F487554
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 987 | 343 | 1974 | 320 |
Family's Representative Sequence
| Representative Sequence | 3300047469|Ga0495673_0002789|Ga0495673_0002789_2851_3987 |
| Length | 378 |
| Sequence | MNLQDMPSLAPTQIELPLPTTAAGEPFKEPAADGYILGGFSWRHERQDTTRPVVIINAATSVRCRHYSRFADYLFANGFDVITYDYRGIGESRPASLKGLHASWTDWGALDFEAMLKRAQREFPGQPIDVVGHSFGGCAAGLGASGHLIRHLVTVGAQFAYWRDYAPVHRWRMFGKWHLVMPLVTMLCGYFPGKRLGWLEDTPAGVVRDWSTPTERYETRPSGRLIHAKTGSLPFAAVTAKTLAISISDDPYGTIPAIERLLSYFTGSTNNHLRIAPEDIGEEEVGHFAFFRSPYQATLWPIALSWLQTGELTPDTPGRLVPRSRSTCPSNEIRNDAHGLRQQAAKTRHPRQSQGQAEPHPTGRCAGRTGPERRSHRL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 19 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 22 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 23 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 24 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 25 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 26 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 34 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 42 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 43 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 44 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 45 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 49 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 50 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 70 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 71 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 72 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 73 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 74 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 75 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 76 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 77 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 78 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 79 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 80 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 81 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 82 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 83 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 84 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 85 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 86 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 87 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 88 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 89 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 90 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 91 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 92 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 93 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 94 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 95 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 96 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 97 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 98 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 99 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 100 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 101 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 102 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 103 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 104 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 105 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 106 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 107 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 108 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 109 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 110 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 111 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 112 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 113 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 114 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 115 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 194 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 195 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 196 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 197 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 198 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 199 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 200 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 201 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 202 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 203 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 204 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 205 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 206 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 207 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 208 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 209 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 210 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 211 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 214 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 215 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 217 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 218 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 219 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 220 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 221 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 222 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 223 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 224 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 225 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 226 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 227 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 228 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 229 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 230 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 231 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 232 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 233 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 234 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 235 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 236 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 237 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 238 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 239 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 240 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 241 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 242 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 243 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 244 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 245 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 246 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 247 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 248 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 249 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 250 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 251 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 252 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 253 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 254 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 255 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 256 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 257 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 258 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 259 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 260 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 261 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 262 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 263 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 264 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 265 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 266 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 267 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 268 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 269 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 270 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 271 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 272 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 273 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 274 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 275 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 276 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 277 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 278 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 279 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 280 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 281 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 282 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 283 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 284 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 285 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 286 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 287 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 288 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 289 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 290 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 291 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 292 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 293 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 294 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 295 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 296 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 297 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 298 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 299 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 300 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 301 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 302 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 303 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 304 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 305 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 306 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 307 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 308 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 309 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 310 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 311 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 312 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 313 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 314 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 315 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 316 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 317 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 318 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 319 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 320 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 321 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 322 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 323 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 324 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 325 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 326 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 327 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 328 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 329 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 330 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 331 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 332 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 333 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 334 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 335 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 336 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 337 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 338 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 339 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 340 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 341 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 342 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 343 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.34 |
| Metatranscriptomes | 0 |
| Isolates | 12.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.15 |
| Nodule | 2.23 |
| Rhizoplane | 3.85 |
| Rhizosphere | 77.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495673_0002789 | 3300047469 | Bacteria | 11937 |
| 2 | MRS2a_Contig_850 | 2124908027 | Bacteria | 12077 |
| 3 | MRS1b_contig_1629842 | 2162886011 | Bacteria | 1745 |
| 4 | JGI25162J39368_1000099 | 3300002737 | Bacteria | 95293 |
