F487554

General Info

Members Datasets Scaffolds Average Seq Length
987 343 1974 320

Family's Representative Sequence

Representative Sequence 3300047469|Ga0495673_0002789|Ga0495673_0002789_2851_3987
Length 378
Sequence MNLQDMPSLAPTQIELPLPTTAAGEPFKEPAADGYILGGFSWRHERQDTTRPVVIINAATSVRCRHYSRFADYLFANGFDVITYDYRGIGESRPASLKGLHASWTDWGALDFEAMLKRAQREFPGQPIDVVGHSFGGCAAGLGASGHLIRHLVTVGAQFAYWRDYAPVHRWRMFGKWHLVMPLVTMLCGYFPGKRLGWLEDTPAGVVRDWSTPTERYETRPSGRLIHAKTGSLPFAAVTAKTLAISISDDPYGTIPAIERLLSYFTGSTNNHLRIAPEDIGEEEVGHFAFFRSPYQATLWPIALSWLQTGELTPDTPGRLVPRSRSTCPSNEIRNDAHGLRQQAAKTRHPRQSQGQAEPHPTGRCAGRTGPERRSHRL

Samples

Sample ID Description Type Environment
1 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
22 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
23 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
24 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
25 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
26 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
27 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
28 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
42 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
43 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
44 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
47 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
48 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
49 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
50 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
51 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
72 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
73 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
74 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
75 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
76 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
81 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
82 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
83 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
84 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
85 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
86 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
87 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
88 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
89 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
90 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
91 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
92 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
93 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
94 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
95 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
96 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
97 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
98 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
99 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
100 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
101 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
102 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
103 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
104 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
105 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
106 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
107 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
108 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
109 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
110 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
111 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
112 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
113 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
114 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
115 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
116 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
117 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
118 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
119 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
120 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
121 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
122 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
123 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
124 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
125 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
126 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
127 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
128 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
129 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
130 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
131 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
132 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
133 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
134 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
135 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
139 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
140 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
141 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
142 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
143 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
144 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
145 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
148 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
149 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
150 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
151 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
154 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
155 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
159 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
162 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
163 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
164 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
165 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
170 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
171 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
181 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
182 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
183 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
184 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
185 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
186 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
187 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
188 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
189 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
190 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
191 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
192 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
201 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
202 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
207 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
208 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
209 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
212 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
213 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
214 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
217 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
218 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
219 2511231004 Pseudomonas sp. GM102 Isolate Nodule
220 2511231006 Pseudomonas sp. GM17 Isolate Nodule
221 2511231007 Pseudomonas sp. GM18 Isolate Nodule
222 2511231008 Pseudomonas sp. GM21 Isolate Nodule
223 2511231010 Pseudomonas sp. GM25 Isolate Nodule
224 2511231011 Pseudomonas sp. GM30 Isolate Nodule
225 2511231012 Pseudomonas sp. GM33 Isolate Nodule
226 2511231014 Pseudomonas sp. GM48 Isolate Nodule
227 2511231015 Pseudomonas sp. GM49 Isolate Nodule
228 2511231016 Pseudomonas sp. GM50 Isolate Nodule
229 2511231017 Pseudomonas sp. GM55 Isolate Nodule
230 2511231018 Pseudomonas sp. GM60 Isolate Nodule
231 2511231019 Pseudomonas sp. GM67 Isolate Nodule
232 2511231020 Pseudomonas sp. GM74 Isolate Nodule
233 2511231021 Pseudomonas sp. GM78 Isolate Nodule
234 2511231022 Pseudomonas sp. GM79 Isolate Nodule
235 2511231023 Pseudomonas sp. GM80 Isolate Nodule
236 2511231031 Pseudomonas sp. GM16 Isolate Nodule
237 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
238 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
239 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
240 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
241 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
242 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
243 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
244 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
245 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
246 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
247 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
248 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
249 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
250 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
251 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
252 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
253 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
254 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
255 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
256 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
257 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
258 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
259 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
260 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
261 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
262 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
263 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
264 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
265 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
266 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
267 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
268 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
269 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
270 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
271 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
272 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
273 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
274 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
275 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
276 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
277 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
278 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
279 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
280 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
281 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
282 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
283 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
284 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
285 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
286 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
287 2773857670 Pseudomonas sp. 478 Isolate Unclassified
288 2784132063 Pseudomonas sp. 424 Isolate Unclassified
289 2784132072 Pseudomonas sp. 460 Isolate Unclassified
290 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
291 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
292 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
293 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
294 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
295 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
