGLKVIIAGAGLAAALPGVAAAHTDLPVIGVPLTSSNSVAGGLDAMLAIAQMPPGVPVACVAVNGARNAAILAAKIINA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 131 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 132 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 194 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 198 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 199 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 201 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 202 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 203 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 204 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 205 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 206 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 207 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 208 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 209 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 210 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 212 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 214 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 215 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 216 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 219 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 221 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 222 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 224 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 225 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 227 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 228 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 229 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 230 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 231 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 232 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 233 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 236 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 237 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 238 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 239 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 240 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 241 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 242 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 243 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 244 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 312 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 313 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 314 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 315 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 316 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 317 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 320 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 321 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 322 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 323 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 324 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 325 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 326 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 327 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 328 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 329 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 330 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 331 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 332 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 333 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 366 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 367 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 368 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 383 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.29 |
| Metatranscriptomes | 0.71 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.74 |
| Nodule | 0 |
| Rhizoplane | 10.33 |
| Rhizosphere | 84.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307408_100860822 | 3300031548 | Bacteria | 827 |
| 2 | LJQas_1000528 | 3300000549 | Bacteria | 6308 |
| 3 | JGI24746J21847_1000506 | 3300001977 | Bacteria | 5853 |
| 4 | JGI24034J26672_10000575 | 3300002239 | Bacteria | 4690 |
| 5 | JGI24751J29686_10026639 | 3300002459 | Bacteria | 1200 |
| 6 | JGI25406J46586_10071554 | 3300003203 | Bacteria | 1087 |
| 7 | JGI25406J46586_10165814 | 3300003203 | Bacteria | 644 |
| 8 | JGI25407J50210_10032826 | 3300003373 | Bacteria | 1342 |
| 9 | Ga0070658_10663830 | 3300005327 | Bacteria | 905 |
| 10 | Ga0070676_10397618 | 3300005328 | Bacteria | 958 |
| 11 | Ga0070683_100004421 | 3300005329 | Bacteria | 11587 |
| 12 | Ga0070683_100005278 | 3300005329 | Bacteria | 10757 |
| 13 | Ga0070683_100024596 | 3300005329 | Bacteria | 5396 |
| 14 | Ga0070683_100519638 | 3300005329 | Bacteria | 1138 |
| 15 | Ga0070683_100598868 | 3300005329 | Bacteria | 1055 |
| 16 | Ga0070670_100174928 | 3300005331 | Bacteria | 1863 |
| 17 | Ga0070677_10000027 | 3300005333 | Bacteria | 43465 |
| 18 | Ga0068869_100030350 | 3300005334 | Bacteria | 3794 |
| 19 | Ga0068869_100243450 | 3300005334 | Bacteria | 1434 |
| 20 | Ga0070666_10015472 | 3300005335 | Bacteria | 4867 |
| 21 | Ga0070666_10260970 | 3300005335 | Bacteria | 1228 |
| 22 | Ga0070666_10335100 | 3300005335 | Unclassified | 1081 |
| 23 | Ga0070680_100023287 | 3300005336 | Bacteria | 4939 |
| 24 | Ga0070682_100000057 | 3300005337 | Bacteria | 108832 |
| 25 | Ga0070682_100000802 | 3300005337 | Bacteria | 18420 |
| 26 | Ga0070682_100177621 | 3300005337 | Bacteria | 1485 |
| 27 | Ga0070682_100183136 | 3300005337 | Bacteria | 1465 |
| 28 | Ga0068868_100000864 | 3300005338 | Bacteria | 20513 |
| 29 | Ga0068868_100002371 | 3300005338 | Bacteria | 13043 |
| 30 | Ga0068868_100062366 | 3300005338 | Bacteria | 2955 |
| 31 | Ga0068868_100093514 | 3300005338 | Bacteria | 2424 |
| 32 | Ga0070660_100102893 | 3300005339 | Bacteria | 2264 |
| 33 | Ga0070689_100024077 | 3300005340 | Bacteria | 4565 |
| 34 | Ga0070689_100055310 | 3300005340 | Bacteria | 3075 |
| 35 | Ga0070691_10000553 | 3300005341 | Bacteria | 14202 |
| 36 | Ga0070687_100074341 | 3300005343 | Bacteria | 1834 |
| 37 | Ga0070687_100640851 | 3300005343 | Bacteria | 735 |
| 38 | Ga0070661_100000031 | 3300005344 | Bacteria | 113816 |
| 39 | Ga0070692_10009721 | 3300005345 | Bacteria | 4351 |
| 40 | Ga0070692_10149828 | 3300005345 | Bacteria | 1328 |
| 41 | Ga0070668_100022932 | 3300005347 | Bacteria | 4719 |
| 42 | Ga0070669_100237228 | 3300005353 | Bacteria | 1447 |
| 43 | Ga0070675_100000015 | 3300005354 | Bacteria | 201080 |
| 44 | Ga0070674_100000003 | 3300005356 | Bacteria | 258221 |
| 45 | Ga0070674_100000316 | 3300005356 | Bacteria | 23768 |
| 46 | Ga0070674_100161769 | 3300005356 | Bacteria | 1699 |
| 47 | Ga0070674_100168820 | 3300005356 | Bacteria | 1666 |
| 48 | Ga0070674_100201223 | 3300005356 | Bacteria | 1538 |
| 49 | Ga0070674_101566037 | 3300005356 | Bacteria | 593 |
| 50 | Ga0070673_100014734 | 3300005364 | Bacteria | 5462 |
| 51 | Ga0070673_100373080 | 3300005364 | Bacteria | 1271 |
| 52 | Ga0070673_100567107 | 3300005364 | Bacteria | 1033 |
| 53 | Ga0070688_100000534 | 3300005365 | Bacteria | 19212 |
| 54 | Ga0070688_100002238 | 3300005365 | Bacteria | 9761 |
| 55 | Ga0070688_100529261 | 3300005365 | Unclassified | 893 |
| 56 | Ga0070659_100107304 | 3300005366 | Bacteria | 2252 |
| 57 | Ga0070667_100150412 | 3300005367 | Bacteria | 2045 |
| 58 | Ga0070667_100265017 | 3300005367 | Bacteria | 1539 |
| 59 | Ga0070667_101992022 | 3300005367 | Unclassified | 547 |
| 60 | Ga0070703_10116555 | 3300005406 | Bacteria | 963 |
| 61 | Ga0070714_100035028 | 3300005435 | Bacteria | 4205 |
| 62 | Ga0070713_100000040 | 3300005436 | Bacteria | 82527 |
| 63 | Ga0070710_11144748 | 3300005437 | Bacteria | 573 |
| 64 | Ga0070701_10266820 | 3300005438 | Bacteria | 1040 |
| 65 | Ga0070711_100068062 | 3300005439 | Bacteria | 2500 |
| 66 | Ga0070711_100095642 | 3300005439 | Bacteria | 2150 |
| 67 | Ga0070700_100681518 | 3300005441 | Bacteria | 815 |
| 68 | Ga0070694_100580189 | 3300005444 | Bacteria | 901 |
| 69 | Ga0070663_100590765 | 3300005455 | Unclassified | 933 |
| 70 | Ga0070678_100004739 | 3300005456 | Bacteria | 7751 |
| 71 | Ga0070678_100045503 | 3300005456 | Bacteria | 3141 |
| 72 | Ga0070678_100123891 | 3300005456 | Bacteria | 2042 |
| 73 | Ga0070662_100000005 | 3300005457 | Bacteria | 183056 |
| 74 | Ga0070681_10186330 | 3300005458 | Bacteria | 1996 |
| 75 | Ga0070681_10232246 | 3300005458 | Bacteria | 1759 |
| 76 | Ga0070681_10594513 | 3300005458 | Bacteria | 1021 |
| 77 | Ga0068867_100000254 | 3300005459 | Bacteria | 35276 |
| 78 | Ga0068867_100069223 | 3300005459 | Bacteria | 2635 |
| 79 | Ga0070685_10000689 | 3300005466 | Bacteria | 18293 |
| 80 | Ga0070685_10001213 | 3300005466 | Bacteria | 13716 |
| 81 | Ga0070685_10023692 | 3300005466 | Bacteria | 3364 |
| 82 | Ga0070685_10031748 | 3300005466 | Bacteria | 2954 |
| 83 | Ga0070685_10082572 | 3300005466 | Bacteria | 1929 |
| 84 | Ga0070685_10491339 | 3300005466 | Bacteria | 867 |
| 85 | Ga0070706_100105033 | 3300005467 | Bacteria | 2628 |
| 86 | Ga0070699_100692192 | 3300005518 | Bacteria | 931 |
| 87 | Ga0070679_100000153 | 3300005530 | Bacteria | 55882 |
| 88 | Ga0070684_100039878 | 3300005535 | Bacteria | 4041 |
| 89 | Ga0070684_100297046 | 3300005535 | Bacteria | 1482 |
| 90 | Ga0070684_100432169 | 3300005535 | Bacteria | 1216 |
| 91 | Ga0070684_100640046 | 3300005535 | Bacteria | 989 |
| 92 | Ga0070684_100792365 | 3300005535 | Unclassified | 886 |
| 93 | Ga0070697_101134740 | 3300005536 | Bacteria | 696 |
| 94 | Ga0068853_100005454 | 3300005539 | Bacteria | 9967 |
| 95 | Ga0070672_100000007 | 3300005543 | Bacteria | 104699 |
| 96 | Ga0070672_100271225 | 3300005543 | Bacteria | 1433 |
| 97 | Ga0070686_100015611 | 3300005544 | Bacteria | 4404 |
| 98 | Ga0070686_100074074 | 3300005544 | Bacteria | 2237 |
| 99 | Ga0070686_100423316 | 3300005544 | Bacteria | 1018 |
| 100 | Ga0070695_100704326 | 3300005545 | Bacteria | 802 |
| 101 | Ga0070695_101092870 | 3300005545 | Bacteria | 652 |
| 102 | Ga0070696_100205020 | 3300005546 | Bacteria | 1473 |
| 103 | Ga0070693_100046061 | 3300005547 | Bacteria | 2475 |
| 104 | Ga0070665_100000159 | 3300005548 | Bacteria | 122613 |
| 105 | Ga0070665_100003550 | 3300005548 | Bacteria | 16555 |
| 106 | Ga0070665_100004595 | 3300005548 | Bacteria | 14443 |
| 107 | Ga0070665_100806546 | 3300005548 | Bacteria | 952 |
| 108 | Ga0070665_101171220 | 3300005548 | Bacteria | 780 |
| 109 | Ga0070665_101749338 | 3300005548 | Bacteria | 629 |
| 110 | Ga0070704_100002311 | 3300005549 | Bacteria | 10668 |
| 111 | Ga0070704_100194204 | 3300005549 | Bacteria | 1634 |
| 112 | Ga0070704_100281438 | 3300005549 | Bacteria | 1378 |
| 113 | Ga0070704_100313272 | 3300005549 | Bacteria | 1312 |
| 114 | Ga0070704_100374492 | 3300005549 | Bacteria | 1208 |
| 115 | Ga0068855_100485814 | 3300005563 | Bacteria | 1344 |
| 116 | Ga0070664_100187226 | 3300005564 | Bacteria | 1843 |
| 117 | Ga0068857_100246536 | 3300005577 | Bacteria | 1637 |
| 118 | Ga0068854_100000371 | 3300005578 | Bacteria | 28637 |
| 119 | Ga0068854_100067303 | 3300005578 | Bacteria | 2609 |
| 120 | Ga0068854_100366795 | 3300005578 | Bacteria | 1183 |
| 121 | Ga0068856_100002486 | 3300005614 | Bacteria | 18972 |
| 122 | Ga0068856_100047894 | 3300005614 | Bacteria | 4212 |
| 123 | Ga0068856_100082112 | 3300005614 | Bacteria | 3198 |
| 124 | Ga0070702_100093761 | 3300005615 | Bacteria | 1826 |
| 125 | Ga0070702_100216888 | 3300005615 | Bacteria | 1277 |
| 126 | Ga0070702_100980639 | 3300005615 | Bacteria | 667 |
| 127 | Ga0068852_100000103 | 3300005616 | Bacteria | 56542 |
| 128 | Ga0068852_100230204 | 3300005616 | Bacteria | 1766 |
| 129 | Ga0068852_100265134 | 3300005616 | Bacteria | 1651 |
| 130 | Ga0068859_100181876 | 3300005617 | Bacteria | 2185 |
| 131 | Ga0068859_100481255 | 3300005617 | Bacteria | 1337 |
| 132 | Ga0068864_100000066 | 3300005618 | Bacteria | 116383 |
| 133 | Ga0068866_10000002 | 3300005718 | Bacteria | 394090 |
| 134 | Ga0068866_10000457 | 3300005718 | Bacteria | 18656 |
| 135 | Ga0068866_10611905 | 3300005718 | Bacteria | 737 |
| 136 | Ga0068861_100173829 | 3300005719 | Bacteria | 1787 |
| 137 | Ga0068861_100716938 | 3300005719 | Bacteria | 931 |
