F487555

General Info

Members Datasets Scaffolds Average Seq Length
987 466 1974 235

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0009198|Ga0495686_0009198_3478_4299
Length 273
Sequence MAREVHAGKRGGGQGLGEFASAEAHRGRPSYPAAFVTIAVMTNADPQELAKFSELAHRWWDQEGEFRPLHQINPLRLDWIDQHARLPGKRVLDVGCGGGILSDSMARRGASVLGIDLAAKPLKVAALHALEAGTANVEYRDVAAEALAAEQPGTYDIVTCMEMLEHVPDPSSIVSACATLAKPGGWLFFSTINRNAKAFAFAIVGAEHVLKLLPKGTHEYAKFIRPSELARWCRSAGLDPIETRGMEYNPLTQRYWLSGDTSVNYLVACRRPA

Samples

Sample ID Description Type Environment
1 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
82 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
133 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
135 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
136 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
137 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
139 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
140 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
145 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
206 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
211 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
213 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
217 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
218 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
219 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
220 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
221 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
222 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
223 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
224 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
225 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
226 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
227 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
228 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
229 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
230 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
231 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
232 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
233 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
234 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
235 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
236 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
237 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
238 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
239 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
240 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
241 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
242 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
243 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
244 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
245 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
246 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
247 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
248 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
249 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
250 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
251 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
252 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
253 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
254 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
255 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
256 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
257 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
258 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
259 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
260 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
261 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
262 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
263 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
264 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
265 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
266 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
267 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
268 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
269 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
270 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
271 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
272 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
273 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
274 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
275 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
276 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
277 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
278 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
279 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