296 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
297 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
298 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
299 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
300 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
301 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
302 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
303 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
304 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
305 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
306 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
307 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
308 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
309 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
310 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
311 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
312 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
313 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
314 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
315 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
316 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
317 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
318 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
319 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
320 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
321 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
322 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
323 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
324 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
325 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
326 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
327 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
328 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
329 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
330 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
331 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
332 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
333 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
334 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
335 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
336 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
337 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
338 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
339 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
340 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
341 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
342 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
343 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.34
Metatranscriptomes 0
Isolates 12.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.15
Nodule 2.23
Rhizoplane 3.85
Rhizosphere 77.51
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495673_0002789 3300047469 Bacteria 11937
2 MRS2a_Contig_850 2124908027 Bacteria 12077
3 MRS1b_contig_1629842 2162886011 Bacteria 1745
4 JGI25162J39368_1000099 3300002737 Bacteria 95293
5 JGI25163J39215_1000781 3300002771 Bacteria 7798
6 JGI25163J39215_1001720 3300002771 Bacteria 3090
7 JGI25164J39214_1000077 3300002772 Bacteria 95293
8 JGI25164J39214_1000477 3300002772 Bacteria 19746
9 JGI25164J39214_1000563 3300002772 Bacteria 16855
10 JGI25165J46597_1000182 3300003214 Bacteria 95293
11 JGI25165J46597_1001123 3300003214 Bacteria 16862
12 Ga0055536_1000109 3300003781 Bacteria 72531
13 Ga0055536_1000539 3300003781 Bacteria 25978
14 Ga0055536_1000945 3300003781 Bacteria 18635
15 Ga0055530_10000034 3300003791 Bacteria 118012
16 Ga0055530_10005906 3300003791 Bacteria 5650
17 Ga0055530_10016613 3300003791 Bacteria 2342
18 Ga0055540_1000064 3300003792 Bacteria 127318
19 Ga0055531_10000039 3300003794 Bacteria 141103
20 Ga0065714_10000677 3300005288 Bacteria 3019
21 Ga0065714_10006736 3300005288 Bacteria 3171
22 Ga0065714_10007227 3300005288 Bacteria 4442
23 Ga0065714_10068888 3300005288 Bacteria 4493
24 Ga0065712_10003423 3300005290 Bacteria 3745
25 Ga0065712_10003440 3300005290 Bacteria 4418
26 Ga0070670_100002657 3300005331 Bacteria 14780
27 Ga0070661_100002281 3300005344 Bacteria 13172
28 Ga0070669_100001095 3300005353 Bacteria 19842
29 Ga0070669_100011538 3300005353 Bacteria 6271
30 Ga0070662_100000851 3300005457 Bacteria 18755
31 Ga0068853_100000029 3300005539 Bacteria 121775
32 Ga0070665_100152640 3300005548 Bacteria 2312
33 Ga0070664_100000039 3300005564 Bacteria 79163
34 Ga0068851_10000035 3300005834 Bacteria 106588
35 Ga0075432_10007826 3300006058 Bacteria 3643
36 Ga0075432_10011738 3300006058 Bacteria 2977
37 Ga0075369_10013145 3300006186 Bacteria 3279
38 Ga0075436_100012824 3300006914 Bacteria 5746
39 Ga0075436_100153655 3300006914 Bacteria 1620
40 Ga0079104_1000104 3300006946 Bacteria 123967
41 Ga0105251_10007717 3300009011 Bacteria 6570
42 Ga0105251_10010061 3300009011 Bacteria 5526
43 Ga0105251_10072895 3300009011 Bacteria 1596
44 Ga0105244_10002169 3300009036 Bacteria 15048
45 Ga0105244_10006525 3300009036 Bacteria 7528
46 Ga0105244_10014244 3300009036 Bacteria 4608
47 Ga0105244_10018615 3300009036 Bacteria 3893
48 Ga0105244_10058156 3300009036 Bacteria 1952
49 Ga0105244_10065735 3300009036 Bacteria 1816
50 Ga0105244_10086361 3300009036 Bacteria 1547
51 Ga0105250_10003521 3300009092 Bacteria 7382
52 Ga0105250_10004993 3300009092 Bacteria 6014
53 Ga0105250_10007009 3300009092 Bacteria 4869
54 Ga0105250_10010708 3300009092 Bacteria 3817
55 Ga0105250_10019016 3300009092 Bacteria 2778
56 Ga0105250_10029049 3300009092 Bacteria 2225
57 Ga0105243_10000047 3300009148 Bacteria 154272
58 Ga0105243_10001372 3300009148 Bacteria 21564
59 Ga0105243_10057018 3300009148 Bacteria 3109
60 Ga0105243_10093376 3300009148 Bacteria 2483
61 Ga0105242_10225062 3300009176 Bacteria 1678
62 Ga0105249_10273122 3300009553 Bacteria 1685
63 Ga0105246_10001783 3300011119 Bacteria 12870
64 Ga0157345_1000197 3300012498 Bacteria 9342
65 Ga0157373_10009880 3300013100 Bacteria 7031
66 Ga0157373_10015997 3300013100 Bacteria 5476
67 Ga0157373_10020335 3300013100 Bacteria 4826
68 Ga0157373_10020352 3300013100 Bacteria 4823
69 Ga0157373_10027437 3300013100 Bacteria 4108
70 Ga0157373_10216351 3300013100 Bacteria 1351
71 Ga0157371_10000356 3300013102 Bacteria 58315
72 Ga0157371_10238596 3300013102 Bacteria 1307
73 Ga0157370_10005146 3300013104 Bacteria 14747
74 Ga0157370_10015663 3300013104 Bacteria 7700
75 Ga0157370_10035652 3300013104 Bacteria 4833
76 Ga0157370_10124806 3300013104 Bacteria 2403
77 Ga0157370_10335485 3300013104 Bacteria 1394
78 Ga0157369_10022614 3300013105 Bacteria 7012
79 Ga0157369_10028863 3300013105 Bacteria 6136
80 Ga0157369_10030701 3300013105 Bacteria 5925
81 Ga0157369_10039023 3300013105 Bacteria 5191
82 Ga0163162_10008135 3300013306 Bacteria 10234
83 Ga0163162_10436454 3300013306 Bacteria 1442
84 Ga0157372_10010372 3300013307 Bacteria 9903
85 Ga0157375_10017607 3300013308 Bacteria 6452
86 Ga0157375_10052397 3300013308 Bacteria 4011
87 Ga0157375_10057028 3300013308 Bacteria 3859
88 Ga0157375_10178515 3300013308 Bacteria 2274
89 Ga0182008_10000066 3300014497 Bacteria 88047
90 Ga0182008_10007475 3300014497 Bacteria 6029
91 Ga0182008_10007709 3300014497 Bacteria 5926
92 Ga0182008_10009651 3300014497 Bacteria 5198
93 Ga0182008_10013620 3300014497 Bacteria 4273
94 Ga0182008_10059143 3300014497 Bacteria 1891
95 Ga0182006_1001904 3300015261 Bacteria 11895
96 Ga0182006_1077568 3300015261 Bacteria 1218
97 Ga0182007_10004021 3300015262 Bacteria 6783
98 Ga0182005_1005166 3300015265 Bacteria 4107
99 Ga0182005_1013457 3300015265 Bacteria 2301
100 Ga0163161_10004434 3300017792 Bacteria 9783
101 Ga0163161_10006065 3300017792 Bacteria 8376
102 Ga0163161_10019131 3300017792 Bacteria 4802
103 Ga0163161_10026430 3300017792 Bacteria 4111
104 Ga0163161_10118911 3300017792 Bacteria 1984
105 Ga0209760_100059 3300025207 Bacteria 97774
106 Ga0209760_100140 3300025207 Bacteria 45356
107 Ga0207427_100014 3300025231 Bacteria 561361
108 Ga0207427_100016 3300025231 Bacteria 538697
109 Ga0209437_100011 3300025233 Bacteria 818520
110 Ga0209437_100016 3300025233 Bacteria 710118
111 Ga0209759_1014821 3300025256 Bacteria 2040
112 Ga0209233_1000019 3300025261 Bacteria 818520
113 Ga0209233_1000036 3300025261 Bacteria 561361
114 Ga0209676_1000025 3300025292 Bacteria 577569
115 Ga0209676_1000032 3300025292 Bacteria 469558
116 Ga0209676_1000208 3300025292 Bacteria 130879
117 Ga0209050_1000025 3300025298 Bacteria 528225
118 Ga0209050_1000099 3300025298 Bacteria 232176
119 Ga0209050_1001463 3300025298 Bacteria 25262
120 Ga0209051_1000026 3300025303 Bacteria 413311
121 Ga0209051_1000039 3300025303 Bacteria 319632
122 Ga0209051_1000047 3300025303 Bacteria 293227
123 Ga0209257_1000034 3300025304 Bacteria 662719
124 Ga0207656_10000008 3300025321 Bacteria 275365
125 Ga0207696_1000084 3300025711 Bacteria 196086
126 Ga0207696_1000563 3300025711 Bacteria 29281
127 Ga0207696_1003779 3300025711 Bacteria 6749
128 Ga0207696_1006428 3300025711 Bacteria 4739
129 Ga0207655_1000162 3300025728 Bacteria 122768
130 Ga0207655_1000495 3300025728 Bacteria 50771
131 Ga0207655_1001897 3300025728 Bacteria 17953
132 Ga0207655_1002594 3300025728 Bacteria 14396
133 Ga0207655_1005378 3300025728 Bacteria 8721
134 Ga0207655_1005689 3300025728 Bacteria 8426
135 Ga0207655_1009290 3300025728 Bacteria 6123
136 Ga0207655_1013422 3300025728 Bacteria 4706
137 Ga0207655_1013802 3300025728 Bacteria 4610
138 Ga0207655_1015415 3300025728 Bacteria 4250
139 Ga0207713_1001090 3300025735 Bacteria 23284
140 Ga0207713_1001569 3300025735 Bacteria 17923
141 Ga0207713_1003590 3300025735 Bacteria 10474
142 Ga0207713_1004477 3300025735 Bacteria 9054
143 Ga0207713_1007019 3300025735 Bacteria 6747
144 Ga0207713_1007259 3300025735 Bacteria 6576
145 Ga0207713_1007321 3300025735 Bacteria 6537
146 Ga0207713_1024486 3300025735 Bacteria 2814
147 Ga0207671_10000015 3300025914 Bacteria 439607
148 Ga0207649_10000001 3300025920 Bacteria 537851
149 Ga0207681_10000325 3300025923 Bacteria 34341
150 Ga0207681_10005906 3300025923 Bacteria 7505
151 Ga0207650_10000186 3300025925 Bacteria 72380
152 Ga0207706_10000081 3300025933 Bacteria 98791
153 Ga0207686_10102983 3300025934 Bacteria 1909
154 Ga0207709_10000040 3300025935 Bacteria 259497
155 Ga0207709_10000249 3300025935 Bacteria 65683
156 Ga0207709_10042300 3300025935 Bacteria 2740
157 Ga0207679_10000009 3300025945 Bacteria 357262
158 Ga0207712_10197618 3300025961 Bacteria 1592
159 Ga0207639_10000090 3300026041 Bacteria 76134
160 Ga0209281_1000026 3300027111 Bacteria 465877
161 Ga0209281_1007948 3300027111 Bacteria 2614
162 Ga0207428_10099323 3300027907 Bacteria 2251
163 Ga0207428_10169211 3300027907 Bacteria 1656
164 Ga0207428_10169925 3300027907 Bacteria 1652
165 Ga0307511_10142236 3300030521 Bacteria 1405
166 Ga0316179_1066635 3300030734 Bacteria 4562
167 Ga0307509_10043687 3300031507 Bacteria 4848
168 Ga0307516_10198683 3300031730 Bacteria 1726
169 Ga0307405_10003246 3300031731 Bacteria 7416
170 Ga0307407_10113432 3300031903 Bacteria 1706
171 Ga0307412_10056702 3300031911 Bacteria 2612
172 Ga0307412_10335246 3300031911 Bacteria 1208
173 Ga0307416_100190002 3300032002 Bacteria 1935
174 Ga0307414_10105636 3300032004 Bacteria 2129
175 Ga0307414_10122438 3300032004 Bacteria 2002
176 Ga0307510_10048465 3300033180 Bacteria 4532
177 Ga0439438_001810 3300041405 Bacteria 9375
178 Ga0439438_006065 3300041405 Bacteria 4332
179 Ga0439438_012300 3300041405 Bacteria 2626
180 Ga0439438_014555 3300041405 Bacteria 2338
181 Ga0439438_021163 3300041405 Bacteria 1817
182 Ga0439447_001459 3300041407 Bacteria 8685
183 Ga0439447_004123 3300041407 Bacteria 5055
184 Ga0439447_005640 3300041407 Bacteria 4142
185 Ga0439447_014479 3300041407 Bacteria 2211
186 Ga0439447_038722 3300041407 Bacteria 1170