| 138 | Ga0068851_10016292 | 3300005834 | Bacteria | 3554 |
| 139 | Ga0068851_10265522 | 3300005834 | Bacteria | 977 |
| 140 | Ga0068870_10043765 | 3300005840 | Bacteria | 2336 |
| 141 | Ga0068863_100000032 | 3300005841 | Bacteria | 172402 |
| 142 | Ga0068858_100000043 | 3300005842 | Bacteria | 132444 |
| 143 | Ga0068858_100000049 | 3300005842 | Bacteria | 122693 |
| 144 | Ga0068858_100041610 | 3300005842 | Bacteria | 4260 |
| 145 | Ga0068858_100178442 | 3300005842 | Bacteria | 2005 |
| 146 | Ga0068858_100179560 | 3300005842 | Bacteria | 1998 |
| 147 | Ga0068858_100653381 | 3300005842 | Bacteria | 1022 |
| 148 | Ga0068860_100009747 | 3300005843 | Bacteria | 9536 |
| 149 | Ga0068860_100036300 | 3300005843 | Bacteria | 4723 |
| 150 | Ga0068860_101447335 | 3300005843 | Bacteria | 708 |
| 151 | Ga0068860_101855181 | 3300005843 | Bacteria | 624 |
| 152 | Ga0068862_100084251 | 3300005844 | Bacteria | 2762 |
| 153 | Ga0068862_100097013 | 3300005844 | Bacteria | 2573 |
| 154 | Ga0068862_102011356 | 3300005844 | Bacteria | 588 |
| 155 | Ga0081455_10005275 | 3300005937 | Bacteria | 14201 |
| 156 | Ga0081455_10009930 | 3300005937 | Bacteria | 9737 |
| 157 | Ga0081455_10011084 | 3300005937 | Bacteria | 9077 |
| 158 | Ga0081455_10029633 | 3300005937 | Bacteria | 4987 |
| 159 | Ga0081455_10044620 | 3300005937 | Bacteria | 3865 |
| 160 | Ga0081455_10068495 | 3300005937 | Bacteria | 2953 |
| 161 | Ga0081455_10109091 | 3300005937 | Bacteria | 2203 |
| 162 | Ga0081455_10110646 | 3300005937 | Bacteria | 2183 |
| 163 | Ga0081455_10285274 | 3300005937 | Bacteria | 1191 |
| 164 | Ga0081455_10343374 | 3300005937 | Bacteria | 1055 |
| 165 | Ga0081455_10394449 | 3300005937 | Unclassified | 963 |
| 166 | Ga0081455_10437480 | 3300005937 | Unclassified | 897 |
| 167 | Ga0081455_10547397 | 3300005937 | Bacteria | 766 |
| 168 | Ga0081538_10000135 | 3300005981 | Bacteria | 76510 |
| 169 | Ga0081538_10000204 | 3300005981 | Bacteria | 65722 |
| 170 | Ga0081538_10001004 | 3300005981 | Bacteria | 30038 |
| 171 | Ga0081538_10035826 | 3300005981 | Bacteria | 3252 |
| 172 | Ga0081538_10128546 | 3300005981 | Bacteria | 1197 |
| 173 | Ga0081540_1000686 | 3300005983 | Bacteria | 31589 |
| 174 | Ga0081540_1171445 | 3300005983 | Bacteria | 825 |
| 175 | Ga0081539_10001602 | 3300005985 | Bacteria | 37290 |
| 176 | Ga0081539_10028563 | 3300005985 | Bacteria | 3504 |
| 177 | Ga0075365_10000180 | 3300006038 | Bacteria | 20608 |
| 178 | Ga0075365_10005742 | 3300006038 | Bacteria | 6734 |
| 179 | Ga0075365_10012257 | 3300006038 | Bacteria | 5082 |
| 180 | Ga0075365_10023529 | 3300006038 | Bacteria | 3875 |
| 181 | Ga0075365_10049013 | 3300006038 | Bacteria | 2782 |
| 182 | Ga0075365_10078811 | 3300006038 | Bacteria | 2228 |
| 183 | Ga0075365_10090970 | 3300006038 | Bacteria | 2078 |
| 184 | Ga0075365_10265918 | 3300006038 | Bacteria | 1206 |
| 185 | Ga0075365_10340651 | 3300006038 | Bacteria | 1057 |
| 186 | Ga0075363_100155442 | 3300006048 | Bacteria | 1293 |
| 187 | Ga0075363_100200801 | 3300006048 | Bacteria | 1139 |
| 188 | Ga0075364_10371169 | 3300006051 | Bacteria | 976 |
| 189 | Ga0075364_10398570 | 3300006051 | Bacteria | 939 |
| 190 | Ga0075364_10488826 | 3300006051 | Bacteria | 841 |
| 191 | Ga0075432_10190437 | 3300006058 | Bacteria | 807 |
| 192 | Ga0070715_10000012 | 3300006163 | Bacteria | 173731 |
| 193 | Ga0070715_10253564 | 3300006163 | Bacteria | 921 |
| 194 | Ga0070712_100002001 | 3300006175 | Bacteria | 12481 |
| 195 | Ga0070712_100368639 | 3300006175 | Bacteria | 1180 |
| 196 | Ga0075367_10362043 | 3300006178 | Bacteria | 916 |
| 197 | Ga0097621_100210577 | 3300006237 | Bacteria | 1691 |
| 198 | Ga0068871_100310687 | 3300006358 | Bacteria | 1386 |
| 199 | Ga0075428_100105390 | 3300006844 | Bacteria | 3075 |
| 200 | Ga0075430_100001324 | 3300006846 | Bacteria | 19981 |
| 201 | Ga0075430_100045670 | 3300006846 | Bacteria | 3699 |
| 202 | Ga0075431_100011036 | 3300006847 | Bacteria | 9092 |
| 203 | Ga0075431_100019567 | 3300006847 | Bacteria | 6907 |
| 204 | Ga0075431_100070406 | 3300006847 | Bacteria | 3609 |
| 205 | Ga0075431_100347497 | 3300006847 | Bacteria | 1492 |
| 206 | Ga0075431_101182759 | 3300006847 | Bacteria | 728 |
| 207 | Ga0075433_10001758 | 3300006852 | Bacteria | 16203 |
| 208 | Ga0075433_10016159 | 3300006852 | Bacteria | 6140 |
| 209 | Ga0075433_10132320 | 3300006852 | Bacteria | 2216 |
| 210 | Ga0075433_10190229 | 3300006852 | Bacteria | 1826 |
| 211 | Ga0075433_10191471 | 3300006852 | Bacteria | 1819 |
| 212 | Ga0075434_100020110 | 3300006871 | Bacteria | 6469 |
| 213 | Ga0075429_100008611 | 3300006880 | Bacteria | 8874 |
| 214 | Ga0068865_100000001 | 3300006881 | Bacteria | 288199 |
| 215 | Ga0075436_100071279 | 3300006914 | Bacteria | 2403 |
| 216 | Ga0075436_100283802 | 3300006914 | Bacteria | 1184 |
| 217 | Ga0097620_100181873 | 3300006931 | Bacteria | 2185 |
| 218 | Ga0097620_100481269 | 3300006931 | Bacteria | 1337 |
| 219 | Ga0075435_100205637 | 3300007076 | Bacteria | 1669 |
| 220 | Ga0075435_100701507 | 3300007076 | Bacteria | 880 |
| 221 | Ga0105240_11025594 | 3300009093 | Bacteria | 881 |
| 222 | Ga0111539_10008366 | 3300009094 | Bacteria | 13164 |
| 223 | Ga0111539_10016386 | 3300009094 | Bacteria | 9190 |
| 224 | Ga0111539_10095657 | 3300009094 | Bacteria | 3489 |
| 225 | Ga0111539_10350303 | 3300009094 | Bacteria | 1719 |
| 226 | Ga0111539_11248138 | 3300009094 | Bacteria | 863 |
| 227 | Ga0105245_10000091 | 3300009098 | Bacteria | 89925 |
| 228 | Ga0105245_10000340 | 3300009098 | Bacteria | 44025 |
| 229 | Ga0105245_10002874 | 3300009098 | Bacteria | 15463 |
| 230 | Ga0105245_10005187 | 3300009098 | Bacteria | 11441 |
| 231 | Ga0105245_10023351 | 3300009098 | Bacteria | 5428 |
| 232 | Ga0105245_10435543 | 3300009098 | Bacteria | 1317 |
| 233 | Ga0105245_10465616 | 3300009098 | Bacteria | 1275 |
| 234 | Ga0105245_10863877 | 3300009098 | Unclassified | 945 |
| 235 | Ga0105245_12403065 | 3300009098 | Bacteria | 580 |
| 236 | Ga0105247_10001345 | 3300009101 | Bacteria | 17864 |
| 237 | Ga0105247_10045449 | 3300009101 | Bacteria | 2694 |
| 238 | Ga0105247_10193065 | 3300009101 | Bacteria | 1364 |
| 239 | Ga0105247_10423716 | 3300009101 | Bacteria | 954 |
| 240 | Ga0105247_10559578 | 3300009101 | Bacteria | 842 |
| 241 | Ga0105247_11393335 | 3300009101 | Bacteria | 567 |
| 242 | Ga0114129_10013966 | 3300009147 | Bacteria | 11444 |
| 243 | Ga0114129_10041143 | 3300009147 | Bacteria | 6514 |
| 244 | Ga0114129_10052844 | 3300009147 | Bacteria | 5701 |
| 245 | Ga0114129_10061521 | 3300009147 | Bacteria | 5247 |
| 246 | Ga0114129_10230323 | 3300009147 | Bacteria | 2495 |
| 247 | Ga0114129_11025191 | 3300009147 | Bacteria | 1038 |
| 248 | Ga0114129_11281874 | 3300009147 | Bacteria | 909 |
| 249 | Ga0114129_11294070 | 3300009147 | Bacteria | 904 |
| 250 | Ga0114129_12245933 | 3300009147 | Bacteria | 656 |
| 251 | Ga0105243_10013134 | 3300009148 | Bacteria | 6259 |
| 252 | Ga0105243_10102834 | 3300009148 | Bacteria | 2375 |
| 253 | Ga0105243_10104004 | 3300009148 | Bacteria | 2362 |
| 254 | Ga0105243_10123078 | 3300009148 | Bacteria | 2190 |
| 255 | Ga0105243_10334879 | 3300009148 | Bacteria | 1384 |
| 256 | Ga0105243_10401099 | 3300009148 | Bacteria | 1274 |
| 257 | Ga0105243_10422461 | 3300009148 | Unclassified | 1244 |
| 258 | Ga0105241_10475723 | 3300009174 | Bacteria | 1109 |
| 259 | Ga0105242_10001420 | 3300009176 | Bacteria | 18882 |
| 260 | Ga0105242_10057966 | 3300009176 | Bacteria | 3173 |
| 261 | Ga0105242_10393544 | 3300009176 | Bacteria | 1291 |
| 262 | Ga0105242_11727381 | 3300009176 | Bacteria | 663 |
| 263 | Ga0105248_10000506 | 3300009177 | Bacteria | 44311 |
| 264 | Ga0105248_10256203 | 3300009177 | Bacteria | 1970 |
| 265 | Ga0105248_10492942 | 3300009177 | Bacteria | 1381 |
| 266 | Ga0105248_10582178 | 3300009177 | Bacteria | 1263 |
| 267 | Ga0105237_10121799 | 3300009545 | Bacteria | 2603 |
| 268 | Ga0105237_10129753 | 3300009545 | Bacteria | 2515 |
| 269 | Ga0105238_10000028 | 3300009551 | Bacteria | 188361 |
| 270 | Ga0105238_10037990 | 3300009551 | Bacteria | 4892 |
| 271 | Ga0105238_10402405 | 3300009551 | Bacteria | 1362 |
| 272 | Ga0105238_10414425 | 3300009551 | Bacteria | 1341 |
| 273 | Ga0105238_10429035 | 3300009551 | Bacteria | 1317 |
| 274 | Ga0105249_10000073 | 3300009553 | Bacteria | 145660 |
| 275 | Ga0105249_10007327 | 3300009553 | Bacteria | 9616 |
| 276 | Ga0105249_10060909 | 3300009553 | Bacteria | 3463 |
| 277 | Ga0105249_10075632 | 3300009553 | Bacteria | 3119 |
| 278 | Ga0105249_10080516 | 3300009553 | Bacteria | 3026 |
| 279 | Ga0105249_10701097 | 3300009553 | Bacteria | 1072 |
| 280 | Ga0105239_10244006 | 3300010375 | Bacteria | 2016 |
| 281 | Ga0105239_11183635 | 3300010375 | Bacteria | 881 |
| 282 | Ga0105239_11206606 | 3300010375 | Bacteria | 872 |
| 283 | Ga0105246_10195700 | 3300011119 | Bacteria | 1568 |
| 284 | Ga0105246_10266248 | 3300011119 | Bacteria | 1368 |
| 285 | Ga0105246_10334851 | 3300011119 | Bacteria | 1235 |
| 286 | Ga0157371_10002665 | 3300013102 | Bacteria | 16879 |
| 287 | Ga0157371_10036579 | 3300013102 | Bacteria | 3515 |
| 288 | Ga0157370_10015146 | 3300013104 | Bacteria | 7854 |
| 289 | Ga0157370_10029574 | 3300013104 | Bacteria | 5373 |
| 290 | Ga0157369_10414972 | 3300013105 | Bacteria | 1396 |
| 291 | Ga0157374_10125138 | 3300013296 | Bacteria | 2485 |
| 292 | Ga0157378_10016506 | 3300013297 | Bacteria | 6467 |
| 293 | Ga0157378_10193802 | 3300013297 | Bacteria | 1918 |
| 294 | Ga0157378_10709855 | 3300013297 | Bacteria | 1026 |
| 295 | Ga0163162_10142956 | 3300013306 | Bacteria | 2507 |
| 296 | Ga0163162_10727512 | 3300013306 | Bacteria | 1113 |
| 297 | Ga0163162_10830584 | 3300013306 | Bacteria | 1040 |
| 298 | Ga0163162_11914823 | 3300013306 | Bacteria | 679 |
| 299 | Ga0157372_10000121 | 3300013307 | Bacteria | 83548 |
| 300 | Ga0157372_10102593 | 3300013307 | Bacteria | 3268 |
| 301 | Ga0157372_10102848 | 3300013307 | Bacteria | 3264 |
| 302 | Ga0157375_10003805 | 3300013308 | Bacteria | 13081 |
| 303 | Ga0157375_10018619 | 3300013308 | Bacteria | 6301 |
| 304 | Ga0157375_10129622 | 3300013308 | Bacteria | 2640 |
| 305 | Ga0157375_10154763 | 3300013308 | Bacteria | 2431 |
| 306 | Ga0157375_11219189 | 3300013308 | Bacteria | 883 |
| 307 | Ga0163163_11189309 | 3300014325 | Bacteria | 825 |
| 308 | Ga0157380_10000400 | 3300014326 | Bacteria | 26203 |
| 309 | Ga0157380_10019156 | 3300014326 | Bacteria | 5097 |
| 310 | Ga0157380_12078162 | 3300014326 | Bacteria | 631 |
| 311 | Ga0157379_10011086 | 3300014968 | Bacteria | 7859 |
| 312 | Ga0157379_10193354 | 3300014968 | Bacteria | 1839 |
| 313 | Ga0157379_10604517 | 3300014968 | Bacteria | 1024 |
| 314 | Ga0157379_11572935 | 3300014968 | Bacteria | 641 |
| 315 | Ga0157376_10287318 | 3300014969 | Bacteria | 1551 |
| 316 | Ga0163161_10000073 | 3300017792 | Bacteria | 102053 |
| 317 | Ga0163161_10271207 | 3300017792 | Bacteria | 1328 |
| 318 | Ga0163161_10320715 | 3300017792 | Bacteria | 1225 |
| 319 | Ga0197907_11003200 | 3300020069 | Bacteria | 1030 |
| 320 | Ga0206356_10604718 | 3300020070 | Bacteria | 1744 |
| 321 | Ga0206354_10017965 | 3300020081 | Bacteria | 1277 |
| 322 | Ga0206354_10281469 | 3300020081 | Bacteria | 622 |
| 323 | Ga0206353_10760314 | 3300020082 | Bacteria | 3837 |
| 324 | Ga0213873_10041676 | 3300021358 | Bacteria | 1185 |
| 325 | Ga0213876_10017769 | 3300021384 | Bacteria | 3753 |
| 326 | Ga0224712_10092910 | 3300022467 | Bacteria | 1267 |
| 327 | Ga0224712_10270126 | 3300022467 | Bacteria | 789 |
| 328 | Ga0207656_10002474 | 3300025321 | Bacteria | 6236 |
| 329 | Ga0207656_10009876 | 3300025321 | Bacteria | 3554 |
| 330 | Ga0207656_10160895 | 3300025321 | Bacteria | 1068 |
| 331 | Ga0207682_10000003 | 3300025893 | Bacteria | 128548 |
| 332 | Ga0207642_10000001 | 3300025899 | Bacteria | 714030 |
| 333 | Ga0207642_10000003 | 3300025899 | Bacteria | 650651 |
| 334 | Ga0207642_10000004 | 3300025899 | Bacteria | 407822 |
| 335 | Ga0207642_10000389 | 3300025899 | Bacteria | 13175 |
| 336 | Ga0207710_10000112 | 3300025900 | Bacteria | 103005 |
| 337 | Ga0207710_10147856 | 3300025900 | Bacteria | 1138 |
| 338 | Ga0207710_10495459 | 3300025900 | Bacteria | 634 |
| 339 | Ga0207688_10039754 | 3300025901 | Bacteria | 2613 |
| 340 | Ga0207680_10001025 | 3300025903 | Bacteria | 13185 |
| 341 | Ga0207680_10154479 | 3300025903 | Bacteria | 1533 |
| 342 | Ga0207685_10000001 | 3300025905 | Bacteria | 604473 |