280 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
281 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
282 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
283 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
284 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
285 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
286 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
287 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
288 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
289 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
290 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
291 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
292 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
293 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
294 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
295 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
296 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
297 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
298 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
299 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
300 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
301 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
302 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
303 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
304 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
305 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
306 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
307 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
308 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
309 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
310 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
311 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
312 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
313 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
314 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
315 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
316 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
317 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
318 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
319 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
320 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
321 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
322 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
323 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
324 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
325 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
326 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
327 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
328 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
329 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
330 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
331 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
332 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
333 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
334 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
335 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
336 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
337 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
338 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
339 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
340 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
341 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
342 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
343 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
344 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
345 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
346 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
347 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
348 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
349 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
350 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
351 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
352 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
353 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
354 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
355 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
356 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
357 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
358 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
359 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
360 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
361 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
362 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
363 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
364 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
365 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
366 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
367 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
368 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
369 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
370 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
371 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
372 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
373 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
374 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
375 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
376 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
377 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
378 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
379 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
380 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
381 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
382 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
393 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
394 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
395 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
396 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
397 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
398 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
399 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
400 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
401 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
402 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
403 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
404 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
405 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
406 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
409 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
410 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
411 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
412 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
413 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
414 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
415 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
416 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
417 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
418 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
419 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
420 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
421 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
422 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
423 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
424 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
425 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
426 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
427 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
428 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
429 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
430 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
431 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
432 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
433 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
434 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
435 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
436 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
437 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
438 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
439 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
440 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
441 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
442 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
443 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
444 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
445 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
446 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
447 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
448 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
449 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
450 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
451 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
452 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
453 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
454 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
455 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
456 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
457 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
458 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
459 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