| 5 | JGI25163J39215_1000781 | 3300002771 | Bacteria | 7798 |
| 6 | JGI25163J39215_1001720 | 3300002771 | Bacteria | 3090 |
| 7 | JGI25164J39214_1000077 | 3300002772 | Bacteria | 95293 |
| 8 | JGI25164J39214_1000477 | 3300002772 | Bacteria | 19746 |
| 9 | JGI25164J39214_1000563 | 3300002772 | Bacteria | 16855 |
| 10 | JGI25165J46597_1000182 | 3300003214 | Bacteria | 95293 |
| 11 | JGI25165J46597_1001123 | 3300003214 | Bacteria | 16862 |
| 12 | Ga0055536_1000109 | 3300003781 | Bacteria | 72531 |
| 13 | Ga0055536_1000539 | 3300003781 | Bacteria | 25978 |
| 14 | Ga0055536_1000945 | 3300003781 | Bacteria | 18635 |
| 15 | Ga0055530_10000034 | 3300003791 | Bacteria | 118012 |
| 16 | Ga0055530_10005906 | 3300003791 | Bacteria | 5650 |
| 17 | Ga0055530_10016613 | 3300003791 | Bacteria | 2342 |
| 18 | Ga0055540_1000064 | 3300003792 | Bacteria | 127318 |
| 19 | Ga0055531_10000039 | 3300003794 | Bacteria | 141103 |
| 20 | Ga0065714_10000677 | 3300005288 | Bacteria | 3019 |
| 21 | Ga0065714_10006736 | 3300005288 | Bacteria | 3171 |
| 22 | Ga0065714_10007227 | 3300005288 | Bacteria | 4442 |
| 23 | Ga0065714_10068888 | 3300005288 | Bacteria | 4493 |
| 24 | Ga0065712_10003423 | 3300005290 | Bacteria | 3745 |
| 25 | Ga0065712_10003440 | 3300005290 | Bacteria | 4418 |
| 26 | Ga0070670_100002657 | 3300005331 | Bacteria | 14780 |
| 27 | Ga0070661_100002281 | 3300005344 | Bacteria | 13172 |
| 28 | Ga0070669_100001095 | 3300005353 | Bacteria | 19842 |
| 29 | Ga0070669_100011538 | 3300005353 | Bacteria | 6271 |
| 30 | Ga0070662_100000851 | 3300005457 | Bacteria | 18755 |
| 31 | Ga0068853_100000029 | 3300005539 | Bacteria | 121775 |
| 32 | Ga0070665_100152640 | 3300005548 | Bacteria | 2312 |
| 33 | Ga0070664_100000039 | 3300005564 | Bacteria | 79163 |
| 34 | Ga0068851_10000035 | 3300005834 | Bacteria | 106588 |
| 35 | Ga0075432_10007826 | 3300006058 | Bacteria | 3643 |
| 36 | Ga0075432_10011738 | 3300006058 | Bacteria | 2977 |
| 37 | Ga0075369_10013145 | 3300006186 | Bacteria | 3279 |
| 38 | Ga0075436_100012824 | 3300006914 | Bacteria | 5746 |
| 39 | Ga0075436_100153655 | 3300006914 | Bacteria | 1620 |
| 40 | Ga0079104_1000104 | 3300006946 | Bacteria | 123967 |
| 41 | Ga0105251_10007717 | 3300009011 | Bacteria | 6570 |
| 42 | Ga0105251_10010061 | 3300009011 | Bacteria | 5526 |
| 43 | Ga0105251_10072895 | 3300009011 | Bacteria | 1596 |
| 44 | Ga0105244_10002169 | 3300009036 | Bacteria | 15048 |
| 45 | Ga0105244_10006525 | 3300009036 | Bacteria | 7528 |
| 46 | Ga0105244_10014244 | 3300009036 | Bacteria | 4608 |
| 47 | Ga0105244_10018615 | 3300009036 | Bacteria | 3893 |
| 48 | Ga0105244_10058156 | 3300009036 | Bacteria | 1952 |
| 49 | Ga0105244_10065735 | 3300009036 | Bacteria | 1816 |
| 50 | Ga0105244_10086361 | 3300009036 | Bacteria | 1547 |
| 51 | Ga0105250_10003521 | 3300009092 | Bacteria | 7382 |
| 52 | Ga0105250_10004993 | 3300009092 | Bacteria | 6014 |
| 53 | Ga0105250_10007009 | 3300009092 | Bacteria | 4869 |
| 54 | Ga0105250_10010708 | 3300009092 | Bacteria | 3817 |
| 55 | Ga0105250_10019016 | 3300009092 | Bacteria | 2778 |
| 56 | Ga0105250_10029049 | 3300009092 | Bacteria | 2225 |
| 57 | Ga0105243_10000047 | 3300009148 | Bacteria | 154272 |
| 58 | Ga0105243_10001372 | 3300009148 | Bacteria | 21564 |
| 59 | Ga0105243_10057018 | 3300009148 | Bacteria | 3109 |
| 60 | Ga0105243_10093376 | 3300009148 | Bacteria | 2483 |
| 61 | Ga0105242_10225062 | 3300009176 | Bacteria | 1678 |
| 62 | Ga0105249_10273122 | 3300009553 | Bacteria | 1685 |
| 63 | Ga0105246_10001783 | 3300011119 | Bacteria | 12870 |
| 64 | Ga0157345_1000197 | 3300012498 | Bacteria | 9342 |
| 65 | Ga0157373_10009880 | 3300013100 | Bacteria | 7031 |
| 66 | Ga0157373_10015997 | 3300013100 | Bacteria | 5476 |
| 67 | Ga0157373_10020335 | 3300013100 | Bacteria | 4826 |
| 68 | Ga0157373_10020352 | 3300013100 | Bacteria | 4823 |
| 69 | Ga0157373_10027437 | 3300013100 | Bacteria | 4108 |
| 70 | Ga0157373_10216351 | 3300013100 | Bacteria | 1351 |
| 71 | Ga0157371_10000356 | 3300013102 | Bacteria | 58315 |
| 72 | Ga0157371_10238596 | 3300013102 | Bacteria | 1307 |
| 73 | Ga0157370_10005146 | 3300013104 | Bacteria | 14747 |
| 74 | Ga0157370_10015663 | 3300013104 | Bacteria | 7700 |
| 75 | Ga0157370_10035652 | 3300013104 | Bacteria | 4833 |
| 76 | Ga0157370_10124806 | 3300013104 | Bacteria | 2403 |
| 77 | Ga0157370_10335485 | 3300013104 | Bacteria | 1394 |
| 78 | Ga0157369_10022614 | 3300013105 | Bacteria | 7012 |
| 79 | Ga0157369_10028863 | 3300013105 | Bacteria | 6136 |
| 80 | Ga0157369_10030701 | 3300013105 | Bacteria | 5925 |
| 81 | Ga0157369_10039023 | 3300013105 | Bacteria | 5191 |
| 82 | Ga0163162_10008135 | 3300013306 | Bacteria | 10234 |
| 83 | Ga0163162_10436454 | 3300013306 | Bacteria | 1442 |
| 84 | Ga0157372_10010372 | 3300013307 | Bacteria | 9903 |
| 85 | Ga0157375_10017607 | 3300013308 | Bacteria | 6452 |
| 86 | Ga0157375_10052397 | 3300013308 | Bacteria | 4011 |
| 87 | Ga0157375_10057028 | 3300013308 | Bacteria | 3859 |
| 88 | Ga0157375_10178515 | 3300013308 | Bacteria | 2274 |
| 89 | Ga0182008_10000066 | 3300014497 | Bacteria | 88047 |
| 90 | Ga0182008_10007475 | 3300014497 | Bacteria | 6029 |
| 91 | Ga0182008_10007709 | 3300014497 | Bacteria | 5926 |
| 92 | Ga0182008_10009651 | 3300014497 | Bacteria | 5198 |
| 93 | Ga0182008_10013620 | 3300014497 | Bacteria | 4273 |
| 94 | Ga0182008_10059143 | 3300014497 | Bacteria | 1891 |
| 95 | Ga0182006_1001904 | 3300015261 | Bacteria | 11895 |
| 96 | Ga0182006_1077568 | 3300015261 | Bacteria | 1218 |
| 97 | Ga0182007_10004021 | 3300015262 | Bacteria | 6783 |
| 98 | Ga0182005_1005166 | 3300015265 | Bacteria | 4107 |
| 99 | Ga0182005_1013457 | 3300015265 | Bacteria | 2301 |
| 100 | Ga0163161_10004434 | 3300017792 | Bacteria | 9783 |
| 101 | Ga0163161_10006065 | 3300017792 | Bacteria | 8376 |
| 102 | Ga0163161_10019131 | 3300017792 | Bacteria | 4802 |
| 103 | Ga0163161_10026430 | 3300017792 | Bacteria | 4111 |
| 104 | Ga0163161_10118911 | 3300017792 | Bacteria | 1984 |
| 105 | Ga0209760_100059 | 3300025207 | Bacteria | 97774 |
| 106 | Ga0209760_100140 | 3300025207 | Bacteria | 45356 |
| 107 | Ga0207427_100014 | 3300025231 | Bacteria | 561361 |
| 108 | Ga0207427_100016 | 3300025231 | Bacteria | 538697 |
| 109 | Ga0209437_100011 | 3300025233 | Bacteria | 818520 |
| 110 | Ga0209437_100016 | 3300025233 | Bacteria | 710118 |
| 111 | Ga0209759_1014821 | 3300025256 | Bacteria | 2040 |
| 112 | Ga0209233_1000019 | 3300025261 | Bacteria | 818520 |
| 113 | Ga0209233_1000036 | 3300025261 | Bacteria | 561361 |
| 114 | Ga0209676_1000025 | 3300025292 | Bacteria | 577569 |
| 115 | Ga0209676_1000032 | 3300025292 | Bacteria | 469558 |
| 116 | Ga0209676_1000208 | 3300025292 | Bacteria | 130879 |
| 117 | Ga0209050_1000025 | 3300025298 | Bacteria | 528225 |
| 118 | Ga0209050_1000099 | 3300025298 | Bacteria | 232176 |
| 119 | Ga0209050_1001463 | 3300025298 | Bacteria | 25262 |
| 120 | Ga0209051_1000026 | 3300025303 | Bacteria | 413311 |
| 121 | Ga0209051_1000039 | 3300025303 | Bacteria | 319632 |
| 122 | Ga0209051_1000047 | 3300025303 | Bacteria | 293227 |
| 123 | Ga0209257_1000034 | 3300025304 | Bacteria | 662719 |
| 124 | Ga0207656_10000008 | 3300025321 | Bacteria | 275365 |
| 125 | Ga0207696_1000084 | 3300025711 | Bacteria | 196086 |
| 126 | Ga0207696_1000563 | 3300025711 | Bacteria | 29281 |
| 127 | Ga0207696_1003779 | 3300025711 | Bacteria | 6749 |
| 128 | Ga0207696_1006428 | 3300025711 | Bacteria | 4739 |
| 129 | Ga0207655_1000162 | 3300025728 | Bacteria | 122768 |
| 130 | Ga0207655_1000495 | 3300025728 | Bacteria | 50771 |
| 131 | Ga0207655_1001897 | 3300025728 | Bacteria | 17953 |
| 132 | Ga0207655_1002594 | 3300025728 | Bacteria | 14396 |
| 133 | Ga0207655_1005378 | 3300025728 | Bacteria | 8721 |
| 134 | Ga0207655_1005689 | 3300025728 | Bacteria | 8426 |
| 135 | Ga0207655_1009290 | 3300025728 | Bacteria | 6123 |
| 136 | Ga0207655_1013422 | 3300025728 | Bacteria | 4706 |
| 137 | Ga0207655_1013802 | 3300025728 | Bacteria | 4610 |
| 138 | Ga0207655_1015415 | 3300025728 | Bacteria | 4250 |
| 139 | Ga0207713_1001090 | 3300025735 | Bacteria | 23284 |
| 140 | Ga0207713_1001569 | 3300025735 | Bacteria | 17923 |
| 141 | Ga0207713_1003590 | 3300025735 | Bacteria | 10474 |
| 142 | Ga0207713_1004477 | 3300025735 | Bacteria | 9054 |
| 143 | Ga0207713_1007019 | 3300025735 | Bacteria | 6747 |
| 144 | Ga0207713_1007259 | 3300025735 | Bacteria | 6576 |
| 145 | Ga0207713_1007321 | 3300025735 | Bacteria | 6537 |
| 146 | Ga0207713_1024486 | 3300025735 | Bacteria | 2814 |
| 147 | Ga0207671_10000015 | 3300025914 | Bacteria | 439607 |
| 148 | Ga0207649_10000001 | 3300025920 | Bacteria | 537851 |
| 149 | Ga0207681_10000325 | 3300025923 | Bacteria | 34341 |
| 150 | Ga0207681_10005906 | 3300025923 | Bacteria | 7505 |
| 151 | Ga0207650_10000186 | 3300025925 | Bacteria | 72380 |
| 152 | Ga0207706_10000081 | 3300025933 | Bacteria | 98791 |
| 153 | Ga0207686_10102983 | 3300025934 | Bacteria | 1909 |
| 154 | Ga0207709_10000040 | 3300025935 | Bacteria | 259497 |
| 155 | Ga0207709_10000249 | 3300025935 | Bacteria | 65683 |
| 156 | Ga0207709_10042300 | 3300025935 | Bacteria | 2740 |
| 157 | Ga0207679_10000009 | 3300025945 | Bacteria | 357262 |
| 158 | Ga0207712_10197618 | 3300025961 | Bacteria | 1592 |
| 159 | Ga0207639_10000090 | 3300026041 | Bacteria | 76134 |
| 160 | Ga0209281_1000026 | 3300027111 | Bacteria | 465877 |
| 161 | Ga0209281_1007948 | 3300027111 | Bacteria | 2614 |
| 162 | Ga0207428_10099323 | 3300027907 | Bacteria | 2251 |
| 163 | Ga0207428_10169211 | 3300027907 | Bacteria | 1656 |
| 164 | Ga0207428_10169925 | 3300027907 | Bacteria | 1652 |
| 165 | Ga0307511_10142236 | 3300030521 | Bacteria | 1405 |
| 166 | Ga0316179_1066635 | 3300030734 | Bacteria | 4562 |
| 167 | Ga0307509_10043687 | 3300031507 | Bacteria | 4848 |
| 168 | Ga0307516_10198683 | 3300031730 | Bacteria | 1726 |
| 169 | Ga0307405_10003246 | 3300031731 | Bacteria | 7416 |
| 170 | Ga0307407_10113432 | 3300031903 | Bacteria | 1706 |
| 171 | Ga0307412_10056702 | 3300031911 | Bacteria | 2612 |
| 172 | Ga0307412_10335246 | 3300031911 | Bacteria | 1208 |
| 173 | Ga0307416_100190002 | 3300032002 | Bacteria | 1935 |
| 174 | Ga0307414_10105636 | 3300032004 | Bacteria | 2129 |
| 175 | Ga0307414_10122438 | 3300032004 | Bacteria | 2002 |
| 176 | Ga0307510_10048465 | 3300033180 | Bacteria | 4532 |
| 177 | Ga0439438_001810 | 3300041405 | Bacteria | 9375 |
| 178 | Ga0439438_006065 | 3300041405 | Bacteria | 4332 |
| 179 | Ga0439438_012300 | 3300041405 | Bacteria | 2626 |
| 180 | Ga0439438_014555 | 3300041405 | Bacteria | 2338 |
| 181 | Ga0439438_021163 | 3300041405 | Bacteria | 1817 |
| 182 | Ga0439447_001459 | 3300041407 | Bacteria | 8685 |
| 183 | Ga0439447_004123 | 3300041407 | Bacteria | 5055 |
| 184 | Ga0439447_005640 | 3300041407 | Bacteria | 4142 |
| 185 | Ga0439447_014479 | 3300041407 | Bacteria | 2211 |
| 186 | Ga0439447_038722 | 3300041407 | Bacteria | 1170 |
| 187 | Ga0439461_0009312 | 3300041410 | Bacteria | 1779 |
| 188 | Ga0439466_0000592 | 3300041411 | Bacteria | 13588 |
| 189 | Ga0439466_0003823 | 3300041411 | Bacteria | 5812 |
| 190 | Ga0439466_0004719 | 3300041411 | Bacteria | 5236 |
| 191 | Ga0439466_0005992 | 3300041411 | Bacteria | 4626 |
| 192 | Ga0439466_0013675 | 3300041411 | Bacteria | 2968 |
| 193 | Ga0439466_0021708 | 3300041411 | Bacteria | 2271 |
| 194 | Ga0439466_0025185 | 3300041411 | Bacteria | 2078 |
| 195 | Ga0439466_0039577 | 3300041411 | Bacteria | 1579 |
| 196 | Ga0439465_0005193 | 3300041413 | Bacteria | 4175 |
| 197 | Ga0439445_0020996 | 3300042004 | Bacteria | 1638 |
| 198 | Ga0439432_005217 | 3300042006 | Bacteria | 4693 |
| 199 | Ga0439432_005529 | 3300042006 | Bacteria | 4547 |
| 200 | Ga0439432_006258 | 3300042006 | Bacteria | 4257 |
| 201 | Ga0439432_026061 | 3300042006 | Bacteria | 1914 |
| 202 | Ga0439451_000777 | 3300042009 | Bacteria | 6068 |
| 203 | Ga0439451_001521 | 3300042009 | Bacteria | 4586 |
| 204 | Ga0439451_004112 | 3300042009 | Bacteria | 2952 |
| 205 | Ga0439451_011103 | 3300042009 | Bacteria | 1816 |
| 206 | Ga0439451_017591 | 3300042009 | Bacteria | 1441 |
| 207 | Ga0439451_029685 | 3300042009 | Bacteria | 1100 |
| 208 | Ga0439452_001440 | 3300042010 | Bacteria | 9721 |
| 209 | Ga0439452_002739 | 3300042010 | Bacteria | 6381 |
| 210 | Ga0439452_003601 | 3300042010 | Bacteria | 5398 |
| 211 | Ga0439452_003840 | 3300042010 | Bacteria | 5159 |
| 212 | Ga0439452_010235 | 3300042010 | Bacteria | 2738 |
| 213 | Ga0439456_000042 | 3300042013 | Bacteria | 46567 |
| 214 | Ga0439456_002784 | 3300042013 | Bacteria | 3524 |
| 215 | Ga0439456_003896 | 3300042013 | Bacteria | 3030 |
| 216 | Ga0439456_008302 | 3300042013 | Bacteria | 2143 |
| 217 | Ga0439463_001102 | 3300042016 | Bacteria | 7260 |
| 218 | Ga0439463_001271 | 3300042016 | Bacteria | 6741 |
| 219 | Ga0439463_006770 | 3300042016 | Bacteria | 2835 |
| 220 | Ga0439463_021443 | 3300042016 | Bacteria | 1613 |
| 221 | Ga0439463_037721 | 3300042016 | Bacteria | 1226 |
| 222 | Ga0439463_048463 | 3300042016 | Bacteria | 1082 |