| 343 | Ga0207645_10258226 | 3300025907 | Bacteria | 1154 |
| 344 | Ga0207645_10504252 | 3300025907 | Bacteria | 819 |
| 345 | Ga0207643_10016033 | 3300025908 | Bacteria | 4082 |
| 346 | Ga0207705_10575650 | 3300025909 | Bacteria | 875 |
| 347 | Ga0207654_10299095 | 3300025911 | Bacteria | 1094 |
| 348 | Ga0207707_10048787 | 3300025912 | Bacteria | 3688 |
| 349 | Ga0207695_10953926 | 3300025913 | Bacteria | 737 |
| 350 | Ga0207693_10000001 | 3300025915 | Bacteria | 469535 |
| 351 | Ga0207693_10002935 | 3300025915 | Bacteria | 14759 |
| 352 | Ga0207693_10011889 | 3300025915 | Bacteria | 7038 |
| 353 | Ga0207663_10043081 | 3300025916 | Bacteria | 2761 |
| 354 | Ga0207663_10050424 | 3300025916 | Bacteria | 2586 |
| 355 | Ga0207660_10172358 | 3300025917 | Bacteria | 1676 |
| 356 | Ga0207660_10840515 | 3300025917 | Bacteria | 749 |
| 357 | Ga0207662_10031842 | 3300025918 | Bacteria | 3065 |
| 358 | Ga0207662_10206928 | 3300025918 | Bacteria | 1272 |
| 359 | Ga0207657_10052488 | 3300025919 | Bacteria | 3538 |
| 360 | Ga0207649_10000021 | 3300025920 | Bacteria | 209660 |
| 361 | Ga0207649_10355235 | 3300025920 | Bacteria | 1086 |
| 362 | Ga0207649_10690387 | 3300025920 | Bacteria | 791 |
| 363 | Ga0207652_10001404 | 3300025921 | Bacteria | 21354 |
| 364 | Ga0207652_10446245 | 3300025921 | Bacteria | 1166 |
| 365 | Ga0207646_11169495 | 3300025922 | Bacteria | 675 |
| 366 | Ga0207681_10080412 | 3300025923 | Bacteria | 2299 |
| 367 | Ga0207681_11054389 | 3300025923 | Unclassified | 682 |
| 368 | Ga0207694_10000008 | 3300025924 | Bacteria | 484902 |
| 369 | Ga0207694_10181668 | 3300025924 | Bacteria | 1706 |
| 370 | Ga0207694_10504585 | 3300025924 | Bacteria | 1013 |
| 371 | Ga0207650_10156560 | 3300025925 | Bacteria | 1802 |
| 372 | Ga0207659_10000094 | 3300025926 | Bacteria | 51695 |
| 373 | Ga0207687_10000012 | 3300025927 | Bacteria | 370729 |
| 374 | Ga0207687_10000042 | 3300025927 | Bacteria | 108169 |
| 375 | Ga0207687_10001586 | 3300025927 | Bacteria | 15645 |
| 376 | Ga0207687_10003941 | 3300025927 | Bacteria | 9937 |
| 377 | Ga0207687_10016098 | 3300025927 | Bacteria | 4908 |
| 378 | Ga0207687_10273513 | 3300025927 | Bacteria | 1351 |
| 379 | Ga0207687_10330135 | 3300025927 | Bacteria | 1237 |
| 380 | Ga0207687_10580791 | 3300025927 | Bacteria | 943 |
| 381 | Ga0207687_10661411 | 3300025927 | Bacteria | 884 |
| 382 | Ga0207700_10000032 | 3300025928 | Bacteria | 125088 |
| 383 | Ga0207664_10003709 | 3300025929 | Bacteria | 10243 |
| 384 | Ga0207644_10055977 | 3300025931 | Bacteria | 2845 |
| 385 | Ga0207690_10001272 | 3300025932 | Bacteria | 15951 |
| 386 | Ga0207690_10744706 | 3300025932 | Bacteria | 807 |
| 387 | Ga0207706_10000006 | 3300025933 | Bacteria | 216994 |
| 388 | Ga0207686_10012361 | 3300025934 | Bacteria | 4694 |
| 389 | Ga0207686_10138659 | 3300025934 | Bacteria | 1678 |
| 390 | Ga0207686_10185978 | 3300025934 | Bacteria | 1477 |
| 391 | Ga0207709_10012145 | 3300025935 | Bacteria | 4747 |
| 392 | Ga0207709_10031084 | 3300025935 | Bacteria | 3114 |
| 393 | Ga0207709_10093073 | 3300025935 | Bacteria | 1975 |
| 394 | Ga0207670_10039494 | 3300025936 | Bacteria | 3091 |
| 395 | Ga0207670_10307009 | 3300025936 | Bacteria | 1244 |
| 396 | Ga0207669_10000016 | 3300025937 | Bacteria | 124532 |
| 397 | Ga0207669_10000023 | 3300025937 | Bacteria | 96638 |
| 398 | Ga0207669_10188325 | 3300025937 | Bacteria | 1486 |
| 399 | Ga0207669_10190543 | 3300025937 | Bacteria | 1479 |
| 400 | Ga0207669_10452186 | 3300025937 | Bacteria | 1018 |
| 401 | Ga0207669_10553006 | 3300025937 | Bacteria | 929 |
| 402 | Ga0207669_10921495 | 3300025937 | Bacteria | 731 |
| 403 | Ga0207704_10000012 | 3300025938 | Bacteria | 178319 |
| 404 | Ga0207704_10868985 | 3300025938 | Bacteria | 757 |
| 405 | Ga0207665_10109152 | 3300025939 | Bacteria | 1942 |
| 406 | Ga0207665_10508763 | 3300025939 | Unclassified | 931 |
| 407 | Ga0207691_10000140 | 3300025940 | Bacteria | 66462 |
| 408 | Ga0207691_10086172 | 3300025940 | Bacteria | 2818 |
| 409 | Ga0207711_10000085 | 3300025941 | Bacteria | 99467 |
| 410 | Ga0207711_10954105 | 3300025941 | Bacteria | 796 |
| 411 | Ga0207689_10024231 | 3300025942 | Bacteria | 5092 |
| 412 | Ga0207689_10180196 | 3300025942 | Bacteria | 1742 |
| 413 | Ga0207661_10000784 | 3300025944 | Bacteria | 20686 |
| 414 | Ga0207661_10007312 | 3300025944 | Bacteria | 7854 |
| 415 | Ga0207661_10013420 | 3300025944 | Bacteria | 5984 |
| 416 | Ga0207661_10029192 | 3300025944 | Bacteria | 4233 |
| 417 | Ga0207661_10154133 | 3300025944 | Bacteria | 1988 |
| 418 | Ga0207661_10274312 | 3300025944 | Bacteria | 1506 |
| 419 | Ga0207661_10398015 | 3300025944 | Bacteria | 1248 |
| 420 | Ga0207661_10825237 | 3300025944 | Bacteria | 853 |
| 421 | Ga0207661_11164889 | 3300025944 | Bacteria | 709 |
| 422 | Ga0207679_10023481 | 3300025945 | Bacteria | 4218 |
| 423 | Ga0207679_10510398 | 3300025945 | Bacteria | 1074 |
| 424 | Ga0207651_10008848 | 3300025960 | Bacteria | 5466 |
| 425 | Ga0207651_10082886 | 3300025960 | Bacteria | 2317 |
| 426 | Ga0207712_10000003 | 3300025961 | Bacteria | 615314 |
| 427 | Ga0207712_10133852 | 3300025961 | Bacteria | 1893 |
| 428 | Ga0207712_10136772 | 3300025961 | Bacteria | 1875 |
| 429 | Ga0207712_10738529 | 3300025961 | Bacteria | 862 |
| 430 | Ga0207668_10132948 | 3300025972 | Bacteria | 1902 |
| 431 | Ga0207668_10185970 | 3300025972 | Bacteria | 1642 |
| 432 | Ga0207668_10874805 | 3300025972 | Bacteria | 799 |
| 433 | Ga0207668_11063320 | 3300025972 | Bacteria | 725 |
| 434 | Ga0207668_11767335 | 3300025972 | Bacteria | 558 |
| 435 | Ga0207640_10000270 | 3300025981 | Bacteria | 35099 |
| 436 | Ga0207640_10499382 | 3300025981 | Bacteria | 1013 |
| 437 | Ga0207640_11341219 | 3300025981 | Archaea | 640 |
| 438 | Ga0207658_10075507 | 3300025986 | Bacteria | 2564 |
| 439 | Ga0207658_10217427 | 3300025986 | Bacteria | 1605 |
| 440 | Ga0207677_10000760 | 3300026023 | Bacteria | 18586 |
| 441 | Ga0207677_10002075 | 3300026023 | Bacteria | 10548 |
| 442 | Ga0207677_10109248 | 3300026023 | Bacteria | 2056 |
| 443 | Ga0207703_10000053 | 3300026035 | Bacteria | 143924 |
| 444 | Ga0207703_10000132 | 3300026035 | Bacteria | 90163 |
| 445 | Ga0207703_10031133 | 3300026035 | Bacteria | 4216 |
| 446 | Ga0207703_10068265 | 3300026035 | Bacteria | 2929 |
| 447 | Ga0207703_10130764 | 3300026035 | Bacteria | 2167 |
| 448 | Ga0207703_10781066 | 3300026035 | Unclassified | 911 |
| 449 | Ga0207639_10001498 | 3300026041 | Bacteria | 15725 |
| 450 | Ga0207639_10569911 | 3300026041 | Bacteria | 1041 |
| 451 | Ga0207678_10059792 | 3300026067 | Bacteria | 3279 |
| 452 | Ga0207678_11755392 | 3300026067 | Bacteria | 544 |
| 453 | Ga0207708_10046046 | 3300026075 | Bacteria | 3323 |
| 454 | Ga0207708_10049604 | 3300026075 | Bacteria | 3197 |
| 455 | Ga0207702_10000332 | 3300026078 | Bacteria | 54147 |
| 456 | Ga0207702_10005812 | 3300026078 | Bacteria | 10730 |
| 457 | Ga0207702_10056840 | 3300026078 | Bacteria | 3323 |
| 458 | Ga0207641_10000071 | 3300026088 | Bacteria | 151812 |
| 459 | Ga0207641_10239994 | 3300026088 | Bacteria | 1688 |
| 460 | Ga0207648_10110678 | 3300026089 | Bacteria | 2411 |
| 461 | Ga0207676_10000038 | 3300026095 | Bacteria | 171492 |
| 462 | Ga0207676_10265327 | 3300026095 | Bacteria | 1552 |
| 463 | Ga0207674_10124152 | 3300026116 | Bacteria | 2547 |
| 464 | Ga0207675_100146309 | 3300026118 | Bacteria | 2247 |
| 465 | Ga0207675_101085713 | 3300026118 | Bacteria | 820 |
| 466 | Ga0207683_10063056 | 3300026121 | Bacteria | 3265 |
| 467 | Ga0207683_10156357 | 3300026121 | Bacteria | 2059 |
| 468 | Ga0207698_10000009 | 3300026142 | Bacteria | 281300 |
| 469 | Ga0207698_10012457 | 3300026142 | Bacteria | 5567 |
| 470 | Ga0207698_10178161 | 3300026142 | Bacteria | 1880 |
| 471 | Ga0207698_10578855 | 3300026142 | Bacteria | 1104 |
| 472 | Ga0207428_10029736 | 3300027907 | Bacteria | 4523 |
| 473 | Ga0207428_10040972 | 3300027907 | Bacteria | 3751 |
| 474 | Ga0207428_10113550 | 3300027907 | Bacteria | 2082 |
| 475 | Ga0207428_10126704 | 3300027907 | Bacteria | 1955 |
| 476 | Ga0268266_10000023 | 3300028379 | Bacteria | 501899 |
| 477 | Ga0268266_10001388 | 3300028379 | Bacteria | 29082 |
| 478 | Ga0268266_10001442 | 3300028379 | Bacteria | 28308 |
| 479 | Ga0268266_10215563 | 3300028379 | Bacteria | 1762 |
| 480 | Ga0268266_10219388 | 3300028379 | Bacteria | 1747 |
| 481 | Ga0268266_10292207 | 3300028379 | Bacteria | 1518 |
| 482 | Ga0268266_10321398 | 3300028379 | Bacteria | 1449 |
| 483 | Ga0268266_10557788 | 3300028379 | Bacteria | 1098 |
| 484 | Ga0268266_11034754 | 3300028379 | Unclassified | 794 |
| 485 | Ga0268265_10120653 | 3300028380 | Bacteria | 2159 |
| 486 | Ga0268265_10697654 | 3300028380 | Bacteria | 980 |
| 487 | Ga0268265_10914133 | 3300028380 | Unclassified | 862 |
| 488 | Ga0268265_11724613 | 3300028380 | Bacteria | 632 |
| 489 | Ga0268264_10002363 | 3300028381 | Bacteria | 16641 |
| 490 | Ga0268264_10077884 | 3300028381 | Bacteria | 2825 |
| 491 | Ga0268264_10177645 | 3300028381 | Bacteria | 1931 |
| 492 | Ga0307511_10137879 | 3300030521 | Bacteria | 1445 |
| 493 | Ga0307408_101355843 | 3300031548 | Bacteria | 668 |
| 494 | Ga0316579_10102806 | 3300031691 | Bacteria | 1369 |
| 495 | Ga0307405_10329116 | 3300031731 | Bacteria | 1170 |
| 496 | Ga0307413_10230678 | 3300031824 | Bacteria | 1359 |
| 497 | Ga0307413_11379752 | 3300031824 | Bacteria | 619 |
| 498 | Ga0307410_10524040 | 3300031852 | Bacteria | 978 |
| 499 | Ga0307410_10739662 | 3300031852 | Bacteria | 832 |
| 500 | Ga0307406_10070979 | 3300031901 | Bacteria | 2281 |
| 501 | Ga0307409_101025834 | 3300031995 | Bacteria | 844 |
| 502 | Ga0307409_101219561 | 3300031995 | Bacteria | 776 |
| 503 | Ga0307416_100661673 | 3300032002 | Bacteria | 1130 |
| 504 | Ga0307414_11238516 | 3300032004 | Bacteria | 691 |
| 505 | Ga0307411_10197561 | 3300032005 | Bacteria | 1542 |
| 506 | Ga0307415_100012565 | 3300032126 | Bacteria | 4900 |
| 507 | Ga0307415_100601707 | 3300032126 | Bacteria | 978 |
| 508 | Ga0316583_10219556 | 3300032133 | Bacteria | 659 |
| 509 | Ga0373939_0128858 | 3300035114 | Bacteria | 901 |
| 510 | Ga0373945_0290247 | 3300035116 | Bacteria | 699 |
| 511 | Ga0373954_0149067 | 3300035118 | Bacteria | 1143 |
| 512 | Ga0373956_0200078 | 3300035119 | Unclassified | 947 |
| 513 | Ga0373957_0097788 | 3300035120 | Unclassified | 1173 |
| 514 | Ga0373960_0083927 | 3300035121 | Bacteria | 1008 |
| 515 | Ga0373943_0047960 | 3300035170 | Bacteria | 2091 |
| 516 | Ga0373955_0124753 | 3300035172 | Bacteria | 1499 |
| 517 | Ga0373942_0103743 | 3300035207 | Bacteria | 872 |
| 518 | Ga0316574_0120286 | 3300035398 | Bacteria | 1686 |
| 519 | Ga0373935_0398012 | 3300035692 | Bacteria | 989 |
| 520 | Ga0373933_0710249 | 3300035724 | Bacteria | 661 |
| 521 | Ga0373947_0248629 | 3300035725 | Bacteria | 1175 |
| 522 | Ga0373937_0027900 | 3300036401 | Bacteria | 5108 |
| 523 | Ga0373937_0042483 | 3300036401 | Bacteria | 4148 |
| 524 | Ga0316582_0811424 | 3300036647 | Bacteria | 641 |
| 525 | Ga0316584_0293899 | 3300036712 | Bacteria | 1178 |
| 526 | Ga0373925_0472415 | 3300037068 | Bacteria | 1028 |
| 527 | Ga0373925_1531738 | 3300037068 | Bacteria | 545 |
| 528 | Ga0395899_0047858 | 3300037312 | Bacteria | 3183 |
| 529 | Ga0395900_0021354 | 3300037418 | Bacteria | 6618 |
| 530 | Ga0395900_0183072 | 3300037418 | Bacteria | 2128 |
| 531 | Ga0395900_0353044 | 3300037418 | Bacteria | 1444 |
| 532 | Ga0395900_0413270 | 3300037418 | Bacteria | 1311 |
| 533 | Ga0395900_0913769 | 3300037418 | Unclassified | 801 |
| 534 | Ga0395900_0975764 | 3300037418 | Bacteria | 768 |
| 535 | Ga0395898_0016278 | 3300037466 | Bacteria | 7610 |
| 536 | Ga0395898_0079042 | 3300037466 | Bacteria | 3173 |
| 537 | Ga0395898_0324326 | 3300037466 | Bacteria | 1469 |
| 538 | Ga0395898_0396725 | 3300037466 | Bacteria | 1315 |
| 539 | Ga0395898_0631227 | 3300037466 | Bacteria | 1014 |
| 540 | Ga0395898_0664614 | 3300037466 | Bacteria | 984 |
| 541 | Ga0395898_0707116 | 3300037466 | Bacteria | 949 |
| 542 | Ga0395898_0850155 | 3300037466 | Unclassified | 852 |
| 543 | Ga0395898_0871284 | 3300037466 | Bacteria | 839 |
| 544 | Ga0395905_0004196 | 3300037471 | Bacteria | 15081 |
| 545 | Ga0395905_0225709 | 3300037471 | Bacteria | 1752 |
| 546 | Ga0395905_0266977 | 3300037471 | Bacteria | 1597 |
| 547 | Ga0395905_0335759 | 3300037471 | Bacteria | 1402 |
| 548 | Ga0395901_0018076 | 3300038443 | Bacteria | 7195 |