460 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
461 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
462 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
463 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
464 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
465 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
466 2932422444 Comamonas sp. 4034 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.89
Metatranscriptomes 0
Isolates 1.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.39
Nodule 0.2
Rhizoplane 2.43
Rhizosphere 74.87
Stem 0
Stem Tuber 0
Unclassified 0.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495686_0009198 3300047472 Bacteria 7152
2 JGI25156J39149_1004175 3300002705 Bacteria 4477
3 JGI25156J39149_1010363 3300002705 Bacteria 2196
4 JGI25156J39149_1021359 3300002705 Bacteria 1121
5 JGI25154J39366_1002195 3300002738 Bacteria 5409
6 JGI25157J39369_1000392 3300002741 Bacteria 30204
7 JGI25152J39213_1000905 3300002773 Bacteria 14528
8 JGI25152J39213_1001351 3300002773 Bacteria 10741
9 JGI25150J39212_1006356 3300002774 Bacteria 2445
10 JGI25153J46596_10006194 3300003215 Bacteria 6120
11 JGI25153J46596_10015186 3300003215 Bacteria 3154
12 rootH2_10021208 3300003320 Bacteria 12225
13 rootL2_10052407 3300003322 Bacteria 8872
14 Ga0055539_1000352 3300003752 Bacteria 20282
15 Ga0055539_1002249 3300003752 Unclassified 3046
16 Ga0055533_1000006 3300003756 Bacteria 635559
17 Ga0055525_1000524 3300003759 Bacteria 18488
18 Ga0055535_1000433 3300003761 Bacteria 38884
19 Ga0055529_1000158 3300003763 Bacteria 93023
20 Ga0055526_1002422 3300003771 Bacteria 12637
21 Ga0055524_1000102 3300003775 Bacteria 105348
22 Ga0055530_10006481 3300003791 Bacteria 5214
23 Ga0055540_1010981 3300003792 Bacteria 2966
24 Ga0065165_1001184 3300005262 Bacteria 30266
25 Ga0065707_10118006 3300005295 Bacteria 2197
26 Ga0065707_10140497 3300005295 Bacteria 1779
27 Ga0070658_10001465 3300005327 Bacteria 20125
28 Ga0070658_10076990 3300005327 Bacteria 2736
29 Ga0070658_10096906 3300005327 Bacteria 2435
30 Ga0070658_10306421 3300005327 Bacteria 1355
31 Ga0070676_10035272 3300005328 Bacteria 2877
32 Ga0070676_10068863 3300005328 Bacteria 2119
33 Ga0070676_10212404 3300005328 Bacteria 1274
34 Ga0070670_100012223 3300005331 Bacteria 7343
35 Ga0070670_100056117 3300005331 Bacteria 3380
36 Ga0070670_100095183 3300005331 Bacteria 2561
37 Ga0070670_100157093 3300005331 Bacteria 1970
38 Ga0070670_100196909 3300005331 Bacteria 1750
39 Ga0070670_100203725 3300005331 Bacteria 1719
40 Ga0070670_100230528 3300005331 Bacteria 1612
41 Ga0070670_100488065 3300005331 Bacteria 1094
42 Ga0070670_100630704 3300005331 Bacteria 960
43 Ga0070677_10029583 3300005333 Bacteria 2078
44 Ga0070677_10066778 3300005333 Bacteria 1501
45 Ga0068869_100039932 3300005334 Bacteria 3353
46 Ga0068869_100188739 3300005334 Bacteria 1620
47 Ga0070666_10008645 3300005335 Bacteria 6331
48 Ga0070680_100065816 3300005336 Bacteria 2971
49 Ga0068868_100046565 3300005338 Bacteria 3395
50 Ga0068868_100136382 3300005338 Bacteria 2012
51 Ga0068868_100193809 3300005338 Bacteria 1691
52 Ga0068868_100288749 3300005338 Bacteria 1390
53 Ga0068868_100489253 3300005338 Bacteria 1076
54 Ga0070660_100066097 3300005339 Bacteria 2814
55 Ga0070660_100231854 3300005339 Bacteria 1502
56 Ga0070689_100001822 3300005340 Bacteria 13722
57 Ga0070689_100259670 3300005340 Bacteria 1435
58 Ga0070687_100388180 3300005343 Bacteria 912
59 Ga0070661_100027147 3300005344 Bacteria 4121
60 Ga0070668_100138568 3300005347 Bacteria 1959
61 Ga0070669_100012328 3300005353 Bacteria 6064
62 Ga0070669_100181771 3300005353 Bacteria 1645
63 Ga0070675_100012792 3300005354 Bacteria 6584
64 Ga0070675_100090045 3300005354 Bacteria 2569
65 Ga0070675_100151094 3300005354 Bacteria 1991
66 Ga0070675_100237260 3300005354 Bacteria 1592
67 Ga0070675_100680710 3300005354 Bacteria 936
68 Ga0070671_100068753 3300005355 Bacteria 2954
69 Ga0070671_100122294 3300005355 Bacteria 2190
70 Ga0070671_100143965 3300005355 Bacteria 2012
71 Ga0070671_100388796 3300005355 Bacteria 1193
72 Ga0070674_100004081 3300005356 Bacteria 8295
73 Ga0070674_100106952 3300005356 Bacteria 2048
74 Ga0070674_100122253 3300005356 Bacteria 1929
75 Ga0070674_100462709 3300005356 Bacteria 1049
76 Ga0070674_100477057 3300005356 Bacteria 1034
77 Ga0070673_100031802 3300005364 Bacteria 3965
78 Ga0070673_100033636 3300005364 Bacteria 3873
79 Ga0070673_100041305 3300005364 Bacteria 3546
80 Ga0070673_100055857 3300005364 Bacteria 3112
81 Ga0070673_100063558 3300005364 Bacteria 2937
82 Ga0070673_100082868 3300005364 Bacteria 2604
83 Ga0070673_100371982 3300005364 Bacteria 1272
84 Ga0070688_100083365 3300005365 Bacteria 2075
85 Ga0070659_100212760 3300005366 Bacteria 1593
86 Ga0070659_100421011 3300005366 Bacteria 1129
87 Ga0070667_100019421 3300005367 Bacteria 5638
88 Ga0070667_100057922 3300005367 Bacteria 3275