| 223 | Ga0450911_000394 | 3300042115 | Bacteria | 14425 |
| 224 | Ga0450911_001041 | 3300042115 | Bacteria | 7069 |
| 225 | Ga0450911_002240 | 3300042115 | Bacteria | 3893 |
| 226 | Ga0450922_000105 | 3300042124 | Bacteria | 8081 |
| 227 | Ga0450922_000231 | 3300042124 | Bacteria | 6024 |
| 228 | Ga0450890_000865 | 3300042127 | Bacteria | 4370 |
| 229 | Ga0450896_002506 | 3300042133 | Bacteria | 2376 |
| 230 | Ga0450898_001042 | 3300042134 | Bacteria | 3511 |
| 231 | Ga0450900_001006 | 3300042136 | Bacteria | 2568 |
| 232 | Ga0450902_003491 | 3300042137 | Bacteria | 2296 |
| 233 | Ga0450902_012476 | 3300042137 | Bacteria | 1360 |
| 234 | Ga0450903_001446 | 3300042138 | Bacteria | 4437 |
| 235 | Ga0450903_002348 | 3300042138 | Bacteria | 3377 |
| 236 | Ga0450903_007061 | 3300042138 | Bacteria | 1854 |
| 237 | Ga0450903_010965 | 3300042138 | Bacteria | 1462 |
| 238 | Ga0450903_012008 | 3300042138 | Bacteria | 1388 |
| 239 | Ga0450904_000669 | 3300042139 | Bacteria | 6122 |
| 240 | Ga0450904_001373 | 3300042139 | Bacteria | 3497 |
| 241 | Ga0450905_003458 | 3300042142 | Bacteria | 2074 |
| 242 | Ga0450905_008268 | 3300042142 | Bacteria | 1423 |
| 243 | Ga0450905_011984 | 3300042142 | Bacteria | 1218 |
| 244 | Ga0450906_000140 | 3300042145 | Bacteria | 13120 |
| 245 | Ga0450906_001955 | 3300042145 | Bacteria | 4501 |
| 246 | Ga0450906_002634 | 3300042145 | Bacteria | 3917 |
| 247 | Ga0450907_001035 | 3300042146 | Bacteria | 6513 |
| 248 | Ga0450907_001261 | 3300042146 | Bacteria | 5673 |
| 249 | Ga0450907_001828 | 3300042146 | Bacteria | 4375 |
| 250 | Ga0450907_013197 | 3300042146 | Bacteria | 1375 |
| 251 | Ga0450910_000899 | 3300042147 | Bacteria | 3587 |
| 252 | Ga0450910_001208 | 3300042147 | Bacteria | 3212 |
| 253 | Ga0439446_0001111 | 3300042156 | Bacteria | 5953 |
| 254 | Ga0450909_000748 | 3300042185 | Bacteria | 4386 |
| 255 | Ga0439434_0001029 | 3300042435 | Bacteria | 8072 |
| 256 | Ga0439464_0001818 | 3300042439 | Bacteria | 5149 |
| 257 | Ga0439460_0002815 | 3300042461 | Bacteria | 4189 |
| 258 | Ga0439460_0005433 | 3300042461 | Bacteria | 3126 |
| 259 | Ga0450918_001677 | 3300042531 | Bacteria | 4342 |
| 260 | Ga0450918_005599 | 3300042531 | Bacteria | 2254 |
| 261 | Ga0450918_005678 | 3300042531 | Bacteria | 2235 |
| 262 | Ga0450893_0003049 | 3300042532 | Bacteria | 2635 |
| 263 | Ga0450901_000527 | 3300042533 | Bacteria | 4541 |
| 264 | Ga0439440_0013454 | 3300042993 | Bacteria | 1755 |
| 265 | Ga0466968_0075512 | 3300044735 | Bacteria | 1473 |
| 266 | Ga0495617_002678 | 3300046452 | Bacteria | 6932 |
| 267 | Ga0495617_003151 | 3300046452 | Bacteria | 6279 |
| 268 | Ga0495617_003353 | 3300046452 | Bacteria | 6048 |
| 269 | Ga0495617_006218 | 3300046452 | Bacteria | 4202 |
| 270 | Ga0495617_010915 | 3300046452 | Bacteria | 3108 |
| 271 | Ga0495617_013399 | 3300046452 | Bacteria | 2789 |
| 272 | Ga0495617_014309 | 3300046452 | Bacteria | 2696 |
| 273 | Ga0495617_018078 | 3300046452 | Bacteria | 2383 |
| 274 | Ga0495617_018600 | 3300046452 | Bacteria | 2349 |
| 275 | Ga0495617_047445 | 3300046452 | Bacteria | 1429 |
| 276 | Ga0495617_073142 | 3300046452 | Bacteria | 1126 |
| 277 | Ga0495627_001941 | 3300046453 | Bacteria | 10765 |
| 278 | Ga0495627_002145 | 3300046453 | Bacteria | 9915 |
| 279 | Ga0495627_002251 | 3300046453 | Bacteria | 9551 |
| 280 | Ga0495627_002921 | 3300046453 | Bacteria | 7857 |
| 281 | Ga0495627_006178 | 3300046453 | Bacteria | 4719 |
| 282 | Ga0495627_010854 | 3300046453 | Bacteria | 3293 |
| 283 | Ga0495627_022247 | 3300046453 | Bacteria | 2088 |
| 284 | Ga0495627_026839 | 3300046453 | Bacteria | 1853 |
| 285 | Ga0495592_0032447 | 3300046454 | Bacteria | 3939 |
| 286 | Ga0495603_0013842 | 3300046455 | Bacteria | 4883 |
| 287 | Ga0495590_0001133 | 3300046457 | Bacteria | 11668 |
| 288 | Ga0495590_0005329 | 3300046457 | Bacteria | 5108 |
| 289 | Ga0495590_0006995 | 3300046457 | Bacteria | 4374 |
| 290 | Ga0495591_001039 | 3300046458 | Bacteria | 18743 |
| 291 | Ga0495591_001516 | 3300046458 | Bacteria | 14289 |
| 292 | Ga0495591_003403 | 3300046458 | Bacteria | 8241 |
| 293 | Ga0495591_004687 | 3300046458 | Bacteria | 6568 |
| 294 | Ga0495591_007643 | 3300046458 | Bacteria | 4558 |
| 295 | Ga0495591_008847 | 3300046458 | Bacteria | 4069 |
| 296 | Ga0495591_009680 | 3300046458 | Bacteria | 3806 |
| 297 | Ga0495591_015548 | 3300046458 | Bacteria | 2682 |
| 298 | Ga0495591_023973 | 3300046458 | Bacteria | 1944 |
| 299 | Ga0495591_024727 | 3300046458 | Bacteria | 1897 |
| 300 | Ga0495638_0004345 | 3300046460 | Bacteria | 10737 |
| 301 | Ga0495638_0007860 | 3300046460 | Bacteria | 7608 |
| 302 | Ga0495638_0010713 | 3300046460 | Bacteria | 6347 |
| 303 | Ga0495638_0010935 | 3300046460 | Bacteria | 6275 |
| 304 | Ga0495638_0012479 | 3300046460 | Bacteria | 5821 |
| 305 | Ga0495638_0015980 | 3300046460 | Bacteria | 5030 |
| 306 | Ga0495638_0017979 | 3300046460 | Bacteria | 4704 |
| 307 | Ga0495638_0022211 | 3300046460 | Bacteria | 4167 |
| 308 | Ga0495638_0025088 | 3300046460 | Bacteria | 3878 |
| 309 | Ga0495638_0029352 | 3300046460 | Bacteria | 3546 |
| 310 | Ga0495638_0040760 | 3300046460 | Bacteria | 2941 |
| 311 | Ga0495638_0056338 | 3300046460 | Bacteria | 2439 |
| 312 | Ga0495638_0092120 | 3300046460 | Bacteria | 1824 |
| 313 | Ga0495638_0119522 | 3300046460 | Bacteria | 1558 |
| 314 | Ga0495638_0129236 | 3300046460 | Bacteria | 1485 |
| 315 | Ga0495638_0218483 | 3300046460 | Bacteria | 1066 |
| 316 | Ga0495653_0001680 | 3300046463 | Bacteria | 17412 |
| 317 | Ga0495653_0027312 | 3300046463 | Bacteria | 4568 |
| 318 | Ga0495650_0001827 | 3300046471 | Bacteria | 19067 |
| 319 | Ga0495650_0006454 | 3300046471 | Bacteria | 7298 |
| 320 | Ga0495650_0010566 | 3300046471 | Bacteria | 5140 |
| 321 | Ga0495650_0012672 | 3300046471 | Bacteria | 4518 |
| 322 | Ga0495650_0013248 | 3300046471 | Bacteria | 4373 |
| 323 | Ga0495650_0074844 | 3300046471 | Bacteria | 1319 |
| 324 | Ga0495605_0002176 | 3300046474 | Bacteria | 12245 |
| 325 | Ga0495605_0010638 | 3300046474 | Bacteria | 5143 |
| 326 | Ga0495605_0010842 | 3300046474 | Bacteria | 5090 |
| 327 | Ga0495605_0017100 | 3300046474 | Bacteria | 3914 |
| 328 | Ga0495605_0018537 | 3300046474 | Bacteria | 3730 |
| 329 | Ga0495605_0022666 | 3300046474 | Bacteria | 3312 |
| 330 | Ga0495605_0033448 | 3300046474 | Bacteria | 2608 |
| 331 | Ga0495605_0046015 | 3300046474 | Bacteria | 2147 |
| 332 | Ga0495605_0053637 | 3300046474 | Bacteria | 1955 |
| 333 | Ga0495605_0093424 | 3300046474 | Bacteria | 1391 |
| 334 | Ga0495605_0100391 | 3300046474 | Bacteria | 1331 |
| 335 | Ga0495639_0000294 | 3300046475 | Bacteria | 24430 |
| 336 | Ga0495639_0001785 | 3300046475 | Bacteria | 9530 |
| 337 | Ga0495639_0038701 | 3300046475 | Bacteria | 2143 |
| 338 | Ga0495584_0001126 | 3300046491 | Bacteria | 16567 |
| 339 | Ga0495584_0003398 | 3300046491 | Bacteria | 8781 |
| 340 | Ga0495584_0004328 | 3300046491 | Bacteria | 7645 |
| 341 | Ga0495584_0004718 | 3300046491 | Bacteria | 7300 |
| 342 | Ga0495584_0006726 | 3300046491 | Bacteria | 6014 |
| 343 | Ga0495584_0007670 | 3300046491 | Bacteria | 5619 |
| 344 | Ga0495584_0009340 | 3300046491 | Bacteria | 5052 |
| 345 | Ga0495584_0012644 | 3300046491 | Bacteria | 4308 |
| 346 | Ga0495584_0013707 | 3300046491 | Bacteria | 4134 |
| 347 | Ga0495584_0015059 | 3300046491 | Bacteria | 3941 |
| 348 | Ga0495584_0024264 | 3300046491 | Bacteria | 3075 |
| 349 | Ga0495584_0029698 | 3300046491 | Bacteria | 2771 |
| 350 | Ga0495584_0075337 | 3300046491 | Bacteria | 1696 |
| 351 | Ga0495584_0126176 | 3300046491 | Bacteria | 1297 |
| 352 | Ga0495585_0005734 | 3300046492 | Bacteria | 7792 |
| 353 | Ga0495585_0007018 | 3300046492 | Bacteria | 6935 |
| 354 | Ga0495585_0009875 | 3300046492 | Bacteria | 5706 |
| 355 | Ga0495585_0013870 | 3300046492 | Bacteria | 4708 |
| 356 | Ga0495585_0015812 | 3300046492 | Bacteria | 4380 |
| 357 | Ga0495585_0016466 | 3300046492 | Bacteria | 4283 |
| 358 | Ga0495585_0019200 | 3300046492 | Bacteria | 3943 |
| 359 | Ga0495585_0023982 | 3300046492 | Bacteria | 3499 |
| 360 | Ga0495585_0033785 | 3300046492 | Bacteria | 2893 |
| 361 | Ga0495585_0076019 | 3300046492 | Bacteria | 1825 |
| 362 | Ga0495594_0008086 | 3300046499 | Bacteria | 5408 |
| 363 | Ga0495594_0017310 | 3300046499 | Bacteria | 3806 |
| 364 | Ga0495596_0000825 | 3300046500 | Bacteria | 18761 |
| 365 | Ga0495596_0007273 | 3300046500 | Bacteria | 5006 |
| 366 | Ga0495596_0082948 | 3300046500 | Bacteria | 1244 |
| 367 | Ga0495607_0002173 | 3300046501 | Bacteria | 16309 |
| 368 | Ga0495607_0006196 | 3300046501 | Bacteria | 8448 |
| 369 | Ga0495607_0006943 | 3300046501 | Bacteria | 7893 |
| 370 | Ga0495607_0008967 | 3300046501 | Bacteria | 6808 |
| 371 | Ga0495607_0013127 | 3300046501 | Bacteria | 5438 |
| 372 | Ga0495607_0016070 | 3300046501 | Bacteria | 4835 |
| 373 | Ga0495607_0024480 | 3300046501 | Bacteria | 3763 |
| 374 | Ga0495607_0041434 | 3300046501 | Bacteria | 2735 |
| 375 | Ga0495607_0043338 | 3300046501 | Bacteria | 2661 |
| 376 | Ga0495607_0061026 | 3300046501 | Bacteria | 2143 |
| 377 | Ga0495607_0077843 | 3300046501 | Bacteria | 1831 |
| 378 | Ga0495607_0102281 | 3300046501 | Bacteria | 1533 |
| 379 | Ga0495607_0122005 | 3300046501 | Bacteria | 1366 |
| 380 | Ga0495607_0128723 | 3300046501 | Bacteria | 1320 |
| 381 | Ga0495583_0002730 | 3300046506 | Bacteria | 14615 |
| 382 | Ga0495583_0006786 | 3300046506 | Bacteria | 7398 |
| 383 | Ga0495583_0012126 | 3300046506 | Bacteria | 4902 |
| 384 | Ga0495583_0022567 | 3300046506 | Bacteria | 3206 |
| 385 | Ga0495583_0096225 | 3300046506 | Bacteria | 1269 |
| 386 | Ga0495583_0103834 | 3300046506 | Bacteria | 1210 |
| 387 | Ga0495606_0005981 | 3300046507 | Bacteria | 11404 |
| 388 | Ga0495606_0006105 | 3300046507 | Bacteria | 11248 |
| 389 | Ga0495606_0007126 | 3300046507 | Bacteria | 10106 |
| 390 | Ga0495606_0014993 | 3300046507 | Bacteria | 6007 |
| 391 | Ga0495610_0002705 | 3300046512 | Bacteria | 14619 |
| 392 | Ga0495610_0004480 | 3300046512 | Bacteria | 10301 |
| 393 | Ga0495610_0005819 | 3300046512 | Bacteria | 8665 |
| 394 | Ga0495610_0007574 | 3300046512 | Bacteria | 7190 |
| 395 | Ga0495610_0007679 | 3300046512 | Bacteria | 7122 |
| 396 | Ga0495610_0007944 | 3300046512 | Bacteria | 6963 |
| 397 | Ga0495610_0010183 | 3300046512 | Bacteria | 5867 |
| 398 | Ga0495610_0010214 | 3300046512 | Bacteria | 5855 |
| 399 | Ga0495610_0011112 | 3300046512 | Bacteria | 5528 |
| 400 | Ga0495610_0035752 | 3300046512 | Bacteria | 2546 |
| 401 | Ga0495610_0064586 | 3300046512 | Bacteria | 1729 |
| 402 | Ga0495616_0001868 | 3300046513 | Bacteria | 14254 |
| 403 | Ga0495616_0004365 | 3300046513 | Bacteria | 8922 |
| 404 | Ga0495616_0005720 | 3300046513 | Bacteria | 7611 |
| 405 | Ga0495616_0005865 | 3300046513 | Bacteria | 7493 |
| 406 | Ga0495616_0011117 | 3300046513 | Bacteria | 5169 |
| 407 | Ga0495616_0020557 | 3300046513 | Bacteria | 3588 |
| 408 | Ga0495616_0021542 | 3300046513 | Bacteria | 3488 |
| 409 | Ga0495616_0024542 | 3300046513 | Bacteria | 3233 |
| 410 | Ga0495616_0034152 | 3300046513 | Bacteria | 2643 |
| 411 | Ga0495616_0045143 | 3300046513 | Bacteria | 2232 |
| 412 | Ga0495616_0074568 | 3300046513 | Bacteria | 1634 |
| 413 | Ga0495620_0000052 | 3300046515 | Bacteria | 103693 |
| 414 | Ga0495620_0001033 | 3300046515 | Bacteria | 17093 |
| 415 | Ga0495620_0001500 | 3300046515 | Bacteria | 13890 |
| 416 | Ga0495620_0003073 | 3300046515 | Bacteria | 9584 |
| 417 | Ga0495620_0003951 | 3300046515 | Bacteria | 8430 |
| 418 | Ga0495620_0007188 | 3300046515 | Bacteria | 6066 |
| 419 | Ga0495620_0008807 | 3300046515 | Bacteria | 5398 |
| 420 | Ga0495620_0011042 | 3300046515 | Bacteria | 4730 |
| 421 | Ga0495620_0042063 | 3300046515 | Bacteria | 1998 |
| 422 | Ga0495620_0089590 | 3300046515 | Bacteria | 1235 |
| 423 | Ga0495628_0036518 | 3300046516 | Bacteria | 3942 |
| 424 | Ga0495630_0014872 | 3300046517 | Bacteria | 5675 |
| 425 | Ga0495630_0017201 | 3300046517 | Bacteria | 5294 |
| 426 | Ga0495630_0057475 | 3300046517 | Bacteria | 2915 |
| 427 | Ga0495631_0003014 | 3300046518 | Bacteria | 9319 |
| 428 | Ga0495631_0003855 | 3300046518 | Bacteria | 8124 |
| 429 | Ga0495631_0006062 | 3300046518 | Bacteria | 6279 |
| 430 | Ga0495631_0006628 | 3300046518 | Bacteria | 5955 |
| 431 | Ga0495631_0010723 | 3300046518 | Bacteria | 4530 |
| 432 | Ga0495631_0014825 | 3300046518 | Bacteria | 3752 |
| 433 | Ga0495632_0000210 | 3300046519 | Bacteria | 59119 |
| 434 | Ga0495632_0001609 | 3300046519 | Bacteria | 18580 |
| 435 | Ga0495632_0004883 | 3300046519 | Bacteria | 8992 |
| 436 | Ga0495632_0006031 | 3300046519 | Bacteria | 7871 |
| 437 | Ga0495632_0008656 | 3300046519 | Bacteria | 6214 |
| 438 | Ga0495632_0012386 | 3300046519 | Bacteria | 4922 |
| 439 | Ga0495632_0012627 | 3300046519 | Bacteria | 4861 |
| 440 | Ga0495632_0016521 | 3300046519 | Bacteria | 4101 |
| 441 | Ga0495632_0021306 | 3300046519 | Bacteria | 3494 |
| 442 | Ga0495632_0025739 | 3300046519 | Bacteria | 3108 |
| 443 | Ga0495632_0049661 | 3300046519 | Bacteria | 2073 |