| 549 | Ga0395901_0080123 | 3300038443 | Bacteria | 3409 |
| 550 | Ga0395901_0264625 | 3300038443 | Bacteria | 1789 |
| 551 | Ga0395901_0904343 | 3300038443 | Unclassified | 864 |
| 552 | Ga0436365_0700522 | 3300039437 | Bacteria | 9909 |
| 553 | Ga0436362_0361016 | 3300039453 | Bacteria | 2104 |
| 554 | Ga0451789_0190937 | 3300041443 | Bacteria | 648 |
| 555 | Ga0451793_1567316 | 3300041452 | Unclassified | 813 |
| 556 | Ga0451833_0127813 | 3300041491 | Bacteria | 728 |
| 557 | Ga0451849_1383452 | 3300041505 | Archaea | 745 |
| 558 | Ga0439448_0128192 | 3300042005 | Bacteria | 873 |
| 559 | Ga0466963_0000406 | 3300044694 | Bacteria | 19714 |
| 560 | Ga0466963_0019056 | 3300044694 | Bacteria | 4297 |
| 561 | Ga0466963_0037755 | 3300044694 | Bacteria | 3157 |
| 562 | Ga0466963_0895737 | 3300044694 | Bacteria | 625 |
| 563 | Ga0466964_0014541 | 3300044706 | Bacteria | 2993 |
| 564 | Ga0466964_0193517 | 3300044706 | Unclassified | 972 |
| 565 | Ga0466964_0355324 | 3300044706 | Unclassified | 754 |
| 566 | Ga0466957_0580411 | 3300044842 | Bacteria | 783 |
| 567 | Ga0466957_0610028 | 3300044842 | Unclassified | 764 |
| 568 | Ga0466960_0187516 | 3300044901 | Bacteria | 1124 |
| 569 | Ga0466958_0201290 | 3300045836 | Bacteria | 1267 |
| 570 | Ga0466967_0000007 | 3300045976 | Bacteria | 135597 |
| 571 | Ga0466967_0003720 | 3300045976 | Bacteria | 10051 |
| 572 | Ga0466967_0032948 | 3300045976 | Bacteria | 4381 |
| 573 | Ga0466967_0061173 | 3300045976 | Bacteria | 3340 |
| 574 | Ga0466967_0612912 | 3300045976 | Bacteria | 1075 |
| 575 | Ga0466967_1544001 | 3300045976 | Bacteria | 661 |
| 576 | Ga0495592_0031293 | 3300046454 | Bacteria | 4022 |
| 577 | Ga0495592_0090252 | 3300046454 | Bacteria | 2199 |
| 578 | Ga0495592_0095353 | 3300046454 | Bacteria | 2128 |
| 579 | Ga0495603_0004170 | 3300046455 | Bacteria | 8615 |
| 580 | Ga0495590_0056589 | 3300046457 | Bacteria | 1371 |
| 581 | Ga0495590_0140401 | 3300046457 | Bacteria | 872 |
| 582 | Ga0495629_0001388 | 3300046459 | Bacteria | 19109 |
| 583 | Ga0495629_0011366 | 3300046459 | Bacteria | 6467 |
| 584 | Ga0495629_0705603 | 3300046459 | Unclassified | 670 |
| 585 | Ga0495638_0134391 | 3300046460 | Bacteria | 1450 |
| 586 | Ga0495641_0000012 | 3300046461 | Bacteria | 144818 |
| 587 | Ga0495641_0010457 | 3300046461 | Bacteria | 5374 |
| 588 | Ga0495641_0062434 | 3300046461 | Bacteria | 1680 |
| 589 | Ga0495651_0024433 | 3300046462 | Bacteria | 4701 |
| 590 | Ga0495651_0082512 | 3300046462 | Bacteria | 2425 |
| 591 | Ga0495651_0140463 | 3300046462 | Bacteria | 1752 |
| 592 | Ga0495651_0192718 | 3300046462 | Bacteria | 1433 |
| 593 | Ga0495651_0404847 | 3300046462 | Unclassified | 890 |
| 594 | Ga0495653_0030121 | 3300046463 | Bacteria | 4326 |
| 595 | Ga0495653_0520267 | 3300046463 | Unclassified | 739 |
| 596 | Ga0495582_0000007 | 3300046473 | Bacteria | 139882 |
| 597 | Ga0495582_0184405 | 3300046473 | Bacteria | 1189 |
| 598 | Ga0495582_0753780 | 3300046473 | Bacteria | 563 |
| 599 | Ga0495639_0292651 | 3300046475 | Bacteria | 811 |
| 600 | Ga0495662_0004180 | 3300046476 | Bacteria | 7274 |
| 601 | Ga0495662_0067271 | 3300046476 | Bacteria | 1733 |
| 602 | Ga0495584_0242898 | 3300046491 | Bacteria | 916 |
| 603 | Ga0495584_0388473 | 3300046491 | Bacteria | 709 |
| 604 | Ga0495585_0272377 | 3300046492 | Bacteria | 839 |
| 605 | Ga0495585_0626687 | 3300046492 | Unclassified | 505 |
| 606 | Ga0495594_0095786 | 3300046499 | Bacteria | 1667 |
| 607 | Ga0495596_0062448 | 3300046500 | Bacteria | 1450 |
| 608 | Ga0495596_0093303 | 3300046500 | Bacteria | 1169 |
| 609 | Ga0495596_0232560 | 3300046500 | Bacteria | 716 |
| 610 | Ga0495606_0000082 | 3300046507 | Bacteria | 159585 |
| 611 | Ga0495608_0000063 | 3300046511 | Bacteria | 83763 |
| 612 | Ga0495608_0005393 | 3300046511 | Bacteria | 9135 |
| 613 | Ga0495608_0027929 | 3300046511 | Bacteria | 3836 |
| 614 | Ga0495608_0063068 | 3300046511 | Bacteria | 2433 |
| 615 | Ga0495608_0100014 | 3300046511 | Bacteria | 1870 |
| 616 | Ga0495616_0160838 | 3300046513 | Bacteria | 1010 |
| 617 | Ga0495616_0327538 | 3300046513 | Bacteria | 642 |
| 618 | Ga0495618_0000003 | 3300046514 | Bacteria | 256269 |
| 619 | Ga0495618_0483003 | 3300046514 | Bacteria | 749 |
| 620 | Ga0495620_0000113 | 3300046515 | Bacteria | 64629 |
| 621 | Ga0495628_0036556 | 3300046516 | Bacteria | 3940 |
| 622 | Ga0495628_0054751 | 3300046516 | Bacteria | 3144 |
| 623 | Ga0495628_0103973 | 3300046516 | Bacteria | 2189 |
| 624 | Ga0495628_0104012 | 3300046516 | Bacteria | 2189 |
| 625 | Ga0495628_0111898 | 3300046516 | Bacteria | 2099 |
| 626 | Ga0495628_0469037 | 3300046516 | Bacteria | 912 |
| 627 | Ga0495630_0000007 | 3300046517 | Bacteria | 376915 |
| 628 | Ga0495630_0000477 | 3300046517 | Bacteria | 29945 |
| 629 | Ga0495630_0447058 | 3300046517 | Bacteria | 990 |
| 630 | Ga0495644_0089288 | 3300046523 | Bacteria | 1163 |
| 631 | Ga0495663_0077994 | 3300046525 | Unclassified | 1063 |
| 632 | Ga0495652_0001430 | 3300046529 | Bacteria | 26465 |
| 633 | Ga0495652_0155110 | 3300046529 | Bacteria | 1784 |
| 634 | Ga0495640_0004409 | 3300046533 | Bacteria | 11236 |
| 635 | Ga0495640_0006935 | 3300046533 | Bacteria | 8922 |
| 636 | Ga0495640_0145828 | 3300046533 | Bacteria | 1523 |
| 637 | Ga0495586_0001272 | 3300046535 | Bacteria | 14120 |
| 638 | Ga0495586_0276550 | 3300046535 | Bacteria | 960 |
| 639 | Ga0495587_0071367 | 3300046536 | Bacteria | 2020 |
| 640 | Ga0495587_0106533 | 3300046536 | Bacteria | 1612 |
| 641 | Ga0495598_0053928 | 3300046537 | Bacteria | 1219 |
| 642 | Ga0495621_0000679 | 3300046539 | Bacteria | 8584 |
| 643 | Ga0495645_0004980 | 3300046543 | Bacteria | 9098 |
| 644 | Ga0495645_0013041 | 3300046543 | Bacteria | 5869 |
| 645 | Ga0495645_0457661 | 3300046543 | Bacteria | 804 |
| 646 | Ga0495667_0090823 | 3300046559 | Bacteria | 1978 |
| 647 | Ga0495656_0299579 | 3300046615 | Bacteria | 824 |
| 648 | Ga0495634_0000125 | 3300046642 | Bacteria | 65586 |
| 649 | Ga0495634_0000828 | 3300046642 | Bacteria | 29940 |
| 650 | Ga0495634_0010756 | 3300046642 | Bacteria | 6693 |
| 651 | Ga0495634_0082549 | 3300046642 | Bacteria | 2100 |
| 652 | Ga0495634_0171893 | 3300046642 | Bacteria | 1361 |
| 653 | Ga0495634_0575152 | 3300046642 | Unclassified | 655 |
| 654 | Ga0495635_0000009 | 3300046663 | Bacteria | 259024 |
| 655 | Ga0495635_0047675 | 3300046663 | Bacteria | 2954 |
| 656 | Ga0495635_0231854 | 3300046663 | Bacteria | 1247 |
| 657 | Ga0495635_0324906 | 3300046663 | Bacteria | 1029 |
| 658 | Ga0495659_0162657 | 3300046664 | Bacteria | 902 |
| 659 | Ga0495588_0000602 | 3300046674 | Bacteria | 16922 |
| 660 | Ga0495657_0000084 | 3300046675 | Bacteria | 83088 |
| 661 | Ga0495657_0010956 | 3300046675 | Bacteria | 6800 |
| 662 | Ga0495657_0023623 | 3300046675 | Bacteria | 4390 |
| 663 | Ga0495599_0136910 | 3300046678 | Bacteria | 1520 |
| 664 | Ga0495599_0335927 | 3300046678 | Bacteria | 907 |
| 665 | Ga0495647_0000014 | 3300046681 | Bacteria | 87792 |
| 666 | Ga0495647_0005014 | 3300046681 | Bacteria | 4334 |
| 667 | Ga0495647_0011161 | 3300046681 | Bacteria | 3073 |
| 668 | Ga0495647_0276770 | 3300046681 | Bacteria | 752 |
| 669 | Ga0495658_0000007 | 3300046683 | Bacteria | 139822 |
| 670 | Ga0495658_0050093 | 3300046683 | Bacteria | 2361 |
| 671 | Ga0495658_0185227 | 3300046683 | Bacteria | 1293 |
| 672 | Ga0495669_0000213 | 3300046684 | Bacteria | 35060 |
| 673 | Ga0495669_0020171 | 3300046684 | Bacteria | 2882 |
| 674 | Ga0495669_0136595 | 3300046684 | Bacteria | 1156 |
| 675 | Ga0495613_0000003 | 3300046689 | Bacteria | 248826 |
| 676 | Ga0495613_0000310 | 3300046689 | Bacteria | 44162 |
| 677 | Ga0495613_0088978 | 3300046689 | Bacteria | 2237 |
| 678 | Ga0495624_0000002 | 3300046690 | Bacteria | 189957 |
| 679 | Ga0495624_0000256 | 3300046690 | Bacteria | 42059 |
| 680 | Ga0495624_0228619 | 3300046690 | Bacteria | 1127 |
| 681 | Ga0495624_0364848 | 3300046690 | Bacteria | 868 |
| 682 | Ga0495670_0103637 | 3300046691 | Bacteria | 1467 |
| 683 | Ga0495649_0034365 | 3300046694 | Bacteria | 2789 |
| 684 | Ga0495589_0230893 | 3300046794 | Bacteria | 868 |
| 685 | Ga0495600_0003063 | 3300046809 | Bacteria | 9768 |
| 686 | Ga0495600_0033862 | 3300046809 | Bacteria | 3317 |
| 687 | Ga0495600_0096189 | 3300046809 | Bacteria | 1931 |
| 688 | Ga0495600_0099370 | 3300046809 | Bacteria | 1897 |
| 689 | Ga0495600_0537082 | 3300046809 | Bacteria | 716 |
| 690 | Ga0495660_0076596 | 3300046810 | Bacteria | 1762 |
| 691 | Ga0495660_0504488 | 3300046810 | Unclassified | 517 |
| 692 | Ga0495581_0160050 | 3300047315 | Bacteria | 1316 |
| 693 | Ga0495604_0000084 | 3300047317 | Bacteria | 82199 |
| 694 | Ga0495604_0043452 | 3300047317 | Bacteria | 3518 |
| 695 | Ga0495674_0000027 | 3300047319 | Bacteria | 132744 |
| 696 | Ga0495672_0046414 | 3300047320 | Bacteria | 2591 |
| 697 | Ga0495672_0125585 | 3300047320 | Bacteria | 1357 |
| 698 | Ga0495676_0001046 | 3300047321 | Bacteria | 23385 |
| 699 | Ga0495676_0049017 | 3300047321 | Bacteria | 3400 |
| 700 | Ga0495676_0314114 | 3300047321 | Bacteria | 1054 |
| 701 | Ga0495680_0000255 | 3300047322 | Bacteria | 58745 |
| 702 | Ga0495680_0000256 | 3300047322 | Bacteria | 58661 |
| 703 | Ga0495680_0081114 | 3300047322 | Bacteria | 2450 |
| 704 | Ga0495680_0318445 | 3300047322 | Bacteria | 1089 |
| 705 | Ga0495675_0000067 | 3300047444 | Bacteria | 71740 |
| 706 | Ga0495675_0070636 | 3300047444 | Bacteria | 2204 |
| 707 | Ga0495679_108621 | 3300047446 | Bacteria | 765 |
| 708 | Ga0495685_060990 | 3300047447 | Bacteria | 1271 |
| 709 | Ga0495673_0078838 | 3300047469 | Bacteria | 1368 |
| 710 | Ga0495684_0092105 | 3300047471 | Bacteria | 2296 |
| 711 | Ga0495686_0010031 | 3300047472 | Bacteria | 6766 |
| 712 | Ga0495686_0048752 | 3300047472 | Bacteria | 2669 |
| 713 | Ga0495593_0087797 | 3300047673 | Bacteria | 1603 |
| 714 | Ga0495593_0119025 | 3300047673 | Bacteria | 1345 |
| 715 | Ga0495602_0000008 | 3300048088 | Bacteria | 260157 |
| 716 | Ga0495602_0349526 | 3300048088 | Bacteria | 1067 |
| 717 | Ga0495614_0287428 | 3300048089 | Bacteria | 758 |
| 718 | Ga0495626_0147357 | 3300048091 | Bacteria | 995 |
| 719 | Ga0496100_0000016 | 3300048903 | Bacteria | 166058 |
| 720 | Ga0496100_1358508 | 3300048903 | Bacteria | 561 |
| 721 | Ga0496101_0000038 | 3300048904 | Bacteria | 166058 |
| 722 | Ga0496101_0002799 | 3300048904 | Bacteria | 10699 |
| 723 | Ga0496101_0058412 | 3300048904 | Bacteria | 2793 |
| 724 | Ga0496101_0372709 | 3300048904 | Bacteria | 1123 |
| 725 | Ga0496101_0601350 | 3300048904 | Bacteria | 869 |
| 726 | Ga0496101_0765465 | 3300048904 | Bacteria | 762 |
| 727 | Ga0496101_0848246 | 3300048904 | Bacteria | 720 |
| 728 | Ga0496101_0860645 | 3300048904 | Bacteria | 714 |
| 729 | Ga0496102_0005397 | 3300048905 | Bacteria | 10856 |
| 730 | Ga0496102_0025633 | 3300048905 | Bacteria | 5252 |
| 731 | Ga0496102_0194530 | 3300048905 | Bacteria | 1911 |
| 732 | Ga0496102_0354963 | 3300048905 | Bacteria | 1380 |
| 733 | Ga0496102_0980740 | 3300048905 | Bacteria | 766 |
| 734 | Ga0496103_0001687 | 3300048906 | Bacteria | 14446 |
| 735 | Ga0496103_0014666 | 3300048906 | Bacteria | 4657 |
| 736 | Ga0496103_0050586 | 3300048906 | Bacteria | 2570 |
| 737 | Ga0496103_0138108 | 3300048906 | Bacteria | 1558 |
| 738 | Ga0496103_0544670 | 3300048906 | Bacteria | 741 |
| 739 | Ga0496104_0000003 | 3300048907 | Bacteria | 669219 |
| 740 | Ga0496104_0000007 | 3300048907 | Bacteria | 524804 |
| 741 | Ga0496104_0000147 | 3300048907 | Bacteria | 65131 |
| 742 | Ga0496104_0036798 | 3300048907 | Bacteria | 4576 |
| 743 | Ga0496104_0074338 | 3300048907 | Bacteria | 3236 |
| 744 | Ga0496105_0000002 | 3300048908 | Bacteria | 753215 |
| 745 | Ga0496105_0000008 | 3300048908 | Bacteria | 335652 |
| 746 | Ga0496105_0000988 | 3300048908 | Bacteria | 19603 |
| 747 | Ga0496105_0024847 | 3300048908 | Bacteria | 4869 |
| 748 | Ga0496105_0026744 | 3300048908 | Bacteria | 4709 |
| 749 | Ga0496105_0086229 | 3300048908 | Bacteria | 2594 |
| 750 | Ga0496106_0000013 | 3300048909 | Bacteria | 202263 |
| 751 | Ga0496106_0000027 | 3300048909 | Bacteria | 149560 |
| 752 | Ga0496106_0048080 | 3300048909 | Bacteria | 3212 |
| 753 | Ga0496106_0071587 | 3300048909 | Bacteria | 2650 |
| 754 | Ga0496106_0076379 | 3300048909 | Bacteria | 2567 |
| 755 | Ga0496106_0616846 | 3300048909 | Bacteria | 868 |
| 756 | Ga0496107_0000003 | 3300048910 | Bacteria | 304038 |