89 Ga0070667_100156615 3300005367 Bacteria 2004
90 Ga0070667_100230829 3300005367 Bacteria 1650
91 Ga0070714_100008092 3300005435 Bacteria 8192
92 Ga0070714_100009364 3300005435 Bacteria 7696
93 Ga0070700_100171856 3300005441 Bacteria 1501
94 Ga0070694_100011996 3300005444 Bacteria 5379
95 Ga0070663_100000634 3300005455 Bacteria 18865
96 Ga0070663_100363465 3300005455 Bacteria 1175
97 Ga0070678_100011636 3300005456 Bacteria 5436
98 Ga0070678_100053283 3300005456 Bacteria 2941
99 Ga0070678_100098523 3300005456 Bacteria 2260
100 Ga0070678_100144005 3300005456 Bacteria 1911
101 Ga0070662_100056749 3300005457 Bacteria 2843
102 Ga0070662_100205026 3300005457 Bacteria 1566
103 Ga0070662_100529358 3300005457 Bacteria 986
104 Ga0070681_10403713 3300005458 Bacteria 1278
105 Ga0068867_100004124 3300005459 Bacteria 10204
106 Ga0068867_100014577 3300005459 Bacteria 5570
107 Ga0068867_100016184 3300005459 Bacteria 5296
108 Ga0068867_100027807 3300005459 Bacteria 4068
109 Ga0068867_100051797 3300005459 Bacteria 3028
110 Ga0068867_100085413 3300005459 Bacteria 2386
111 Ga0068867_100157587 3300005459 Bacteria 1788
112 Ga0070685_10076725 3300005466 Bacteria 1994
113 Ga0070706_100002793 3300005467 Bacteria 17459
114 Ga0070706_100061643 3300005467 Bacteria 3464
115 Ga0070707_100490901 3300005468 Bacteria 1190
116 Ga0070707_100936360 3300005468 Bacteria 831
117 Ga0070699_100437364 3300005518 Bacteria 1185
118 Ga0070679_100006218 3300005530 Bacteria 11123
119 Ga0070697_100180184 3300005536 Bacteria 1791
120 Ga0068853_100228317 3300005539 Bacteria 1702
121 Ga0068853_100654113 3300005539 Bacteria 1000
122 Ga0070672_100011823 3300005543 Bacteria 6097
123 Ga0070672_100016450 3300005543 Bacteria 5296
124 Ga0070672_100106565 3300005543 Bacteria 2280
125 Ga0070672_100109760 3300005543 Bacteria 2247
126 Ga0070695_100126007 3300005545 Bacteria 1759
127 Ga0070695_100471274 3300005545 Bacteria 966
128 Ga0070696_100054709 3300005546 Bacteria 2782
129 Ga0070696_100158450 3300005546 Bacteria 1666
130 Ga0070693_100034493 3300005547 Bacteria 2800
131 Ga0070693_100053646 3300005547 Bacteria 2315
132 Ga0070665_100168115 3300005548 Bacteria 2195
133 Ga0070665_100272135 3300005548 Bacteria 1696
134 Ga0070665_100280439 3300005548 Bacteria 1668
135 Ga0070665_100545645 3300005548 Bacteria 1171
136 Ga0070704_100233161 3300005549 Bacteria 1503
137 Ga0068855_100010413 3300005563 Bacteria 11217
138 Ga0068855_100070036 3300005563 Bacteria 4081
139 Ga0068855_100113366 3300005563 Bacteria 3110
140 Ga0068855_100131402 3300005563 Bacteria 2859
141 Ga0068855_100417808 3300005563 Bacteria 1467
142 Ga0068855_100591613 3300005563 Bacteria 1197
143 Ga0070664_100117980 3300005564 Bacteria 2321
144 Ga0070664_100212941 3300005564 Bacteria 1727
145 Ga0070664_100281225 3300005564 Bacteria 1500
146 Ga0070664_100560435 3300005564 Bacteria 1057
147 Ga0068857_100103415 3300005577 Bacteria 2557
148 Ga0068857_100176721 3300005577 Bacteria 1942
149 Ga0068857_100367425 3300005577 Bacteria 1334
150 Ga0068854_100085208 3300005578 Bacteria 2340
151 Ga0068856_100012303 3300005614 Bacteria 8285
152 Ga0068852_100015266 3300005616 Bacteria 5949
153 Ga0068852_100068355 3300005616 Bacteria 3109
154 Ga0068852_100085353 3300005616 Bacteria 2812
155 Ga0068852_100109877 3300005616 Bacteria 2504
156 Ga0068852_100131801 3300005616 Bacteria 2303
157 Ga0068852_100149236 3300005616 Bacteria 2172
158 Ga0068852_100521923 3300005616 Bacteria 1185
159 Ga0068859_100039311 3300005617 Bacteria 4745
160 Ga0068859_100042728 3300005617 Bacteria 4553
161 Ga0068859_100550968 3300005617 Bacteria 1248
162 Ga0068864_100016361 3300005618 Bacteria 6174
163 Ga0068864_100104399 3300005618 Bacteria 2517
164 Ga0068864_100128029 3300005618 Bacteria 2277
165 Ga0068864_100236957 3300005618 Bacteria 1689
166 Ga0068866_10052876 3300005718 Bacteria 2074
167 Ga0068861_100019097 3300005719 Bacteria 4895
168 Ga0068861_100659008 3300005719 Bacteria 968
169 Ga0068851_10129270 3300005834 Bacteria 1364
170 Ga0068851_10155781 3300005834 Bacteria 1252
171 Ga0068870_10022355 3300005840 Bacteria 3107
172 Ga0068870_10154893 3300005840 Bacteria 1353
173 Ga0068870_10261186 3300005840 Bacteria 1078
174 Ga0068863_100022617 3300005841 Bacteria 6005
175 Ga0068863_100085754 3300005841 Bacteria 2984
176 Ga0068863_100566987 3300005841 Bacteria 1122
177 Ga0068863_100633508 3300005841 Bacteria 1060
178 Ga0068858_100002454 3300005842 Bacteria 18720
179 Ga0068858_100053499 3300005842 Bacteria 3734
180 Ga0068858_100234035 3300005842 Bacteria 1742
181 Ga0068860_100001400 3300005843 Bacteria 26146
182 Ga0068860_100064632 3300005843 Bacteria 3475
183 Ga0068862_100005708 3300005844 Bacteria 10383
184 Ga0068862_100283598 3300005844 Bacteria 1519
185 Ga0081539_10158893 3300005985 Bacteria 1079
186 Ga0075365_10304467 3300006038 Bacteria 1122
187 Ga0075368_10037234 3300006042 Bacteria 1902
188 Ga0075368_10132336 3300006042 Bacteria 1037