| 444 | Ga0495632_0054136 | 3300046519 | Bacteria | 1967 |
| 445 | Ga0495632_0057612 | 3300046519 | Bacteria | 1896 |
| 446 | Ga0495632_0064845 | 3300046519 | Bacteria | 1765 |
| 447 | Ga0495632_0090953 | 3300046519 | Bacteria | 1446 |
| 448 | Ga0495637_0001728 | 3300046520 | Bacteria | 12538 |
| 449 | Ga0495637_0003277 | 3300046520 | Bacteria | 8615 |
| 450 | Ga0495637_0004668 | 3300046520 | Bacteria | 7076 |
| 451 | Ga0495637_0004680 | 3300046520 | Bacteria | 7064 |
| 452 | Ga0495637_0004823 | 3300046520 | Bacteria | 6954 |
| 453 | Ga0495637_0005107 | 3300046520 | Bacteria | 6732 |
| 454 | Ga0495637_0005172 | 3300046520 | Bacteria | 6683 |
| 455 | Ga0495637_0009869 | 3300046520 | Bacteria | 4642 |
| 456 | Ga0495637_0011171 | 3300046520 | Bacteria | 4319 |
| 457 | Ga0495637_0016642 | 3300046520 | Bacteria | 3435 |
| 458 | Ga0495637_0019095 | 3300046520 | Bacteria | 3171 |
| 459 | Ga0495637_0022273 | 3300046520 | Bacteria | 2891 |
| 460 | Ga0495637_0023277 | 3300046520 | Bacteria | 2817 |
| 461 | Ga0495637_0030032 | 3300046520 | Bacteria | 2413 |
| 462 | Ga0495643_0000197 | 3300046522 | Bacteria | 95489 |
| 463 | Ga0495643_0000344 | 3300046522 | Bacteria | 63135 |
| 464 | Ga0495643_0003510 | 3300046522 | Bacteria | 11416 |
| 465 | Ga0495643_0006716 | 3300046522 | Bacteria | 7531 |
| 466 | Ga0495643_0009107 | 3300046522 | Bacteria | 6219 |
| 467 | Ga0495643_0024178 | 3300046522 | Bacteria | 3448 |
| 468 | Ga0495643_0032116 | 3300046522 | Bacteria | 2916 |
| 469 | Ga0495643_0124790 | 3300046522 | Bacteria | 1297 |
| 470 | Ga0495644_0001046 | 3300046523 | Bacteria | 11535 |
| 471 | Ga0495644_0001271 | 3300046523 | Bacteria | 10359 |
| 472 | Ga0495644_0007710 | 3300046523 | Bacteria | 4150 |
| 473 | Ga0495644_0008800 | 3300046523 | Bacteria | 3882 |
| 474 | Ga0495644_0009183 | 3300046523 | Bacteria | 3809 |
| 475 | Ga0495648_0000679 | 3300046524 | Bacteria | 36303 |
| 476 | Ga0495648_0002981 | 3300046524 | Bacteria | 15191 |
| 477 | Ga0495648_0006163 | 3300046524 | Bacteria | 9831 |
| 478 | Ga0495648_0015264 | 3300046524 | Bacteria | 5585 |
| 479 | Ga0495648_0016039 | 3300046524 | Bacteria | 5409 |
| 480 | Ga0495648_0017930 | 3300046524 | Bacteria | 5038 |
| 481 | Ga0495648_0022217 | 3300046524 | Bacteria | 4372 |
| 482 | Ga0495648_0025483 | 3300046524 | Bacteria | 4002 |
| 483 | Ga0495648_0032407 | 3300046524 | Bacteria | 3429 |
| 484 | Ga0495648_0035719 | 3300046524 | Bacteria | 3218 |
| 485 | Ga0495648_0040632 | 3300046524 | Bacteria | 2947 |
| 486 | Ga0495648_0087021 | 3300046524 | Bacteria | 1761 |
| 487 | Ga0495666_0005963 | 3300046526 | Bacteria | 6143 |
| 488 | Ga0495666_0007854 | 3300046526 | Bacteria | 5342 |
| 489 | Ga0495666_0065205 | 3300046526 | Bacteria | 1737 |
| 490 | Ga0495642_0001171 | 3300046528 | Bacteria | 12049 |
| 491 | Ga0495642_0002264 | 3300046528 | Bacteria | 7869 |
| 492 | Ga0495642_0003292 | 3300046528 | Bacteria | 6385 |
| 493 | Ga0495652_0211054 | 3300046529 | Bacteria | 1466 |
| 494 | Ga0495654_0001750 | 3300046530 | Bacteria | 14546 |
| 495 | Ga0495654_0001797 | 3300046530 | Bacteria | 14286 |
| 496 | Ga0495654_0002117 | 3300046530 | Bacteria | 12962 |
| 497 | Ga0495654_0005462 | 3300046530 | Bacteria | 7376 |
| 498 | Ga0495654_0006180 | 3300046530 | Bacteria | 6843 |
| 499 | Ga0495654_0007154 | 3300046530 | Bacteria | 6265 |
| 500 | Ga0495654_0007720 | 3300046530 | Bacteria | 5988 |
| 501 | Ga0495654_0014074 | 3300046530 | Bacteria | 4265 |
| 502 | Ga0495654_0024461 | 3300046530 | Bacteria | 3119 |
| 503 | Ga0495654_0024851 | 3300046530 | Bacteria | 3090 |
| 504 | Ga0495654_0033498 | 3300046530 | Bacteria | 2599 |
| 505 | Ga0495654_0055779 | 3300046530 | Bacteria | 1911 |
| 506 | Ga0495654_0059569 | 3300046530 | Bacteria | 1838 |
| 507 | Ga0495654_0070413 | 3300046530 | Bacteria | 1658 |
| 508 | Ga0495654_0140078 | 3300046530 | Bacteria | 1078 |
| 509 | Ga0495586_0006337 | 3300046535 | Bacteria | 6322 |
| 510 | Ga0495587_0005500 | 3300046536 | Bacteria | 8264 |
| 511 | Ga0495587_0007573 | 3300046536 | Bacteria | 7023 |
| 512 | Ga0495609_0002518 | 3300046538 | Bacteria | 11243 |
| 513 | Ga0495609_0007681 | 3300046538 | Bacteria | 5354 |
| 514 | Ga0495609_0019508 | 3300046538 | Bacteria | 3136 |
| 515 | Ga0495609_0044832 | 3300046538 | Bacteria | 1983 |
| 516 | Ga0495609_0080478 | 3300046538 | Bacteria | 1424 |
| 517 | Ga0495609_0086719 | 3300046538 | Bacteria | 1364 |
| 518 | Ga0495597_0003741 | 3300046542 | Bacteria | 8675 |
| 519 | Ga0495597_0005474 | 3300046542 | Bacteria | 6717 |
| 520 | Ga0495597_0014704 | 3300046542 | Bacteria | 3723 |
| 521 | Ga0495597_0018196 | 3300046542 | Bacteria | 3299 |
| 522 | Ga0495597_0021608 | 3300046542 | Bacteria | 2990 |
| 523 | Ga0495597_0028064 | 3300046542 | Bacteria | 2577 |
| 524 | Ga0495597_0084035 | 3300046542 | Bacteria | 1358 |
| 525 | Ga0495645_0162104 | 3300046543 | Bacteria | 1545 |
| 526 | Ga0495622_0002723 | 3300046557 | Bacteria | 8460 |
| 527 | Ga0495622_0005121 | 3300046557 | Bacteria | 6073 |
| 528 | Ga0495622_0047534 | 3300046557 | Bacteria | 1993 |
| 529 | Ga0495622_0057333 | 3300046557 | Bacteria | 1805 |
| 530 | Ga0495622_0069293 | 3300046557 | Bacteria | 1628 |
| 531 | Ga0495633_0004035 | 3300046558 | Bacteria | 9497 |
| 532 | Ga0495633_0005819 | 3300046558 | Bacteria | 7435 |
| 533 | Ga0495633_0020239 | 3300046558 | Bacteria | 3350 |
| 534 | Ga0495633_0061675 | 3300046558 | Bacteria | 1755 |
| 535 | Ga0495633_0074783 | 3300046558 | Bacteria | 1578 |
| 536 | Ga0495656_0024139 | 3300046615 | Bacteria | 2398 |
| 537 | Ga0495668_0001129 | 3300046616 | Bacteria | 27359 |
| 538 | Ga0495668_0002393 | 3300046616 | Bacteria | 15548 |
| 539 | Ga0495668_0011216 | 3300046616 | Bacteria | 5379 |
| 540 | Ga0495634_0008471 | 3300046642 | Bacteria | 7650 |
| 541 | Ga0495634_0023826 | 3300046642 | Bacteria | 4300 |
| 542 | Ga0495611_0001084 | 3300046648 | Bacteria | 14351 |
| 543 | Ga0495611_0008804 | 3300046648 | Bacteria | 4269 |
| 544 | Ga0495611_0018224 | 3300046648 | Bacteria | 3009 |
| 545 | Ga0495611_0032834 | 3300046648 | Bacteria | 2289 |
| 546 | Ga0495611_0042105 | 3300046648 | Bacteria | 2038 |
| 547 | Ga0495625_0003953 | 3300046660 | Bacteria | 14244 |
| 548 | Ga0495625_0006328 | 3300046660 | Bacteria | 10584 |
| 549 | Ga0495625_0007050 | 3300046660 | Bacteria | 9878 |
| 550 | Ga0495625_0011065 | 3300046660 | Bacteria | 7392 |
| 551 | Ga0495625_0011399 | 3300046660 | Bacteria | 7255 |
| 552 | Ga0495625_0024389 | 3300046660 | Bacteria | 4604 |
| 553 | Ga0495625_0051744 | 3300046660 | Bacteria | 2943 |
| 554 | Ga0495625_0091901 | 3300046660 | Bacteria | 2097 |
| 555 | Ga0495625_0159788 | 3300046660 | Bacteria | 1510 |
| 556 | Ga0495625_0211104 | 3300046660 | Bacteria | 1276 |
| 557 | Ga0495635_0011238 | 3300046663 | Bacteria | 6277 |
| 558 | Ga0495635_0015853 | 3300046663 | Bacteria | 5264 |
| 559 | Ga0495659_0001680 | 3300046664 | Bacteria | 7418 |
| 560 | Ga0495659_0002221 | 3300046664 | Bacteria | 6313 |
| 561 | Ga0495659_0019940 | 3300046664 | Bacteria | 2247 |
| 562 | Ga0495659_0036456 | 3300046664 | Bacteria | 1737 |
| 563 | Ga0495661_0001354 | 3300046665 | Bacteria | 20741 |
| 564 | Ga0495661_0009797 | 3300046665 | Bacteria | 6556 |
| 565 | Ga0495661_0010223 | 3300046665 | Bacteria | 6412 |
| 566 | Ga0495661_0064894 | 3300046665 | Bacteria | 2152 |
| 567 | Ga0495661_0065744 | 3300046665 | Bacteria | 2136 |
| 568 | Ga0495661_0116326 | 3300046665 | Bacteria | 1483 |
| 569 | Ga0495588_0003321 | 3300046674 | Bacteria | 6982 |
| 570 | Ga0495588_0007109 | 3300046674 | Bacteria | 5075 |
| 571 | Ga0495588_0012513 | 3300046674 | Bacteria | 4013 |
| 572 | Ga0495588_0054506 | 3300046674 | Bacteria | 2063 |
| 573 | Ga0495623_0018761 | 3300046679 | Bacteria | 4466 |
| 574 | Ga0495646_0003357 | 3300046680 | Bacteria | 9956 |
| 575 | Ga0495646_0007624 | 3300046680 | Bacteria | 6876 |
| 576 | Ga0495669_0000275 | 3300046684 | Bacteria | 29419 |
| 577 | Ga0495669_0014283 | 3300046684 | Bacteria | 3395 |
| 578 | Ga0495613_0007674 | 3300046689 | Bacteria | 8026 |
| 579 | Ga0495613_0019593 | 3300046689 | Bacteria | 5042 |
| 580 | Ga0495613_0032984 | 3300046689 | Bacteria | 3848 |
| 581 | Ga0495670_0002096 | 3300046691 | Bacteria | 9838 |
| 582 | Ga0495670_0002438 | 3300046691 | Bacteria | 9187 |
| 583 | Ga0495670_0002606 | 3300046691 | Bacteria | 8907 |
| 584 | Ga0495670_0003560 | 3300046691 | Bacteria | 7652 |
| 585 | Ga0495670_0017283 | 3300046691 | Bacteria | 3548 |
| 586 | Ga0495670_0025591 | 3300046691 | Bacteria | 2919 |
| 587 | Ga0495670_0035586 | 3300046691 | Bacteria | 2481 |
| 588 | Ga0495670_0049803 | 3300046691 | Bacteria | 2096 |
| 589 | Ga0495670_0062467 | 3300046691 | Bacteria | 1874 |
| 590 | Ga0495671_0002446 | 3300046692 | Bacteria | 11721 |
| 591 | Ga0495671_0002796 | 3300046692 | Bacteria | 10915 |
| 592 | Ga0495671_0002816 | 3300046692 | Bacteria | 10881 |
| 593 | Ga0495671_0005620 | 3300046692 | Bacteria | 7313 |
| 594 | Ga0495671_0006769 | 3300046692 | Bacteria | 6594 |
| 595 | Ga0495671_0007523 | 3300046692 | Bacteria | 6203 |
| 596 | Ga0495671_0009714 | 3300046692 | Bacteria | 5363 |
| 597 | Ga0495671_0012989 | 3300046692 | Bacteria | 4530 |
| 598 | Ga0495671_0021336 | 3300046692 | Bacteria | 3404 |
| 599 | Ga0495671_0026252 | 3300046692 | Bacteria | 3021 |
| 600 | Ga0495671_0034544 | 3300046692 | Bacteria | 2570 |
| 601 | Ga0495671_0077052 | 3300046692 | Bacteria | 1634 |
| 602 | Ga0495671_0087232 | 3300046692 | Bacteria | 1528 |
| 603 | Ga0495649_0001197 | 3300046694 | Bacteria | 20009 |
| 604 | Ga0495649_0003408 | 3300046694 | Bacteria | 10744 |
| 605 | Ga0495649_0003507 | 3300046694 | Bacteria | 10559 |
| 606 | Ga0495649_0005650 | 3300046694 | Bacteria | 7896 |
| 607 | Ga0495649_0009983 | 3300046694 | Bacteria | 5612 |
| 608 | Ga0495649_0013051 | 3300046694 | Bacteria | 4804 |
| 609 | Ga0495649_0017655 | 3300046694 | Bacteria | 4023 |
| 610 | Ga0495649_0018688 | 3300046694 | Bacteria | 3896 |
| 611 | Ga0495649_0026244 | 3300046694 | Bacteria | 3241 |
| 612 | Ga0495649_0032363 | 3300046694 | Bacteria | 2880 |
| 613 | Ga0495649_0040829 | 3300046694 | Bacteria | 2538 |
| 614 | Ga0495649_0063351 | 3300046694 | Bacteria | 1986 |
| 615 | Ga0495649_0141158 | 3300046694 | Bacteria | 1268 |
| 616 | Ga0495589_0000573 | 3300046794 | Bacteria | 25427 |
| 617 | Ga0495589_0002034 | 3300046794 | Bacteria | 11443 |
| 618 | Ga0495589_0002449 | 3300046794 | Bacteria | 10419 |
| 619 | Ga0495589_0006573 | 3300046794 | Bacteria | 6127 |
| 620 | Ga0495589_0011999 | 3300046794 | Bacteria | 4493 |
| 621 | Ga0495589_0013119 | 3300046794 | Bacteria | 4277 |
| 622 | Ga0495589_0013802 | 3300046794 | Bacteria | 4167 |
| 623 | Ga0495589_0016586 | 3300046794 | Bacteria | 3784 |
| 624 | Ga0495589_0030713 | 3300046794 | Bacteria | 2705 |
| 625 | Ga0495589_0043032 | 3300046794 | Bacteria | 2249 |
| 626 | Ga0495600_0006569 | 3300046809 | Bacteria | 7078 |
| 627 | Ga0495600_0047768 | 3300046809 | Bacteria | 2792 |
| 628 | Ga0495600_0059004 | 3300046809 | Bacteria | 2506 |
| 629 | Ga0495660_0009794 | 3300046810 | Bacteria | 5581 |
| 630 | Ga0495660_0014300 | 3300046810 | Bacteria | 4595 |
| 631 | Ga0495660_0014620 | 3300046810 | Bacteria | 4539 |
| 632 | Ga0495660_0020607 | 3300046810 | Bacteria | 3779 |
| 633 | Ga0495660_0021169 | 3300046810 | Bacteria | 3725 |
| 634 | Ga0495660_0025778 | 3300046810 | Bacteria | 3336 |
| 635 | Ga0495660_0050427 | 3300046810 | Bacteria | 2267 |
| 636 | Ga0495660_0054307 | 3300046810 | Bacteria | 2170 |
| 637 | Ga0495660_0054765 | 3300046810 | Bacteria | 2160 |
| 638 | Ga0495660_0070638 | 3300046810 | Bacteria | 1852 |
| 639 | Ga0495660_0110059 | 3300046810 | Bacteria | 1406 |
| 640 | Ga0495581_0009732 | 3300047315 | Bacteria | 5563 |
| 641 | Ga0495604_0005000 | 3300047317 | Bacteria | 10499 |
| 642 | Ga0495604_0008683 | 3300047317 | Bacteria | 8031 |
| 643 | Ga0495604_0021610 | 3300047317 | Bacteria | 5138 |
| 644 | Ga0495636_0019518 | 3300047318 | Bacteria | 2725 |
| 645 | Ga0495674_0040813 | 3300047319 | Bacteria | 4148 |
| 646 | Ga0495672_0002646 | 3300047320 | Bacteria | 16164 |
| 647 | Ga0495672_0003540 | 3300047320 | Bacteria | 13298 |
| 648 | Ga0495672_0004515 | 3300047320 | Bacteria | 11359 |
| 649 | Ga0495672_0005186 | 3300047320 | Bacteria | 10389 |
| 650 | Ga0495672_0005696 | 3300047320 | Bacteria | 9813 |
| 651 | Ga0495672_0011462 | 3300047320 | Bacteria | 6256 |
| 652 | Ga0495672_0013136 | 3300047320 | Bacteria | 5728 |
| 653 | Ga0495672_0014058 | 3300047320 | Bacteria | 5496 |
| 654 | Ga0495672_0023425 | 3300047320 | Bacteria | 3996 |
| 655 | Ga0495672_0033995 | 3300047320 | Bacteria | 3154 |
| 656 | Ga0495672_0042348 | 3300047320 | Bacteria | 2746 |
| 657 | Ga0495672_0141604 | 3300047320 | Bacteria | 1255 |
| 658 | Ga0495676_0003332 | 3300047321 | Bacteria | 14524 |
| 659 | Ga0495676_0039359 | 3300047321 | Bacteria | 3916 |
| 660 | Ga0495680_0005487 | 3300047322 | Bacteria | 11923 |
| 661 | Ga0495680_0013007 | 3300047322 | Bacteria | 7281 |
| 662 | Ga0495680_0015346 | 3300047322 | Bacteria | 6609 |
| 663 | Ga0495680_0017202 | 3300047322 | Bacteria | 6184 |