187 Ga0439461_0009312 3300041410 Bacteria 1779
188 Ga0439466_0000592 3300041411 Bacteria 13588
189 Ga0439466_0003823 3300041411 Bacteria 5812
190 Ga0439466_0004719 3300041411 Bacteria 5236
191 Ga0439466_0005992 3300041411 Bacteria 4626
192 Ga0439466_0013675 3300041411 Bacteria 2968
193 Ga0439466_0021708 3300041411 Bacteria 2271
194 Ga0439466_0025185 3300041411 Bacteria 2078
195 Ga0439466_0039577 3300041411 Bacteria 1579
196 Ga0439465_0005193 3300041413 Bacteria 4175
197 Ga0439445_0020996 3300042004 Bacteria 1638
198 Ga0439432_005217 3300042006 Bacteria 4693
199 Ga0439432_005529 3300042006 Bacteria 4547
200 Ga0439432_006258 3300042006 Bacteria 4257
201 Ga0439432_026061 3300042006 Bacteria 1914
202 Ga0439451_000777 3300042009 Bacteria 6068
203 Ga0439451_001521 3300042009 Bacteria 4586
204 Ga0439451_004112 3300042009 Bacteria 2952
205 Ga0439451_011103 3300042009 Bacteria 1816
206 Ga0439451_017591 3300042009 Bacteria 1441
207 Ga0439451_029685 3300042009 Bacteria 1100
208 Ga0439452_001440 3300042010 Bacteria 9721
209 Ga0439452_002739 3300042010 Bacteria 6381
210 Ga0439452_003601 3300042010 Bacteria 5398
211 Ga0439452_003840 3300042010 Bacteria 5159
212 Ga0439452_010235 3300042010 Bacteria 2738
213 Ga0439456_000042 3300042013 Bacteria 46567
214 Ga0439456_002784 3300042013 Bacteria 3524
215 Ga0439456_003896 3300042013 Bacteria 3030
216 Ga0439456_008302 3300042013 Bacteria 2143
217 Ga0439463_001102 3300042016 Bacteria 7260
218 Ga0439463_001271 3300042016 Bacteria 6741
219 Ga0439463_006770 3300042016 Bacteria 2835
220 Ga0439463_021443 3300042016 Bacteria 1613
221 Ga0439463_037721 3300042016 Bacteria 1226
222 Ga0439463_048463 3300042016 Bacteria 1082
223 Ga0450911_000394 3300042115 Bacteria 14425
224 Ga0450911_001041 3300042115 Bacteria 7069
225 Ga0450911_002240 3300042115 Bacteria 3893
226 Ga0450922_000105 3300042124 Bacteria 8081
227 Ga0450922_000231 3300042124 Bacteria 6024
228 Ga0450890_000865 3300042127 Bacteria 4370
229 Ga0450896_002506 3300042133 Bacteria 2376
230 Ga0450898_001042 3300042134 Bacteria 3511
231 Ga0450900_001006 3300042136 Bacteria 2568
232 Ga0450902_003491 3300042137 Bacteria 2296
233 Ga0450902_012476 3300042137 Bacteria 1360
234 Ga0450903_001446 3300042138 Bacteria 4437
235 Ga0450903_002348 3300042138 Bacteria 3377
236 Ga0450903_007061 3300042138 Bacteria 1854
237 Ga0450903_010965 3300042138 Bacteria 1462
238 Ga0450903_012008 3300042138 Bacteria 1388
239 Ga0450904_000669 3300042139 Bacteria 6122
240 Ga0450904_001373 3300042139 Bacteria 3497
241 Ga0450905_003458 3300042142 Bacteria 2074
242 Ga0450905_008268 3300042142 Bacteria 1423
243 Ga0450905_011984 3300042142 Bacteria 1218
244 Ga0450906_000140 3300042145 Bacteria 13120
245 Ga0450906_001955 3300042145 Bacteria 4501
246 Ga0450906_002634 3300042145 Bacteria 3917
247 Ga0450907_001035 3300042146 Bacteria 6513
248 Ga0450907_001261 3300042146 Bacteria 5673
249 Ga0450907_001828 3300042146 Bacteria 4375
250 Ga0450907_013197 3300042146 Bacteria 1375
251 Ga0450910_000899 3300042147 Bacteria 3587
252 Ga0450910_001208 3300042147 Bacteria 3212
253 Ga0439446_0001111 3300042156 Bacteria 5953
254 Ga0450909_000748 3300042185 Bacteria 4386
255 Ga0439434_0001029 3300042435 Bacteria 8072
256 Ga0439464_0001818 3300042439 Bacteria 5149
257 Ga0439460_0002815 3300042461 Bacteria 4189
258 Ga0439460_0005433 3300042461 Bacteria 3126
259 Ga0450918_001677 3300042531 Bacteria 4342
260 Ga0450918_005599 3300042531 Bacteria 2254
261 Ga0450918_005678 3300042531 Bacteria 2235
262 Ga0450893_0003049 3300042532 Bacteria 2635
263 Ga0450901_000527 3300042533 Bacteria 4541
264 Ga0439440_0013454 3300042993 Bacteria 1755
265 Ga0466968_0075512 3300044735 Bacteria 1473
266 Ga0495617_002678 3300046452 Bacteria 6932
267 Ga0495617_003151 3300046452 Bacteria 6279
268 Ga0495617_003353 3300046452 Bacteria 6048
269 Ga0495617_006218 3300046452 Bacteria 4202
270 Ga0495617_010915 3300046452 Bacteria 3108
271 Ga0495617_013399 3300046452 Bacteria 2789
272 Ga0495617_014309 3300046452 Bacteria 2696
273 Ga0495617_018078 3300046452 Bacteria 2383
274 Ga0495617_018600 3300046452 Bacteria 2349
275 Ga0495617_047445 3300046452 Bacteria 1429
276 Ga0495617_073142 3300046452 Bacteria 1126
277 Ga0495627_001941 3300046453 Bacteria 10765
278 Ga0495627_002145 3300046453 Bacteria 9915
279 Ga0495627_002251 3300046453 Bacteria 9551
280 Ga0495627_002921 3300046453 Bacteria 7857
281 Ga0495627_006178 3300046453 Bacteria 4719
282 Ga0495627_010854 3300046453 Bacteria 3293
283 Ga0495627_022247 3300046453 Bacteria 2088
284 Ga0495627_026839 3300046453 Bacteria 1853
285 Ga0495592_0032447 3300046454 Bacteria 3939
286 Ga0495603_0013842 3300046455 Bacteria 4883
287 Ga0495590_0001133 3300046457 Bacteria 11668
288 Ga0495590_0005329 3300046457 Bacteria 5108
289 Ga0495590_0006995 3300046457 Bacteria 4374
290 Ga0495591_001039 3300046458 Bacteria 18743
291 Ga0495591_001516 3300046458 Bacteria 14289
292 Ga0495591_003403 3300046458 Bacteria 8241
293 Ga0495591_004687 3300046458 Bacteria 6568
294 Ga0495591_007643 3300046458 Bacteria 4558
295 Ga0495591_008847 3300046458 Bacteria 4069
296 Ga0495591_009680 3300046458 Bacteria 3806
297 Ga0495591_015548 3300046458 Bacteria 2682
298 Ga0495591_023973 3300046458 Bacteria 1944
299 Ga0495591_024727 3300046458 Bacteria 1897
300 Ga0495638_0004345 3300046460 Bacteria 10737
301 Ga0495638_0007860 3300046460 Bacteria 7608
302 Ga0495638_0010713 3300046460 Bacteria 6347
303 Ga0495638_0010935 3300046460 Bacteria 6275
304 Ga0495638_0012479 3300046460 Bacteria 5821
305 Ga0495638_0015980 3300046460 Bacteria 5030
306 Ga0495638_0017979 3300046460 Bacteria 4704
307 Ga0495638_0022211 3300046460 Bacteria 4167
308 Ga0495638_0025088 3300046460 Bacteria 3878
309 Ga0495638_0029352 3300046460 Bacteria 3546
310 Ga0495638_0040760 3300046460 Bacteria 2941
311 Ga0495638_0056338 3300046460 Bacteria 2439
312 Ga0495638_0092120 3300046460 Bacteria 1824
313 Ga0495638_0119522 3300046460 Bacteria 1558
314 Ga0495638_0129236 3300046460 Bacteria 1485
315 Ga0495638_0218483 3300046460 Bacteria 1066
316 Ga0495653_0001680 3300046463 Bacteria 17412
317 Ga0495653_0027312 3300046463 Bacteria 4568
318 Ga0495650_0001827 3300046471 Bacteria 19067
319 Ga0495650_0006454 3300046471 Bacteria 7298
320 Ga0495650_0010566 3300046471 Bacteria 5140
321 Ga0495650_0012672 3300046471 Bacteria 4518
322 Ga0495650_0013248 3300046471 Bacteria 4373
323 Ga0495650_0074844 3300046471 Bacteria 1319
324 Ga0495605_0002176 3300046474 Bacteria 12245
325 Ga0495605_0010638 3300046474 Bacteria 5143
326 Ga0495605_0010842 3300046474 Bacteria 5090
327 Ga0495605_0017100 3300046474 Bacteria 3914
328 Ga0495605_0018537 3300046474 Bacteria 3730
329 Ga0495605_0022666 3300046474 Bacteria 3312
330 Ga0495605_0033448 3300046474 Bacteria 2608
331 Ga0495605_0046015 3300046474 Bacteria 2147
332 Ga0495605_0053637 3300046474 Bacteria 1955
333 Ga0495605_0093424 3300046474 Bacteria 1391
334 Ga0495605_0100391 3300046474 Bacteria 1331
335 Ga0495639_0000294 3300046475 Bacteria 24430
336 Ga0495639_0001785 3300046475 Bacteria 9530
337 Ga0495639_0038701 3300046475 Bacteria 2143
338 Ga0495584_0001126 3300046491 Bacteria 16567
339 Ga0495584_0003398 3300046491 Bacteria 8781
340 Ga0495584_0004328 3300046491 Bacteria 7645
341 Ga0495584_0004718 3300046491 Bacteria 7300
342 Ga0495584_0006726 3300046491 Bacteria 6014
343 Ga0495584_0007670 3300046491 Bacteria 5619
344 Ga0495584_0009340 3300046491 Bacteria 5052
345 Ga0495584_0012644 3300046491 Bacteria 4308
346 Ga0495584_0013707 3300046491 Bacteria 4134
347 Ga0495584_0015059 3300046491 Bacteria 3941
348 Ga0495584_0024264 3300046491 Bacteria 3075
349 Ga0495584_0029698 3300046491 Bacteria 2771
350 Ga0495584_0075337 3300046491 Bacteria 1696
351 Ga0495584_0126176 3300046491 Bacteria 1297
352 Ga0495585_0005734 3300046492 Bacteria 7792
353 Ga0495585_0007018 3300046492 Bacteria 6935
354 Ga0495585_0009875 3300046492 Bacteria 5706
355 Ga0495585_0013870 3300046492 Bacteria 4708
356 Ga0495585_0015812 3300046492 Bacteria 4380
357 Ga0495585_0016466 3300046492 Bacteria 4283
358 Ga0495585_0019200 3300046492 Bacteria 3943
359 Ga0495585_0023982 3300046492 Bacteria 3499
360 Ga0495585_0033785 3300046492 Bacteria 2893
361 Ga0495585_0076019 3300046492 Bacteria 1825
362 Ga0495594_0008086 3300046499 Bacteria 5408
363 Ga0495594_0017310 3300046499 Bacteria 3806
364 Ga0495596_0000825 3300046500 Bacteria 18761
365 Ga0495596_0007273 3300046500 Bacteria 5006
366 Ga0495596_0082948 3300046500 Bacteria 1244
367 Ga0495607_0002173 3300046501 Bacteria 16309
368 Ga0495607_0006196 3300046501 Bacteria 8448
369 Ga0495607_0006943 3300046501 Bacteria 7893
370 Ga0495607_0008967 3300046501 Bacteria 6808
371 Ga0495607_0013127 3300046501 Bacteria 5438
372 Ga0495607_0016070 3300046501 Bacteria 4835
373 Ga0495607_0024480 3300046501 Bacteria 3763
374 Ga0495607_0041434 3300046501 Bacteria 2735
375 Ga0495607_0043338 3300046501 Bacteria 2661
376 Ga0495607_0061026 3300046501 Bacteria 2143
377 Ga0495607_0077843 3300046501 Bacteria 1831
378 Ga0495607_0102281 3300046501 Bacteria 1533
379 Ga0495607_0122005 3300046501 Bacteria 1366
380 Ga0495607_0128723 3300046501 Bacteria 1320
381 Ga0495583_0002730 3300046506 Bacteria 14615
382 Ga0495583_0006786 3300046506 Bacteria 7398
383 Ga0495583_0012126 3300046506 Bacteria 4902
384 Ga0495583_0022567 3300046506 Bacteria 3206
385 Ga0495583_0096225 3300046506 Bacteria 1269
386 Ga0495583_0103834 3300046506 Bacteria 1210
387 Ga0495606_0005981 3300046507 Bacteria 11404
388 Ga0495606_0006105 3300046507 Bacteria 11248
389 Ga0495606_0007126 3300046507 Bacteria 10106
390 Ga0495606_0014993 3300046507 Bacteria 6007
391 Ga0495610_0002705 3300046512 Bacteria 14619
392 Ga0495610_0004480 3300046512 Bacteria 10301
393 Ga0495610_0005819 3300046512 Bacteria 8665
394 Ga0495610_0007574 3300046512 Bacteria 7190
395 Ga0495610_0007679 3300046512 Bacteria 7122
396 Ga0495610_0007944 3300046512 Bacteria 6963
397 Ga0495610_0010183 3300046512 Bacteria 5867
398 Ga0495610_0010214 3300046512 Bacteria 5855
399 Ga0495610_0011112 3300046512 Bacteria 5528
400 Ga0495610_0035752 3300046512 Bacteria 2546
401 Ga0495610_0064586 3300046512 Bacteria 1729
402 Ga0495616_0001868 3300046513 Bacteria 14254
403 Ga0495616_0004365 3300046513 Bacteria 8922
404 Ga0495616_0005720 3300046513 Bacteria 7611
405 Ga0495616_0005865 3300046513 Bacteria 7493
406 Ga0495616_0011117 3300046513 Bacteria 5169
407 Ga0495616_0020557 3300046513 Bacteria 3588
408 Ga0495616_0021542 3300046513 Bacteria 3488
409 Ga0495616_0024542 3300046513 Bacteria 3233
410 Ga0495616_0034152 3300046513 Bacteria 2643
411 Ga0495616_0045143 3300046513 Bacteria 2232
412 Ga0495616_0074568 3300046513 Bacteria 1634
413 Ga0495620_0000052 3300046515 Bacteria 103693
414 Ga0495620_0001033 3300046515 Bacteria 17093
415 Ga0495620_0001500 3300046515 Bacteria 13890
416 Ga0495620_0003073 3300046515 Bacteria 9584
417 Ga0495620_0003951 3300046515 Bacteria 8430
418 Ga0495620_0007188 3300046515 Bacteria 6066
419 Ga0495620_0008807 3300046515 Bacteria 5398
420 Ga0495620_0011042 3300046515 Bacteria 4730
421 Ga0495620_0042063 3300046515 Bacteria 1998
422 Ga0495620_0089590 3300046515 Bacteria 1235
423 Ga0495628_0036518 3300046516 Bacteria 3942
424 Ga0495630_0014872 3300046517 Bacteria 5675
425 Ga0495630_0017201 3300046517 Bacteria 5294
426 Ga0495630_0057475 3300046517 Bacteria 2915
427 Ga0495631_0003014 3300046518 Bacteria 9319
428 Ga0495631_0003855 3300046518 Bacteria 8124
429 Ga0495631_0006062 3300046518 Bacteria 6279
430 Ga0495631_0006628 3300046518 Bacteria 5955
431 Ga0495631_0010723 3300046518 Bacteria 4530
432 Ga0495631_0014825 3300046518 Bacteria 3752
433 Ga0495632_0000210 3300046519 Bacteria 59119
434 Ga0495632_0001609 3300046519 Bacteria 18580
435 Ga0495632_0004883 3300046519 Bacteria 8992
436 Ga0495632_0006031 3300046519 Bacteria 7871
437 Ga0495632_0008656 3300046519 Bacteria 6214
438 Ga0495632_0012386 3300046519 Bacteria 4922