| 757 | Ga0496107_0034892 | 3300048910 | Bacteria | 3605 |
| 758 | Ga0496107_0051851 | 3300048910 | Bacteria | 2960 |
| 759 | Ga0496107_0094312 | 3300048910 | Bacteria | 2190 |
| 760 | Ga0496107_0306002 | 3300048910 | Bacteria | 1183 |
| 761 | Ga0496108_0000002 | 3300048911 | Bacteria | 700890 |
| 762 | Ga0496108_0000216 | 3300048911 | Bacteria | 52702 |
| 763 | Ga0496108_0000254 | 3300048911 | Bacteria | 46564 |
| 764 | Ga0496108_0002779 | 3300048911 | Bacteria | 14026 |
| 765 | Ga0496108_0010108 | 3300048911 | Bacteria | 7655 |
| 766 | Ga0496108_0019207 | 3300048911 | Bacteria | 5610 |
| 767 | Ga0496108_0079609 | 3300048911 | Bacteria | 2774 |
| 768 | Ga0496108_0249765 | 3300048911 | Bacteria | 1543 |
| 769 | Ga0496108_0374770 | 3300048911 | Bacteria | 1243 |
| 770 | Ga0496108_0381682 | 3300048911 | Bacteria | 1230 |
| 771 | Ga0496108_0839740 | 3300048911 | Unclassified | 791 |
| 772 | Ga0496109_0000001 | 3300048912 | Bacteria | 700852 |
| 773 | Ga0496109_0000046 | 3300048912 | Bacteria | 131025 |
| 774 | Ga0496109_0000085 | 3300048912 | Bacteria | 95437 |
| 775 | Ga0496109_0000321 | 3300048912 | Bacteria | 45109 |
| 776 | Ga0496109_0129770 | 3300048912 | Bacteria | 2352 |
| 777 | Ga0496109_0170671 | 3300048912 | Bacteria | 2040 |
| 778 | Ga0496109_0199975 | 3300048912 | Bacteria | 1878 |
| 779 | Ga0496109_0212228 | 3300048912 | Bacteria | 1820 |
| 780 | Ga0496109_0323286 | 3300048912 | Bacteria | 1456 |
| 781 | Ga0496109_0999829 | 3300048912 | Bacteria | 774 |
| 782 | Ga0496110_0000004 | 3300048913 | Bacteria | 122867 |
| 783 | Ga0496110_0006148 | 3300048913 | Bacteria | 9468 |
| 784 | Ga0496110_0047435 | 3300048913 | Bacteria | 3761 |
| 785 | Ga0496110_0066142 | 3300048913 | Bacteria | 3196 |
| 786 | Ga0496110_0142170 | 3300048913 | Bacteria | 2169 |
| 787 | Ga0496110_0143405 | 3300048913 | Bacteria | 2159 |
| 788 | Ga0496110_0702373 | 3300048913 | Bacteria | 913 |
| 789 | Ga0496110_1042929 | 3300048913 | Bacteria | 725 |
| 790 | Ga0496111_0000002 | 3300048914 | Bacteria | 135794 |
| 791 | Ga0496111_0000644 | 3300048914 | Bacteria | 18422 |
| 792 | Ga0496111_0010486 | 3300048914 | Bacteria | 6221 |
| 793 | Ga0496111_0012361 | 3300048914 | Bacteria | 5777 |
| 794 | Ga0496111_0035437 | 3300048914 | Bacteria | 3566 |
| 795 | Ga0496111_0072352 | 3300048914 | Bacteria | 2509 |
| 796 | Ga0496111_0133809 | 3300048914 | Bacteria | 1836 |
| 797 | Ga0496111_0204669 | 3300048914 | Bacteria | 1467 |
| 798 | Ga0496111_0490988 | 3300048914 | Bacteria | 904 |
| 799 | Ga0496112_0000539 | 3300048915 | Bacteria | 25967 |
| 800 | Ga0496112_0002982 | 3300048915 | Bacteria | 13811 |
| 801 | Ga0496112_0009876 | 3300048915 | Bacteria | 8626 |
| 802 | Ga0496112_0106817 | 3300048915 | Bacteria | 2769 |
| 803 | Ga0496112_0256448 | 3300048915 | Bacteria | 1699 |
| 804 | Ga0496112_1321111 | 3300048915 | Bacteria | 636 |
| 805 | Ga0496113_0000012 | 3300048916 | Bacteria | 81903 |
| 806 | Ga0496113_0005984 | 3300048916 | Bacteria | 7655 |
| 807 | Ga0496113_0018250 | 3300048916 | Bacteria | 4884 |
| 808 | Ga0496113_0028851 | 3300048916 | Bacteria | 3997 |
| 809 | Ga0496113_0043034 | 3300048916 | Bacteria | 3340 |
| 810 | Ga0496113_0049342 | 3300048916 | Bacteria | 3134 |
| 811 | Ga0496113_0167441 | 3300048916 | Bacteria | 1739 |
| 812 | Ga0496113_0353712 | 3300048916 | Bacteria | 1178 |
| 813 | Ga0496114_0013938 | 3300048917 | Bacteria | 6446 |
| 814 | Ga0496114_0034256 | 3300048917 | Bacteria | 4188 |
| 815 | Ga0496114_0625873 | 3300048917 | Bacteria | 948 |
| 816 | Ga0496115_0070655 | 3300048918 | Bacteria | 2830 |
| 817 | Ga0496115_0702504 | 3300048918 | Bacteria | 795 |
| 818 | Ga0496115_0858722 | 3300048918 | Bacteria | 702 |
| 819 | Ga0496117_0007101 | 3300048920 | Bacteria | 11070 |
| 820 | Ga0496117_0050346 | 3300048920 | Bacteria | 2954 |
| 821 | Ga0496118_0005481 | 3300048921 | Bacteria | 14399 |
| 822 | Ga0496118_0336440 | 3300048921 | Bacteria | 811 |
| 823 | Ga0496119_0002987 | 3300048922 | Bacteria | 17953 |
| 824 | Ga0496119_0013469 | 3300048922 | Bacteria | 6508 |
| 825 | Ga0496120_0001095 | 3300048923 | Bacteria | 35373 |
| 826 | Ga0496121_0011630 | 3300048924 | Bacteria | 9732 |
| 827 | Ga0496121_0022888 | 3300048924 | Bacteria | 6039 |
| 828 | Ga0496124_0131915 | 3300048927 | Bacteria | 1984 |
| 829 | Ga0496124_0339272 | 3300048927 | Bacteria | 1068 |
| 830 | Ga0496125_0044847 | 3300048928 | Bacteria | 3731 |
| 831 | Ga0496125_0104642 | 3300048928 | Bacteria | 2072 |
| 832 | Ga0496125_0139856 | 3300048928 | Bacteria | 1685 |
| 833 | Ga0496126_0137633 | 3300048929 | Bacteria | 2105 |
| 834 | Ga0496126_0212423 | 3300048929 | Bacteria | 1628 |
| 835 | Ga0501031_0051779 | 3300049568 | Bacteria | 2675 |
| 836 | Ga0501031_0263255 | 3300049568 | Unclassified | 1120 |
| 837 | Ga0501031_0365053 | 3300049568 | Bacteria | 934 |
| 838 | Ga0501032_0359357 | 3300049569 | Bacteria | 938 |
| 839 | Ga0501034_0272633 | 3300049571 | Bacteria | 1633 |
| 840 | Ga0501034_0471595 | 3300049571 | Bacteria | 1171 |
| 841 | Ga0501036_0169598 | 3300049572 | Bacteria | 1839 |
| 842 | Ga0501036_0306887 | 3300049572 | Bacteria | 1327 |
| 843 | Ga0501036_0399100 | 3300049572 | Bacteria | 1147 |
| 844 | Ga0501037_0391835 | 3300049573 | Bacteria | 953 |
| 845 | Ga0501038_0002086 | 3300049574 | Bacteria | 18534 |
| 846 | Ga0501038_0243544 | 3300049574 | Bacteria | 1427 |
| 847 | Ga0501039_0033485 | 3300049575 | Bacteria | 3962 |
| 848 | Ga0501039_0074638 | 3300049575 | Bacteria | 2636 |
| 849 | Ga0501039_0552765 | 3300049575 | Bacteria | 903 |
| 850 | Ga0501039_0576216 | 3300049575 | Bacteria | 883 |
| 851 | Ga0501040_0055297 | 3300049576 | Bacteria | 2721 |
| 852 | Ga0501040_0186593 | 3300049576 | Bacteria | 1471 |
| 853 | Ga0501040_0219932 | 3300049576 | Bacteria | 1351 |
| 854 | Ga0501041_0227767 | 3300049577 | Bacteria | 1170 |
| 855 | Ga0501041_0426737 | 3300049577 | Archaea | 841 |
| 856 | Ga0501042_0020276 | 3300049578 | Bacteria | 4626 |
| 857 | Ga0501042_0090625 | 3300049578 | Bacteria | 2195 |
| 858 | Ga0501042_0103541 | 3300049578 | Bacteria | 2048 |
| 859 | Ga0501042_0317273 | 3300049578 | Bacteria | 1126 |
| 860 | Ga0501042_0640125 | 3300049578 | Bacteria | 773 |
| 861 | Ga0501042_0989538 | 3300049578 | Bacteria | 613 |
| 862 | Ga0501043_0123822 | 3300049579 | Bacteria | 2027 |
| 863 | Ga0501043_0402565 | 3300049579 | Bacteria | 1034 |
| 864 | Ga0501046_0120997 | 3300049580 | Bacteria | 1991 |
| 865 | Ga0501046_0999677 | 3300049580 | Bacteria | 581 |
| 866 | Ga0501047_0051981 | 3300049581 | Bacteria | 3960 |
| 867 | Ga0501047_0305516 | 3300049581 | Bacteria | 1432 |
| 868 | Ga0501047_0418482 | 3300049581 | Bacteria | 1171 |
| 869 | Ga0501047_1036311 | 3300049581 | Bacteria | 634 |
| 870 | Ga0501048_0008530 | 3300049582 | Bacteria | 7748 |
| 871 | Ga0501048_0088046 | 3300049582 | Bacteria | 2190 |
| 872 | Ga0501048_0326761 | 3300049582 | Bacteria | 1093 |
| 873 | Ga0501067_0003029 | 3300049583 | Bacteria | 9283 |
| 874 | Ga0501067_0193611 | 3300049583 | Bacteria | 1133 |
| 875 | Ga0501067_0307059 | 3300049583 | Bacteria | 883 |
| 876 | Ga0501067_0380033 | 3300049583 | Bacteria | 787 |
| 877 | Ga0501068_0298701 | 3300049584 | Bacteria | 1031 |
| 878 | Ga0501069_0035960 | 3300049585 | Bacteria | 2729 |
| 879 | Ga0501069_0138787 | 3300049585 | Bacteria | 1394 |
| 880 | Ga0501070_0065913 | 3300049586 | Bacteria | 2999 |
| 881 | Ga0501070_0174961 | 3300049586 | Bacteria | 1767 |
| 882 | Ga0501071_0013125 | 3300049587 | Bacteria | 5639 |
| 883 | Ga0501071_0226155 | 3300049587 | Bacteria | 1409 |
| 884 | Ga0501071_0377482 | 3300049587 | Bacteria | 1081 |
| 885 | Ga0501071_1171743 | 3300049587 | Bacteria | 594 |
| 886 | Ga0501071_1193892 | 3300049587 | Bacteria | 588 |
| 887 | Ga0501072_0018459 | 3300049588 | Bacteria | 5373 |
| 888 | Ga0501072_0038791 | 3300049588 | Bacteria | 3738 |
| 889 | Ga0501072_0275263 | 3300049588 | Bacteria | 1339 |
| 890 | Ga0501073_0121469 | 3300049589 | Bacteria | 1810 |
| 891 | Ga0501074_0026425 | 3300049590 | Bacteria | 4210 |
| 892 | Ga0501074_0122651 | 3300049590 | Bacteria | 1859 |
| 893 | Ga0501074_0471970 | 3300049590 | Bacteria | 889 |
| 894 | Ga0501075_0000170 | 3300049591 | Bacteria | 33818 |
| 895 | Ga0501075_0721178 | 3300049591 | Bacteria | 759 |
| 896 | Ga0501075_1124881 | 3300049591 | Bacteria | 596 |
| 897 | Ga0501076_0016885 | 3300049592 | Bacteria | 5543 |
| 898 | Ga0501076_0166709 | 3300049592 | Bacteria | 1795 |
| 899 | Ga0501076_0218717 | 3300049592 | Bacteria | 1557 |
| 900 | Ga0501076_0319220 | 3300049592 | Bacteria | 1274 |
| 901 | Ga0501077_0307141 | 3300049593 | Bacteria | 1011 |
| 902 | Ga0501079_0013899 | 3300049741 | Bacteria | 6142 |
| 903 | Ga0501079_0118954 | 3300049741 | Bacteria | 2054 |
| 904 | Ga0501079_0498773 | 3300049741 | Bacteria | 957 |
| 905 | Ga0501080_1196246 | 3300049742 | Unclassified | 653 |
| 906 | Ga0501081_0037530 | 3300049743 | Bacteria | 3306 |
| 907 | Ga0501081_0176682 | 3300049743 | Bacteria | 1543 |
| 908 | Ga0501081_0382392 | 3300049743 | Bacteria | 1040 |
| 909 | Ga0501081_1241151 | 3300049743 | Bacteria | 565 |
| 910 | Ga0501083_0068703 | 3300049744 | Bacteria | 2357 |
| 911 | Ga0501083_0407402 | 3300049744 | Unclassified | 885 |
| 912 | Ga0501035_0152248 | 3300049822 | Bacteria | 2006 |
| 913 | Ga0501044_0282410 | 3300049823 | Bacteria | 1593 |
| 914 | Ga0501044_0302710 | 3300049823 | Bacteria | 1527 |
| 915 | Ga0501044_0652956 | 3300049823 | Bacteria | 941 |
| 916 | Ga0501045_0057132 | 3300049824 | Bacteria | 2855 |
| 917 | Ga0501045_0088010 | 3300049824 | Bacteria | 2294 |
| 918 | Ga0501045_0142479 | 3300049824 | Bacteria | 1782 |
| 919 | Ga0501045_0229920 | 3300049824 | Bacteria | 1381 |
| 920 | Ga0501045_0465642 | 3300049824 | Bacteria | 939 |
| 921 | Ga0501045_0494108 | 3300049824 | Bacteria | 909 |
| 922 | nmdc:mga03n38_110084_c1 | 3300050490 | Bacteria | 1340 |
| 923 | nmdc:mga00v17_502276_c1 | 3300050491 | Unclassified | 786 |
| 924 | nmdc:mga00v17_515867_c1 | 3300050491 | Bacteria | 774 |
| 925 | nmdc:mga0yw44_136463_c1 | 3300050492 | Bacteria | 1592 |
| 926 | nmdc:mga0yw44_14146_c1 | 3300050492 | Bacteria | 4225 |
| 927 | nmdc:mga0yw44_236709_c1 | 3300050492 | Bacteria | 1213 |
| 928 | nmdc:mga0yw44_289477_c1 | 3300050492 | Bacteria | 1096 |
| 929 | nmdc:mga0yw44_4178_c1 | 3300050492 | Bacteria | 6568 |
| 930 | nmdc:mga0yw44_69374_c1 | 3300050492 | Bacteria | 2183 |
| 931 | nmdc:mga0yw44_8746_c1 | 3300050492 | Bacteria | 5065 |
| 932 | nmdc:mga0yw44_96717_c1 | 3300050492 | Bacteria | 1875 |
| 933 | nmdc:mga05p37_1265375_c1 | 3300050507 | Bacteria | 755 |
| 934 | nmdc:mga05p37_13588_c1 | 3300050507 | Bacteria | 9758 |
| 935 | nmdc:mga05p37_268605_c1 | 3300050507 | Bacteria | 2039 |
| 936 | nmdc:mga05p37_28044_c1 | 3300050507 | Bacteria | 2413 |
| 937 | nmdc:mga05p37_554091_c1 | 3300050507 | Bacteria | 1308 |
| 938 | nmdc:mga09592_8684_c1 | 3300050508 | Bacteria | 8266 |
| 939 | nmdc:mga0qj67_30495_c1 | 3300050509 | Bacteria | 4199 |
| 940 | nmdc:mga06r32_166766_c1 | 3300050510 | Bacteria | 2186 |
| 941 | nmdc:mga06r32_21065_c1 | 3300050510 | Bacteria | 6014 |
| 942 | nmdc:mga06r32_258346_c1 | 3300050510 | Bacteria | 1730 |
| 943 | nmdc:mga06r32_529255_c1 | 3300050510 | Bacteria | 1154 |
| 944 | nmdc:mga06r32_97959_c1 | 3300050510 | Bacteria | 2874 |
| 945 | nmdc:mga08y16_1131440_c1 | 3300050511 | Bacteria | 757 |
| 946 | nmdc:mga08y16_22469_c1 | 3300050511 | Bacteria | 6658 |
| 947 | nmdc:mga08y16_50599_c1 | 3300050511 | Bacteria | 4348 |
| 948 | nmdc:mga0n895_102613_c1 | 3300050512 | Bacteria | 2871 |
| 949 | nmdc:mga0n895_242366_c1 | 3300050512 | Bacteria | 1830 |
| 950 | nmdc:mga0n895_311350_c1 | 3300050512 | Bacteria | 1596 |
| 951 | nmdc:mga0rr50_62733_c1 | 3300050513 | Bacteria | 2805 |
| 952 | nmdc:mga08x19_130895_c1 | 3300050514 | Bacteria | 1687 |
| 953 | nmdc:mga08x19_395299_c1 | 3300050514 | Bacteria | 969 |
| 954 | nmdc:mga0a205_10759_c2 | 3300050515 | Bacteria | 2248 |
| 955 | nmdc:mga0a205_12_c2 | 3300050515 | Bacteria | 69190 |
| 956 | nmdc:mga0a205_156791_c1 | 3300050515 | Bacteria | 2175 |
| 957 | nmdc:mga0a205_244153_c1 | 3300050515 | Bacteria | 1676 |
| 958 | Ga0495601_0000073 | 3300053077 | Bacteria | 55911 |
| 959 | Ga0495601_0000080 | 3300053077 | Bacteria | 51518 |
| 960 | Ga0495601_0004476 | 3300053077 | Bacteria | 8076 |
| 961 | Ga0495601_0023491 | 3300053077 | Bacteria | 3788 |
| 962 | Ga0495601_0499084 | 3300053077 | Bacteria | 785 |