| 664 | Ga0495680_0049858 | 3300047322 | Bacteria | 3276 |
| 665 | Ga0495683_0001176 | 3300047323 | Bacteria | 17863 |
| 666 | Ga0495683_0003293 | 3300047323 | Bacteria | 9441 |
| 667 | Ga0495683_0005969 | 3300047323 | Bacteria | 6689 |
| 668 | Ga0495683_0014780 | 3300047323 | Bacteria | 4065 |
| 669 | Ga0495683_0015298 | 3300047323 | Bacteria | 3994 |
| 670 | Ga0495683_0040849 | 3300047323 | Bacteria | 2342 |
| 671 | Ga0495683_0056229 | 3300047323 | Bacteria | 1957 |
| 672 | Ga0495683_0069250 | 3300047323 | Bacteria | 1734 |
| 673 | Ga0495683_0072992 | 3300047323 | Bacteria | 1683 |
| 674 | Ga0495683_0125733 | 3300047323 | Bacteria | 1213 |
| 675 | Ga0495687_002029 | 3300047443 | Bacteria | 17125 |
| 676 | Ga0495687_002352 | 3300047443 | Bacteria | 15339 |
| 677 | Ga0495687_005636 | 3300047443 | Bacteria | 7911 |
| 678 | Ga0495687_017951 | 3300047443 | Bacteria | 3511 |
| 679 | Ga0495675_0034124 | 3300047444 | Bacteria | 3247 |
| 680 | Ga0495675_0221592 | 3300047444 | Bacteria | 1144 |
| 681 | Ga0495677_0024480 | 3300047445 | Bacteria | 2189 |
| 682 | Ga0495677_0025495 | 3300047445 | Bacteria | 2145 |
| 683 | Ga0495679_001001 | 3300047446 | Bacteria | 17395 |
| 684 | Ga0495679_001762 | 3300047446 | Bacteria | 11881 |
| 685 | Ga0495679_003869 | 3300047446 | Bacteria | 7085 |
| 686 | Ga0495679_004363 | 3300047446 | Bacteria | 6555 |
| 687 | Ga0495679_004730 | 3300047446 | Bacteria | 6181 |
| 688 | Ga0495679_005012 | 3300047446 | Bacteria | 5959 |
| 689 | Ga0495679_010118 | 3300047446 | Bacteria | 3725 |
| 690 | Ga0495679_010261 | 3300047446 | Bacteria | 3687 |
| 691 | Ga0495685_001865 | 3300047447 | Bacteria | 6511 |
| 692 | Ga0495685_041915 | 3300047447 | Bacteria | 1563 |
| 693 | Ga0495673_0001224 | 3300047469 | Bacteria | 21295 |
| 694 | Ga0495673_0001229 | 3300047469 | Bacteria | 21226 |
| 695 | Ga0495673_0002473 | 3300047469 | Bacteria | 12979 |
| 696 | Ga0495673_0002511 | 3300047469 | Bacteria | 12837 |
| 697 | Ga0495673_0003744 | 3300047469 | Bacteria | 9870 |
| 698 | Ga0495673_0005069 | 3300047469 | Bacteria | 8062 |
| 699 | Ga0495673_0010542 | 3300047469 | Bacteria | 5018 |
| 700 | Ga0495673_0013881 | 3300047469 | Bacteria | 4208 |
| 701 | Ga0495673_0015870 | 3300047469 | Bacteria | 3867 |
| 702 | Ga0495673_0023468 | 3300047469 | Bacteria | 2999 |
| 703 | Ga0495673_0042606 | 3300047469 | Bacteria | 2036 |
| 704 | Ga0495681_0001719 | 3300047470 | Bacteria | 16182 |
| 705 | Ga0495681_0002805 | 3300047470 | Bacteria | 12330 |
| 706 | Ga0495681_0003994 | 3300047470 | Bacteria | 10153 |
| 707 | Ga0495681_0004222 | 3300047470 | Bacteria | 9855 |
| 708 | Ga0495681_0005833 | 3300047470 | Bacteria | 8176 |
| 709 | Ga0495681_0006731 | 3300047470 | Bacteria | 7497 |
| 710 | Ga0495681_0009298 | 3300047470 | Bacteria | 6069 |
| 711 | Ga0495681_0011363 | 3300047470 | Bacteria | 5306 |
| 712 | Ga0495681_0013761 | 3300047470 | Bacteria | 4677 |
| 713 | Ga0495681_0014606 | 3300047470 | Bacteria | 4488 |
| 714 | Ga0495681_0014696 | 3300047470 | Bacteria | 4472 |
| 715 | Ga0495681_0019667 | 3300047470 | Bacteria | 3679 |
| 716 | Ga0495681_0022097 | 3300047470 | Bacteria | 3412 |
| 717 | Ga0495681_0023475 | 3300047470 | Bacteria | 3275 |
| 718 | Ga0495681_0036762 | 3300047470 | Bacteria | 2418 |
| 719 | Ga0495684_0034197 | 3300047471 | Bacteria | 3900 |
| 720 | Ga0495684_0088038 | 3300047471 | Bacteria | 2353 |
| 721 | Ga0495686_0003667 | 3300047472 | Bacteria | 13139 |
| 722 | Ga0495686_0007987 | 3300047472 | Bacteria | 7846 |
| 723 | Ga0495686_0015337 | 3300047472 | Bacteria | 5237 |
| 724 | Ga0495686_0153363 | 3300047472 | Bacteria | 1351 |
| 725 | Ga0495686_0163620 | 3300047472 | Bacteria | 1298 |
| 726 | Ga0495593_0010781 | 3300047673 | Bacteria | 5269 |
| 727 | Ga0495593_0028808 | 3300047673 | Bacteria | 3049 |
| 728 | Ga0495593_0031196 | 3300047673 | Bacteria | 2913 |
| 729 | Ga0495593_0040439 | 3300047673 | Bacteria | 2510 |
| 730 | Ga0495593_0069296 | 3300047673 | Bacteria | 1834 |
| 731 | Ga0495602_0024294 | 3300048088 | Bacteria | 5881 |
| 732 | Ga0495626_0001348 | 3300048091 | Bacteria | 19838 |
| 733 | Ga0495626_0002025 | 3300048091 | Bacteria | 14887 |
| 734 | Ga0495626_0002432 | 3300048091 | Bacteria | 12924 |
| 735 | Ga0495626_0002902 | 3300048091 | Bacteria | 11418 |
| 736 | Ga0495626_0005078 | 3300048091 | Bacteria | 7847 |
| 737 | Ga0495626_0006667 | 3300048091 | Bacteria | 6546 |
| 738 | Ga0495626_0010145 | 3300048091 | Bacteria | 5053 |
| 739 | Ga0495626_0014757 | 3300048091 | Bacteria | 4016 |
| 740 | Ga0495626_0060967 | 3300048091 | Bacteria | 1717 |
| 741 | Ga0496102_0002488 | 3300048905 | Bacteria | 15730 |
| 742 | Ga0496103_0007679 | 3300048906 | Bacteria | 6413 |
| 743 | Ga0496105_0035042 | 3300048908 | Bacteria | 4130 |
| 744 | Ga0496106_0085807 | 3300048909 | Bacteria | 2424 |
| 745 | Ga0496110_0081238 | 3300048913 | Bacteria | 2889 |
| 746 | Ga0496110_0168663 | 3300048913 | Bacteria | 1986 |
| 747 | Ga0496110_0177671 | 3300048913 | Bacteria | 1933 |
| 748 | Ga0496114_0007200 | 3300048917 | Bacteria | 8781 |
| 749 | Ga0496114_0200099 | 3300048917 | Bacteria | 1750 |
| 750 | Ga0496115_0151116 | 3300048918 | Bacteria | 1918 |
| 751 | Ga0496116_0000239 | 3300048919 | Bacteria | 100609 |
| 752 | Ga0496116_0004006 | 3300048919 | Bacteria | 14285 |
| 753 | Ga0496116_0005049 | 3300048919 | Bacteria | 12417 |
| 754 | Ga0496116_0015910 | 3300048919 | Bacteria | 5917 |
| 755 | Ga0496116_0015993 | 3300048919 | Bacteria | 5897 |
| 756 | Ga0496116_0020611 | 3300048919 | Bacteria | 5001 |
| 757 | Ga0496116_0074385 | 3300048919 | Bacteria | 2137 |
| 758 | Ga0496116_0135076 | 3300048919 | Bacteria | 1399 |
| 759 | Ga0496117_0000553 | 3300048920 | Bacteria | 61439 |
| 760 | Ga0496117_0000656 | 3300048920 | Bacteria | 55325 |
| 761 | Ga0496117_0001985 | 3300048920 | Bacteria | 27171 |
| 762 | Ga0496117_0003511 | 3300048920 | Bacteria | 18163 |
| 763 | Ga0496117_0017035 | 3300048920 | Bacteria | 6086 |
| 764 | Ga0496117_0022375 | 3300048920 | Bacteria | 5071 |
| 765 | Ga0496117_0022545 | 3300048920 | Bacteria | 5048 |
| 766 | Ga0496117_0039599 | 3300048920 | Bacteria | 3476 |
| 767 | Ga0496117_0044736 | 3300048920 | Bacteria | 3204 |
| 768 | Ga0496117_0052604 | 3300048920 | Bacteria | 2867 |
| 769 | Ga0496117_0055441 | 3300048920 | Bacteria | 2769 |
| 770 | Ga0496117_0070943 | 3300048920 | Bacteria | 2336 |
| 771 | Ga0496117_0102780 | 3300048920 | Bacteria | 1802 |
| 772 | Ga0496117_0113198 | 3300048920 | Bacteria | 1685 |
| 773 | Ga0496118_0000526 | 3300048921 | Bacteria | 62798 |
| 774 | Ga0496118_0001278 | 3300048921 | Bacteria | 38517 |
| 775 | Ga0496118_0004135 | 3300048921 | Bacteria | 17546 |
| 776 | Ga0496118_0014238 | 3300048921 | Bacteria | 7458 |
| 777 | Ga0496118_0019644 | 3300048921 | Bacteria | 6030 |
| 778 | Ga0496118_0020963 | 3300048921 | Bacteria | 5773 |
| 779 | Ga0496118_0026316 | 3300048921 | Bacteria | 4959 |
| 780 | Ga0496118_0033192 | 3300048921 | Bacteria | 4239 |
| 781 | Ga0496118_0053464 | 3300048921 | Bacteria | 3069 |
| 782 | Ga0496118_0064211 | 3300048921 | Bacteria | 2695 |
| 783 | Ga0496119_0019142 | 3300048922 | Bacteria | 5058 |
| 784 | Ga0496119_0024432 | 3300048922 | Bacteria | 4251 |
| 785 | Ga0496119_0049182 | 3300048922 | Bacteria | 2609 |
| 786 | Ga0496120_0004601 | 3300048923 | Bacteria | 11469 |
| 787 | Ga0496120_0012012 | 3300048923 | Bacteria | 5918 |
| 788 | Ga0496120_0015570 | 3300048923 | Bacteria | 5009 |
| 789 | Ga0496121_0000262 | 3300048924 | Bacteria | 109686 |
| 790 | Ga0496121_0020525 | 3300048924 | Bacteria | 6531 |
| 791 | Ga0496121_0028833 | 3300048924 | Bacteria | 5155 |
| 792 | Ga0496121_0036664 | 3300048924 | Bacteria | 4366 |
| 793 | Ga0496121_0046691 | 3300048924 | Bacteria | 3704 |
| 794 | Ga0496121_0078845 | 3300048924 | Bacteria | 2616 |
| 795 | Ga0496121_0082725 | 3300048924 | Bacteria | 2536 |
| 796 | Ga0496121_0122361 | 3300048924 | Bacteria | 1962 |
| 797 | Ga0496122_0004903 | 3300048925 | Bacteria | 16231 |
| 798 | Ga0496122_0005619 | 3300048925 | Bacteria | 14831 |
| 799 | Ga0496122_0024048 | 3300048925 | Bacteria | 5343 |
| 800 | Ga0496122_0038118 | 3300048925 | Bacteria | 3856 |
| 801 | Ga0496122_0053358 | 3300048925 | Bacteria | 3048 |
| 802 | Ga0496122_0080141 | 3300048925 | Bacteria | 2278 |
| 803 | Ga0496123_0001108 | 3300048926 | Bacteria | 40430 |
| 804 | Ga0496123_0001256 | 3300048926 | Bacteria | 36483 |
| 805 | Ga0496123_0018549 | 3300048926 | Bacteria | 5526 |
| 806 | Ga0496123_0032364 | 3300048926 | Bacteria | 3788 |
| 807 | Ga0496123_0037338 | 3300048926 | Bacteria | 3430 |
| 808 | Ga0496123_0042502 | 3300048926 | Bacteria | 3135 |
| 809 | Ga0496123_0072264 | 3300048926 | Bacteria | 2147 |
| 810 | Ga0496124_0001363 | 3300048927 | Bacteria | 36583 |
| 811 | Ga0496124_0002451 | 3300048927 | Bacteria | 24268 |
| 812 | Ga0496124_0015442 | 3300048927 | Bacteria | 7318 |
| 813 | Ga0496124_0026041 | 3300048927 | Bacteria | 5281 |
| 814 | Ga0496124_0039263 | 3300048927 | Bacteria | 4104 |
| 815 | Ga0496124_0041424 | 3300048927 | Bacteria | 3974 |
| 816 | Ga0496124_0049513 | 3300048927 | Bacteria | 3584 |
| 817 | Ga0496124_0053423 | 3300048927 | Bacteria | 3424 |
| 818 | Ga0496124_0097426 | 3300048927 | Bacteria | 2388 |
| 819 | Ga0496124_0138180 | 3300048927 | Bacteria | 1926 |
| 820 | Ga0496124_0259787 | 3300048927 | Bacteria | 1279 |
| 821 | Ga0496125_0000240 | 3300048928 | Bacteria | 112092 |
| 822 | Ga0496125_0012262 | 3300048928 | Bacteria | 8523 |
| 823 | Ga0496125_0012345 | 3300048928 | Bacteria | 8488 |
| 824 | Ga0496125_0015428 | 3300048928 | Bacteria | 7390 |
| 825 | Ga0496125_0017739 | 3300048928 | Bacteria | 6775 |
| 826 | Ga0496125_0020268 | 3300048928 | Bacteria | 6243 |
| 827 | Ga0496125_0029174 | 3300048928 | Bacteria | 4963 |
| 828 | Ga0496125_0029574 | 3300048928 | Bacteria | 4920 |
| 829 | Ga0496125_0032238 | 3300048928 | Bacteria | 4657 |
| 830 | Ga0496125_0033127 | 3300048928 | Bacteria | 4578 |
| 831 | Ga0496125_0050271 | 3300048928 | Bacteria | 3453 |
| 832 | Ga0496126_0025027 | 3300048929 | Bacteria | 5752 |
| 833 | Ga0496126_0119444 | 3300048929 | Bacteria | 2287 |
| 834 | Ga0496126_0131418 | 3300048929 | Bacteria | 2163 |
| 835 | Ga0496126_0202255 | 3300048929 | Bacteria | 1676 |
| 836 | Ga0495678_002970 | 3300049459 | Bacteria | 10824 |
| 837 | Ga0495678_003267 | 3300049459 | Bacteria | 10131 |
| 838 | Ga0495678_004677 | 3300049459 | Bacteria | 7840 |
| 839 | Ga0495678_007795 | 3300049459 | Bacteria | 5509 |
| 840 | Ga0495678_008089 | 3300049459 | Bacteria | 5357 |
| 841 | Ga0495678_009940 | 3300049459 | Bacteria | 4661 |
| 842 | Ga0495678_011100 | 3300049459 | Bacteria | 4328 |
| 843 | Ga0495678_018318 | 3300049459 | Bacteria | 3152 |
| 844 | Ga0495678_022269 | 3300049459 | Bacteria | 2773 |
| 845 | Ga0495678_023567 | 3300049459 | Bacteria | 2672 |
| 846 | Ga0495678_036931 | 3300049459 | Bacteria | 1989 |
| 847 | Ga0495678_037944 | 3300049459 | Bacteria | 1953 |
| 848 | Ga0495678_061126 | 3300049459 | Bacteria | 1414 |
| 849 | Ga0495682_0000589 | 3300049460 | Bacteria | 24714 |
| 850 | Ga0495682_0000608 | 3300049460 | Bacteria | 24165 |
| 851 | Ga0495682_0002668 | 3300049460 | Bacteria | 8327 |
| 852 | Ga0495682_0013053 | 3300049460 | Bacteria | 3168 |
| 853 | Ga0495682_0077162 | 3300049460 | Bacteria | 1198 |
| 854 | Ga0501241_001805 | 3300049758 | Bacteria | 4221 |
| 855 | nmdc:mga00v17_105504_c1 | 3300050491 | Bacteria | 1783 |
| 856 | nmdc:mga00v17_112636_c1 | 3300050491 | Bacteria | 1727 |
| 857 | nmdc:mga00v17_39314_c1 | 3300050491 | Bacteria | 2833 |
| 858 | nmdc:mga08x19_239922_c1 | 3300050514 | Bacteria | 1249 |
| 859 | nmdc:mga08x19_387042_c1 | 3300050514 | Bacteria | 980 |
| 860 | nmdc:mga0sz30_39533_c1 | 3300050516 | Bacteria | 1979 |
| 861 | Ga0500572_001103 | 3300053111 | Bacteria | 7889 |
| 862 | Ga0500634_0004336 | 3300053161 | Bacteria | 6532 |
| 863 | 2511253912 | 2511231004 | Bacteria | 6669789 |
| 864 | 2511263571 | 2511231006 | Bacteria | 6794709 |
| 865 | 2511272622 | 2511231007 | Bacteria | 6306603 |
| 866 | 2511280634 | 2511231008 | Bacteria | 6624100 |
| 867 | 2511288901 | 2511231010 | Bacteria | 6373152 |
| 868 | 2511293853 | 2511231011 | Bacteria | 6149768 |
| 869 | 2511300652 | 2511231012 | Bacteria | 6738011 |
| 870 | 2511312153 | 2511231014 | Bacteria | 6462302 |
| 871 | 2511318579 | 2511231015 | Bacteria | 6598026 |
| 872 | 2511323737 | 2511231016 | Bacteria | 6704427 |
| 873 | 2511332770 | 2511231017 | Bacteria | 6503007 |
| 874 | 2511336224 | 2511231018 | Bacteria | 6436256 |
| 875 | 2511345138 | 2511231019 | Bacteria | 6520662 |
| 876 | 2511348393 | 2511231020 | Bacteria | 6115223 |
| 877 | 2511356148 | 2511231021 | Bacteria | 7302637 |
| 878 | 2511361369 | 2511231022 | Bacteria | 6719296 |
| 879 | 2511368512 | 2511231023 | Bacteria | 6808468 |
| 880 | 2511411191 | 2511231031 | Bacteria | 6558529 |
| 881 | 2512327865 | 2512047018 | Bacteria | 6663241 |
| 882 | 2555667295 | 2554235341 | Bacteria | 6867980 |
| 883 | 2583789920 | 2582580891 | Bacteria | 6800976 |
| 884 | 2597855539 | 2597489887 | Bacteria | 6666321 |
| 885 | 2599356518 | 2599185160 | Bacteria | 6844013 |