439 Ga0495632_0012627 3300046519 Bacteria 4861
440 Ga0495632_0016521 3300046519 Bacteria 4101
441 Ga0495632_0021306 3300046519 Bacteria 3494
442 Ga0495632_0025739 3300046519 Bacteria 3108
443 Ga0495632_0049661 3300046519 Bacteria 2073
444 Ga0495632_0054136 3300046519 Bacteria 1967
445 Ga0495632_0057612 3300046519 Bacteria 1896
446 Ga0495632_0064845 3300046519 Bacteria 1765
447 Ga0495632_0090953 3300046519 Bacteria 1446
448 Ga0495637_0001728 3300046520 Bacteria 12538
449 Ga0495637_0003277 3300046520 Bacteria 8615
450 Ga0495637_0004668 3300046520 Bacteria 7076
451 Ga0495637_0004680 3300046520 Bacteria 7064
452 Ga0495637_0004823 3300046520 Bacteria 6954
453 Ga0495637_0005107 3300046520 Bacteria 6732
454 Ga0495637_0005172 3300046520 Bacteria 6683
455 Ga0495637_0009869 3300046520 Bacteria 4642
456 Ga0495637_0011171 3300046520 Bacteria 4319
457 Ga0495637_0016642 3300046520 Bacteria 3435
458 Ga0495637_0019095 3300046520 Bacteria 3171
459 Ga0495637_0022273 3300046520 Bacteria 2891
460 Ga0495637_0023277 3300046520 Bacteria 2817
461 Ga0495637_0030032 3300046520 Bacteria 2413
462 Ga0495643_0000197 3300046522 Bacteria 95489
463 Ga0495643_0000344 3300046522 Bacteria 63135
464 Ga0495643_0003510 3300046522 Bacteria 11416
465 Ga0495643_0006716 3300046522 Bacteria 7531
466 Ga0495643_0009107 3300046522 Bacteria 6219
467 Ga0495643_0024178 3300046522 Bacteria 3448
468 Ga0495643_0032116 3300046522 Bacteria 2916
469 Ga0495643_0124790 3300046522 Bacteria 1297
470 Ga0495644_0001046 3300046523 Bacteria 11535
471 Ga0495644_0001271 3300046523 Bacteria 10359
472 Ga0495644_0007710 3300046523 Bacteria 4150
473 Ga0495644_0008800 3300046523 Bacteria 3882
474 Ga0495644_0009183 3300046523 Bacteria 3809
475 Ga0495648_0000679 3300046524 Bacteria 36303
476 Ga0495648_0002981 3300046524 Bacteria 15191
477 Ga0495648_0006163 3300046524 Bacteria 9831
478 Ga0495648_0015264 3300046524 Bacteria 5585
479 Ga0495648_0016039 3300046524 Bacteria 5409
480 Ga0495648_0017930 3300046524 Bacteria 5038
481 Ga0495648_0022217 3300046524 Bacteria 4372
482 Ga0495648_0025483 3300046524 Bacteria 4002
483 Ga0495648_0032407 3300046524 Bacteria 3429
484 Ga0495648_0035719 3300046524 Bacteria 3218
485 Ga0495648_0040632 3300046524 Bacteria 2947
486 Ga0495648_0087021 3300046524 Bacteria 1761
487 Ga0495666_0005963 3300046526 Bacteria 6143
488 Ga0495666_0007854 3300046526 Bacteria 5342
489 Ga0495666_0065205 3300046526 Bacteria 1737
490 Ga0495642_0001171 3300046528 Bacteria 12049
491 Ga0495642_0002264 3300046528 Bacteria 7869
492 Ga0495642_0003292 3300046528 Bacteria 6385
493 Ga0495652_0211054 3300046529 Bacteria 1466
494 Ga0495654_0001750 3300046530 Bacteria 14546
495 Ga0495654_0001797 3300046530 Bacteria 14286
496 Ga0495654_0002117 3300046530 Bacteria 12962
497 Ga0495654_0005462 3300046530 Bacteria 7376
498 Ga0495654_0006180 3300046530 Bacteria 6843
499 Ga0495654_0007154 3300046530 Bacteria 6265
500 Ga0495654_0007720 3300046530 Bacteria 5988
501 Ga0495654_0014074 3300046530 Bacteria 4265
502 Ga0495654_0024461 3300046530 Bacteria 3119
503 Ga0495654_0024851 3300046530 Bacteria 3090
504 Ga0495654_0033498 3300046530 Bacteria 2599
505 Ga0495654_0055779 3300046530 Bacteria 1911
506 Ga0495654_0059569 3300046530 Bacteria 1838
507 Ga0495654_0070413 3300046530 Bacteria 1658
508 Ga0495654_0140078 3300046530 Bacteria 1078
509 Ga0495586_0006337 3300046535 Bacteria 6322
510 Ga0495587_0005500 3300046536 Bacteria 8264
511 Ga0495587_0007573 3300046536 Bacteria 7023
512 Ga0495609_0002518 3300046538 Bacteria 11243
513 Ga0495609_0007681 3300046538 Bacteria 5354
514 Ga0495609_0019508 3300046538 Bacteria 3136
515 Ga0495609_0044832 3300046538 Bacteria 1983
516 Ga0495609_0080478 3300046538 Bacteria 1424
517 Ga0495609_0086719 3300046538 Bacteria 1364
518 Ga0495597_0003741 3300046542 Bacteria 8675
519 Ga0495597_0005474 3300046542 Bacteria 6717
520 Ga0495597_0014704 3300046542 Bacteria 3723
521 Ga0495597_0018196 3300046542 Bacteria 3299
522 Ga0495597_0021608 3300046542 Bacteria 2990
523 Ga0495597_0028064 3300046542 Bacteria 2577
524 Ga0495597_0084035 3300046542 Bacteria 1358
525 Ga0495645_0162104 3300046543 Bacteria 1545
526 Ga0495622_0002723 3300046557 Bacteria 8460
527 Ga0495622_0005121 3300046557 Bacteria 6073
528 Ga0495622_0047534 3300046557 Bacteria 1993
529 Ga0495622_0057333 3300046557 Bacteria 1805
530 Ga0495622_0069293 3300046557 Bacteria 1628
531 Ga0495633_0004035 3300046558 Bacteria 9497
532 Ga0495633_0005819 3300046558 Bacteria 7435
533 Ga0495633_0020239 3300046558 Bacteria 3350
534 Ga0495633_0061675 3300046558 Bacteria 1755
535 Ga0495633_0074783 3300046558 Bacteria 1578
536 Ga0495656_0024139 3300046615 Bacteria 2398
537 Ga0495668_0001129 3300046616 Bacteria 27359
538 Ga0495668_0002393 3300046616 Bacteria 15548
539 Ga0495668_0011216 3300046616 Bacteria 5379
540 Ga0495634_0008471 3300046642 Bacteria 7650
541 Ga0495634_0023826 3300046642 Bacteria 4300
542 Ga0495611_0001084 3300046648 Bacteria 14351
543 Ga0495611_0008804 3300046648 Bacteria 4269
544 Ga0495611_0018224 3300046648 Bacteria 3009
545 Ga0495611_0032834 3300046648 Bacteria 2289
546 Ga0495611_0042105 3300046648 Bacteria 2038
547 Ga0495625_0003953 3300046660 Bacteria 14244
548 Ga0495625_0006328 3300046660 Bacteria 10584
549 Ga0495625_0007050 3300046660 Bacteria 9878
550 Ga0495625_0011065 3300046660 Bacteria 7392
551 Ga0495625_0011399 3300046660 Bacteria 7255
552 Ga0495625_0024389 3300046660 Bacteria 4604
553 Ga0495625_0051744 3300046660 Bacteria 2943
554 Ga0495625_0091901 3300046660 Bacteria 2097
555 Ga0495625_0159788 3300046660 Bacteria 1510
556 Ga0495625_0211104 3300046660 Bacteria 1276
557 Ga0495635_0011238 3300046663 Bacteria 6277
558 Ga0495635_0015853 3300046663 Bacteria 5264
559 Ga0495659_0001680 3300046664 Bacteria 7418
560 Ga0495659_0002221 3300046664 Bacteria 6313
561 Ga0495659_0019940 3300046664 Bacteria 2247
562 Ga0495659_0036456 3300046664 Bacteria 1737
563 Ga0495661_0001354 3300046665 Bacteria 20741
564 Ga0495661_0009797 3300046665 Bacteria 6556
565 Ga0495661_0010223 3300046665 Bacteria 6412
566 Ga0495661_0064894 3300046665 Bacteria 2152
567 Ga0495661_0065744 3300046665 Bacteria 2136
568 Ga0495661_0116326 3300046665 Bacteria 1483
569 Ga0495588_0003321 3300046674 Bacteria 6982
570 Ga0495588_0007109 3300046674 Bacteria 5075
571 Ga0495588_0012513 3300046674 Bacteria 4013
572 Ga0495588_0054506 3300046674 Bacteria 2063
573 Ga0495623_0018761 3300046679 Bacteria 4466
574 Ga0495646_0003357 3300046680 Bacteria 9956
575 Ga0495646_0007624 3300046680 Bacteria 6876
576 Ga0495669_0000275 3300046684 Bacteria 29419
577 Ga0495669_0014283 3300046684 Bacteria 3395
578 Ga0495613_0007674 3300046689 Bacteria 8026
579 Ga0495613_0019593 3300046689 Bacteria 5042
580 Ga0495613_0032984 3300046689 Bacteria 3848
581 Ga0495670_0002096 3300046691 Bacteria 9838
582 Ga0495670_0002438 3300046691 Bacteria 9187
583 Ga0495670_0002606 3300046691 Bacteria 8907
584 Ga0495670_0003560 3300046691 Bacteria 7652
585 Ga0495670_0017283 3300046691 Bacteria 3548
586 Ga0495670_0025591 3300046691 Bacteria 2919
587 Ga0495670_0035586 3300046691 Bacteria 2481
588 Ga0495670_0049803 3300046691 Bacteria 2096
589 Ga0495670_0062467 3300046691 Bacteria 1874
590 Ga0495671_0002446 3300046692 Bacteria 11721
591 Ga0495671_0002796 3300046692 Bacteria 10915
592 Ga0495671_0002816 3300046692 Bacteria 10881
593 Ga0495671_0005620 3300046692 Bacteria 7313
594 Ga0495671_0006769 3300046692 Bacteria 6594
595 Ga0495671_0007523 3300046692 Bacteria 6203
596 Ga0495671_0009714 3300046692 Bacteria 5363
597 Ga0495671_0012989 3300046692 Bacteria 4530
598 Ga0495671_0021336 3300046692 Bacteria 3404
599 Ga0495671_0026252 3300046692 Bacteria 3021
600 Ga0495671_0034544 3300046692 Bacteria 2570
601 Ga0495671_0077052 3300046692 Bacteria 1634
602 Ga0495671_0087232 3300046692 Bacteria 1528
603 Ga0495649_0001197 3300046694 Bacteria 20009
604 Ga0495649_0003408 3300046694 Bacteria 10744
605 Ga0495649_0003507 3300046694 Bacteria 10559
606 Ga0495649_0005650 3300046694 Bacteria 7896
607 Ga0495649_0009983 3300046694 Bacteria 5612
608 Ga0495649_0013051 3300046694 Bacteria 4804
609 Ga0495649_0017655 3300046694 Bacteria 4023
610 Ga0495649_0018688 3300046694 Bacteria 3896
611 Ga0495649_0026244 3300046694 Bacteria 3241
612 Ga0495649_0032363 3300046694 Bacteria 2880
613 Ga0495649_0040829 3300046694 Bacteria 2538
614 Ga0495649_0063351 3300046694 Bacteria 1986
615 Ga0495649_0141158 3300046694 Bacteria 1268
616 Ga0495589_0000573 3300046794 Bacteria 25427
617 Ga0495589_0002034 3300046794 Bacteria 11443
618 Ga0495589_0002449 3300046794 Bacteria 10419
619 Ga0495589_0006573 3300046794 Bacteria 6127
620 Ga0495589_0011999 3300046794 Bacteria 4493
621 Ga0495589_0013119 3300046794 Bacteria 4277
622 Ga0495589_0013802 3300046794 Bacteria 4167
623 Ga0495589_0016586 3300046794 Bacteria 3784
624 Ga0495589_0030713 3300046794 Bacteria 2705
625 Ga0495589_0043032 3300046794 Bacteria 2249
626 Ga0495600_0006569 3300046809 Bacteria 7078
627 Ga0495600_0047768 3300046809 Bacteria 2792
628 Ga0495600_0059004 3300046809 Bacteria 2506
629 Ga0495660_0009794 3300046810 Bacteria 5581
630 Ga0495660_0014300 3300046810 Bacteria 4595
631 Ga0495660_0014620 3300046810 Bacteria 4539
632 Ga0495660_0020607 3300046810 Bacteria 3779
633 Ga0495660_0021169 3300046810 Bacteria 3725
634 Ga0495660_0025778 3300046810 Bacteria 3336
635 Ga0495660_0050427 3300046810 Bacteria 2267
636 Ga0495660_0054307 3300046810 Bacteria 2170
637 Ga0495660_0054765 3300046810 Bacteria 2160
638 Ga0495660_0070638 3300046810 Bacteria 1852
639 Ga0495660_0110059 3300046810 Bacteria 1406
640 Ga0495581_0009732 3300047315 Bacteria 5563
641 Ga0495604_0005000 3300047317 Bacteria 10499
642 Ga0495604_0008683 3300047317 Bacteria 8031
643 Ga0495604_0021610 3300047317 Bacteria 5138
644 Ga0495636_0019518 3300047318 Bacteria 2725
645 Ga0495674_0040813 3300047319 Bacteria 4148
646 Ga0495672_0002646 3300047320 Bacteria 16164
647 Ga0495672_0003540 3300047320 Bacteria 13298
648 Ga0495672_0004515 3300047320 Bacteria 11359
649 Ga0495672_0005186 3300047320 Bacteria 10389
650 Ga0495672_0005696 3300047320 Bacteria 9813
651 Ga0495672_0011462 3300047320 Bacteria 6256
652 Ga0495672_0013136 3300047320 Bacteria 5728
653 Ga0495672_0014058 3300047320 Bacteria 5496
654 Ga0495672_0023425 3300047320 Bacteria 3996
655 Ga0495672_0033995 3300047320 Bacteria 3154
656 Ga0495672_0042348 3300047320 Bacteria 2746
657 Ga0495672_0141604 3300047320 Bacteria 1255
658 Ga0495676_0003332 3300047321 Bacteria 14524
659 Ga0495676_0039359 3300047321 Bacteria 3916
660 Ga0495680_0005487 3300047322 Bacteria 11923
661 Ga0495680_0013007 3300047322 Bacteria 7281
662 Ga0495680_0015346 3300047322 Bacteria 6609
663 Ga0495680_0017202 3300047322 Bacteria 6184
664 Ga0495680_0049858 3300047322 Bacteria 3276
665 Ga0495683_0001176 3300047323 Bacteria 17863
666 Ga0495683_0003293 3300047323 Bacteria 9441
667 Ga0495683_0005969 3300047323 Bacteria 6689
668 Ga0495683_0014780 3300047323 Bacteria 4065
669 Ga0495683_0015298 3300047323 Bacteria 3994
670 Ga0495683_0040849 3300047323 Bacteria 2342
671 Ga0495683_0056229 3300047323 Bacteria 1957
672 Ga0495683_0069250 3300047323 Bacteria 1734
673 Ga0495683_0072992 3300047323 Bacteria 1683
674 Ga0495683_0125733 3300047323 Bacteria 1213
675 Ga0495687_002029 3300047443 Bacteria 17125
676 Ga0495687_002352 3300047443 Bacteria 15339
677 Ga0495687_005636 3300047443 Bacteria 7911
678 Ga0495687_017951 3300047443 Bacteria 3511
679 Ga0495675_0034124 3300047444 Bacteria 3247
680 Ga0495675_0221592 3300047444 Bacteria 1144
681 Ga0495677_0024480 3300047445 Bacteria 2189
682 Ga0495677_0025495 3300047445 Bacteria 2145
683 Ga0495679_001001 3300047446 Bacteria 17395
684 Ga0495679_001762 3300047446 Bacteria 11881
685 Ga0495679_003869 3300047446 Bacteria 7085
686 Ga0495679_004363 3300047446 Bacteria 6555
687 Ga0495679_004730 3300047446 Bacteria 6181
688 Ga0495679_005012 3300047446 Bacteria 5959
689 Ga0495679_010118 3300047446 Bacteria 3725