| 963 | Ga0495612_0000410 | 3300053078 | Bacteria | 17077 |
| 964 | Ga0495612_0001984 | 3300053078 | Bacteria | 8425 |
| 965 | Ga0495612_0067334 | 3300053078 | Bacteria | 1489 |
| 966 | Ga0495612_0183661 | 3300053078 | Bacteria | 919 |
| 967 | Ga0495655_0001122 | 3300053083 | Bacteria | 4140 |
| 968 | Ga0495595_0000001 | 3300053084 | Bacteria | 495226 |
| 969 | Ga0495595_0000069 | 3300053084 | Bacteria | 50835 |
| 970 | Ga0495595_0032654 | 3300053084 | Bacteria | 2345 |
| 971 | Ga0495595_0035624 | 3300053084 | Bacteria | 2254 |
| 972 | Ga0495595_0717977 | 3300053084 | Unclassified | 512 |
| 973 | Ga0495619_0000024 | 3300053085 | Bacteria | 180821 |
| 974 | Ga0495619_0000065 | 3300053085 | Bacteria | 83763 |
| 975 | Ga0495619_0000479 | 3300053085 | Bacteria | 26801 |
| 976 | Ga0495619_0001018 | 3300053085 | Bacteria | 18364 |
| 977 | Ga0495619_0001209 | 3300053085 | Bacteria | 16929 |
| 978 | Ga0495619_0001424 | 3300053085 | Bacteria | 15727 |
| 979 | Ga0495619_0003660 | 3300053085 | Bacteria | 9908 |
| 980 | Ga0495619_0013290 | 3300053085 | Bacteria | 5186 |
| 981 | Ga0500614_000272 | 3300053123 | Bacteria | 13406 |
| 982 | Ga0501084_0067497 | 3300054114 | Bacteria | 2993 |
| 983 | Ga0501084_0354701 | 3300054114 | Bacteria | 1239 |
| 984 | Ga0501082_0105363 | 3300060353 | Bacteria | 2439 |
| 985 | Ga0501082_0126485 | 3300060353 | Bacteria | 2216 |
| 986 | Ga0530510_0004092 | 3300061734 | Bacteria | 10063 |
| 987 | Ga0530510_0750660 | 3300061734 | Bacteria | 744 |
| 988 | Ga0307408_100860822 | |||
| 989 | LJQas_1000528 | |||
| 990 | JGI24746J21847_1000506 | |||
| 991 | JGI24034J26672_10000575 | |||
| 992 | JGI24751J29686_10026639 | |||
| 993 | JGI25406J46586_10071554 | |||
| 994 | JGI25406J46586_10165814 | |||
| 995 | JGI25407J50210_10032826 | |||
| 996 | Ga0070658_10663830 | |||
| 997 | Ga0070676_10397618 | |||
| 998 | Ga0070683_100004421 | |||
| 999 | Ga0070683_100005278 | |||
| 1000 | Ga0070683_100024596 | |||
| 1001 | Ga0070683_100519638 | |||
| 1002 | Ga0070683_100598868 | |||
| 1003 | Ga0070670_100174928 | |||
| 1004 | Ga0070677_10000027 | |||
| 1005 | Ga0068869_100030350 | |||
| 1006 | Ga0068869_100243450 | |||
| 1007 | Ga0070666_10015472 | |||
| 1008 | Ga0070666_10260970 | |||
| 1009 | Ga0070666_10335100 | |||
| 1010 | Ga0070680_100023287 | |||
| 1011 | Ga0070682_100000057 | |||
| 1012 | Ga0070682_100000802 | |||
| 1013 | Ga0070682_100177621 | |||
| 1014 | Ga0070682_100183136 | |||
| 1015 | Ga0068868_100000864 | |||
| 1016 | Ga0068868_100002371 | |||
| 1017 | Ga0068868_100062366 | |||
| 1018 | Ga0068868_100093514 | |||
| 1019 | Ga0070660_100102893 | |||
| 1020 | Ga0070689_100024077 | |||
| 1021 | Ga0070689_100055310 | |||
| 1022 | Ga0070691_10000553 | |||
| 1023 | Ga0070687_100074341 | |||
| 1024 | Ga0070687_100640851 | |||
| 1025 | Ga0070661_100000031 | |||
| 1026 | Ga0070692_10009721 | |||
| 1027 | Ga0070692_10149828 | |||
| 1028 | Ga0070668_100022932 | |||
| 1029 | Ga0070669_100237228 | |||
| 1030 | Ga0070675_100000015 | |||
| 1031 | Ga0070674_100000003 | |||
| 1032 | Ga0070674_100000316 | |||
| 1033 | Ga0070674_100161769 | |||
| 1034 | Ga0070674_100168820 | |||
| 1035 | Ga0070674_100201223 | |||
| 1036 | Ga0070674_101566037 | |||
| 1037 | Ga0070673_100014734 | |||
| 1038 | Ga0070673_100373080 | |||
| 1039 | Ga0070673_100567107 | |||
| 1040 | Ga0070688_100000534 | |||
| 1041 | Ga0070688_100002238 | |||
| 1042 | Ga0070688_100529261 | |||
| 1043 | Ga0070659_100107304 | |||
| 1044 | Ga0070667_100150412 | |||
| 1045 | Ga0070667_100265017 | |||
| 1046 | Ga0070667_101992022 | |||
| 1047 | Ga0070703_10116555 | |||
| 1048 | Ga0070714_100035028 | |||
| 1049 | Ga0070713_100000040 | |||
| 1050 | Ga0070710_11144748 | |||
| 1051 | Ga0070701_10266820 | |||
| 1052 | Ga0070711_100068062 | |||
| 1053 | Ga0070711_100095642 | |||
| 1054 | Ga0070700_100681518 | |||
| 1055 | Ga0070694_100580189 | |||
| 1056 | Ga0070663_100590765 | |||
| 1057 | Ga0070678_100004739 | |||
| 1058 | Ga0070678_100045503 | |||
| 1059 | Ga0070678_100123891 | |||
| 1060 | Ga0070662_100000005 | |||
| 1061 | Ga0070681_10186330 | |||
| 1062 | Ga0070681_10232246 | |||
| 1063 | Ga0070681_10594513 | |||
| 1064 | Ga0068867_100000254 | |||
| 1065 | Ga0068867_100069223 | |||
| 1066 | Ga0070685_10000689 | |||
| 1067 | Ga0070685_10001213 | |||
| 1068 | Ga0070685_10023692 | |||
| 1069 | Ga0070685_10031748 | |||
| 1070 | Ga0070685_10082572 | |||
| 1071 | Ga0070685_10491339 | |||
| 1072 | Ga0070706_100105033 | |||
| 1073 | Ga0070699_100692192 | |||
| 1074 | Ga0070679_100000153 | |||
| 1075 | Ga0070684_100039878 | |||
| 1076 | Ga0070684_100297046 | |||
| 1077 | Ga0070684_100432169 | |||
| 1078 | Ga0070684_100640046 | |||
| 1079 | Ga0070684_100792365 | |||
| 1080 | Ga0070697_101134740 | |||
| 1081 | Ga0068853_100005454 | |||
| 1082 | Ga0070672_100000007 | |||
| 1083 | Ga0070672_100271225 | |||
| 1084 | Ga0070686_100015611 | |||
| 1085 | Ga0070686_100074074 | |||
| 1086 | Ga0070686_100423316 | |||
| 1087 | Ga0070695_100704326 | |||
| 1088 | Ga0070695_101092870 | |||
| 1089 | Ga0070696_100205020 | |||
| 1090 | Ga0070693_100046061 | |||
| 1091 | Ga0070665_100000159 | |||
| 1092 | Ga0070665_100003550 | |||
| 1093 | Ga0070665_100004595 | |||
| 1094 | Ga0070665_100806546 | |||
| 1095 | Ga0070665_101171220 | |||
| 1096 | Ga0070665_101749338 | |||
| 1097 | Ga0070704_100002311 | |||
| 1098 | Ga0070704_100194204 | |||
| 1099 | Ga0070704_100281438 | |||
| 1100 | Ga0070704_100313272 | |||
| 1101 | Ga0070704_100374492 | |||
| 1102 | Ga0068855_100485814 | |||
| 1103 | Ga0070664_100187226 | |||
| 1104 | Ga0068857_100246536 | |||
| 1105 | Ga0068854_100000371 | |||
| 1106 | Ga0068854_100067303 | |||
| 1107 | Ga0068854_100366795 | |||
| 1108 | Ga0068856_100002486 | |||
| 1109 | Ga0068856_100047894 | |||
| 1110 | Ga0068856_100082112 | |||
| 1111 | Ga0070702_100093761 | |||
| 1112 | Ga0070702_100216888 | |||
| 1113 | Ga0070702_100980639 | |||
| 1114 | Ga0068852_100000103 | |||
| 1115 | Ga0068852_100230204 | |||
| 1116 | Ga0068852_100265134 | |||
| 1117 | Ga0068859_100181876 | |||
| 1118 | Ga0068859_100481255 | |||
| 1119 | Ga0068864_100000066 | |||
| 1120 | Ga0068866_10000002 | |||
| 1121 | Ga0068866_10000457 | |||
| 1122 | Ga0068866_10611905 | |||
| 1123 | Ga0068861_100173829 | |||
| 1124 | Ga0068861_100716938 | |||
| 1125 | Ga0068851_10016292 | |||
| 1126 | Ga0068851_10265522 | |||
| 1127 | Ga0068870_10043765 | |||
| 1128 | Ga0068863_100000032 | |||
| 1129 | Ga0068858_100000043 | |||
| 1130 | Ga0068858_100000049 | |||
| 1131 | Ga0068858_100041610 | |||
| 1132 | Ga0068858_100178442 | |||
| 1133 | Ga0068858_100179560 | |||
| 1134 | Ga0068858_100653381 | |||
| 1135 | Ga0068860_100009747 | |||
| 1136 | Ga0068860_100036300 | |||
| 1137 | Ga0068860_101447335 | |||
| 1138 | Ga0068860_101855181 | |||
| 1139 | Ga0068862_100084251 | |||
| 1140 | Ga0068862_100097013 | |||
| 1141 | Ga0068862_102011356 | |||
| 1142 | Ga0081455_10005275 | |||
| 1143 | Ga0081455_10009930 | |||
| 1144 | Ga0081455_10011084 | |||
| 1145 | Ga0081455_10029633 | |||
| 1146 | Ga0081455_10044620 | |||
| 1147 | Ga0081455_10068495 | |||
| 1148 | Ga0081455_10109091 | |||
| 1149 | Ga0081455_10110646 | |||
| 1150 | Ga0081455_10285274 | |||
| 1151 | Ga0081455_10343374 | |||
| 1152 | Ga0081455_10394449 | |||
| 1153 | Ga0081455_10437480 | |||
| 1154 | Ga0081455_10547397 | |||
| 1155 | Ga0081538_10000135 | |||
| 1156 | Ga0081538_10000204 | |||
| 1157 | Ga0081538_10001004 | |||
| 1158 | Ga0081538_10035826 | |||
| 1159 | Ga0081538_10128546 | |||
| 1160 | Ga0081540_1000686 | |||
| 1161 | Ga0081540_1171445 | |||
| 1162 | Ga0081539_10001602 | |||
| 1163 | Ga0081539_10028563 | |||
| 1164 | Ga0075365_10000180 | |||
| 1165 | Ga0075365_10005742 | |||
| 1166 | Ga0075365_10012257 | |||
| 1167 | Ga0075365_10023529 | |||
| 1168 | Ga0075365_10049013 | |||
| 1169 | Ga0075365_10078811 | |||
| 1170 | Ga0075365_10090970 | |||
| 1171 | Ga0075365_10265918 | |||
| 1172 | Ga0075365_10340651 | |||
| 1173 | Ga0075363_100155442 | |||
| 1174 | Ga0075363_100200801 | |||
| 1175 | Ga0075364_10371169 | |||
| 1176 | Ga0075364_10398570 | |||
| 1177 | Ga0075364_10488826 | |||
| 1178 | Ga0075432_10190437 | |||
| 1179 | Ga0070715_10000012 | |||
| 1180 | Ga0070715_10253564 | |||
| 1181 | Ga0070712_100002001 | |||
| 1182 | Ga0070712_100368639 | |||
| 1183 | Ga0075367_10362043 | |||
| 1184 | Ga0097621_100210577 | |||
| 1185 | Ga0068871_100310687 | |||
| 1186 | Ga0075428_100105390 | |||
| 1187 | Ga0075430_100001324 | |||
| 1188 | Ga0075430_100045670 | |||
| 1189 | Ga0075431_100011036 | |||
| 1190 | Ga0075431_100019567 | |||
| 1191 | Ga0075431_100070406 | |||
| 1192 | Ga0075431_100347497 | |||
| 1193 | Ga0075431_101182759 | |||
| 1194 | Ga0075433_10001758 | |||
| 1195 | Ga0075433_10016159 | |||
| 1196 | Ga0075433_10132320 | |||
| 1197 | Ga0075433_10190229 | |||
| 1198 | Ga0075433_10191471 | |||
| 1199 | Ga0075434_100020110 | |||
| 1200 | Ga0075429_100008611 | |||
| 1201 | Ga0068865_100000001 | |||
| 1202 | Ga0075436_100071279 | |||
| 1203 | Ga0075436_100283802 | |||
| 1204 | Ga0097620_100181873 | |||
| 1205 | Ga0097620_100481269 | |||
| 1206 | Ga0075435_100205637 | |||
| 1207 | Ga0075435_100701507 | |||
| 1208 | Ga0105240_11025594 | |||
| 1209 | Ga0111539_10008366 | |||
| 1210 | Ga0111539_10016386 | |||
| 1211 | Ga0111539_10095657 | |||
| 1212 | Ga0111539_10350303 | |||
| 1213 | Ga0111539_11248138 | |||
| 1214 | Ga0105245_10000091 | |||
| 1215 | Ga0105245_10000340 | |||
| 1216 | Ga0105245_10002874 | |||
| 1217 | Ga0105245_10005187 | |||
| 1218 | Ga0105245_10023351 | |||
| 1219 | Ga0105245_10435543 | |||
| 1220 | Ga0105245_10465616 | |||
| 1221 | Ga0105245_10863877 | |||
| 1222 | Ga0105245_12403065 | |||
| 1223 | Ga0105247_10001345 | |||
| 1224 | Ga0105247_10045449 | |||
| 1225 | Ga0105247_10193065 | |||
| 1226 | Ga0105247_10423716 | |||
| 1227 | Ga0105247_10559578 | |||
| 1228 | Ga0105247_11393335 | |||
| 1229 | Ga0114129_10013966 | |||
| 1230 | Ga0114129_10041143 | |||
| 1231 | Ga0114129_10052844 | |||
| 1232 | Ga0114129_10061521 | |||
| 1233 | Ga0114129_10230323 | |||
| 1234 | Ga0114129_11025191 | |||
| 1235 | Ga0114129_11281874 | |||
| 1236 | Ga0114129_11294070 | |||
| 1237 | Ga0114129_12245933 | |||
| 1238 | Ga0105243_10013134 | |||
| 1239 | Ga0105243_10102834 | |||
| 1240 | Ga0105243_10104004 | |||
| 1241 | Ga0105243_10123078 | |||
| 1242 | Ga0105243_10334879 | |||
| 1243 | Ga0105243_10401099 | |||
| 1244 | Ga0105243_10422461 | |||
| 1245 | Ga0105241_10475723 | |||
| 1246 | Ga0105242_10001420 | |||
| 1247 | Ga0105242_10057966 | |||
| 1248 | Ga0105242_10393544 | |||
| 1249 | Ga0105242_11727381 | |||
| 1250 | Ga0105248_10000506 | |||
| 1251 | Ga0105248_10256203 | |||
| 1252 | Ga0105248_10492942 | |||
| 1253 | Ga0105248_10582178 | |||
| 1254 | Ga0105237_10121799 | |||
| 1255 | Ga0105237_10129753 | |||
| 1256 | Ga0105238_10000028 | |||
| 1257 | Ga0105238_10037990 | |||
| 1258 | Ga0105238_10402405 | |||
| 1259 | Ga0105238_10414425 | |||
| 1260 | Ga0105238_10429035 | |||
| 1261 | Ga0105249_10000073 | |||
| 1262 | Ga0105249_10007327 | |||
| 1263 | Ga0105249_10060909 | |||
| 1264 | Ga0105249_10075632 | |||
| 1265 | Ga0105249_10080516 | |||
| 1266 | Ga0105249_10701097 | |||
| 1267 | Ga0105239_10244006 | |||
| 1268 | Ga0105239_11183635 | |||
| 1269 | Ga0105239_11206606 | |||
| 1270 | Ga0105246_10195700 | |||
| 1271 | Ga0105246_10266248 | |||
| 1272 | Ga0105246_10334851 | |||
| 1273 | Ga0157371_10002665 | |||
| 1274 | Ga0157371_10036579 | |||
| 1275 | Ga0157370_10015146 | |||
| 1276 | Ga0157370_10029574 | |||
| 1277 | Ga0157369_10414972 | |||
| 1278 | Ga0157374_10125138 | |||
| 1279 | Ga0157378_10016506 | |||
| 1280 | Ga0157378_10193802 | |||
| 1281 | Ga0157378_10709855 | |||
| 1282 | Ga0163162_10142956 | |||
| 1283 | Ga0163162_10727512 | |||
| 1284 | Ga0163162_10830584 | |||
| 1285 | Ga0163162_11914823 | |||
| 1286 | Ga0157372_10000121 | |||
| 1287 | Ga0157372_10102593 | |||
| 1288 | Ga0157372_10102848 | |||
| 1289 | Ga0157375_10003805 | |||
| 1290 | Ga0157375_10018619 | |||
| 1291 | Ga0157375_10129622 | |||
| 1292 | Ga0157375_10154763 | |||
| 1293 | Ga0157375_11219189 | |||
| 1294 | Ga0163163_11189309 | |||
| 1295 | Ga0157380_10000400 | |||
| 1296 | Ga0157380_10019156 | |||
| 1297 | Ga0157380_12078162 | |||
| 1298 | Ga0157379_10011086 | |||
| 1299 | Ga0157379_10193354 | |||
| 1300 | Ga0157379_10604517 | |||
| 1301 | Ga0157379_11572935 | |||