189 Ga0075363_100052276 3300006048 Bacteria 2180
190 Ga0075363_100064680 3300006048 Bacteria 1976
191 Ga0075363_100113720 3300006048 Bacteria 1506
192 Ga0075364_10066372 3300006051 Bacteria 2370
193 Ga0075364_10067124 3300006051 Bacteria 2357
194 Ga0070712_100163453 3300006175 Bacteria 1721
195 Ga0075362_10032933 3300006177 Bacteria 2252
196 Ga0075362_10047567 3300006177 Bacteria 1911
197 Ga0075367_10054547 3300006178 Bacteria 2370
198 Ga0075367_10055203 3300006178 Bacteria 2357
199 Ga0075367_10056702 3300006178 Bacteria 2328
200 Ga0075367_10228367 3300006178 Bacteria 1165
201 Ga0075369_10040130 3300006186 Bacteria 2000
202 Ga0075369_10052138 3300006186 Bacteria 1773
203 Ga0075366_10004345 3300006195 Bacteria 7596
204 Ga0075366_10055842 3300006195 Bacteria 2345
205 Ga0075366_10055891 3300006195 Bacteria 2344
206 Ga0075366_10061309 3300006195 Bacteria 2235
207 Ga0075366_10071747 3300006195 Bacteria 2063
208 Ga0075366_10079518 3300006195 Bacteria 1957
209 Ga0075366_10079524 3300006195 Bacteria 1957
210 Ga0075366_10091583 3300006195 Bacteria 1821
211 Ga0075366_10099646 3300006195 Bacteria 1743
212 Ga0075366_10208343 3300006195 Bacteria 1190
213 Ga0075366_10258021 3300006195 Bacteria 1064
214 Ga0075366_10277735 3300006195 Bacteria 1023
215 Ga0097621_100072410 3300006237 Bacteria 2850
216 Ga0097621_100530068 3300006237 Bacteria 1070
217 Ga0075370_10010352 3300006353 Bacteria 4874
218 Ga0075370_10029569 3300006353 Bacteria 3052
219 Ga0075370_10051089 3300006353 Bacteria 2345
220 Ga0075370_10052590 3300006353 Bacteria 2311
221 Ga0075370_10053862 3300006353 Bacteria 2283
222 Ga0075370_10067176 3300006353 Bacteria 2046
223 Ga0075370_10074900 3300006353 Bacteria 1940
224 Ga0075370_10099434 3300006353 Bacteria 1683
225 Ga0068871_100063525 3300006358 Bacteria 3020
226 Ga0068871_100139938 3300006358 Bacteria 2057
227 Ga0068871_100186431 3300006358 Bacteria 1785
228 Ga0075428_100009664 3300006844 Bacteria 10711
229 Ga0075428_100040186 3300006844 Bacteria 5148
230 Ga0075430_100023952 3300006846 Bacteria 5199
231 Ga0075431_100195675 3300006847 Bacteria 2070
232 Ga0075429_100014458 3300006880 Bacteria 6840
233 Ga0075429_100026505 3300006880 Bacteria 5034
234 Ga0075429_100056611 3300006880 Bacteria 3413
235 Ga0068865_100006089 3300006881 Bacteria 7358
236 Ga0068865_100041377 3300006881 Bacteria 3135
237 Ga0068865_100160843 3300006881 Bacteria 1713
238 Ga0068865_100486047 3300006881 Bacteria 1027
239 Ga0075436_100040472 3300006914 Bacteria 3216
240 Ga0097620_100039310 3300006931 Bacteria 4745
241 Ga0097620_100042728 3300006931 Bacteria 4553
242 Ga0097620_100550967 3300006931 Bacteria 1248
243 Ga0079104_1000688 3300006946 Bacteria 31113
244 Ga0075435_100032840 3300007076 Bacteria 4100
245 Ga0099794_10235776 3300007265 Bacteria 942
246 Ga0105240_10005231 3300009093 Bacteria 19405
247 Ga0105240_10079444 3300009093 Bacteria 4036
248 Ga0111539_10000243 3300009094 Bacteria 65363
249 Ga0111539_10099768 3300009094 Bacteria 3409
250 Ga0111539_10291450 3300009094 Bacteria 1899
251 Ga0111539_10474150 3300009094 Bacteria 1457
252 Ga0111539_10928310 3300009094 Bacteria 1012
253 Ga0105245_10069829 3300009098 Bacteria 3186
254 Ga0105245_10208407 3300009098 Bacteria 1880
255 Ga0105245_10592922 3300009098 Bacteria 1134
256 Ga0105245_10973293 3300009098 Bacteria 892
257 Ga0114129_10066741 3300009147 Bacteria 5017
258 Ga0114129_10582979 3300009147 Bacteria 1451
259 Ga0105243_10050096 3300009148 Bacteria 3298
260 Ga0105243_10053545 3300009148 Bacteria 3201
261 Ga0105243_10067795 3300009148 Bacteria 2874
262 Ga0105243_10383680 3300009148 Bacteria 1300
263 Ga0105241_10176129 3300009174 Bacteria 1770
264 Ga0105241_10306079 3300009174 Bacteria 1365
265 Ga0105242_10030444 3300009176 Bacteria 4308
266 Ga0105242_10083680 3300009176 Bacteria 2673
267 Ga0105248_10034428 3300009177 Bacteria 5663
268 Ga0105248_10399494 3300009177 Bacteria 1548
269 Ga0105248_10543655 3300009177 Bacteria 1310
270 Ga0105237_10001569 3300009545 Bacteria 29799
271 Ga0105237_10046244 3300009545 Bacteria 4378
272 Ga0105237_10800780 3300009545 Bacteria 949
273 Ga0105238_10047205 3300009551 Bacteria 4344
274 Ga0105238_10132356 3300009551 Bacteria 2472
275 Ga0105238_10230809 3300009551 Bacteria 1827
276 Ga0105249_10141262 3300009553 Bacteria 2309
277 Ga0105249_10261243 3300009553 Bacteria 1721
278 Ga0105239_10000486 3300010375 Bacteria 57901
279 Ga0105239_10053414 3300010375 Bacteria 4433
280 Ga0105239_10069245 3300010375 Bacteria 3877
281 Ga0105246_10075982 3300011119 Bacteria 2379
282 Ga0105246_10219711 3300011119 Bacteria 1489
283 Ga0157370_10017241 3300013104 Bacteria 7289
284 Ga0157370_10214811 3300013104 Bacteria 1782
285 Ga0157369_10009180 3300013105 Bacteria 11314
286 Ga0157374_10042556 3300013296 Bacteria 4190
287 Ga0157374_10139883 3300013296 Bacteria 2349
288 Ga0157374_10304049 3300013296 Bacteria 1578
289 Ga0157374_10652903 3300013296 Bacteria 1064