690 Ga0495679_010261 3300047446 Bacteria 3687
691 Ga0495685_001865 3300047447 Bacteria 6511
692 Ga0495685_041915 3300047447 Bacteria 1563
693 Ga0495673_0001224 3300047469 Bacteria 21295
694 Ga0495673_0001229 3300047469 Bacteria 21226
695 Ga0495673_0002473 3300047469 Bacteria 12979
696 Ga0495673_0002511 3300047469 Bacteria 12837
697 Ga0495673_0003744 3300047469 Bacteria 9870
698 Ga0495673_0005069 3300047469 Bacteria 8062
699 Ga0495673_0010542 3300047469 Bacteria 5018
700 Ga0495673_0013881 3300047469 Bacteria 4208
701 Ga0495673_0015870 3300047469 Bacteria 3867
702 Ga0495673_0023468 3300047469 Bacteria 2999
703 Ga0495673_0042606 3300047469 Bacteria 2036
704 Ga0495681_0001719 3300047470 Bacteria 16182
705 Ga0495681_0002805 3300047470 Bacteria 12330
706 Ga0495681_0003994 3300047470 Bacteria 10153
707 Ga0495681_0004222 3300047470 Bacteria 9855
708 Ga0495681_0005833 3300047470 Bacteria 8176
709 Ga0495681_0006731 3300047470 Bacteria 7497
710 Ga0495681_0009298 3300047470 Bacteria 6069
711 Ga0495681_0011363 3300047470 Bacteria 5306
712 Ga0495681_0013761 3300047470 Bacteria 4677
713 Ga0495681_0014606 3300047470 Bacteria 4488
714 Ga0495681_0014696 3300047470 Bacteria 4472
715 Ga0495681_0019667 3300047470 Bacteria 3679
716 Ga0495681_0022097 3300047470 Bacteria 3412
717 Ga0495681_0023475 3300047470 Bacteria 3275
718 Ga0495681_0036762 3300047470 Bacteria 2418
719 Ga0495684_0034197 3300047471 Bacteria 3900
720 Ga0495684_0088038 3300047471 Bacteria 2353
721 Ga0495686_0003667 3300047472 Bacteria 13139
722 Ga0495686_0007987 3300047472 Bacteria 7846
723 Ga0495686_0015337 3300047472 Bacteria 5237
724 Ga0495686_0153363 3300047472 Bacteria 1351
725 Ga0495686_0163620 3300047472 Bacteria 1298
726 Ga0495593_0010781 3300047673 Bacteria 5269
727 Ga0495593_0028808 3300047673 Bacteria 3049
728 Ga0495593_0031196 3300047673 Bacteria 2913
729 Ga0495593_0040439 3300047673 Bacteria 2510
730 Ga0495593_0069296 3300047673 Bacteria 1834
731 Ga0495602_0024294 3300048088 Bacteria 5881
732 Ga0495626_0001348 3300048091 Bacteria 19838
733 Ga0495626_0002025 3300048091 Bacteria 14887
734 Ga0495626_0002432 3300048091 Bacteria 12924
735 Ga0495626_0002902 3300048091 Bacteria 11418
736 Ga0495626_0005078 3300048091 Bacteria 7847
737 Ga0495626_0006667 3300048091 Bacteria 6546
738 Ga0495626_0010145 3300048091 Bacteria 5053
739 Ga0495626_0014757 3300048091 Bacteria 4016
740 Ga0495626_0060967 3300048091 Bacteria 1717
741 Ga0496102_0002488 3300048905 Bacteria 15730
742 Ga0496103_0007679 3300048906 Bacteria 6413
743 Ga0496105_0035042 3300048908 Bacteria 4130
744 Ga0496106_0085807 3300048909 Bacteria 2424
745 Ga0496110_0081238 3300048913 Bacteria 2889
746 Ga0496110_0168663 3300048913 Bacteria 1986
747 Ga0496110_0177671 3300048913 Bacteria 1933
748 Ga0496114_0007200 3300048917 Bacteria 8781
749 Ga0496114_0200099 3300048917 Bacteria 1750
750 Ga0496115_0151116 3300048918 Bacteria 1918
751 Ga0496116_0000239 3300048919 Bacteria 100609
752 Ga0496116_0004006 3300048919 Bacteria 14285
753 Ga0496116_0005049 3300048919 Bacteria 12417
754 Ga0496116_0015910 3300048919 Bacteria 5917
755 Ga0496116_0015993 3300048919 Bacteria 5897
756 Ga0496116_0020611 3300048919 Bacteria 5001
757 Ga0496116_0074385 3300048919 Bacteria 2137
758 Ga0496116_0135076 3300048919 Bacteria 1399
759 Ga0496117_0000553 3300048920 Bacteria 61439
760 Ga0496117_0000656 3300048920 Bacteria 55325
761 Ga0496117_0001985 3300048920 Bacteria 27171
762 Ga0496117_0003511 3300048920 Bacteria 18163
763 Ga0496117_0017035 3300048920 Bacteria 6086
764 Ga0496117_0022375 3300048920 Bacteria 5071
765 Ga0496117_0022545 3300048920 Bacteria 5048
766 Ga0496117_0039599 3300048920 Bacteria 3476
767 Ga0496117_0044736 3300048920 Bacteria 3204
768 Ga0496117_0052604 3300048920 Bacteria 2867
769 Ga0496117_0055441 3300048920 Bacteria 2769
770 Ga0496117_0070943 3300048920 Bacteria 2336
771 Ga0496117_0102780 3300048920 Bacteria 1802
772 Ga0496117_0113198 3300048920 Bacteria 1685
773 Ga0496118_0000526 3300048921 Bacteria 62798
774 Ga0496118_0001278 3300048921 Bacteria 38517
775 Ga0496118_0004135 3300048921 Bacteria 17546
776 Ga0496118_0014238 3300048921 Bacteria 7458
777 Ga0496118_0019644 3300048921 Bacteria 6030
778 Ga0496118_0020963 3300048921 Bacteria 5773
779 Ga0496118_0026316 3300048921 Bacteria 4959
780 Ga0496118_0033192 3300048921 Bacteria 4239
781 Ga0496118_0053464 3300048921 Bacteria 3069
782 Ga0496118_0064211 3300048921 Bacteria 2695
783 Ga0496119_0019142 3300048922 Bacteria 5058
784 Ga0496119_0024432 3300048922 Bacteria 4251
785 Ga0496119_0049182 3300048922 Bacteria 2609
786 Ga0496120_0004601 3300048923 Bacteria 11469
787 Ga0496120_0012012 3300048923 Bacteria 5918
788 Ga0496120_0015570 3300048923 Bacteria 5009
789 Ga0496121_0000262 3300048924 Bacteria 109686
790 Ga0496121_0020525 3300048924 Bacteria 6531
791 Ga0496121_0028833 3300048924 Bacteria 5155
792 Ga0496121_0036664 3300048924 Bacteria 4366
793 Ga0496121_0046691 3300048924 Bacteria 3704
794 Ga0496121_0078845 3300048924 Bacteria 2616
795 Ga0496121_0082725 3300048924 Bacteria 2536
796 Ga0496121_0122361 3300048924 Bacteria 1962
797 Ga0496122_0004903 3300048925 Bacteria 16231
798 Ga0496122_0005619 3300048925 Bacteria 14831
799 Ga0496122_0024048 3300048925 Bacteria 5343
800 Ga0496122_0038118 3300048925 Bacteria 3856
801 Ga0496122_0053358 3300048925 Bacteria 3048
802 Ga0496122_0080141 3300048925 Bacteria 2278
803 Ga0496123_0001108 3300048926 Bacteria 40430
804 Ga0496123_0001256 3300048926 Bacteria 36483
805 Ga0496123_0018549 3300048926 Bacteria 5526
806 Ga0496123_0032364 3300048926 Bacteria 3788
807 Ga0496123_0037338 3300048926 Bacteria 3430
808 Ga0496123_0042502 3300048926 Bacteria 3135
809 Ga0496123_0072264 3300048926 Bacteria 2147
810 Ga0496124_0001363 3300048927 Bacteria 36583
811 Ga0496124_0002451 3300048927 Bacteria 24268
812 Ga0496124_0015442 3300048927 Bacteria 7318
813 Ga0496124_0026041 3300048927 Bacteria 5281
814 Ga0496124_0039263 3300048927 Bacteria 4104
815 Ga0496124_0041424 3300048927 Bacteria 3974
816 Ga0496124_0049513 3300048927 Bacteria 3584
817 Ga0496124_0053423 3300048927 Bacteria 3424
818 Ga0496124_0097426 3300048927 Bacteria 2388
819 Ga0496124_0138180 3300048927 Bacteria 1926
820 Ga0496124_0259787 3300048927 Bacteria 1279
821 Ga0496125_0000240 3300048928 Bacteria 112092
822 Ga0496125_0012262 3300048928 Bacteria 8523
823 Ga0496125_0012345 3300048928 Bacteria 8488
824 Ga0496125_0015428 3300048928 Bacteria 7390
825 Ga0496125_0017739 3300048928 Bacteria 6775
826 Ga0496125_0020268 3300048928 Bacteria 6243
827 Ga0496125_0029174 3300048928 Bacteria 4963
828 Ga0496125_0029574 3300048928 Bacteria 4920
829 Ga0496125_0032238 3300048928 Bacteria 4657
830 Ga0496125_0033127 3300048928 Bacteria 4578
831 Ga0496125_0050271 3300048928 Bacteria 3453
832 Ga0496126_0025027 3300048929 Bacteria 5752
833 Ga0496126_0119444 3300048929 Bacteria 2287
834 Ga0496126_0131418 3300048929 Bacteria 2163
835 Ga0496126_0202255 3300048929 Bacteria 1676
836 Ga0495678_002970 3300049459 Bacteria 10824
837 Ga0495678_003267 3300049459 Bacteria 10131
838 Ga0495678_004677 3300049459 Bacteria 7840
839 Ga0495678_007795 3300049459 Bacteria 5509
840 Ga0495678_008089 3300049459 Bacteria 5357
841 Ga0495678_009940 3300049459 Bacteria 4661
842 Ga0495678_011100 3300049459 Bacteria 4328
843 Ga0495678_018318 3300049459 Bacteria 3152
844 Ga0495678_022269 3300049459 Bacteria 2773
845 Ga0495678_023567 3300049459 Bacteria 2672
846 Ga0495678_036931 3300049459 Bacteria 1989
847 Ga0495678_037944 3300049459 Bacteria 1953
848 Ga0495678_061126 3300049459 Bacteria 1414
849 Ga0495682_0000589 3300049460 Bacteria 24714
850 Ga0495682_0000608 3300049460 Bacteria 24165
851 Ga0495682_0002668 3300049460 Bacteria 8327
852 Ga0495682_0013053 3300049460 Bacteria 3168
853 Ga0495682_0077162 3300049460 Bacteria 1198
854 Ga0501241_001805 3300049758 Bacteria 4221
855 nmdc:mga00v17_105504_c1 3300050491 Bacteria 1783
856 nmdc:mga00v17_112636_c1 3300050491 Bacteria 1727
857 nmdc:mga00v17_39314_c1 3300050491 Bacteria 2833
858 nmdc:mga08x19_239922_c1 3300050514 Bacteria 1249
859 nmdc:mga08x19_387042_c1 3300050514 Bacteria 980
860 nmdc:mga0sz30_39533_c1 3300050516 Bacteria 1979
861 Ga0500572_001103 3300053111 Bacteria 7889
862 Ga0500634_0004336 3300053161 Bacteria 6532
863 2511253912 2511231004 Bacteria 6669789
864 2511263571 2511231006 Bacteria 6794709
865 2511272622 2511231007 Bacteria 6306603
866 2511280634 2511231008 Bacteria 6624100
867 2511288901 2511231010 Bacteria 6373152
868 2511293853 2511231011 Bacteria 6149768
869 2511300652 2511231012 Bacteria 6738011
870 2511312153 2511231014 Bacteria 6462302
871 2511318579 2511231015 Bacteria 6598026
872 2511323737 2511231016 Bacteria 6704427
873 2511332770 2511231017 Bacteria 6503007
874 2511336224 2511231018 Bacteria 6436256
875 2511345138 2511231019 Bacteria 6520662
876 2511348393 2511231020 Bacteria 6115223
877 2511356148 2511231021 Bacteria 7302637
878 2511361369 2511231022 Bacteria 6719296
879 2511368512 2511231023 Bacteria 6808468
880 2511411191 2511231031 Bacteria 6558529
881 2512327865 2512047018 Bacteria 6663241
882 2555667295 2554235341 Bacteria 6867980
883 2583789920 2582580891 Bacteria 6800976
884 2597855539 2597489887 Bacteria 6666321
885 2599356518 2599185160 Bacteria 6844013
886 2599363454 2599185161 Bacteria 6960462
887 2599369594 2599185162 Bacteria 6957254
888 2599376563 2599185163 Bacteria 6995158
889 2599381623 2599185164 Bacteria 6841688
890 2599388233 2599185165 Bacteria 6843250
891 2599395241 2599185166 Bacteria 6959206
892 2599398975 2599185167 Bacteria 6353609
893 2599407006 2599185168 Bacteria 6997636
894 2599451026 2599185179 Bacteria 6611171
895 2599463351 2599185181 Bacteria 6844519
896 2599469301 2599185182 Bacteria 6883168
897 2599485442 2599185185 Bacteria 6652270
898 2599492368 2599185186 Bacteria 6831633
899 2599514028 2599185190 Bacteria 6285678
900 2599518625 2599185191 Bacteria 6297582
901 2599806574 2599185257 Bacteria 6492581
902 2599882542 2599185288 Bacteria 6666191
903 2599893637 2599185290 Bacteria 6289611
904 2599950540 2599185303 Bacteria 6512725
905 2600215980 2599185356 Bacteria 6843884
906 2600368428 2600254931 Bacteria 6734225
907 2601776147 2600255313 Bacteria 6842543
908 2606076802 2603880185 Bacteria 6379190
909 2606128784 2603880199 Bacteria 6377649
910 2621302288 2619619299 Bacteria 6649820
911 2624478101 2623620443 Bacteria 6427864
912 2624489645 2623620446 Bacteria 6500345
913 2643840864 2643221565 Bacteria 6216018
914 2643955040 2643221589 Bacteria 6250934
915 2644024674 2643221602 Bacteria 6249926
916 2644189579 2643221633 Bacteria 6733554
917 2671100094 2667528171 Bacteria 6900659
918 2671772225 2671180172 Bacteria 6495783
919 2715749091 2713897148 Bacteria 5883533
920 2715754361 2713897149 Bacteria 6506249
921 2718632046 2718217725 Bacteria 5758958
922 2738674952 2738541265 Bacteria 6594665
923 2738753345 2738541282 Bacteria 6593925
924 2738808036 2738541294 Bacteria 6925949
925 2738862544 2738541303 Bacteria 6591772
926 2738895396 2738541309 Bacteria 6926455
927 2739197909 2738543004 Bacteria 6381073
928 2739260432 2738543015 Bacteria 6750701
929 2739311155 2738543025 Bacteria 6600348
930 2743734958 2740892503 Bacteria 6855563
931 2774119680 2773857670 Bacteria 6407454
932 2784261168 2784132063 Bacteria 6262788
933 2784316247 2784132072 Bacteria 6596533
934 2808931280 2808606377 Bacteria 6646337
935 2808953230 2808606381 Bacteria 6646461
936 2808955738 2808606382 Bacteria 6841132
937 2808976780 2808606385 Bacteria 6711065
938 2808991782 2808606388 Bacteria 6706662
939 2809217863 2808606445 Bacteria 6057339
940 2817488285 2816332298 Bacteria 6852809
941 2819657109 2818991456 Bacteria 6123676
942 2819705090 2818991464 Bacteria 6907494
943 2834032326 2834028612 Bacteria 6354979
944 2842846478 2842843487 Bacteria 6004777
945 2844667772 2844665904 Bacteria 6817974
946 2852616946 2852612431 Bacteria 6885235