| 1302 | Ga0157376_10287318 | |||
| 1303 | Ga0163161_10000073 | |||
| 1304 | Ga0163161_10271207 | |||
| 1305 | Ga0163161_10320715 | |||
| 1306 | Ga0197907_11003200 | |||
| 1307 | Ga0206356_10604718 | |||
| 1308 | Ga0206354_10017965 | |||
| 1309 | Ga0206354_10281469 | |||
| 1310 | Ga0206353_10760314 | |||
| 1311 | Ga0213873_10041676 | |||
| 1312 | Ga0213876_10017769 | |||
| 1313 | Ga0224712_10092910 | |||
| 1314 | Ga0224712_10270126 | |||
| 1315 | Ga0207656_10002474 | |||
| 1316 | Ga0207656_10009876 | |||
| 1317 | Ga0207656_10160895 | |||
| 1318 | Ga0207682_10000003 | |||
| 1319 | Ga0207642_10000001 | |||
| 1320 | Ga0207642_10000003 | |||
| 1321 | Ga0207642_10000004 | |||
| 1322 | Ga0207642_10000389 | |||
| 1323 | Ga0207710_10000112 | |||
| 1324 | Ga0207710_10147856 | |||
| 1325 | Ga0207710_10495459 | |||
| 1326 | Ga0207688_10039754 | |||
| 1327 | Ga0207680_10001025 | |||
| 1328 | Ga0207680_10154479 | |||
| 1329 | Ga0207685_10000001 | |||
| 1330 | Ga0207645_10258226 | |||
| 1331 | Ga0207645_10504252 | |||
| 1332 | Ga0207643_10016033 | |||
| 1333 | Ga0207705_10575650 | |||
| 1334 | Ga0207654_10299095 | |||
| 1335 | Ga0207707_10048787 | |||
| 1336 | Ga0207695_10953926 | |||
| 1337 | Ga0207693_10000001 | |||
| 1338 | Ga0207693_10002935 | |||
| 1339 | Ga0207693_10011889 | |||
| 1340 | Ga0207663_10043081 | |||
| 1341 | Ga0207663_10050424 | |||
| 1342 | Ga0207660_10172358 | |||
| 1343 | Ga0207660_10840515 | |||
| 1344 | Ga0207662_10031842 | |||
| 1345 | Ga0207662_10206928 | |||
| 1346 | Ga0207657_10052488 | |||
| 1347 | Ga0207649_10000021 | |||
| 1348 | Ga0207649_10355235 | |||
| 1349 | Ga0207649_10690387 | |||
| 1350 | Ga0207652_10001404 | |||
| 1351 | Ga0207652_10446245 | |||
| 1352 | Ga0207646_11169495 | |||
| 1353 | Ga0207681_10080412 | |||
| 1354 | Ga0207681_11054389 | |||
| 1355 | Ga0207694_10000008 | |||
| 1356 | Ga0207694_10181668 | |||
| 1357 | Ga0207694_10504585 | |||
| 1358 | Ga0207650_10156560 | |||
| 1359 | Ga0207659_10000094 | |||
| 1360 | Ga0207687_10000012 | |||
| 1361 | Ga0207687_10000042 | |||
| 1362 | Ga0207687_10001586 | |||
| 1363 | Ga0207687_10003941 | |||
| 1364 | Ga0207687_10016098 | |||
| 1365 | Ga0207687_10273513 | |||
| 1366 | Ga0207687_10330135 | |||
| 1367 | Ga0207687_10580791 | |||
| 1368 | Ga0207687_10661411 | |||
| 1369 | Ga0207700_10000032 | |||
| 1370 | Ga0207664_10003709 | |||
| 1371 | Ga0207644_10055977 | |||
| 1372 | Ga0207690_10001272 | |||
| 1373 | Ga0207690_10744706 | |||
| 1374 | Ga0207706_10000006 | |||
| 1375 | Ga0207686_10012361 | |||
| 1376 | Ga0207686_10138659 | |||
| 1377 | Ga0207686_10185978 | |||
| 1378 | Ga0207709_10012145 | |||
| 1379 | Ga0207709_10031084 | |||
| 1380 | Ga0207709_10093073 | |||
| 1381 | Ga0207670_10039494 | |||
| 1382 | Ga0207670_10307009 | |||
| 1383 | Ga0207669_10000016 | |||
| 1384 | Ga0207669_10000023 | |||
| 1385 | Ga0207669_10188325 | |||
| 1386 | Ga0207669_10190543 | |||
| 1387 | Ga0207669_10452186 | |||
| 1388 | Ga0207669_10553006 | |||
| 1389 | Ga0207669_10921495 | |||
| 1390 | Ga0207704_10000012 | |||
| 1391 | Ga0207704_10868985 | |||
| 1392 | Ga0207665_10109152 | |||
| 1393 | Ga0207665_10508763 | |||
| 1394 | Ga0207691_10000140 | |||
| 1395 | Ga0207691_10086172 | |||
| 1396 | Ga0207711_10000085 | |||
| 1397 | Ga0207711_10954105 | |||
| 1398 | Ga0207689_10024231 | |||
| 1399 | Ga0207689_10180196 | |||
| 1400 | Ga0207661_10000784 | |||
| 1401 | Ga0207661_10007312 | |||
| 1402 | Ga0207661_10013420 | |||
| 1403 | Ga0207661_10029192 | |||
| 1404 | Ga0207661_10154133 | |||
| 1405 | Ga0207661_10274312 | |||
| 1406 | Ga0207661_10398015 | |||
| 1407 | Ga0207661_10825237 | |||
| 1408 | Ga0207661_11164889 | |||
| 1409 | Ga0207679_10023481 | |||
| 1410 | Ga0207679_10510398 | |||
| 1411 | Ga0207651_10008848 | |||
| 1412 | Ga0207651_10082886 | |||
| 1413 | Ga0207712_10000003 | |||
| 1414 | Ga0207712_10133852 | |||
| 1415 | Ga0207712_10136772 | |||
| 1416 | Ga0207712_10738529 | |||
| 1417 | Ga0207668_10132948 | |||
| 1418 | Ga0207668_10185970 | |||
| 1419 | Ga0207668_10874805 | |||
| 1420 | Ga0207668_11063320 | |||
| 1421 | Ga0207668_11767335 | |||
| 1422 | Ga0207640_10000270 | |||
| 1423 | Ga0207640_10499382 | |||
| 1424 | Ga0207640_11341219 | |||
| 1425 | Ga0207658_10075507 | |||
| 1426 | Ga0207658_10217427 | |||
| 1427 | Ga0207677_10000760 | |||
| 1428 | Ga0207677_10002075 | |||
| 1429 | Ga0207677_10109248 | |||
| 1430 | Ga0207703_10000053 | |||
| 1431 | Ga0207703_10000132 | |||
| 1432 | Ga0207703_10031133 | |||
| 1433 | Ga0207703_10068265 | |||
| 1434 | Ga0207703_10130764 | |||
| 1435 | Ga0207703_10781066 | |||
| 1436 | Ga0207639_10001498 | |||
| 1437 | Ga0207639_10569911 | |||
| 1438 | Ga0207678_10059792 | |||
| 1439 | Ga0207678_11755392 | |||
| 1440 | Ga0207708_10046046 | |||
| 1441 | Ga0207708_10049604 | |||
| 1442 | Ga0207702_10000332 | |||
| 1443 | Ga0207702_10005812 | |||
| 1444 | Ga0207702_10056840 | |||
| 1445 | Ga0207641_10000071 | |||
| 1446 | Ga0207641_10239994 | |||
| 1447 | Ga0207648_10110678 | |||
| 1448 | Ga0207676_10000038 | |||
| 1449 | Ga0207676_10265327 | |||
| 1450 | Ga0207674_10124152 | |||
| 1451 | Ga0207675_100146309 | |||
| 1452 | Ga0207675_101085713 | |||
| 1453 | Ga0207683_10063056 | |||
| 1454 | Ga0207683_10156357 | |||
| 1455 | Ga0207698_10000009 | |||
| 1456 | Ga0207698_10012457 | |||
| 1457 | Ga0207698_10178161 | |||
| 1458 | Ga0207698_10578855 | |||
| 1459 | Ga0207428_10029736 | |||
| 1460 | Ga0207428_10040972 | |||
| 1461 | Ga0207428_10113550 | |||
| 1462 | Ga0207428_10126704 | |||
| 1463 | Ga0268266_10000023 | |||
| 1464 | Ga0268266_10001388 | |||
| 1465 | Ga0268266_10001442 | |||
| 1466 | Ga0268266_10215563 | |||
| 1467 | Ga0268266_10219388 | |||
| 1468 | Ga0268266_10292207 | |||
| 1469 | Ga0268266_10321398 | |||
| 1470 | Ga0268266_10557788 | |||
| 1471 | Ga0268266_11034754 | |||
| 1472 | Ga0268265_10120653 | |||
| 1473 | Ga0268265_10697654 | |||
| 1474 | Ga0268265_10914133 | |||
| 1475 | Ga0268265_11724613 | |||
| 1476 | Ga0268264_10002363 | |||
| 1477 | Ga0268264_10077884 | |||
| 1478 | Ga0268264_10177645 | |||
| 1479 | Ga0307511_10137879 | |||
| 1480 | Ga0307408_101355843 | |||
| 1481 | Ga0316579_10102806 | |||
| 1482 | Ga0307405_10329116 | |||
| 1483 | Ga0307413_10230678 | |||
| 1484 | Ga0307413_11379752 | |||
| 1485 | Ga0307410_10524040 | |||
| 1486 | Ga0307410_10739662 | |||
| 1487 | Ga0307406_10070979 | |||
| 1488 | Ga0307409_101025834 | |||
| 1489 | Ga0307409_101219561 | |||
| 1490 | Ga0307416_100661673 | |||
| 1491 | Ga0307414_11238516 | |||
| 1492 | Ga0307411_10197561 | |||
| 1493 | Ga0307415_100012565 | |||
| 1494 | Ga0307415_100601707 | |||
| 1495 | Ga0316583_10219556 | |||
| 1496 | Ga0373939_0128858 | |||
| 1497 | Ga0373945_0290247 | |||
| 1498 | Ga0373954_0149067 | |||
| 1499 | Ga0373956_0200078 | |||
| 1500 | Ga0373957_0097788 | |||
| 1501 | Ga0373960_0083927 | |||
| 1502 | Ga0373943_0047960 | |||
| 1503 | Ga0373955_0124753 | |||
| 1504 | Ga0373942_0103743 | |||
| 1505 | Ga0316574_0120286 | |||
| 1506 | Ga0373935_0398012 | |||
| 1507 | Ga0373933_0710249 | |||
| 1508 | Ga0373947_0248629 | |||
| 1509 | Ga0373937_0027900 | |||
| 1510 | Ga0373937_0042483 | |||
| 1511 | Ga0316582_0811424 | |||
| 1512 | Ga0316584_0293899 | |||
| 1513 | Ga0373925_0472415 | |||
| 1514 | Ga0373925_1531738 | |||
| 1515 | Ga0395899_0047858 | |||
| 1516 | Ga0395900_0021354 | |||
| 1517 | Ga0395900_0183072 | |||
| 1518 | Ga0395900_0353044 | |||
| 1519 | Ga0395900_0413270 | |||
| 1520 | Ga0395900_0913769 | |||
| 1521 | Ga0395900_0975764 | |||
| 1522 | Ga0395898_0016278 | |||
| 1523 | Ga0395898_0079042 | |||
| 1524 | Ga0395898_0324326 | |||
| 1525 | Ga0395898_0396725 | |||
| 1526 | Ga0395898_0631227 | |||
| 1527 | Ga0395898_0664614 | |||
| 1528 | Ga0395898_0707116 | |||
| 1529 | Ga0395898_0850155 | |||
| 1530 | Ga0395898_0871284 | |||
| 1531 | Ga0395905_0004196 | |||
| 1532 | Ga0395905_0225709 | |||
| 1533 | Ga0395905_0266977 | |||
| 1534 | Ga0395905_0335759 | |||
| 1535 | Ga0395901_0018076 | |||
| 1536 | Ga0395901_0080123 | |||
| 1537 | Ga0395901_0264625 | |||
| 1538 | Ga0395901_0904343 | |||
| 1539 | Ga0436365_0700522 | |||
| 1540 | Ga0436362_0361016 | |||
| 1541 | Ga0451789_0190937 | |||
| 1542 | Ga0451793_1567316 | |||
| 1543 | Ga0451833_0127813 | |||
| 1544 | Ga0451849_1383452 | |||
| 1545 | Ga0439448_0128192 | |||
| 1546 | Ga0466963_0000406 | |||
| 1547 | Ga0466963_0019056 | |||
| 1548 | Ga0466963_0037755 | |||
| 1549 | Ga0466963_0895737 | |||
| 1550 | Ga0466964_0014541 | |||
| 1551 | Ga0466964_0193517 | |||
| 1552 | Ga0466964_0355324 | |||
| 1553 | Ga0466957_0580411 | |||
| 1554 | Ga0466957_0610028 | |||
| 1555 | Ga0466960_0187516 | |||
| 1556 | Ga0466958_0201290 | |||
| 1557 | Ga0466967_0000007 | |||
| 1558 | Ga0466967_0003720 | |||
| 1559 | Ga0466967_0032948 | |||
| 1560 | Ga0466967_0061173 | |||
| 1561 | Ga0466967_0612912 | |||
| 1562 | Ga0466967_1544001 | |||
| 1563 | Ga0495592_0031293 | |||
| 1564 | Ga0495592_0090252 | |||
| 1565 | Ga0495592_0095353 | |||
| 1566 | Ga0495603_0004170 | |||
| 1567 | Ga0495590_0056589 | |||
| 1568 | Ga0495590_0140401 | |||
| 1569 | Ga0495629_0001388 | |||
| 1570 | Ga0495629_0011366 | |||
| 1571 | Ga0495629_0705603 | |||
| 1572 | Ga0495638_0134391 | |||
| 1573 | Ga0495641_0000012 | |||
| 1574 | Ga0495641_0010457 | |||
| 1575 | Ga0495641_0062434 | |||
| 1576 | Ga0495651_0024433 | |||
| 1577 | Ga0495651_0082512 | |||
| 1578 | Ga0495651_0140463 | |||
| 1579 | Ga0495651_0192718 | |||
| 1580 | Ga0495651_0404847 | |||
| 1581 | Ga0495653_0030121 | |||
| 1582 | Ga0495653_0520267 | |||
| 1583 | Ga0495582_0000007 | |||
| 1584 | Ga0495582_0184405 | |||
| 1585 | Ga0495582_0753780 | |||
| 1586 | Ga0495639_0292651 | |||
| 1587 | Ga0495662_0004180 | |||
| 1588 | Ga0495662_0067271 | |||
| 1589 | Ga0495584_0242898 | |||
| 1590 | Ga0495584_0388473 | |||
| 1591 | Ga0495585_0272377 | |||
| 1592 | Ga0495585_0626687 | |||
| 1593 | Ga0495594_0095786 | |||
| 1594 | Ga0495596_0062448 | |||
| 1595 | Ga0495596_0093303 | |||
| 1596 | Ga0495596_0232560 | |||
| 1597 | Ga0495606_0000082 | |||
| 1598 | Ga0495608_0000063 | |||
| 1599 | Ga0495608_0005393 | |||
| 1600 | Ga0495608_0027929 | |||
| 1601 | Ga0495608_0063068 | |||
| 1602 | Ga0495608_0100014 | |||
| 1603 | Ga0495616_0160838 | |||
| 1604 | Ga0495616_0327538 | |||
| 1605 | Ga0495618_0000003 | |||
| 1606 | Ga0495618_0483003 | |||
| 1607 | Ga0495620_0000113 | |||
| 1608 | Ga0495628_0036556 | |||
| 1609 | Ga0495628_0054751 | |||
| 1610 | Ga0495628_0103973 | |||
| 1611 | Ga0495628_0104012 | |||
| 1612 | Ga0495628_0111898 | |||
| 1613 | Ga0495628_0469037 | |||
| 1614 | Ga0495630_0000007 | |||
| 1615 | Ga0495630_0000477 | |||
| 1616 | Ga0495630_0447058 | |||
| 1617 | Ga0495644_0089288 | |||
| 1618 | Ga0495663_0077994 | |||
| 1619 | Ga0495652_0001430 | |||
| 1620 | Ga0495652_0155110 | |||
| 1621 | Ga0495640_0004409 | |||
| 1622 | Ga0495640_0006935 | |||
| 1623 | Ga0495640_0145828 | |||
| 1624 | Ga0495586_0001272 | |||
| 1625 | Ga0495586_0276550 | |||
| 1626 | Ga0495587_0071367 | |||
| 1627 | Ga0495587_0106533 | |||
| 1628 | Ga0495598_0053928 | |||
| 1629 | Ga0495621_0000679 | |||
| 1630 | Ga0495645_0004980 | |||
| 1631 | Ga0495645_0013041 | |||
| 1632 | Ga0495645_0457661 | |||
| 1633 | Ga0495667_0090823 | |||
| 1634 | Ga0495656_0299579 | |||
| 1635 | Ga0495634_0000125 | |||
| 1636 | Ga0495634_0000828 | |||
| 1637 | Ga0495634_0010756 | |||
| 1638 | Ga0495634_0082549 | |||
| 1639 | Ga0495634_0171893 | |||
| 1640 | Ga0495634_0575152 | |||
| 1641 | Ga0495635_0000009 | |||
| 1642 | Ga0495635_0047675 | |||
| 1643 | Ga0495635_0231854 | |||
| 1644 | Ga0495635_0324906 | |||
| 1645 | Ga0495659_0162657 | |||
| 1646 | Ga0495588_0000602 | |||
| 1647 | Ga0495657_0000084 | |||
| 1648 | Ga0495657_0010956 | |||
| 1649 | Ga0495657_0023623 | |||
| 1650 | Ga0495599_0136910 | |||
| 1651 | Ga0495599_0335927 | |||
| 1652 | Ga0495647_0000014 | |||
| 1653 | Ga0495647_0005014 | |||
| 1654 | Ga0495647_0011161 | |||
| 1655 | Ga0495647_0276770 | |||
| 1656 | Ga0495658_0000007 | |||
| 1657 | Ga0495658_0050093 | |||
| 1658 | Ga0495658_0185227 | |||
| 1659 | Ga0495669_0000213 | |||
| 1660 | Ga0495669_0020171 | |||
| 1661 | Ga0495669_0136595 | |||
| 1662 | Ga0495613_0000003 | |||
| 1663 | Ga0495613_0000310 | |||
| 1664 | Ga0495613_0088978 | |||
| 1665 | Ga0495624_0000002 | |||
| 1666 | Ga0495624_0000256 | |||
| 1667 | Ga0495624_0228619 | |||
| 1668 | Ga0495624_0364848 | |||
| 1669 | Ga0495670_0103637 | |||