| 886 | 2599363454 | 2599185161 | Bacteria | 6960462 |
| 887 | 2599369594 | 2599185162 | Bacteria | 6957254 |
| 888 | 2599376563 | 2599185163 | Bacteria | 6995158 |
| 889 | 2599381623 | 2599185164 | Bacteria | 6841688 |
| 890 | 2599388233 | 2599185165 | Bacteria | 6843250 |
| 891 | 2599395241 | 2599185166 | Bacteria | 6959206 |
| 892 | 2599398975 | 2599185167 | Bacteria | 6353609 |
| 893 | 2599407006 | 2599185168 | Bacteria | 6997636 |
| 894 | 2599451026 | 2599185179 | Bacteria | 6611171 |
| 895 | 2599463351 | 2599185181 | Bacteria | 6844519 |
| 896 | 2599469301 | 2599185182 | Bacteria | 6883168 |
| 897 | 2599485442 | 2599185185 | Bacteria | 6652270 |
| 898 | 2599492368 | 2599185186 | Bacteria | 6831633 |
| 899 | 2599514028 | 2599185190 | Bacteria | 6285678 |
| 900 | 2599518625 | 2599185191 | Bacteria | 6297582 |
| 901 | 2599806574 | 2599185257 | Bacteria | 6492581 |
| 902 | 2599882542 | 2599185288 | Bacteria | 6666191 |
| 903 | 2599893637 | 2599185290 | Bacteria | 6289611 |
| 904 | 2599950540 | 2599185303 | Bacteria | 6512725 |
| 905 | 2600215980 | 2599185356 | Bacteria | 6843884 |
| 906 | 2600368428 | 2600254931 | Bacteria | 6734225 |
| 907 | 2601776147 | 2600255313 | Bacteria | 6842543 |
| 908 | 2606076802 | 2603880185 | Bacteria | 6379190 |
| 909 | 2606128784 | 2603880199 | Bacteria | 6377649 |
| 910 | 2621302288 | 2619619299 | Bacteria | 6649820 |
| 911 | 2624478101 | 2623620443 | Bacteria | 6427864 |
| 912 | 2624489645 | 2623620446 | Bacteria | 6500345 |
| 913 | 2643840864 | 2643221565 | Bacteria | 6216018 |
| 914 | 2643955040 | 2643221589 | Bacteria | 6250934 |
| 915 | 2644024674 | 2643221602 | Bacteria | 6249926 |
| 916 | 2644189579 | 2643221633 | Bacteria | 6733554 |
| 917 | 2671100094 | 2667528171 | Bacteria | 6900659 |
| 918 | 2671772225 | 2671180172 | Bacteria | 6495783 |
| 919 | 2715749091 | 2713897148 | Bacteria | 5883533 |
| 920 | 2715754361 | 2713897149 | Bacteria | 6506249 |
| 921 | 2718632046 | 2718217725 | Bacteria | 5758958 |
| 922 | 2738674952 | 2738541265 | Bacteria | 6594665 |
| 923 | 2738753345 | 2738541282 | Bacteria | 6593925 |
| 924 | 2738808036 | 2738541294 | Bacteria | 6925949 |
| 925 | 2738862544 | 2738541303 | Bacteria | 6591772 |
| 926 | 2738895396 | 2738541309 | Bacteria | 6926455 |
| 927 | 2739197909 | 2738543004 | Bacteria | 6381073 |
| 928 | 2739260432 | 2738543015 | Bacteria | 6750701 |
| 929 | 2739311155 | 2738543025 | Bacteria | 6600348 |
| 930 | 2743734958 | 2740892503 | Bacteria | 6855563 |
| 931 | 2774119680 | 2773857670 | Bacteria | 6407454 |
| 932 | 2784261168 | 2784132063 | Bacteria | 6262788 |
| 933 | 2784316247 | 2784132072 | Bacteria | 6596533 |
| 934 | 2808931280 | 2808606377 | Bacteria | 6646337 |
| 935 | 2808953230 | 2808606381 | Bacteria | 6646461 |
| 936 | 2808955738 | 2808606382 | Bacteria | 6841132 |
| 937 | 2808976780 | 2808606385 | Bacteria | 6711065 |
| 938 | 2808991782 | 2808606388 | Bacteria | 6706662 |
| 939 | 2809217863 | 2808606445 | Bacteria | 6057339 |
| 940 | 2817488285 | 2816332298 | Bacteria | 6852809 |
| 941 | 2819657109 | 2818991456 | Bacteria | 6123676 |
| 942 | 2819705090 | 2818991464 | Bacteria | 6907494 |
| 943 | 2834032326 | 2834028612 | Bacteria | 6354979 |
| 944 | 2842846478 | 2842843487 | Bacteria | 6004777 |
| 945 | 2844667772 | 2844665904 | Bacteria | 6817974 |
| 946 | 2852616946 | 2852612431 | Bacteria | 6885235 |
| 947 | 2852672065 | 2852667396 | Bacteria | 6885555 |
| 948 | 2860344871 | 2860339153 | Bacteria | 6846989 |
| 949 | 2878030046 | 2878029506 | Bacteria | 6418441 |
| 950 | 2904552367 | 2904550169 | Bacteria | 6221258 |
| 951 | 2908446898 | 2908446538 | Bacteria | 6829095 |
| 952 | 2917071043 | 2917070673 | Bacteria | 6868303 |
| 953 | 2919066271 | 2919063839 | Bacteria | 6302690 |
| 954 | 2919389897 | 2919385768 | Bacteria | 5897293 |
| 955 | 2919459857 | 2919456309 | Bacteria | 6586567 |
| 956 | 2919488823 | 2919487758 | Bacteria | 5929766 |
| 957 | 2923153951 | 2923153595 | Bacteria | 6870622 |
| 958 | 2931391257 | 2931390751 | Bacteria | 6273349 |
| 959 | 2931398718 | 2931396565 | Bacteria | 7251677 |
| 960 | 2935358871 | 2935353572 | Unclassified | 6955622 |
| 961 | 2939640981 | 2939636861 | Bacteria | 6297853 |
| 962 | 2939652111 | 2939651529 | Bacteria | 5895393 |
| 963 | 2969304835 | 2969304461 | Bacteria | 6601805 |
| 964 | 2974293466 | 2974289157 | Bacteria | 6080362 |
| 965 | 2984292106 | 2984286254 | Bacteria | 6702062 |
| 966 | 2998140339 | 2998139840 | Bacteria | 6073514 |
| 967 | 3007397967 | 3007395558 | Bacteria | 6755444 |
| 968 | 3007419900 | 3007419365 | Bacteria | 7026924 |
| 969 | 3007517755 | 3007511990 | Bacteria | 6481491 |
| 970 | 3007617418 | 3007614139 | Bacteria | 6053559 |
| 971 | 3007625332 | 3007619802 | Bacteria | 6411688 |
| 972 | 3007723805 | 3007718800 | Bacteria | 5971527 |
| 973 | 3007864454 | 3007861166 | Bacteria | 6045338 |
| 974 | 637317694 | 637000220 | Bacteria | 7074893 |
| 975 | 8015688200 | 8015687852 | Bacteria | 6613826 |
| 976 | 8019770194 | 8019769354 | Bacteria | 6924660 |
| 977 | 8019777220 | 8019775933 | Bacteria | 6858656 |
| 978 | 8054291488 | 8054285046 | Bacteria | 6919322 |
| 979 | 8054932979 | 8054929484 | Bacteria | 5599761 |
| 980 | 8055771302 | 8055770955 | Bacteria | 6827675 |
| 981 | 8055818235 | 8055817908 | Bacteria | 6609162 |
| 982 | 8056126350 | 8056125926 | Bacteria | 6228218 |
| 983 | 8056158396 | 8056155041 | Bacteria | 6486948 |
| 984 | 8056170704 | 8056166840 | Bacteria | 5820959 |
| 985 | 8056179677 | 8056177738 | Bacteria | 6748268 |
| 986 | 8056572203 | 8056569372 | Bacteria | 5997322 |
| 987 | 8057802592 | 8057798959 | Bacteria | 6713499 |
| 988 | Ga0495673_0002789 | |||
| 989 | MRS2a_Contig_850 | |||
| 990 | MRS1b_contig_1629842 | |||
| 991 | JGI25162J39368_1000099 | |||
| 992 | JGI25163J39215_1000781 | |||
| 993 | JGI25163J39215_1001720 | |||
| 994 | JGI25164J39214_1000077 | |||
| 995 | JGI25164J39214_1000477 | |||
| 996 | JGI25164J39214_1000563 | |||
| 997 | JGI25165J46597_1000182 | |||
| 998 | JGI25165J46597_1001123 | |||
| 999 | Ga0055536_1000109 | |||
| 1000 | Ga0055536_1000539 | |||
| 1001 | Ga0055536_1000945 | |||
| 1002 | Ga0055530_10000034 | |||
| 1003 | Ga0055530_10005906 | |||
| 1004 | Ga0055530_10016613 | |||
| 1005 | Ga0055540_1000064 | |||
| 1006 | Ga0055531_10000039 | |||
| 1007 | Ga0065714_10000677 | |||
| 1008 | Ga0065714_10006736 | |||
| 1009 | Ga0065714_10007227 | |||
| 1010 | Ga0065714_10068888 | |||
| 1011 | Ga0065712_10003423 | |||
| 1012 | Ga0065712_10003440 | |||
| 1013 | Ga0070670_100002657 | |||
| 1014 | Ga0070661_100002281 | |||
| 1015 | Ga0070669_100001095 | |||
| 1016 | Ga0070669_100011538 | |||
| 1017 | Ga0070662_100000851 | |||
| 1018 | Ga0068853_100000029 | |||
| 1019 | Ga0070665_100152640 | |||
| 1020 | Ga0070664_100000039 | |||
| 1021 | Ga0068851_10000035 | |||
| 1022 | Ga0075432_10007826 | |||
| 1023 | Ga0075432_10011738 | |||
| 1024 | Ga0075369_10013145 | |||
| 1025 | Ga0075436_100012824 | |||
| 1026 | Ga0075436_100153655 | |||
| 1027 | Ga0079104_1000104 | |||
| 1028 | Ga0105251_10007717 | |||
| 1029 | Ga0105251_10010061 | |||
| 1030 | Ga0105251_10072895 | |||
| 1031 | Ga0105244_10002169 | |||
| 1032 | Ga0105244_10006525 | |||
| 1033 | Ga0105244_10014244 | |||
| 1034 | Ga0105244_10018615 | |||
| 1035 | Ga0105244_10058156 | |||
| 1036 | Ga0105244_10065735 | |||
| 1037 | Ga0105244_10086361 | |||
| 1038 | Ga0105250_10003521 | |||
| 1039 | Ga0105250_10004993 | |||
| 1040 | Ga0105250_10007009 | |||
| 1041 | Ga0105250_10010708 | |||
| 1042 | Ga0105250_10019016 | |||
| 1043 | Ga0105250_10029049 | |||
| 1044 | Ga0105243_10000047 | |||
| 1045 | Ga0105243_10001372 | |||
| 1046 | Ga0105243_10057018 | |||
| 1047 | Ga0105243_10093376 | |||
| 1048 | Ga0105242_10225062 | |||
| 1049 | Ga0105249_10273122 | |||
| 1050 | Ga0105246_10001783 | |||
| 1051 | Ga0157345_1000197 | |||
| 1052 | Ga0157373_10009880 | |||
| 1053 | Ga0157373_10015997 | |||
| 1054 | Ga0157373_10020335 | |||
| 1055 | Ga0157373_10020352 | |||
| 1056 | Ga0157373_10027437 | |||
| 1057 | Ga0157373_10216351 | |||
| 1058 | Ga0157371_10000356 | |||
| 1059 | Ga0157371_10238596 | |||
| 1060 | Ga0157370_10005146 | |||
| 1061 | Ga0157370_10015663 | |||
| 1062 | Ga0157370_10035652 | |||
| 1063 | Ga0157370_10124806 | |||
| 1064 | Ga0157370_10335485 | |||
| 1065 | Ga0157369_10022614 | |||
| 1066 | Ga0157369_10028863 | |||
| 1067 | Ga0157369_10030701 | |||
| 1068 | Ga0157369_10039023 | |||
| 1069 | Ga0163162_10008135 | |||
| 1070 | Ga0163162_10436454 | |||
| 1071 | Ga0157372_10010372 | |||
| 1072 | Ga0157375_10017607 | |||
| 1073 | Ga0157375_10052397 | |||
| 1074 | Ga0157375_10057028 | |||
| 1075 | Ga0157375_10178515 | |||
| 1076 | Ga0182008_10000066 | |||
| 1077 | Ga0182008_10007475 | |||
| 1078 | Ga0182008_10007709 | |||
| 1079 | Ga0182008_10009651 | |||
| 1080 | Ga0182008_10013620 | |||
| 1081 | Ga0182008_10059143 | |||
| 1082 | Ga0182006_1001904 | |||
| 1083 | Ga0182006_1077568 | |||
| 1084 | Ga0182007_10004021 | |||
| 1085 | Ga0182005_1005166 | |||
| 1086 | Ga0182005_1013457 | |||
| 1087 | Ga0163161_10004434 | |||
| 1088 | Ga0163161_10006065 | |||
| 1089 | Ga0163161_10019131 | |||
| 1090 | Ga0163161_10026430 | |||
| 1091 | Ga0163161_10118911 | |||
| 1092 | Ga0209760_100059 | |||
| 1093 | Ga0209760_100140 | |||
| 1094 | Ga0207427_100014 | |||
| 1095 | Ga0207427_100016 | |||
| 1096 | Ga0209437_100011 | |||
| 1097 | Ga0209437_100016 | |||
| 1098 | Ga0209759_1014821 | |||
| 1099 | Ga0209233_1000019 | |||
| 1100 | Ga0209233_1000036 | |||
| 1101 | Ga0209676_1000025 | |||
| 1102 | Ga0209676_1000032 | |||
| 1103 | Ga0209676_1000208 | |||
| 1104 | Ga0209050_1000025 | |||
| 1105 | Ga0209050_1000099 | |||
| 1106 | Ga0209050_1001463 | |||
| 1107 | Ga0209051_1000026 | |||
| 1108 | Ga0209051_1000039 | |||
| 1109 | Ga0209051_1000047 | |||
| 1110 | Ga0209257_1000034 | |||
| 1111 | Ga0207656_10000008 | |||
| 1112 | Ga0207696_1000084 | |||
| 1113 | Ga0207696_1000563 | |||
| 1114 | Ga0207696_1003779 | |||
| 1115 | Ga0207696_1006428 | |||
| 1116 | Ga0207655_1000162 | |||
| 1117 | Ga0207655_1000495 | |||
| 1118 | Ga0207655_1001897 | |||
| 1119 | Ga0207655_1002594 | |||
| 1120 | Ga0207655_1005378 | |||
| 1121 | Ga0207655_1005689 | |||
| 1122 | Ga0207655_1009290 | |||
| 1123 | Ga0207655_1013422 | |||
| 1124 | Ga0207655_1013802 | |||
| 1125 | Ga0207655_1015415 | |||
| 1126 | Ga0207713_1001090 | |||
| 1127 | Ga0207713_1001569 | |||
| 1128 | Ga0207713_1003590 | |||
| 1129 | Ga0207713_1004477 | |||
| 1130 | Ga0207713_1007019 | |||
| 1131 | Ga0207713_1007259 | |||
| 1132 | Ga0207713_1007321 | |||
| 1133 | Ga0207713_1024486 | |||
| 1134 | Ga0207671_10000015 | |||
| 1135 | Ga0207649_10000001 | |||
| 1136 | Ga0207681_10000325 | |||
| 1137 | Ga0207681_10005906 | |||
| 1138 | Ga0207650_10000186 | |||
| 1139 | Ga0207706_10000081 | |||
| 1140 | Ga0207686_10102983 | |||
| 1141 | Ga0207709_10000040 | |||
| 1142 | Ga0207709_10000249 | |||
| 1143 | Ga0207709_10042300 | |||
| 1144 | Ga0207679_10000009 | |||
| 1145 | Ga0207712_10197618 | |||
| 1146 | Ga0207639_10000090 | |||
| 1147 | Ga0209281_1000026 | |||
| 1148 | Ga0209281_1007948 | |||
| 1149 | Ga0207428_10099323 | |||
| 1150 | Ga0207428_10169211 | |||
| 1151 | Ga0207428_10169925 | |||
| 1152 | Ga0307511_10142236 | |||
| 1153 | Ga0316179_1066635 | |||
| 1154 | Ga0307509_10043687 | |||
| 1155 | Ga0307516_10198683 | |||
| 1156 | Ga0307405_10003246 | |||
| 1157 | Ga0307407_10113432 | |||
| 1158 | Ga0307412_10056702 | |||
| 1159 | Ga0307412_10335246 | |||
| 1160 | Ga0307416_100190002 | |||
| 1161 | Ga0307414_10105636 | |||
| 1162 | Ga0307414_10122438 | |||
| 1163 | Ga0307510_10048465 | |||
| 1164 | Ga0439438_001810 | |||
| 1165 | Ga0439438_006065 | |||
| 1166 | Ga0439438_012300 | |||
| 1167 | Ga0439438_014555 | |||
| 1168 | Ga0439438_021163 | |||
| 1169 | Ga0439447_001459 | |||
| 1170 | Ga0439447_004123 | |||
| 1171 | Ga0439447_005640 | |||
| 1172 | Ga0439447_014479 | |||
| 1173 | Ga0439447_038722 | |||
| 1174 | Ga0439461_0009312 | |||
| 1175 | Ga0439466_0000592 | |||
| 1176 | Ga0439466_0003823 | |||
| 1177 | Ga0439466_0004719 | |||
| 1178 | Ga0439466_0005992 | |||
| 1179 | Ga0439466_0013675 | |||
| 1180 | Ga0439466_0021708 | |||
| 1181 | Ga0439466_0025185 | |||
| 1182 | Ga0439466_0039577 | |||
| 1183 | Ga0439465_0005193 | |||
| 1184 | Ga0439445_0020996 | |||
| 1185 | Ga0439432_005217 | |||
| 1186 | Ga0439432_005529 | |||
| 1187 | Ga0439432_006258 | |||
| 1188 | Ga0439432_026061 | |||
| 1189 | Ga0439451_000777 | |||
| 1190 | Ga0439451_001521 | |||
| 1191 | Ga0439451_004112 | |||
| 1192 | Ga0439451_011103 | |||
| 1193 | Ga0439451_017591 | |||
| 1194 | Ga0439451_029685 | |||
| 1195 | Ga0439452_001440 | |||
| 1196 | Ga0439452_002739 | |||
| 1197 | Ga0439452_003601 | |||
| 1198 | Ga0439452_003840 | |||
| 1199 | Ga0439452_010235 | |||
| 1200 | Ga0439456_000042 | |||
| 1201 | Ga0439456_002784 | |||
| 1202 | Ga0439456_003896 | |||
| 1203 | Ga0439456_008302 | |||
| 1204 | Ga0439463_001102 | |||
| 1205 | Ga0439463_001271 | |||
| 1206 | Ga0439463_006770 | |||
| 1207 | Ga0439463_021443 | |||