947 2852672065 2852667396 Bacteria 6885555
948 2860344871 2860339153 Bacteria 6846989
949 2878030046 2878029506 Bacteria 6418441
950 2904552367 2904550169 Bacteria 6221258
951 2908446898 2908446538 Bacteria 6829095
952 2917071043 2917070673 Bacteria 6868303
953 2919066271 2919063839 Bacteria 6302690
954 2919389897 2919385768 Bacteria 5897293
955 2919459857 2919456309 Bacteria 6586567
956 2919488823 2919487758 Bacteria 5929766
957 2923153951 2923153595 Bacteria 6870622
958 2931391257 2931390751 Bacteria 6273349
959 2931398718 2931396565 Bacteria 7251677
960 2935358871 2935353572 Unclassified 6955622
961 2939640981 2939636861 Bacteria 6297853
962 2939652111 2939651529 Bacteria 5895393
963 2969304835 2969304461 Bacteria 6601805
964 2974293466 2974289157 Bacteria 6080362
965 2984292106 2984286254 Bacteria 6702062
966 2998140339 2998139840 Bacteria 6073514
967 3007397967 3007395558 Bacteria 6755444
968 3007419900 3007419365 Bacteria 7026924
969 3007517755 3007511990 Bacteria 6481491
970 3007617418 3007614139 Bacteria 6053559
971 3007625332 3007619802 Bacteria 6411688
972 3007723805 3007718800 Bacteria 5971527
973 3007864454 3007861166 Bacteria 6045338
974 637317694 637000220 Bacteria 7074893
975 8015688200 8015687852 Bacteria 6613826
976 8019770194 8019769354 Bacteria 6924660
977 8019777220 8019775933 Bacteria 6858656
978 8054291488 8054285046 Bacteria 6919322
979 8054932979 8054929484 Bacteria 5599761
980 8055771302 8055770955 Bacteria 6827675
981 8055818235 8055817908 Bacteria 6609162
982 8056126350 8056125926 Bacteria 6228218
983 8056158396 8056155041 Bacteria 6486948
984 8056170704 8056166840 Bacteria 5820959
985 8056179677 8056177738 Bacteria 6748268
986 8056572203 8056569372 Bacteria 5997322
987 8057802592 8057798959 Bacteria 6713499
988 Ga0495673_0002789
989 MRS2a_Contig_850
990 MRS1b_contig_1629842
991 JGI25162J39368_1000099
992 JGI25163J39215_1000781
993 JGI25163J39215_1001720
994 JGI25164J39214_1000077
995 JGI25164J39214_1000477
996 JGI25164J39214_1000563
997 JGI25165J46597_1000182
998 JGI25165J46597_1001123
999 Ga0055536_1000109
1000 Ga0055536_1000539
1001 Ga0055536_1000945
1002 Ga0055530_10000034
1003 Ga0055530_10005906
1004 Ga0055530_10016613
1005 Ga0055540_1000064
1006 Ga0055531_10000039
1007 Ga0065714_10000677
1008 Ga0065714_10006736
1009 Ga0065714_10007227
1010 Ga0065714_10068888
1011 Ga0065712_10003423
1012 Ga0065712_10003440
1013 Ga0070670_100002657
1014 Ga0070661_100002281
1015 Ga0070669_100001095
1016 Ga0070669_100011538
1017 Ga0070662_100000851
1018 Ga0068853_100000029
1019 Ga0070665_100152640
1020 Ga0070664_100000039
1021 Ga0068851_10000035
1022 Ga0075432_10007826
1023 Ga0075432_10011738
1024 Ga0075369_10013145
1025 Ga0075436_100012824
1026 Ga0075436_100153655
1027 Ga0079104_1000104
1028 Ga0105251_10007717
1029 Ga0105251_10010061
1030 Ga0105251_10072895
1031 Ga0105244_10002169
1032 Ga0105244_10006525
1033 Ga0105244_10014244
1034 Ga0105244_10018615
1035 Ga0105244_10058156
1036 Ga0105244_10065735
1037 Ga0105244_10086361
1038 Ga0105250_10003521
1039 Ga0105250_10004993
1040 Ga0105250_10007009
1041 Ga0105250_10010708
1042 Ga0105250_10019016
1043 Ga0105250_10029049
1044 Ga0105243_10000047
1045 Ga0105243_10001372
1046 Ga0105243_10057018
1047 Ga0105243_10093376
1048 Ga0105242_10225062
1049 Ga0105249_10273122
1050 Ga0105246_10001783
1051 Ga0157345_1000197
1052 Ga0157373_10009880
1053 Ga0157373_10015997
1054 Ga0157373_10020335
1055 Ga0157373_10020352
1056 Ga0157373_10027437
1057 Ga0157373_10216351
1058 Ga0157371_10000356
1059 Ga0157371_10238596
1060 Ga0157370_10005146
1061 Ga0157370_10015663
1062 Ga0157370_10035652
1063 Ga0157370_10124806
1064 Ga0157370_10335485
1065 Ga0157369_10022614
1066 Ga0157369_10028863
1067 Ga0157369_10030701
1068 Ga0157369_10039023
1069 Ga0163162_10008135
1070 Ga0163162_10436454
1071 Ga0157372_10010372
1072 Ga0157375_10017607
1073 Ga0157375_10052397
1074 Ga0157375_10057028
1075 Ga0157375_10178515
1076 Ga0182008_10000066
1077 Ga0182008_10007475
1078 Ga0182008_10007709
1079 Ga0182008_10009651
1080 Ga0182008_10013620
1081 Ga0182008_10059143
1082 Ga0182006_1001904
1083 Ga0182006_1077568
1084 Ga0182007_10004021
1085 Ga0182005_1005166
1086 Ga0182005_1013457
1087 Ga0163161_10004434
1088 Ga0163161_10006065
1089 Ga0163161_10019131
1090 Ga0163161_10026430
1091 Ga0163161_10118911
1092 Ga0209760_100059
1093 Ga0209760_100140
1094 Ga0207427_100014
1095 Ga0207427_100016
1096 Ga0209437_100011
1097 Ga0209437_100016
1098 Ga0209759_1014821
1099 Ga0209233_1000019
1100 Ga0209233_1000036
1101 Ga0209676_1000025
1102 Ga0209676_1000032
1103 Ga0209676_1000208
1104 Ga0209050_1000025
1105 Ga0209050_1000099
1106 Ga0209050_1001463
1107 Ga0209051_1000026
1108 Ga0209051_1000039
1109 Ga0209051_1000047
1110 Ga0209257_1000034
1111 Ga0207656_10000008
1112 Ga0207696_1000084
1113 Ga0207696_1000563
1114 Ga0207696_1003779
1115 Ga0207696_1006428
1116 Ga0207655_1000162
1117 Ga0207655_1000495
1118 Ga0207655_1001897
1119 Ga0207655_1002594
1120 Ga0207655_1005378
1121 Ga0207655_1005689
1122 Ga0207655_1009290
1123 Ga0207655_1013422
1124 Ga0207655_1013802
1125 Ga0207655_1015415
1126 Ga0207713_1001090
1127 Ga0207713_1001569
1128 Ga0207713_1003590
1129 Ga0207713_1004477
1130 Ga0207713_1007019
1131 Ga0207713_1007259
1132 Ga0207713_1007321
1133 Ga0207713_1024486
1134 Ga0207671_10000015
1135 Ga0207649_10000001
1136 Ga0207681_10000325
1137 Ga0207681_10005906
1138 Ga0207650_10000186
1139 Ga0207706_10000081
1140 Ga0207686_10102983
1141 Ga0207709_10000040
1142 Ga0207709_10000249
1143 Ga0207709_10042300
1144 Ga0207679_10000009
1145 Ga0207712_10197618
1146 Ga0207639_10000090
1147 Ga0209281_1000026
1148 Ga0209281_1007948
1149 Ga0207428_10099323
1150 Ga0207428_10169211
1151 Ga0207428_10169925
1152 Ga0307511_10142236
1153 Ga0316179_1066635
1154 Ga0307509_10043687
1155 Ga0307516_10198683
1156 Ga0307405_10003246
1157 Ga0307407_10113432
1158 Ga0307412_10056702
1159 Ga0307412_10335246
1160 Ga0307416_100190002
1161 Ga0307414_10105636
1162 Ga0307414_10122438
1163 Ga0307510_10048465
1164 Ga0439438_001810
1165 Ga0439438_006065
1166 Ga0439438_012300
1167 Ga0439438_014555
1168 Ga0439438_021163
1169 Ga0439447_001459
1170 Ga0439447_004123
1171 Ga0439447_005640
1172 Ga0439447_014479
1173 Ga0439447_038722
1174 Ga0439461_0009312
1175 Ga0439466_0000592
1176 Ga0439466_0003823
1177 Ga0439466_0004719
1178 Ga0439466_0005992
1179 Ga0439466_0013675
1180 Ga0439466_0021708
1181 Ga0439466_0025185
1182 Ga0439466_0039577
1183 Ga0439465_0005193
1184 Ga0439445_0020996
1185 Ga0439432_005217
1186 Ga0439432_005529
1187 Ga0439432_006258
1188 Ga0439432_026061
1189 Ga0439451_000777
1190 Ga0439451_001521
1191 Ga0439451_004112
1192 Ga0439451_011103
1193 Ga0439451_017591
1194 Ga0439451_029685
1195 Ga0439452_001440
1196 Ga0439452_002739
1197 Ga0439452_003601
1198 Ga0439452_003840
1199 Ga0439452_010235
1200 Ga0439456_000042
1201 Ga0439456_002784
1202 Ga0439456_003896
1203 Ga0439456_008302
1204 Ga0439463_001102
1205 Ga0439463_001271
1206 Ga0439463_006770
1207 Ga0439463_021443
1208 Ga0439463_037721
1209 Ga0439463_048463
1210 Ga0450911_000394
1211 Ga0450911_001041
1212 Ga0450911_002240
1213 Ga0450922_000105
1214 Ga0450922_000231
1215 Ga0450890_000865
1216 Ga0450896_002506
1217 Ga0450898_001042
1218 Ga0450900_001006
1219 Ga0450902_003491
1220 Ga0450902_012476
1221 Ga0450903_001446
1222 Ga0450903_002348
1223 Ga0450903_007061
1224 Ga0450903_010965
1225 Ga0450903_012008
1226 Ga0450904_000669
1227 Ga0450904_001373
1228 Ga0450905_003458
1229 Ga0450905_008268
1230 Ga0450905_011984
1231 Ga0450906_000140
1232 Ga0450906_001955
1233 Ga0450906_002634
1234 Ga0450907_001035
1235 Ga0450907_001261
1236 Ga0450907_001828
1237 Ga0450907_013197
1238 Ga0450910_000899
1239 Ga0450910_001208
1240 Ga0439446_0001111
1241 Ga0450909_000748
1242 Ga0439434_0001029
1243 Ga0439464_0001818
1244 Ga0439460_0002815
1245 Ga0439460_0005433
1246 Ga0450918_001677
1247 Ga0450918_005599
1248 Ga0450918_005678
1249 Ga0450893_0003049
1250 Ga0450901_000527
1251 Ga0439440_0013454
1252 Ga0466968_0075512
1253 Ga0495617_002678
1254 Ga0495617_003151
1255 Ga0495617_003353
1256 Ga0495617_006218
1257 Ga0495617_010915
1258 Ga0495617_013399
1259 Ga0495617_014309
1260 Ga0495617_018078
1261 Ga0495617_018600
1262 Ga0495617_047445
1263 Ga0495617_073142
1264 Ga0495627_001941
1265 Ga0495627_002145
1266 Ga0495627_002251
1267 Ga0495627_002921
1268 Ga0495627_006178
1269 Ga0495627_010854
1270 Ga0495627_022247
1271 Ga0495627_026839
1272 Ga0495592_0032447
1273 Ga0495603_0013842
1274 Ga0495590_0001133
1275 Ga0495590_0005329
1276 Ga0495590_0006995
1277 Ga0495591_001039
1278 Ga0495591_001516
1279 Ga0495591_003403
1280 Ga0495591_004687
1281 Ga0495591_007643
1282 Ga0495591_008847
1283 Ga0495591_009680
1284 Ga0495591_015548
1285 Ga0495591_023973
1286 Ga0495591_024727
1287 Ga0495638_0004345
1288 Ga0495638_0007860
1289 Ga0495638_0010713
1290 Ga0495638_0010935
1291 Ga0495638_0012479
1292 Ga0495638_0015980
1293 Ga0495638_0017979
1294 Ga0495638_0022211
1295 Ga0495638_0025088
1296 Ga0495638_0029352
1297 Ga0495638_0040760
1298 Ga0495638_0056338
1299 Ga0495638_0092120
1300 Ga0495638_0119522
1301 Ga0495638_0129236
1302 Ga0495638_0218483
1303 Ga0495653_0001680
1304 Ga0495653_0027312
1305 Ga0495650_0001827
1306 Ga0495650_0006454
1307 Ga0495650_0010566
1308 Ga0495650_0012672
1309 Ga0495650_0013248
1310 Ga0495650_0074844
1311 Ga0495605_0002176
1312 Ga0495605_0010638
1313 Ga0495605_0010842
1314 Ga0495605_0017100
1315 Ga0495605_0018537
1316 Ga0495605_0022666
1317 Ga0495605_0033448
1318 Ga0495605_0046015
1319 Ga0495605_0053637
1320 Ga0495605_0093424
1321 Ga0495605_0100391
1322 Ga0495639_0000294
1323 Ga0495639_0001785
1324 Ga0495639_0038701
1325 Ga0495584_0001126
1326 Ga0495584_0003398
1327 Ga0495584_0004328
1328 Ga0495584_0004718
1329 Ga0495584_0006726
1330 Ga0495584_0007670
1331 Ga0495584_0009340
1332 Ga0495584_0012644
1333 Ga0495584_0013707
1334 Ga0495584_0015059
1335 Ga0495584_0024264
1336 Ga0495584_0029698
1337 Ga0495584_0075337
1338 Ga0495584_0126176
1339 Ga0495585_0005734
1340 Ga0495585_0007018
1341 Ga0495585_0009875
1342 Ga0495585_0013870
1343 Ga0495585_0015812
1344 Ga0495585_0016466
1345 Ga0495585_0019200
1346 Ga0495585_0023982
1347 Ga0495585_0033785
1348 Ga0495585_0076019
1349 Ga0495594_0008086
1350 Ga0495594_0017310
1351 Ga0495596_0000825
1352 Ga0495596_0007273
1353 Ga0495596_0082948
1354 Ga0495607_0002173
1355 Ga0495607_0006196
1356 Ga0495607_0006943
1357 Ga0495607_0008967
1358 Ga0495607_0013127
1359 Ga0495607_0016070
1360 Ga0495607_0024480
1361 Ga0495607_0041434
1362 Ga0495607_0043338
1363 Ga0495607_0061026
1364 Ga0495607_0077843
1365 Ga0495607_0102281
1366 Ga0495607_0122005
1367 Ga0495607_0128723
1368 Ga0495583_0002730
1369 Ga0495583_0006786
1370 Ga0495583_0012126
1371 Ga0495583_0022567
1372 Ga0495583_0096225
1373 Ga0495583_0103834
1374 Ga0495606_0005981
1375 Ga0495606_0006105
1376 Ga0495606_0007126
1377 Ga0495606_0014993
1378 Ga0495610_0002705
1379 Ga0495610_0004480
1380 Ga0495610_0005819
1381 Ga0495610_0007574
1382 Ga0495610_0007679
1383 Ga0495610_0007944
1384 Ga0495610_0010183
1385 Ga0495610_0010214
1386 Ga0495610_0011112
1387 Ga0495610_0035752
1388 Ga0495610_0064586
1389 Ga0495616_0001868
1390 Ga0495616_0004365
1391 Ga0495616_0005720
1392 Ga0495616_0005865
1393 Ga0495616_0011117
1394 Ga0495616_0020557
1395 Ga0495616_0021542
1396 Ga0495616_0024542
1397 Ga0495616_0034152
1398 Ga0495616_0045143
1399 Ga0495616_0074568
1400 Ga0495620_0000052
1401 Ga0495620_0001033
1402 Ga0495620_0001500
1403 Ga0495620_0003073
1404 Ga0495620_0003951
1405 Ga0495620_0007188
1406 Ga0495620_0008807
1407 Ga0495620_0011042
1408 Ga0495620_0042063
1409 Ga0495620_0089590
1410 Ga0495628_0036518
1411 Ga0495630_0014872
1412 Ga0495630_0017201
1413 Ga0495630_0057475
1414 Ga0495631_0003014
1415 Ga0495631_0003855
1416 Ga0495631_0006062
1417 Ga0495631_0006628
1418 Ga0495631_0010723
1419 Ga0495631_0014825
1420 Ga0495632_0000210
1421 Ga0495632_0001609
1422 Ga0495632_0004883
1423 Ga0495632_0006031