| 1670 | Ga0495649_0034365 | |||
| 1671 | Ga0495589_0230893 | |||
| 1672 | Ga0495600_0003063 | |||
| 1673 | Ga0495600_0033862 | |||
| 1674 | Ga0495600_0096189 | |||
| 1675 | Ga0495600_0099370 | |||
| 1676 | Ga0495600_0537082 | |||
| 1677 | Ga0495660_0076596 | |||
| 1678 | Ga0495660_0504488 | |||
| 1679 | Ga0495581_0160050 | |||
| 1680 | Ga0495604_0000084 | |||
| 1681 | Ga0495604_0043452 | |||
| 1682 | Ga0495674_0000027 | |||
| 1683 | Ga0495672_0046414 | |||
| 1684 | Ga0495672_0125585 | |||
| 1685 | Ga0495676_0001046 | |||
| 1686 | Ga0495676_0049017 | |||
| 1687 | Ga0495676_0314114 | |||
| 1688 | Ga0495680_0000255 | |||
| 1689 | Ga0495680_0000256 | |||
| 1690 | Ga0495680_0081114 | |||
| 1691 | Ga0495680_0318445 | |||
| 1692 | Ga0495675_0000067 | |||
| 1693 | Ga0495675_0070636 | |||
| 1694 | Ga0495679_108621 | |||
| 1695 | Ga0495685_060990 | |||
| 1696 | Ga0495673_0078838 | |||
| 1697 | Ga0495684_0092105 | |||
| 1698 | Ga0495686_0010031 | |||
| 1699 | Ga0495686_0048752 | |||
| 1700 | Ga0495593_0087797 | |||
| 1701 | Ga0495593_0119025 | |||
| 1702 | Ga0495602_0000008 | |||
| 1703 | Ga0495602_0349526 | |||
| 1704 | Ga0495614_0287428 | |||
| 1705 | Ga0495626_0147357 | |||
| 1706 | Ga0496100_0000016 | |||
| 1707 | Ga0496100_1358508 | |||
| 1708 | Ga0496101_0000038 | |||
| 1709 | Ga0496101_0002799 | |||
| 1710 | Ga0496101_0058412 | |||
| 1711 | Ga0496101_0372709 | |||
| 1712 | Ga0496101_0601350 | |||
| 1713 | Ga0496101_0765465 | |||
| 1714 | Ga0496101_0848246 | |||
| 1715 | Ga0496101_0860645 | |||
| 1716 | Ga0496102_0005397 | |||
| 1717 | Ga0496102_0025633 | |||
| 1718 | Ga0496102_0194530 | |||
| 1719 | Ga0496102_0354963 | |||
| 1720 | Ga0496102_0980740 | |||
| 1721 | Ga0496103_0001687 | |||
| 1722 | Ga0496103_0014666 | |||
| 1723 | Ga0496103_0050586 | |||
| 1724 | Ga0496103_0138108 | |||
| 1725 | Ga0496103_0544670 | |||
| 1726 | Ga0496104_0000003 | |||
| 1727 | Ga0496104_0000007 | |||
| 1728 | Ga0496104_0000147 | |||
| 1729 | Ga0496104_0036798 | |||
| 1730 | Ga0496104_0074338 | |||
| 1731 | Ga0496105_0000002 | |||
| 1732 | Ga0496105_0000008 | |||
| 1733 | Ga0496105_0000988 | |||
| 1734 | Ga0496105_0024847 | |||
| 1735 | Ga0496105_0026744 | |||
| 1736 | Ga0496105_0086229 | |||
| 1737 | Ga0496106_0000013 | |||
| 1738 | Ga0496106_0000027 | |||
| 1739 | Ga0496106_0048080 | |||
| 1740 | Ga0496106_0071587 | |||
| 1741 | Ga0496106_0076379 | |||
| 1742 | Ga0496106_0616846 | |||
| 1743 | Ga0496107_0000003 | |||
| 1744 | Ga0496107_0034892 | |||
| 1745 | Ga0496107_0051851 | |||
| 1746 | Ga0496107_0094312 | |||
| 1747 | Ga0496107_0306002 | |||
| 1748 | Ga0496108_0000002 | |||
| 1749 | Ga0496108_0000216 | |||
| 1750 | Ga0496108_0000254 | |||
| 1751 | Ga0496108_0002779 | |||
| 1752 | Ga0496108_0010108 | |||
| 1753 | Ga0496108_0019207 | |||
| 1754 | Ga0496108_0079609 | |||
| 1755 | Ga0496108_0249765 | |||
| 1756 | Ga0496108_0374770 | |||
| 1757 | Ga0496108_0381682 | |||
| 1758 | Ga0496108_0839740 | |||
| 1759 | Ga0496109_0000001 | |||
| 1760 | Ga0496109_0000046 | |||
| 1761 | Ga0496109_0000085 | |||
| 1762 | Ga0496109_0000321 | |||
| 1763 | Ga0496109_0129770 | |||
| 1764 | Ga0496109_0170671 | |||
| 1765 | Ga0496109_0199975 | |||
| 1766 | Ga0496109_0212228 | |||
| 1767 | Ga0496109_0323286 | |||
| 1768 | Ga0496109_0999829 | |||
| 1769 | Ga0496110_0000004 | |||
| 1770 | Ga0496110_0006148 | |||
| 1771 | Ga0496110_0047435 | |||
| 1772 | Ga0496110_0066142 | |||
| 1773 | Ga0496110_0142170 | |||
| 1774 | Ga0496110_0143405 | |||
| 1775 | Ga0496110_0702373 | |||
| 1776 | Ga0496110_1042929 | |||
| 1777 | Ga0496111_0000002 | |||
| 1778 | Ga0496111_0000644 | |||
| 1779 | Ga0496111_0010486 | |||
| 1780 | Ga0496111_0012361 | |||
| 1781 | Ga0496111_0035437 | |||
| 1782 | Ga0496111_0072352 | |||
| 1783 | Ga0496111_0133809 | |||
| 1784 | Ga0496111_0204669 | |||
| 1785 | Ga0496111_0490988 | |||
| 1786 | Ga0496112_0000539 | |||
| 1787 | Ga0496112_0002982 | |||
| 1788 | Ga0496112_0009876 | |||
| 1789 | Ga0496112_0106817 | |||
| 1790 | Ga0496112_0256448 | |||
| 1791 | Ga0496112_1321111 | |||
| 1792 | Ga0496113_0000012 | |||
| 1793 | Ga0496113_0005984 | |||
| 1794 | Ga0496113_0018250 | |||
| 1795 | Ga0496113_0028851 | |||
| 1796 | Ga0496113_0043034 | |||
| 1797 | Ga0496113_0049342 | |||
| 1798 | Ga0496113_0167441 | |||
| 1799 | Ga0496113_0353712 | |||
| 1800 | Ga0496114_0013938 | |||
| 1801 | Ga0496114_0034256 | |||
| 1802 | Ga0496114_0625873 | |||
| 1803 | Ga0496115_0070655 | |||
| 1804 | Ga0496115_0702504 | |||
| 1805 | Ga0496115_0858722 | |||
| 1806 | Ga0496117_0007101 | |||
| 1807 | Ga0496117_0050346 | |||
| 1808 | Ga0496118_0005481 | |||
| 1809 | Ga0496118_0336440 | |||
| 1810 | Ga0496119_0002987 | |||
| 1811 | Ga0496119_0013469 | |||
| 1812 | Ga0496120_0001095 | |||
| 1813 | Ga0496121_0011630 | |||
| 1814 | Ga0496121_0022888 | |||
| 1815 | Ga0496124_0131915 | |||
| 1816 | Ga0496124_0339272 | |||
| 1817 | Ga0496125_0044847 | |||
| 1818 | Ga0496125_0104642 | |||
| 1819 | Ga0496125_0139856 | |||
| 1820 | Ga0496126_0137633 | |||
| 1821 | Ga0496126_0212423 | |||
| 1822 | Ga0501031_0051779 | |||
| 1823 | Ga0501031_0263255 | |||
| 1824 | Ga0501031_0365053 | |||
| 1825 | Ga0501032_0359357 | |||
| 1826 | Ga0501034_0272633 | |||
| 1827 | Ga0501034_0471595 | |||
| 1828 | Ga0501036_0169598 | |||
| 1829 | Ga0501036_0306887 | |||
| 1830 | Ga0501036_0399100 | |||
| 1831 | Ga0501037_0391835 | |||
| 1832 | Ga0501038_0002086 | |||
| 1833 | Ga0501038_0243544 | |||
| 1834 | Ga0501039_0033485 | |||
| 1835 | Ga0501039_0074638 | |||
| 1836 | Ga0501039_0552765 | |||
| 1837 | Ga0501039_0576216 | |||
| 1838 | Ga0501040_0055297 | |||
| 1839 | Ga0501040_0186593 | |||
| 1840 | Ga0501040_0219932 | |||
| 1841 | Ga0501041_0227767 | |||
| 1842 | Ga0501041_0426737 | |||
| 1843 | Ga0501042_0020276 | |||
| 1844 | Ga0501042_0090625 | |||
| 1845 | Ga0501042_0103541 | |||
| 1846 | Ga0501042_0317273 | |||
| 1847 | Ga0501042_0640125 | |||
| 1848 | Ga0501042_0989538 | |||
| 1849 | Ga0501043_0123822 | |||
| 1850 | Ga0501043_0402565 | |||
| 1851 | Ga0501046_0120997 | |||
| 1852 | Ga0501046_0999677 | |||
| 1853 | Ga0501047_0051981 | |||
| 1854 | Ga0501047_0305516 | |||
| 1855 | Ga0501047_0418482 | |||
| 1856 | Ga0501047_1036311 | |||
| 1857 | Ga0501048_0008530 | |||
| 1858 | Ga0501048_0088046 | |||
| 1859 | Ga0501048_0326761 | |||
| 1860 | Ga0501067_0003029 | |||
| 1861 | Ga0501067_0193611 | |||
| 1862 | Ga0501067_0307059 | |||
| 1863 | Ga0501067_0380033 | |||
| 1864 | Ga0501068_0298701 | |||
| 1865 | Ga0501069_0035960 | |||
| 1866 | Ga0501069_0138787 | |||
| 1867 | Ga0501070_0065913 | |||
| 1868 | Ga0501070_0174961 | |||
| 1869 | Ga0501071_0013125 | |||
| 1870 | Ga0501071_0226155 | |||
| 1871 | Ga0501071_0377482 | |||
| 1872 | Ga0501071_1171743 | |||
| 1873 | Ga0501071_1193892 | |||
| 1874 | Ga0501072_0018459 | |||
| 1875 | Ga0501072_0038791 | |||
| 1876 | Ga0501072_0275263 | |||
| 1877 | Ga0501073_0121469 | |||
| 1878 | Ga0501074_0026425 | |||
| 1879 | Ga0501074_0122651 | |||
| 1880 | Ga0501074_0471970 | |||
| 1881 | Ga0501075_0000170 | |||
| 1882 | Ga0501075_0721178 | |||
| 1883 | Ga0501075_1124881 | |||
| 1884 | Ga0501076_0016885 | |||
| 1885 | Ga0501076_0166709 | |||
| 1886 | Ga0501076_0218717 | |||
| 1887 | Ga0501076_0319220 | |||
| 1888 | Ga0501077_0307141 | |||
| 1889 | Ga0501079_0013899 | |||
| 1890 | Ga0501079_0118954 | |||
| 1891 | Ga0501079_0498773 | |||
| 1892 | Ga0501080_1196246 | |||
| 1893 | Ga0501081_0037530 | |||
| 1894 | Ga0501081_0176682 | |||
| 1895 | Ga0501081_0382392 | |||
| 1896 | Ga0501081_1241151 | |||
| 1897 | Ga0501083_0068703 | |||
| 1898 | Ga0501083_0407402 | |||
| 1899 | Ga0501035_0152248 | |||
| 1900 | Ga0501044_0282410 | |||
| 1901 | Ga0501044_0302710 | |||
| 1902 | Ga0501044_0652956 | |||
| 1903 | Ga0501045_0057132 | |||
| 1904 | Ga0501045_0088010 | |||
| 1905 | Ga0501045_0142479 | |||
| 1906 | Ga0501045_0229920 | |||
| 1907 | Ga0501045_0465642 | |||
| 1908 | Ga0501045_0494108 | |||
| 1909 | nmdc:mga03n38_110084_c1 | |||
| 1910 | nmdc:mga00v17_502276_c1 | |||
| 1911 | nmdc:mga00v17_515867_c1 | |||
| 1912 | nmdc:mga0yw44_136463_c1 | |||
| 1913 | nmdc:mga0yw44_14146_c1 | |||
| 1914 | nmdc:mga0yw44_236709_c1 | |||
| 1915 | nmdc:mga0yw44_289477_c1 | |||
| 1916 | nmdc:mga0yw44_4178_c1 | |||
| 1917 | nmdc:mga0yw44_69374_c1 | |||
| 1918 | nmdc:mga0yw44_8746_c1 | |||
| 1919 | nmdc:mga0yw44_96717_c1 | |||
| 1920 | nmdc:mga05p37_1265375_c1 | |||
| 1921 | nmdc:mga05p37_13588_c1 | |||
| 1922 | nmdc:mga05p37_268605_c1 | |||
| 1923 | nmdc:mga05p37_28044_c1 | |||
| 1924 | nmdc:mga05p37_554091_c1 | |||
| 1925 | nmdc:mga09592_8684_c1 | |||
| 1926 | nmdc:mga0qj67_30495_c1 | |||
| 1927 | nmdc:mga06r32_166766_c1 | |||
| 1928 | nmdc:mga06r32_21065_c1 | |||
| 1929 | nmdc:mga06r32_258346_c1 | |||
| 1930 | nmdc:mga06r32_529255_c1 | |||
| 1931 | nmdc:mga06r32_97959_c1 | |||
| 1932 | nmdc:mga08y16_1131440_c1 | |||
| 1933 | nmdc:mga08y16_22469_c1 | |||
| 1934 | nmdc:mga08y16_50599_c1 | |||
| 1935 | nmdc:mga0n895_102613_c1 | |||
| 1936 | nmdc:mga0n895_242366_c1 | |||
| 1937 | nmdc:mga0n895_311350_c1 | |||
| 1938 | nmdc:mga0rr50_62733_c1 | |||
| 1939 | nmdc:mga08x19_130895_c1 | |||
| 1940 | nmdc:mga08x19_395299_c1 | |||
| 1941 | nmdc:mga0a205_10759_c2 | |||
| 1942 | nmdc:mga0a205_12_c2 | |||
| 1943 | nmdc:mga0a205_156791_c1 | |||
| 1944 | nmdc:mga0a205_244153_c1 | |||
| 1945 | Ga0495601_0000073 | |||
| 1946 | Ga0495601_0000080 | |||
| 1947 | Ga0495601_0004476 | |||
| 1948 | Ga0495601_0023491 | |||
| 1949 | Ga0495601_0499084 | |||
| 1950 | Ga0495612_0000410 | |||
| 1951 | Ga0495612_0001984 | |||
| 1952 | Ga0495612_0067334 | |||
| 1953 | Ga0495612_0183661 | |||
| 1954 | Ga0495655_0001122 | |||
| 1955 | Ga0495595_0000001 | |||
| 1956 | Ga0495595_0000069 | |||
| 1957 | Ga0495595_0032654 | |||
| 1958 | Ga0495595_0035624 | |||
| 1959 | Ga0495595_0717977 | |||
| 1960 | Ga0495619_0000024 | |||
| 1961 | Ga0495619_0000065 | |||
| 1962 | Ga0495619_0000479 | |||
| 1963 | Ga0495619_0001018 | |||
| 1964 | Ga0495619_0001209 | |||
| 1965 | Ga0495619_0001424 | |||
| 1966 | Ga0495619_0003660 | |||
| 1967 | Ga0495619_0013290 | |||
| 1968 | Ga0500614_000272 | |||
| 1969 | Ga0501084_0067497 | |||
| 1970 | Ga0501084_0354701 | |||
| 1971 | Ga0501082_0105363 | |||
| 1972 | Ga0501082_0126485 | |||
| 1973 | Ga0530510_0004092 | |||
| 1974 | Ga0530510_0750660 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1o4v-assembly1.cif.gz_A | crystal structure of the catalytic subunit of a phosphoribosylaminoimidazole mutase (tm0446) from thermotoga maritima at 1.77 a resolution | 0.9507 | 28 | 157 |
| 4ay4-assembly1.cif.gz_D | crystal structure of bacillus anthracis pure | 0.9496 | 27 | 157 |
| 2fw9-assembly1.cif.gz_B | structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h59f from the acidophilic bacterium acetobacter aceti, at ph 8 | 0.9494 | 27 | 157 |
| 2fwb-assembly1.cif.gz_B | structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h89f from the acidophilic bacterium acetobacter aceti, at ph 8 | 0.9492 | 27 | 157 |
| 4zjy-assembly1.cif.gz_B | structure of acetobacter aceti pure-s57n | 0.9492 | 27 | 157 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9SJ42_1_162_3.40.50.1970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.955 | 34 | 157 | 3.40.50.1970 |
| 5cvtB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9431 | 27 | 157 | 3.40.50.1970 |
| 2ywxA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9405 | 30 | 157 | 3.40.50.1970 |
| af_Q2FZJ5_1_139_3.40.50.1970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9244 | 50 | 157 | 3.40.50.1970 |
| 4ja0C02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9126 | 29 | 159 | 3.40.50.1970 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C0XMX6-F1-model_v4 | N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) | 0.9859 | 27 | 141 |
GO:0006189
GO:0034023 |
| AF-A0A7X8GA15-F1-model_v4 | N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) | 0.9781 | 27 | 157 |
GO:0004638
GO:0006189 GO:0034023 |
| AF-A0A7W0U9B4-F1-model_v4 | N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) | 0.9776 | 34 | 159 |
GO:0006189
GO:0016020 GO:0034023 |
| AF-A0A1Q3U5Y5-F1-model_v4 | N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) | 0.9776 | 27 | 157 |
GO:0006189
GO:0034023 |
| AF-A0A7V4HB36-F1-model_v4 | 5-(Carboxyamino)imidazole ribonucleotide mutase (EC 4.1.1.21, EC 5.4.99.18) | 0.9762 | 27 | 156 |
GO:0004638
GO:0006189 GO:0034023 |