| 1208 | Ga0439463_037721 | |||
| 1209 | Ga0439463_048463 | |||
| 1210 | Ga0450911_000394 | |||
| 1211 | Ga0450911_001041 | |||
| 1212 | Ga0450911_002240 | |||
| 1213 | Ga0450922_000105 | |||
| 1214 | Ga0450922_000231 | |||
| 1215 | Ga0450890_000865 | |||
| 1216 | Ga0450896_002506 | |||
| 1217 | Ga0450898_001042 | |||
| 1218 | Ga0450900_001006 | |||
| 1219 | Ga0450902_003491 | |||
| 1220 | Ga0450902_012476 | |||
| 1221 | Ga0450903_001446 | |||
| 1222 | Ga0450903_002348 | |||
| 1223 | Ga0450903_007061 | |||
| 1224 | Ga0450903_010965 | |||
| 1225 | Ga0450903_012008 | |||
| 1226 | Ga0450904_000669 | |||
| 1227 | Ga0450904_001373 | |||
| 1228 | Ga0450905_003458 | |||
| 1229 | Ga0450905_008268 | |||
| 1230 | Ga0450905_011984 | |||
| 1231 | Ga0450906_000140 | |||
| 1232 | Ga0450906_001955 | |||
| 1233 | Ga0450906_002634 | |||
| 1234 | Ga0450907_001035 | |||
| 1235 | Ga0450907_001261 | |||
| 1236 | Ga0450907_001828 | |||
| 1237 | Ga0450907_013197 | |||
| 1238 | Ga0450910_000899 | |||
| 1239 | Ga0450910_001208 | |||
| 1240 | Ga0439446_0001111 | |||
| 1241 | Ga0450909_000748 | |||
| 1242 | Ga0439434_0001029 | |||
| 1243 | Ga0439464_0001818 | |||
| 1244 | Ga0439460_0002815 | |||
| 1245 | Ga0439460_0005433 | |||
| 1246 | Ga0450918_001677 | |||
| 1247 | Ga0450918_005599 | |||
| 1248 | Ga0450918_005678 | |||
| 1249 | Ga0450893_0003049 | |||
| 1250 | Ga0450901_000527 | |||
| 1251 | Ga0439440_0013454 | |||
| 1252 | Ga0466968_0075512 | |||
| 1253 | Ga0495617_002678 | |||
| 1254 | Ga0495617_003151 | |||
| 1255 | Ga0495617_003353 | |||
| 1256 | Ga0495617_006218 | |||
| 1257 | Ga0495617_010915 | |||
| 1258 | Ga0495617_013399 | |||
| 1259 | Ga0495617_014309 | |||
| 1260 | Ga0495617_018078 | |||
| 1261 | Ga0495617_018600 | |||
| 1262 | Ga0495617_047445 | |||
| 1263 | Ga0495617_073142 | |||
| 1264 | Ga0495627_001941 | |||
| 1265 | Ga0495627_002145 | |||
| 1266 | Ga0495627_002251 | |||
| 1267 | Ga0495627_002921 | |||
| 1268 | Ga0495627_006178 | |||
| 1269 | Ga0495627_010854 | |||
| 1270 | Ga0495627_022247 | |||
| 1271 | Ga0495627_026839 | |||
| 1272 | Ga0495592_0032447 | |||
| 1273 | Ga0495603_0013842 | |||
| 1274 | Ga0495590_0001133 | |||
| 1275 | Ga0495590_0005329 | |||
| 1276 | Ga0495590_0006995 | |||
| 1277 | Ga0495591_001039 | |||
| 1278 | Ga0495591_001516 | |||
| 1279 | Ga0495591_003403 | |||
| 1280 | Ga0495591_004687 | |||
| 1281 | Ga0495591_007643 | |||
| 1282 | Ga0495591_008847 | |||
| 1283 | Ga0495591_009680 | |||
| 1284 | Ga0495591_015548 | |||
| 1285 | Ga0495591_023973 | |||
| 1286 | Ga0495591_024727 | |||
| 1287 | Ga0495638_0004345 | |||
| 1288 | Ga0495638_0007860 | |||
| 1289 | Ga0495638_0010713 | |||
| 1290 | Ga0495638_0010935 | |||
| 1291 | Ga0495638_0012479 | |||
| 1292 | Ga0495638_0015980 | |||
| 1293 | Ga0495638_0017979 | |||
| 1294 | Ga0495638_0022211 | |||
| 1295 | Ga0495638_0025088 | |||
| 1296 | Ga0495638_0029352 | |||
| 1297 | Ga0495638_0040760 | |||
| 1298 | Ga0495638_0056338 | |||
| 1299 | Ga0495638_0092120 | |||
| 1300 | Ga0495638_0119522 | |||
| 1301 | Ga0495638_0129236 | |||
| 1302 | Ga0495638_0218483 | |||
| 1303 | Ga0495653_0001680 | |||
| 1304 | Ga0495653_0027312 | |||
| 1305 | Ga0495650_0001827 | |||
| 1306 | Ga0495650_0006454 | |||
| 1307 | Ga0495650_0010566 | |||
| 1308 | Ga0495650_0012672 | |||
| 1309 | Ga0495650_0013248 | |||
| 1310 | Ga0495650_0074844 | |||
| 1311 | Ga0495605_0002176 | |||
| 1312 | Ga0495605_0010638 | |||
| 1313 | Ga0495605_0010842 | |||
| 1314 | Ga0495605_0017100 | |||
| 1315 | Ga0495605_0018537 | |||
| 1316 | Ga0495605_0022666 | |||
| 1317 | Ga0495605_0033448 | |||
| 1318 | Ga0495605_0046015 | |||
| 1319 | Ga0495605_0053637 | |||
| 1320 | Ga0495605_0093424 | |||
| 1321 | Ga0495605_0100391 | |||
| 1322 | Ga0495639_0000294 | |||
| 1323 | Ga0495639_0001785 | |||
| 1324 | Ga0495639_0038701 | |||
| 1325 | Ga0495584_0001126 | |||
| 1326 | Ga0495584_0003398 | |||
| 1327 | Ga0495584_0004328 | |||
| 1328 | Ga0495584_0004718 | |||
| 1329 | Ga0495584_0006726 | |||
| 1330 | Ga0495584_0007670 | |||
| 1331 | Ga0495584_0009340 | |||
| 1332 | Ga0495584_0012644 | |||
| 1333 | Ga0495584_0013707 | |||
| 1334 | Ga0495584_0015059 | |||
| 1335 | Ga0495584_0024264 | |||
| 1336 | Ga0495584_0029698 | |||
| 1337 | Ga0495584_0075337 | |||
| 1338 | Ga0495584_0126176 | |||
| 1339 | Ga0495585_0005734 | |||
| 1340 | Ga0495585_0007018 | |||
| 1341 | Ga0495585_0009875 | |||
| 1342 | Ga0495585_0013870 | |||
| 1343 | Ga0495585_0015812 | |||
| 1344 | Ga0495585_0016466 | |||
| 1345 | Ga0495585_0019200 | |||
| 1346 | Ga0495585_0023982 | |||
| 1347 | Ga0495585_0033785 | |||
| 1348 | Ga0495585_0076019 | |||
| 1349 | Ga0495594_0008086 | |||
| 1350 | Ga0495594_0017310 | |||
| 1351 | Ga0495596_0000825 | |||
| 1352 | Ga0495596_0007273 | |||
| 1353 | Ga0495596_0082948 | |||
| 1354 | Ga0495607_0002173 | |||
| 1355 | Ga0495607_0006196 | |||
| 1356 | Ga0495607_0006943 | |||
| 1357 | Ga0495607_0008967 | |||
| 1358 | Ga0495607_0013127 | |||
| 1359 | Ga0495607_0016070 | |||
| 1360 | Ga0495607_0024480 | |||
| 1361 | Ga0495607_0041434 | |||
| 1362 | Ga0495607_0043338 | |||
| 1363 | Ga0495607_0061026 | |||
| 1364 | Ga0495607_0077843 | |||
| 1365 | Ga0495607_0102281 | |||
| 1366 | Ga0495607_0122005 | |||
| 1367 | Ga0495607_0128723 | |||
| 1368 | Ga0495583_0002730 | |||
| 1369 | Ga0495583_0006786 | |||
| 1370 | Ga0495583_0012126 | |||
| 1371 | Ga0495583_0022567 | |||
| 1372 | Ga0495583_0096225 | |||
| 1373 | Ga0495583_0103834 | |||
| 1374 | Ga0495606_0005981 | |||
| 1375 | Ga0495606_0006105 | |||
| 1376 | Ga0495606_0007126 | |||
| 1377 | Ga0495606_0014993 | |||
| 1378 | Ga0495610_0002705 | |||
| 1379 | Ga0495610_0004480 | |||
| 1380 | Ga0495610_0005819 | |||
| 1381 | Ga0495610_0007574 | |||
| 1382 | Ga0495610_0007679 | |||
| 1383 | Ga0495610_0007944 | |||
| 1384 | Ga0495610_0010183 | |||
| 1385 | Ga0495610_0010214 | |||
| 1386 | Ga0495610_0011112 | |||
| 1387 | Ga0495610_0035752 | |||
| 1388 | Ga0495610_0064586 | |||
| 1389 | Ga0495616_0001868 | |||
| 1390 | Ga0495616_0004365 | |||
| 1391 | Ga0495616_0005720 | |||
| 1392 | Ga0495616_0005865 | |||
| 1393 | Ga0495616_0011117 | |||
| 1394 | Ga0495616_0020557 | |||
| 1395 | Ga0495616_0021542 | |||
| 1396 | Ga0495616_0024542 | |||
| 1397 | Ga0495616_0034152 | |||
| 1398 | Ga0495616_0045143 | |||
| 1399 | Ga0495616_0074568 | |||
| 1400 | Ga0495620_0000052 | |||
| 1401 | Ga0495620_0001033 | |||
| 1402 | Ga0495620_0001500 | |||
| 1403 | Ga0495620_0003073 | |||
| 1404 | Ga0495620_0003951 | |||
| 1405 | Ga0495620_0007188 | |||
| 1406 | Ga0495620_0008807 | |||
| 1407 | Ga0495620_0011042 | |||
| 1408 | Ga0495620_0042063 | |||
| 1409 | Ga0495620_0089590 | |||
| 1410 | Ga0495628_0036518 | |||
| 1411 | Ga0495630_0014872 | |||
| 1412 | Ga0495630_0017201 | |||
| 1413 | Ga0495630_0057475 | |||
| 1414 | Ga0495631_0003014 | |||
| 1415 | Ga0495631_0003855 | |||
| 1416 | Ga0495631_0006062 | |||
| 1417 | Ga0495631_0006628 | |||
| 1418 | Ga0495631_0010723 | |||
| 1419 | Ga0495631_0014825 | |||
| 1420 | Ga0495632_0000210 | |||
| 1421 | Ga0495632_0001609 | |||
| 1422 | Ga0495632_0004883 | |||
| 1423 | Ga0495632_0006031 | |||
| 1424 | Ga0495632_0008656 | |||
| 1425 | Ga0495632_0012386 | |||
| 1426 | Ga0495632_0012627 | |||
| 1427 | Ga0495632_0016521 | |||
| 1428 | Ga0495632_0021306 | |||
| 1429 | Ga0495632_0025739 | |||
| 1430 | Ga0495632_0049661 | |||
| 1431 | Ga0495632_0054136 | |||
| 1432 | Ga0495632_0057612 | |||
| 1433 | Ga0495632_0064845 | |||
| 1434 | Ga0495632_0090953 | |||
| 1435 | Ga0495637_0001728 | |||
| 1436 | Ga0495637_0003277 | |||
| 1437 | Ga0495637_0004668 | |||
| 1438 | Ga0495637_0004680 | |||
| 1439 | Ga0495637_0004823 | |||
| 1440 | Ga0495637_0005107 | |||
| 1441 | Ga0495637_0005172 | |||
| 1442 | Ga0495637_0009869 | |||
| 1443 | Ga0495637_0011171 | |||
| 1444 | Ga0495637_0016642 | |||
| 1445 | Ga0495637_0019095 | |||
| 1446 | Ga0495637_0022273 | |||
| 1447 | Ga0495637_0023277 | |||
| 1448 | Ga0495637_0030032 | |||
| 1449 | Ga0495643_0000197 | |||
| 1450 | Ga0495643_0000344 | |||
| 1451 | Ga0495643_0003510 | |||
| 1452 | Ga0495643_0006716 | |||
| 1453 | Ga0495643_0009107 | |||
| 1454 | Ga0495643_0024178 | |||
| 1455 | Ga0495643_0032116 | |||
| 1456 | Ga0495643_0124790 | |||
| 1457 | Ga0495644_0001046 | |||
| 1458 | Ga0495644_0001271 | |||
| 1459 | Ga0495644_0007710 | |||
| 1460 | Ga0495644_0008800 | |||
| 1461 | Ga0495644_0009183 | |||
| 1462 | Ga0495648_0000679 | |||
| 1463 | Ga0495648_0002981 | |||
| 1464 | Ga0495648_0006163 | |||
| 1465 | Ga0495648_0015264 | |||
| 1466 | Ga0495648_0016039 | |||
| 1467 | Ga0495648_0017930 | |||
| 1468 | Ga0495648_0022217 | |||
| 1469 | Ga0495648_0025483 | |||
| 1470 | Ga0495648_0032407 | |||
| 1471 | Ga0495648_0035719 | |||
| 1472 | Ga0495648_0040632 | |||
| 1473 | Ga0495648_0087021 | |||
| 1474 | Ga0495666_0005963 | |||
| 1475 | Ga0495666_0007854 | |||
| 1476 | Ga0495666_0065205 | |||
| 1477 | Ga0495642_0001171 | |||
| 1478 | Ga0495642_0002264 | |||
| 1479 | Ga0495642_0003292 | |||
| 1480 | Ga0495652_0211054 | |||
| 1481 | Ga0495654_0001750 | |||
| 1482 | Ga0495654_0001797 | |||
| 1483 | Ga0495654_0002117 | |||
| 1484 | Ga0495654_0005462 | |||
| 1485 | Ga0495654_0006180 | |||
| 1486 | Ga0495654_0007154 | |||
| 1487 | Ga0495654_0007720 | |||
| 1488 | Ga0495654_0014074 | |||
| 1489 | Ga0495654_0024461 | |||
| 1490 | Ga0495654_0024851 | |||
| 1491 | Ga0495654_0033498 | |||
| 1492 | Ga0495654_0055779 | |||
| 1493 | Ga0495654_0059569 | |||
| 1494 | Ga0495654_0070413 | |||
| 1495 | Ga0495654_0140078 | |||
| 1496 | Ga0495586_0006337 | |||
| 1497 | Ga0495587_0005500 | |||
| 1498 | Ga0495587_0007573 | |||
| 1499 | Ga0495609_0002518 | |||
| 1500 | Ga0495609_0007681 | |||
| 1501 | Ga0495609_0019508 | |||
| 1502 | Ga0495609_0044832 | |||
| 1503 | Ga0495609_0080478 | |||
| 1504 | Ga0495609_0086719 | |||
| 1505 | Ga0495597_0003741 | |||
| 1506 | Ga0495597_0005474 | |||
| 1507 | Ga0495597_0014704 | |||
| 1508 | Ga0495597_0018196 | |||
| 1509 | Ga0495597_0021608 | |||
| 1510 | Ga0495597_0028064 | |||
| 1511 | Ga0495597_0084035 | |||
| 1512 | Ga0495645_0162104 | |||
| 1513 | Ga0495622_0002723 | |||
| 1514 | Ga0495622_0005121 | |||
| 1515 | Ga0495622_0047534 | |||
| 1516 | Ga0495622_0057333 | |||
| 1517 | Ga0495622_0069293 | |||
| 1518 | Ga0495633_0004035 | |||
| 1519 | Ga0495633_0005819 | |||
| 1520 | Ga0495633_0020239 | |||
| 1521 | Ga0495633_0061675 | |||
| 1522 | Ga0495633_0074783 | |||
| 1523 | Ga0495656_0024139 | |||
| 1524 | Ga0495668_0001129 | |||
| 1525 | Ga0495668_0002393 | |||
| 1526 | Ga0495668_0011216 | |||
| 1527 | Ga0495634_0008471 | |||
| 1528 | Ga0495634_0023826 | |||
| 1529 | Ga0495611_0001084 | |||
| 1530 | Ga0495611_0008804 | |||
| 1531 | Ga0495611_0018224 | |||
| 1532 | Ga0495611_0032834 | |||
| 1533 | Ga0495611_0042105 | |||
| 1534 | Ga0495625_0003953 | |||
| 1535 | Ga0495625_0006328 | |||
| 1536 | Ga0495625_0007050 | |||
| 1537 | Ga0495625_0011065 | |||
| 1538 | Ga0495625_0011399 | |||
| 1539 | Ga0495625_0024389 | |||
| 1540 | Ga0495625_0051744 | |||
| 1541 | Ga0495625_0091901 | |||
| 1542 | Ga0495625_0159788 | |||
| 1543 | Ga0495625_0211104 | |||
| 1544 | Ga0495635_0011238 | |||
| 1545 | Ga0495635_0015853 | |||
| 1546 | Ga0495659_0001680 | |||
| 1547 | Ga0495659_0002221 | |||
| 1548 | Ga0495659_0019940 | |||
| 1549 | Ga0495659_0036456 | |||
| 1550 | Ga0495661_0001354 | |||
| 1551 | Ga0495661_0009797 | |||
| 1552 | Ga0495661_0010223 | |||
| 1553 | Ga0495661_0064894 | |||
| 1554 | Ga0495661_0065744 | |||
| 1555 | Ga0495661_0116326 | |||
| 1556 | Ga0495588_0003321 | |||
| 1557 | Ga0495588_0007109 | |||
| 1558 | Ga0495588_0012513 | |||
| 1559 | Ga0495588_0054506 | |||
| 1560 | Ga0495623_0018761 | |||
| 1561 | Ga0495646_0003357 | |||
| 1562 | Ga0495646_0007624 | |||
| 1563 | Ga0495669_0000275 | |||
| 1564 | Ga0495669_0014283 | |||
| 1565 | Ga0495613_0007674 | |||
| 1566 | Ga0495613_0019593 | |||
| 1567 | Ga0495613_0032984 | |||
| 1568 | Ga0495670_0002096 | |||
| 1569 | Ga0495670_0002438 | |||
| 1570 | Ga0495670_0002606 | |||
| 1571 | Ga0495670_0003560 | |||
| 1572 | Ga0495670_0017283 | |||
| 1573 | Ga0495670_0025591 | |||
| 1574 | Ga0495670_0035586 | |||
| 1575 | Ga0495670_0049803 | |||
| 1576 | Ga0495670_0062467 | |||
| 1577 | Ga0495671_0002446 | |||
| 1578 | Ga0495671_0002796 | |||
| 1579 | Ga0495671_0002816 | |||
| 1580 | Ga0495671_0005620 | |||
| 1581 | Ga0495671_0006769 | |||
| 1582 | Ga0495671_0007523 | |||
| 1583 | Ga0495671_0009714 | |||
| 1584 | Ga0495671_0012989 | |||
| 1585 | Ga0495671_0021336 | |||
| 1586 | Ga0495671_0026252 | |||
| 1587 | Ga0495671_0034544 | |||
| 1588 | Ga0495671_0077052 | |||
| 1589 | Ga0495671_0087232 | |||
| 1590 | Ga0495649_0001197 | |||
| 1591 | Ga0495649_0003408 | |||
| 1592 | Ga0495649_0003507 | |||
| 1593 | Ga0495649_0005650 | |||
| 1594 | Ga0495649_0009983 | |||
| 1595 | Ga0495649_0013051 | |||
| 1596 | Ga0495649_0017655 | |||
| 1597 | Ga0495649_0018688 | |||
| 1598 | Ga0495649_0026244 | |||
| 1599 | Ga0495649_0032363 | |||
| 1600 | Ga0495649_0040829 | |||
| 1601 | Ga0495649_0063351 | |||
| 1602 | Ga0495649_0141158 | |||
| 1603 | Ga0495589_0000573 | |||