1424 Ga0495632_0008656
1425 Ga0495632_0012386
1426 Ga0495632_0012627
1427 Ga0495632_0016521
1428 Ga0495632_0021306
1429 Ga0495632_0025739
1430 Ga0495632_0049661
1431 Ga0495632_0054136
1432 Ga0495632_0057612
1433 Ga0495632_0064845
1434 Ga0495632_0090953
1435 Ga0495637_0001728
1436 Ga0495637_0003277
1437 Ga0495637_0004668
1438 Ga0495637_0004680
1439 Ga0495637_0004823
1440 Ga0495637_0005107
1441 Ga0495637_0005172
1442 Ga0495637_0009869
1443 Ga0495637_0011171
1444 Ga0495637_0016642
1445 Ga0495637_0019095
1446 Ga0495637_0022273
1447 Ga0495637_0023277
1448 Ga0495637_0030032
1449 Ga0495643_0000197
1450 Ga0495643_0000344
1451 Ga0495643_0003510
1452 Ga0495643_0006716
1453 Ga0495643_0009107
1454 Ga0495643_0024178
1455 Ga0495643_0032116
1456 Ga0495643_0124790
1457 Ga0495644_0001046
1458 Ga0495644_0001271
1459 Ga0495644_0007710
1460 Ga0495644_0008800
1461 Ga0495644_0009183
1462 Ga0495648_0000679
1463 Ga0495648_0002981
1464 Ga0495648_0006163
1465 Ga0495648_0015264
1466 Ga0495648_0016039
1467 Ga0495648_0017930
1468 Ga0495648_0022217
1469 Ga0495648_0025483
1470 Ga0495648_0032407
1471 Ga0495648_0035719
1472 Ga0495648_0040632
1473 Ga0495648_0087021
1474 Ga0495666_0005963
1475 Ga0495666_0007854
1476 Ga0495666_0065205
1477 Ga0495642_0001171
1478 Ga0495642_0002264
1479 Ga0495642_0003292
1480 Ga0495652_0211054
1481 Ga0495654_0001750
1482 Ga0495654_0001797
1483 Ga0495654_0002117
1484 Ga0495654_0005462
1485 Ga0495654_0006180
1486 Ga0495654_0007154
1487 Ga0495654_0007720
1488 Ga0495654_0014074
1489 Ga0495654_0024461
1490 Ga0495654_0024851
1491 Ga0495654_0033498
1492 Ga0495654_0055779
1493 Ga0495654_0059569
1494 Ga0495654_0070413
1495 Ga0495654_0140078
1496 Ga0495586_0006337
1497 Ga0495587_0005500
1498 Ga0495587_0007573
1499 Ga0495609_0002518
1500 Ga0495609_0007681
1501 Ga0495609_0019508
1502 Ga0495609_0044832
1503 Ga0495609_0080478
1504 Ga0495609_0086719
1505 Ga0495597_0003741
1506 Ga0495597_0005474
1507 Ga0495597_0014704
1508 Ga0495597_0018196
1509 Ga0495597_0021608
1510 Ga0495597_0028064
1511 Ga0495597_0084035
1512 Ga0495645_0162104
1513 Ga0495622_0002723
1514 Ga0495622_0005121
1515 Ga0495622_0047534
1516 Ga0495622_0057333
1517 Ga0495622_0069293
1518 Ga0495633_0004035
1519 Ga0495633_0005819
1520 Ga0495633_0020239
1521 Ga0495633_0061675
1522 Ga0495633_0074783
1523 Ga0495656_0024139
1524 Ga0495668_0001129
1525 Ga0495668_0002393
1526 Ga0495668_0011216
1527 Ga0495634_0008471
1528 Ga0495634_0023826
1529 Ga0495611_0001084
1530 Ga0495611_0008804
1531 Ga0495611_0018224
1532 Ga0495611_0032834
1533 Ga0495611_0042105
1534 Ga0495625_0003953
1535 Ga0495625_0006328
1536 Ga0495625_0007050
1537 Ga0495625_0011065
1538 Ga0495625_0011399
1539 Ga0495625_0024389
1540 Ga0495625_0051744
1541 Ga0495625_0091901
1542 Ga0495625_0159788
1543 Ga0495625_0211104
1544 Ga0495635_0011238
1545 Ga0495635_0015853
1546 Ga0495659_0001680
1547 Ga0495659_0002221
1548 Ga0495659_0019940
1549 Ga0495659_0036456
1550 Ga0495661_0001354
1551 Ga0495661_0009797
1552 Ga0495661_0010223
1553 Ga0495661_0064894
1554 Ga0495661_0065744
1555 Ga0495661_0116326
1556 Ga0495588_0003321
1557 Ga0495588_0007109
1558 Ga0495588_0012513
1559 Ga0495588_0054506
1560 Ga0495623_0018761
1561 Ga0495646_0003357
1562 Ga0495646_0007624
1563 Ga0495669_0000275
1564 Ga0495669_0014283
1565 Ga0495613_0007674
1566 Ga0495613_0019593
1567 Ga0495613_0032984
1568 Ga0495670_0002096
1569 Ga0495670_0002438
1570 Ga0495670_0002606
1571 Ga0495670_0003560
1572 Ga0495670_0017283
1573 Ga0495670_0025591
1574 Ga0495670_0035586
1575 Ga0495670_0049803
1576 Ga0495670_0062467
1577 Ga0495671_0002446
1578 Ga0495671_0002796
1579 Ga0495671_0002816
1580 Ga0495671_0005620
1581 Ga0495671_0006769
1582 Ga0495671_0007523
1583 Ga0495671_0009714
1584 Ga0495671_0012989
1585 Ga0495671_0021336
1586 Ga0495671_0026252
1587 Ga0495671_0034544
1588 Ga0495671_0077052
1589 Ga0495671_0087232
1590 Ga0495649_0001197
1591 Ga0495649_0003408
1592 Ga0495649_0003507
1593 Ga0495649_0005650
1594 Ga0495649_0009983
1595 Ga0495649_0013051
1596 Ga0495649_0017655
1597 Ga0495649_0018688
1598 Ga0495649_0026244
1599 Ga0495649_0032363
1600 Ga0495649_0040829
1601 Ga0495649_0063351
1602 Ga0495649_0141158
1603 Ga0495589_0000573
1604 Ga0495589_0002034
1605 Ga0495589_0002449
1606 Ga0495589_0006573
1607 Ga0495589_0011999
1608 Ga0495589_0013119
1609 Ga0495589_0013802
1610 Ga0495589_0016586
1611 Ga0495589_0030713
1612 Ga0495589_0043032
1613 Ga0495600_0006569
1614 Ga0495600_0047768
1615 Ga0495600_0059004
1616 Ga0495660_0009794
1617 Ga0495660_0014300
1618 Ga0495660_0014620
1619 Ga0495660_0020607
1620 Ga0495660_0021169
1621 Ga0495660_0025778
1622 Ga0495660_0050427
1623 Ga0495660_0054307
1624 Ga0495660_0054765
1625 Ga0495660_0070638
1626 Ga0495660_0110059
1627 Ga0495581_0009732
1628 Ga0495604_0005000
1629 Ga0495604_0008683
1630 Ga0495604_0021610
1631 Ga0495636_0019518
1632 Ga0495674_0040813
1633 Ga0495672_0002646
1634 Ga0495672_0003540
1635 Ga0495672_0004515
1636 Ga0495672_0005186
1637 Ga0495672_0005696
1638 Ga0495672_0011462
1639 Ga0495672_0013136
1640 Ga0495672_0014058
1641 Ga0495672_0023425
1642 Ga0495672_0033995
1643 Ga0495672_0042348
1644 Ga0495672_0141604
1645 Ga0495676_0003332
1646 Ga0495676_0039359
1647 Ga0495680_0005487
1648 Ga0495680_0013007
1649 Ga0495680_0015346
1650 Ga0495680_0017202
1651 Ga0495680_0049858
1652 Ga0495683_0001176
1653 Ga0495683_0003293
1654 Ga0495683_0005969
1655 Ga0495683_0014780
1656 Ga0495683_0015298
1657 Ga0495683_0040849
1658 Ga0495683_0056229
1659 Ga0495683_0069250
1660 Ga0495683_0072992
1661 Ga0495683_0125733
1662 Ga0495687_002029
1663 Ga0495687_002352
1664 Ga0495687_005636
1665 Ga0495687_017951
1666 Ga0495675_0034124
1667 Ga0495675_0221592
1668 Ga0495677_0024480
1669 Ga0495677_0025495
1670 Ga0495679_001001
1671 Ga0495679_001762
1672 Ga0495679_003869
1673 Ga0495679_004363
1674 Ga0495679_004730
1675 Ga0495679_005012
1676 Ga0495679_010118
1677 Ga0495679_010261
1678 Ga0495685_001865
1679 Ga0495685_041915
1680 Ga0495673_0001224
1681 Ga0495673_0001229
1682 Ga0495673_0002473
1683 Ga0495673_0002511
1684 Ga0495673_0003744
1685 Ga0495673_0005069
1686 Ga0495673_0010542
1687 Ga0495673_0013881
1688 Ga0495673_0015870
1689 Ga0495673_0023468
1690 Ga0495673_0042606
1691 Ga0495681_0001719
1692 Ga0495681_0002805
1693 Ga0495681_0003994
1694 Ga0495681_0004222
1695 Ga0495681_0005833
1696 Ga0495681_0006731
1697 Ga0495681_0009298
1698 Ga0495681_0011363
1699 Ga0495681_0013761
1700 Ga0495681_0014606
1701 Ga0495681_0014696
1702 Ga0495681_0019667
1703 Ga0495681_0022097
1704 Ga0495681_0023475
1705 Ga0495681_0036762
1706 Ga0495684_0034197
1707 Ga0495684_0088038
1708 Ga0495686_0003667
1709 Ga0495686_0007987
1710 Ga0495686_0015337
1711 Ga0495686_0153363
1712 Ga0495686_0163620
1713 Ga0495593_0010781
1714 Ga0495593_0028808
1715 Ga0495593_0031196
1716 Ga0495593_0040439
1717 Ga0495593_0069296
1718 Ga0495602_0024294
1719 Ga0495626_0001348
1720 Ga0495626_0002025
1721 Ga0495626_0002432
1722 Ga0495626_0002902
1723 Ga0495626_0005078
1724 Ga0495626_0006667
1725 Ga0495626_0010145
1726 Ga0495626_0014757
1727 Ga0495626_0060967
1728 Ga0496102_0002488
1729 Ga0496103_0007679
1730 Ga0496105_0035042
1731 Ga0496106_0085807
1732 Ga0496110_0081238
1733 Ga0496110_0168663
1734 Ga0496110_0177671
1735 Ga0496114_0007200
1736 Ga0496114_0200099
1737 Ga0496115_0151116
1738 Ga0496116_0000239
1739 Ga0496116_0004006
1740 Ga0496116_0005049
1741 Ga0496116_0015910
1742 Ga0496116_0015993
1743 Ga0496116_0020611
1744 Ga0496116_0074385
1745 Ga0496116_0135076
1746 Ga0496117_0000553
1747 Ga0496117_0000656
1748 Ga0496117_0001985
1749 Ga0496117_0003511
1750 Ga0496117_0017035
1751 Ga0496117_0022375
1752 Ga0496117_0022545
1753 Ga0496117_0039599
1754 Ga0496117_0044736
1755 Ga0496117_0052604
1756 Ga0496117_0055441
1757 Ga0496117_0070943
1758 Ga0496117_0102780
1759 Ga0496117_0113198
1760 Ga0496118_0000526
1761 Ga0496118_0001278
1762 Ga0496118_0004135
1763 Ga0496118_0014238
1764 Ga0496118_0019644
1765 Ga0496118_0020963
1766 Ga0496118_0026316
1767 Ga0496118_0033192
1768 Ga0496118_0053464
1769 Ga0496118_0064211
1770 Ga0496119_0019142
1771 Ga0496119_0024432
1772 Ga0496119_0049182
1773 Ga0496120_0004601
1774 Ga0496120_0012012
1775 Ga0496120_0015570
1776 Ga0496121_0000262
1777 Ga0496121_0020525
1778 Ga0496121_0028833
1779 Ga0496121_0036664
1780 Ga0496121_0046691
1781 Ga0496121_0078845
1782 Ga0496121_0082725
1783 Ga0496121_0122361
1784 Ga0496122_0004903
1785 Ga0496122_0005619
1786 Ga0496122_0024048
1787 Ga0496122_0038118
1788 Ga0496122_0053358
1789 Ga0496122_0080141
1790 Ga0496123_0001108
1791 Ga0496123_0001256
1792 Ga0496123_0018549
1793 Ga0496123_0032364
1794 Ga0496123_0037338
1795 Ga0496123_0042502
1796 Ga0496123_0072264
1797 Ga0496124_0001363
1798 Ga0496124_0002451
1799 Ga0496124_0015442
1800 Ga0496124_0026041
1801 Ga0496124_0039263
1802 Ga0496124_0041424
1803 Ga0496124_0049513
1804 Ga0496124_0053423
1805 Ga0496124_0097426
1806 Ga0496124_0138180
1807 Ga0496124_0259787
1808 Ga0496125_0000240
1809 Ga0496125_0012262
1810 Ga0496125_0012345
1811 Ga0496125_0015428
1812 Ga0496125_0017739
1813 Ga0496125_0020268
1814 Ga0496125_0029174
1815 Ga0496125_0029574
1816 Ga0496125_0032238
1817 Ga0496125_0033127
1818 Ga0496125_0050271
1819 Ga0496126_0025027
1820 Ga0496126_0119444
1821 Ga0496126_0131418
1822 Ga0496126_0202255
1823 Ga0495678_002970
1824 Ga0495678_003267
1825 Ga0495678_004677
1826 Ga0495678_007795
1827 Ga0495678_008089
1828 Ga0495678_009940
1829 Ga0495678_011100
1830 Ga0495678_018318
1831 Ga0495678_022269
1832 Ga0495678_023567
1833 Ga0495678_036931
1834 Ga0495678_037944
1835 Ga0495678_061126
1836 Ga0495682_0000589
1837 Ga0495682_0000608
1838 Ga0495682_0002668
1839 Ga0495682_0013053
1840 Ga0495682_0077162
1841 Ga0501241_001805
1842 nmdc:mga00v17_105504_c1
1843 nmdc:mga00v17_112636_c1
1844 nmdc:mga00v17_39314_c1
1845 nmdc:mga08x19_239922_c1
1846 nmdc:mga08x19_387042_c1
1847 nmdc:mga0sz30_39533_c1
1848 Ga0500572_001103
1849 Ga0500634_0004336
1850 2511253912
1851 2511263571
1852 2511272622
1853 2511280634
1854 2511288901
1855 2511293853
1856 2511300652
1857 2511312153
1858 2511318579
1859 2511323737
1860 2511332770
1861 2511336224
1862 2511345138
1863 2511348393
1864 2511356148
1865 2511361369
1866 2511368512
1867 2511411191
1868 2512327865
1869 2555667295
1870 2583789920
1871 2597855539
1872 2599356518
1873 2599363454
1874 2599369594
1875 2599376563
1876 2599381623
1877 2599388233
1878 2599395241
1879 2599398975
1880 2599407006
1881 2599451026
1882 2599463351
1883 2599469301
1884 2599485442
1885 2599492368
1886 2599514028
1887 2599518625
1888 2599806574
1889 2599882542
1890 2599893637
1891 2599950540
1892 2600215980
1893 2600368428
1894 2601776147
1895 2606076802
1896 2606128784
1897 2621302288
1898 2624478101
1899 2624489645
1900 2643840864
1901 2643955040
1902 2644024674
1903 2644189579
1904 2671100094
1905 2671772225
1906 2715749091
1907 2715754361
1908 2718632046
1909 2738674952
1910 2738753345
1911 2738808036
1912 2738862544
1913 2738895396
1914 2739197909
1915 2739260432
1916 2739311155
1917 2743734958
1918 2774119680
1919 2784261168
1920 2784316247
1921 2808931280
1922 2808953230
1923 2808955738
1924 2808976780
1925 2808991782
1926 2809217863
1927 2817488285
1928 2819657109
1929 2819705090
1930 2834032326
1931 2842846478
1932 2844667772
1933 2852616946
1934 2852672065
1935 2860344871
1936 2878030046
1937 2904552367
1938 2908446898
1939 2917071043
1940 2919066271
1941 2919389897
1942 2919459857
1943 2919488823
1944 2923153951
1945 2931391257
1946 2931398718
1947 2935358871
1948 2939640981
1949 2939652111
1950 2969304835
1951 2974293466
1952 2984292106
1953 2998140339
1954 3007397967
1955 3007419900
1956 3007517755
1957 3007617418
1958 3007625332
1959 3007723805
1960 3007864454
1961 637317694
1962 8015688200
1963 8019770194
1964 8019777220
1965 8054291488
1966 8054932979
1967 8055771302
1968 8055818235
1969 8056126350
1970 8056158396
1971 8056170704
1972 8056179677
1973 8056572203
1974 8057802592

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

51

179

0.83

PF12146

Hydrolase_4

Serine aminopeptidase, S33

48

211

0.79

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

53

299

0.59

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xrh-assembly1.cif.gz_B feruloyl esterase from lactobacillus acidophilus 0.7659 26 305
7xrh-assembly1.cif.gz_B feruloyl esterase from lactobacillus acidophilus 0.7477 26 305
6v7n-assembly2.cif.gz_B crystal structure of a human lysosome resident glycoprotein, lysosomal acid lipase, and its implications in cholesteryl ester storage disease (cesd) 0.7375 24 306
3pf9-assembly1.cif.gz_A crystal structure of the lactobacillus johnsonii cinnamoyl esterase lj0536 s106a mutant 0.7366 26 307
2d81-assembly1.cif.gz_A phb depolymerase (s39a) complexed with r3hb trimer 0.7334 238 285
ID Description Score Start End Superfamily
af_A0A0R0GYE0_51_217_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7924 24 150 3.40.50.1820
af_Q9VPE9_27_395_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7729 25 307 3.40.50.1820
af_K7N1G9_24_286_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7628 26 137 3.40.50.1820
af_A0A1D6K8I4_16_172_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7616 26 138 3.40.50.1820
af_M0R7L1_20_396_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.739 24 273 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A0H5AA48-F1-model_v4 Alpha/beta hydrolase 0.967 22 317 GO:0016787
AF-A0A379J1P8-F1-model_v4 deleted 0.9661 19 319
AF-A0A6G6F206-F1-model_v4 deleted 0.9625 37 320
AF-I3USN7-F1-model_v4 Alpha/beta hydrolase-like protein 0.9615 55 320 GO:0016787
AF-A0A6L5I5U1-F1-model_v4 deleted 0.9612 37 320

Map