| 1604 | Ga0495589_0002034 | |||
| 1605 | Ga0495589_0002449 | |||
| 1606 | Ga0495589_0006573 | |||
| 1607 | Ga0495589_0011999 | |||
| 1608 | Ga0495589_0013119 | |||
| 1609 | Ga0495589_0013802 | |||
| 1610 | Ga0495589_0016586 | |||
| 1611 | Ga0495589_0030713 | |||
| 1612 | Ga0495589_0043032 | |||
| 1613 | Ga0495600_0006569 | |||
| 1614 | Ga0495600_0047768 | |||
| 1615 | Ga0495600_0059004 | |||
| 1616 | Ga0495660_0009794 | |||
| 1617 | Ga0495660_0014300 | |||
| 1618 | Ga0495660_0014620 | |||
| 1619 | Ga0495660_0020607 | |||
| 1620 | Ga0495660_0021169 | |||
| 1621 | Ga0495660_0025778 | |||
| 1622 | Ga0495660_0050427 | |||
| 1623 | Ga0495660_0054307 | |||
| 1624 | Ga0495660_0054765 | |||
| 1625 | Ga0495660_0070638 | |||
| 1626 | Ga0495660_0110059 | |||
| 1627 | Ga0495581_0009732 | |||
| 1628 | Ga0495604_0005000 | |||
| 1629 | Ga0495604_0008683 | |||
| 1630 | Ga0495604_0021610 | |||
| 1631 | Ga0495636_0019518 | |||
| 1632 | Ga0495674_0040813 | |||
| 1633 | Ga0495672_0002646 | |||
| 1634 | Ga0495672_0003540 | |||
| 1635 | Ga0495672_0004515 | |||
| 1636 | Ga0495672_0005186 | |||
| 1637 | Ga0495672_0005696 | |||
| 1638 | Ga0495672_0011462 | |||
| 1639 | Ga0495672_0013136 | |||
| 1640 | Ga0495672_0014058 | |||
| 1641 | Ga0495672_0023425 | |||
| 1642 | Ga0495672_0033995 | |||
| 1643 | Ga0495672_0042348 | |||
| 1644 | Ga0495672_0141604 | |||
| 1645 | Ga0495676_0003332 | |||
| 1646 | Ga0495676_0039359 | |||
| 1647 | Ga0495680_0005487 | |||
| 1648 | Ga0495680_0013007 | |||
| 1649 | Ga0495680_0015346 | |||
| 1650 | Ga0495680_0017202 | |||
| 1651 | Ga0495680_0049858 | |||
| 1652 | Ga0495683_0001176 | |||
| 1653 | Ga0495683_0003293 | |||
| 1654 | Ga0495683_0005969 | |||
| 1655 | Ga0495683_0014780 | |||
| 1656 | Ga0495683_0015298 | |||
| 1657 | Ga0495683_0040849 | |||
| 1658 | Ga0495683_0056229 | |||
| 1659 | Ga0495683_0069250 | |||
| 1660 | Ga0495683_0072992 | |||
| 1661 | Ga0495683_0125733 | |||
| 1662 | Ga0495687_002029 | |||
| 1663 | Ga0495687_002352 | |||
| 1664 | Ga0495687_005636 | |||
| 1665 | Ga0495687_017951 | |||
| 1666 | Ga0495675_0034124 | |||
| 1667 | Ga0495675_0221592 | |||
| 1668 | Ga0495677_0024480 | |||
| 1669 | Ga0495677_0025495 | |||
| 1670 | Ga0495679_001001 | |||
| 1671 | Ga0495679_001762 | |||
| 1672 | Ga0495679_003869 | |||
| 1673 | Ga0495679_004363 | |||
| 1674 | Ga0495679_004730 | |||
| 1675 | Ga0495679_005012 | |||
| 1676 | Ga0495679_010118 | |||
| 1677 | Ga0495679_010261 | |||
| 1678 | Ga0495685_001865 | |||
| 1679 | Ga0495685_041915 | |||
| 1680 | Ga0495673_0001224 | |||
| 1681 | Ga0495673_0001229 | |||
| 1682 | Ga0495673_0002473 | |||
| 1683 | Ga0495673_0002511 | |||
| 1684 | Ga0495673_0003744 | |||
| 1685 | Ga0495673_0005069 | |||
| 1686 | Ga0495673_0010542 | |||
| 1687 | Ga0495673_0013881 | |||
| 1688 | Ga0495673_0015870 | |||
| 1689 | Ga0495673_0023468 | |||
| 1690 | Ga0495673_0042606 | |||
| 1691 | Ga0495681_0001719 | |||
| 1692 | Ga0495681_0002805 | |||
| 1693 | Ga0495681_0003994 | |||
| 1694 | Ga0495681_0004222 | |||
| 1695 | Ga0495681_0005833 | |||
| 1696 | Ga0495681_0006731 | |||
| 1697 | Ga0495681_0009298 | |||
| 1698 | Ga0495681_0011363 | |||
| 1699 | Ga0495681_0013761 | |||
| 1700 | Ga0495681_0014606 | |||
| 1701 | Ga0495681_0014696 | |||
| 1702 | Ga0495681_0019667 | |||
| 1703 | Ga0495681_0022097 | |||
| 1704 | Ga0495681_0023475 | |||
| 1705 | Ga0495681_0036762 | |||
| 1706 | Ga0495684_0034197 | |||
| 1707 | Ga0495684_0088038 | |||
| 1708 | Ga0495686_0003667 | |||
| 1709 | Ga0495686_0007987 | |||
| 1710 | Ga0495686_0015337 | |||
| 1711 | Ga0495686_0153363 | |||
| 1712 | Ga0495686_0163620 | |||
| 1713 | Ga0495593_0010781 | |||
| 1714 | Ga0495593_0028808 | |||
| 1715 | Ga0495593_0031196 | |||
| 1716 | Ga0495593_0040439 | |||
| 1717 | Ga0495593_0069296 | |||
| 1718 | Ga0495602_0024294 | |||
| 1719 | Ga0495626_0001348 | |||
| 1720 | Ga0495626_0002025 | |||
| 1721 | Ga0495626_0002432 | |||
| 1722 | Ga0495626_0002902 | |||
| 1723 | Ga0495626_0005078 | |||
| 1724 | Ga0495626_0006667 | |||
| 1725 | Ga0495626_0010145 | |||
| 1726 | Ga0495626_0014757 | |||
| 1727 | Ga0495626_0060967 | |||
| 1728 | Ga0496102_0002488 | |||
| 1729 | Ga0496103_0007679 | |||
| 1730 | Ga0496105_0035042 | |||
| 1731 | Ga0496106_0085807 | |||
| 1732 | Ga0496110_0081238 | |||
| 1733 | Ga0496110_0168663 | |||
| 1734 | Ga0496110_0177671 | |||
| 1735 | Ga0496114_0007200 | |||
| 1736 | Ga0496114_0200099 | |||
| 1737 | Ga0496115_0151116 | |||
| 1738 | Ga0496116_0000239 | |||
| 1739 | Ga0496116_0004006 | |||
| 1740 | Ga0496116_0005049 | |||
| 1741 | Ga0496116_0015910 | |||
| 1742 | Ga0496116_0015993 | |||
| 1743 | Ga0496116_0020611 | |||
| 1744 | Ga0496116_0074385 | |||
| 1745 | Ga0496116_0135076 | |||
| 1746 | Ga0496117_0000553 | |||
| 1747 | Ga0496117_0000656 | |||
| 1748 | Ga0496117_0001985 | |||
| 1749 | Ga0496117_0003511 | |||
| 1750 | Ga0496117_0017035 | |||
| 1751 | Ga0496117_0022375 | |||
| 1752 | Ga0496117_0022545 | |||
| 1753 | Ga0496117_0039599 | |||
| 1754 | Ga0496117_0044736 | |||
| 1755 | Ga0496117_0052604 | |||
| 1756 | Ga0496117_0055441 | |||
| 1757 | Ga0496117_0070943 | |||
| 1758 | Ga0496117_0102780 | |||
| 1759 | Ga0496117_0113198 | |||
| 1760 | Ga0496118_0000526 | |||
| 1761 | Ga0496118_0001278 | |||
| 1762 | Ga0496118_0004135 | |||
| 1763 | Ga0496118_0014238 | |||
| 1764 | Ga0496118_0019644 | |||
| 1765 | Ga0496118_0020963 | |||
| 1766 | Ga0496118_0026316 | |||
| 1767 | Ga0496118_0033192 | |||
| 1768 | Ga0496118_0053464 | |||
| 1769 | Ga0496118_0064211 | |||
| 1770 | Ga0496119_0019142 | |||
| 1771 | Ga0496119_0024432 | |||
| 1772 | Ga0496119_0049182 | |||
| 1773 | Ga0496120_0004601 | |||
| 1774 | Ga0496120_0012012 | |||
| 1775 | Ga0496120_0015570 | |||
| 1776 | Ga0496121_0000262 | |||
| 1777 | Ga0496121_0020525 | |||
| 1778 | Ga0496121_0028833 | |||
| 1779 | Ga0496121_0036664 | |||
| 1780 | Ga0496121_0046691 | |||
| 1781 | Ga0496121_0078845 | |||
| 1782 | Ga0496121_0082725 | |||
| 1783 | Ga0496121_0122361 | |||
| 1784 | Ga0496122_0004903 | |||
| 1785 | Ga0496122_0005619 | |||
| 1786 | Ga0496122_0024048 | |||
| 1787 | Ga0496122_0038118 | |||
| 1788 | Ga0496122_0053358 | |||
| 1789 | Ga0496122_0080141 | |||
| 1790 | Ga0496123_0001108 | |||
| 1791 | Ga0496123_0001256 | |||
| 1792 | Ga0496123_0018549 | |||
| 1793 | Ga0496123_0032364 | |||
| 1794 | Ga0496123_0037338 | |||
| 1795 | Ga0496123_0042502 | |||
| 1796 | Ga0496123_0072264 | |||
| 1797 | Ga0496124_0001363 | |||
| 1798 | Ga0496124_0002451 | |||
| 1799 | Ga0496124_0015442 | |||
| 1800 | Ga0496124_0026041 | |||
| 1801 | Ga0496124_0039263 | |||
| 1802 | Ga0496124_0041424 | |||
| 1803 | Ga0496124_0049513 | |||
| 1804 | Ga0496124_0053423 | |||
| 1805 | Ga0496124_0097426 | |||
| 1806 | Ga0496124_0138180 | |||
| 1807 | Ga0496124_0259787 | |||
| 1808 | Ga0496125_0000240 | |||
| 1809 | Ga0496125_0012262 | |||
| 1810 | Ga0496125_0012345 | |||
| 1811 | Ga0496125_0015428 | |||
| 1812 | Ga0496125_0017739 | |||
| 1813 | Ga0496125_0020268 | |||
| 1814 | Ga0496125_0029174 | |||
| 1815 | Ga0496125_0029574 | |||
| 1816 | Ga0496125_0032238 | |||
| 1817 | Ga0496125_0033127 | |||
| 1818 | Ga0496125_0050271 | |||
| 1819 | Ga0496126_0025027 | |||
| 1820 | Ga0496126_0119444 | |||
| 1821 | Ga0496126_0131418 | |||
| 1822 | Ga0496126_0202255 | |||
| 1823 | Ga0495678_002970 | |||
| 1824 | Ga0495678_003267 | |||
| 1825 | Ga0495678_004677 | |||
| 1826 | Ga0495678_007795 | |||
| 1827 | Ga0495678_008089 | |||
| 1828 | Ga0495678_009940 | |||
| 1829 | Ga0495678_011100 | |||
| 1830 | Ga0495678_018318 | |||
| 1831 | Ga0495678_022269 | |||
| 1832 | Ga0495678_023567 | |||
| 1833 | Ga0495678_036931 | |||
| 1834 | Ga0495678_037944 | |||
| 1835 | Ga0495678_061126 | |||
| 1836 | Ga0495682_0000589 | |||
| 1837 | Ga0495682_0000608 | |||
| 1838 | Ga0495682_0002668 | |||
| 1839 | Ga0495682_0013053 | |||
| 1840 | Ga0495682_0077162 | |||
| 1841 | Ga0501241_001805 | |||
| 1842 | nmdc:mga00v17_105504_c1 | |||
| 1843 | nmdc:mga00v17_112636_c1 | |||
| 1844 | nmdc:mga00v17_39314_c1 | |||
| 1845 | nmdc:mga08x19_239922_c1 | |||
| 1846 | nmdc:mga08x19_387042_c1 | |||
| 1847 | nmdc:mga0sz30_39533_c1 | |||
| 1848 | Ga0500572_001103 | |||
| 1849 | Ga0500634_0004336 | |||
| 1850 | 2511253912 | |||
| 1851 | 2511263571 | |||
| 1852 | 2511272622 | |||
| 1853 | 2511280634 | |||
| 1854 | 2511288901 | |||
| 1855 | 2511293853 | |||
| 1856 | 2511300652 | |||
| 1857 | 2511312153 | |||
| 1858 | 2511318579 | |||
| 1859 | 2511323737 | |||
| 1860 | 2511332770 | |||
| 1861 | 2511336224 | |||
| 1862 | 2511345138 | |||
| 1863 | 2511348393 | |||
| 1864 | 2511356148 | |||
| 1865 | 2511361369 | |||
| 1866 | 2511368512 | |||
| 1867 | 2511411191 | |||
| 1868 | 2512327865 | |||
| 1869 | 2555667295 | |||
| 1870 | 2583789920 | |||
| 1871 | 2597855539 | |||
| 1872 | 2599356518 | |||
| 1873 | 2599363454 | |||
| 1874 | 2599369594 | |||
| 1875 | 2599376563 | |||
| 1876 | 2599381623 | |||
| 1877 | 2599388233 | |||
| 1878 | 2599395241 | |||
| 1879 | 2599398975 | |||
| 1880 | 2599407006 | |||
| 1881 | 2599451026 | |||
| 1882 | 2599463351 | |||
| 1883 | 2599469301 | |||
| 1884 | 2599485442 | |||
| 1885 | 2599492368 | |||
| 1886 | 2599514028 | |||
| 1887 | 2599518625 | |||
| 1888 | 2599806574 | |||
| 1889 | 2599882542 | |||
| 1890 | 2599893637 | |||
| 1891 | 2599950540 | |||
| 1892 | 2600215980 | |||
| 1893 | 2600368428 | |||
| 1894 | 2601776147 | |||
| 1895 | 2606076802 | |||
| 1896 | 2606128784 | |||
| 1897 | 2621302288 | |||
| 1898 | 2624478101 | |||
| 1899 | 2624489645 | |||
| 1900 | 2643840864 | |||
| 1901 | 2643955040 | |||
| 1902 | 2644024674 | |||
| 1903 | 2644189579 | |||
| 1904 | 2671100094 | |||
| 1905 | 2671772225 | |||
| 1906 | 2715749091 | |||
| 1907 | 2715754361 | |||
| 1908 | 2718632046 | |||
| 1909 | 2738674952 | |||
| 1910 | 2738753345 | |||
| 1911 | 2738808036 | |||
| 1912 | 2738862544 | |||
| 1913 | 2738895396 | |||
| 1914 | 2739197909 | |||
| 1915 | 2739260432 | |||
| 1916 | 2739311155 | |||
| 1917 | 2743734958 | |||
| 1918 | 2774119680 | |||
| 1919 | 2784261168 | |||
| 1920 | 2784316247 | |||
| 1921 | 2808931280 | |||
| 1922 | 2808953230 | |||
| 1923 | 2808955738 | |||
| 1924 | 2808976780 | |||
| 1925 | 2808991782 | |||
| 1926 | 2809217863 | |||
| 1927 | 2817488285 | |||
| 1928 | 2819657109 | |||
| 1929 | 2819705090 | |||
| 1930 | 2834032326 | |||
| 1931 | 2842846478 | |||
| 1932 | 2844667772 | |||
| 1933 | 2852616946 | |||
| 1934 | 2852672065 | |||
| 1935 | 2860344871 | |||
| 1936 | 2878030046 | |||
| 1937 | 2904552367 | |||
| 1938 | 2908446898 | |||
| 1939 | 2917071043 | |||
| 1940 | 2919066271 | |||
| 1941 | 2919389897 | |||
| 1942 | 2919459857 | |||
| 1943 | 2919488823 | |||
| 1944 | 2923153951 | |||
| 1945 | 2931391257 | |||
| 1946 | 2931398718 | |||
| 1947 | 2935358871 | |||
| 1948 | 2939640981 | |||
| 1949 | 2939652111 | |||
| 1950 | 2969304835 | |||
| 1951 | 2974293466 | |||
| 1952 | 2984292106 | |||
| 1953 | 2998140339 | |||
| 1954 | 3007397967 | |||
| 1955 | 3007419900 | |||
| 1956 | 3007517755 | |||
| 1957 | 3007617418 | |||
| 1958 | 3007625332 | |||
| 1959 | 3007723805 | |||
| 1960 | 3007864454 | |||
| 1961 | 637317694 | |||
| 1962 | 8015688200 | |||
| 1963 | 8019770194 | |||
| 1964 | 8019777220 | |||
| 1965 | 8054291488 | |||
| 1966 | 8054932979 | |||
| 1967 | 8055771302 | |||
| 1968 | 8055818235 | |||
| 1969 | 8056126350 | |||
| 1970 | 8056158396 | |||
| 1971 | 8056170704 | |||
| 1972 | 8056179677 | |||
| 1973 | 8056572203 | |||
| 1974 | 8057802592 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7xrh-assembly1.cif.gz_B | feruloyl esterase from lactobacillus acidophilus | 0.7659 | 26 | 305 |
| 7xrh-assembly1.cif.gz_B | feruloyl esterase from lactobacillus acidophilus | 0.7477 | 26 | 305 |
| 6v7n-assembly2.cif.gz_B | crystal structure of a human lysosome resident glycoprotein, lysosomal acid lipase, and its implications in cholesteryl ester storage disease (cesd) | 0.7375 | 24 | 306 |
| 3pf9-assembly1.cif.gz_A | crystal structure of the lactobacillus johnsonii cinnamoyl esterase lj0536 s106a mutant | 0.7366 | 26 | 307 |
| 2d81-assembly1.cif.gz_A | phb depolymerase (s39a) complexed with r3hb trimer | 0.7334 | 238 | 285 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0GYE0_51_217_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7924 | 24 | 150 | 3.40.50.1820 |
| af_Q9VPE9_27_395_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7729 | 25 | 307 | 3.40.50.1820 |
| af_K7N1G9_24_286_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7628 | 26 | 137 | 3.40.50.1820 |
| af_A0A1D6K8I4_16_172_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7616 | 26 | 138 | 3.40.50.1820 |
| af_M0R7L1_20_396_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.739 | 24 | 273 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0H5AA48-F1-model_v4 | Alpha/beta hydrolase | 0.967 | 22 | 317 |
GO:0016787
|
| AF-A0A379J1P8-F1-model_v4 | deleted | 0.9661 | 19 | 319 |
|
| AF-A0A6G6F206-F1-model_v4 | deleted | 0.9625 | 37 | 320 |
|
| AF-I3USN7-F1-model_v4 | Alpha/beta hydrolase-like protein | 0.9615 | 55 | 320 |
GO:0016787
|
| AF-A0A6L5I5U1-F1-model_v4 | deleted | 0.9612 | 37 | 320 |
|