290 Ga0157378_10021826 3300013297 Bacteria 5630
291 Ga0157378_10028209 3300013297 Bacteria 4950
292 Ga0157378_10052031 3300013297 Bacteria 3644
293 Ga0157378_10133891 3300013297 Bacteria 2297
294 Ga0157378_10221124 3300013297 Bacteria 1800
295 Ga0157378_10230687 3300013297 Bacteria 1764
296 Ga0157378_10389993 3300013297 Bacteria 1369
297 Ga0163162_10003214 3300013306 Bacteria 15630
298 Ga0163162_10131030 3300013306 Bacteria 2616
299 Ga0163162_10161077 3300013306 Bacteria 2365
300 Ga0163162_10748205 3300013306 Bacteria 1097
301 Ga0163162_11143150 3300013306 Bacteria 883
302 Ga0157372_10081759 3300013307 Bacteria 3657
303 Ga0157372_10223867 3300013307 Bacteria 2181
304 Ga0157372_10396553 3300013307 Bacteria 1608
305 Ga0157372_10408023 3300013307 Bacteria 1583
306 Ga0157375_10028646 3300013308 Bacteria 5225
307 Ga0157375_10056335 3300013308 Bacteria 3881
308 Ga0157375_10104691 3300013308 Bacteria 2919
309 Ga0157375_10471622 3300013308 Bacteria 1420
310 Ga0157375_10720202 3300013308 Bacteria 1150
311 Ga0163163_10032862 3300014325 Bacteria 5013
312 Ga0163163_10435022 3300014325 Bacteria 1371
313 Ga0157380_10059818 3300014326 Bacteria 3042
314 Ga0157380_10160367 3300014326 Bacteria 1954
315 Ga0157380_10393650 3300014326 Bacteria 1312
316 Ga0157380_10587063 3300014326 Bacteria 1100
317 Ga0157380_10634194 3300014326 Bacteria 1063
318 Ga0157377_10164241 3300014745 Bacteria 1383
319 Ga0157379_10017321 3300014968 Bacteria 6349
320 Ga0157379_10055575 3300014968 Bacteria 3537
321 Ga0157379_10083358 3300014968 Bacteria 2865
322 Ga0157379_10098107 3300014968 Bacteria 2631
323 Ga0157379_10143611 3300014968 Bacteria 2152
324 Ga0157376_10208888 3300014969 Bacteria 1801
325 Ga0182005_1086174 3300015265 Bacteria 870
326 Ga0163161_10177045 3300017792 Bacteria 1633
327 Ga0163161_10544744 3300017792 Bacteria 950
328 Ga0209674_100003 3300025226 Bacteria 2196646
329 Ga0209672_110789 3300025228 Bacteria 1216
330 Ga0209563_100010 3300025230 Bacteria 1337457
331 Ga0207427_100530 3300025231 Bacteria 19851
332 Ga0209258_100110 3300025242 Bacteria 201322
333 Ga0209258_101188 3300025242 Bacteria 10428
334 Ga0207425_1000203 3300025245 Bacteria 47325
335 Ga0209646_1000115 3300025246 Bacteria 152389
336 Ga0209026_1000115 3300025250 Bacteria 136234
337 Ga0209677_100026 3300025253 Bacteria 382520
338 Ga0209677_100869 3300025253 Bacteria 14855
339 Ga0209759_1000733 3300025256 Bacteria 28730
340 Ga0209759_1005390 3300025256 Bacteria 4492
341 Ga0209759_1010434 3300025256 Bacteria 2722
342 Ga0209129_1000012 3300025258 Bacteria 541516
343 Ga0209565_1007930 3300025263 Bacteria 2816
344 Ga0209455_1000104 3300025272 Bacteria 201321
345 Ga0209673_1004874 3300025273 Bacteria 7006
346 Ga0209564_1000022 3300025295 Bacteria 555109
347 Ga0209758_1000099 3300025297 Bacteria 230054
348 Ga0209758_1000233 3300025297 Bacteria 116640
349 Ga0209050_1000165 3300025298 Bacteria 152109
350 Ga0209256_1000011 3300025299 Bacteria 865309
351 Ga0209256_1020421 3300025299 Bacteria 2067
352 Ga0209051_1001632 3300025303 Bacteria 18183
353 Ga0209051_1007536 3300025303 Bacteria 5930
354 Ga0209051_1054682 3300025303 Bacteria 1301
355 Ga0207697_10009127 3300025315 Bacteria 4298
356 Ga0207697_10025486 3300025315 Bacteria 2417
357 Ga0207656_10082926 3300025321 Bacteria 1444
358 Ga0207682_10026388 3300025893 Bacteria 2309
359 Ga0207682_10046897 3300025893 Bacteria 1777
360 Ga0207642_10107695 3300025899 Bacteria 1412
361 Ga0207642_10274449 3300025899 Bacteria 967
362 Ga0207688_10243681 3300025901 Bacteria 1087
363 Ga0207688_10251163 3300025901 Bacteria 1071
364 Ga0207680_10002882 3300025903 Bacteria 8061
365 Ga0207680_10447355 3300025903 Bacteria 917
366 Ga0207645_10004234 3300025907 Bacteria 10652
367 Ga0207645_10037680 3300025907 Bacteria 3102
368 Ga0207645_10085360 3300025907 Bacteria 2027
369 Ga0207645_10100271 3300025907 Bacteria 1868
370 Ga0207645_10450712 3300025907 Bacteria 869
371 Ga0207643_10012500 3300025908 Bacteria 4588
372 Ga0207643_10027724 3300025908 Bacteria 3142
373 Ga0207705_10009994 3300025909 Bacteria 6909
374 Ga0207705_10102092 3300025909 Bacteria 2111
375 Ga0207705_10362049 3300025909 Bacteria 1118
376 Ga0207684_10039040 3300025910 Bacteria 4028
377 Ga0207684_10167148 3300025910 Bacteria 1896
378 Ga0207654_10238951 3300025911 Bacteria 1213
379 Ga0207707_10284673 3300025912 Bacteria 1431
380 Ga0207695_10008032 3300025913 Bacteria 13283
381 Ga0207695_10103847 3300025913 Bacteria 2833
382 Ga0207671_10001963 3300025914 Bacteria 22689
383 Ga0207671_10012877 3300025914 Bacteria 6697
384 Ga0207693_10524885 3300025915 Bacteria 924
385 Ga0207660_10045635 3300025917 Bacteria 3088
386 Ga0207662_10258329 3300025918 Bacteria 1146
387 Ga0207662_10290833 3300025918 Bacteria 1084
388 Ga0207657_10135633 3300025919 Bacteria 2014
389 Ga0207657_10250721 3300025919 Bacteria 1411
390 Ga0207657_10412261 3300025919 Bacteria 1062
391 Ga0207649_10160502 3300025920 Bacteria 1557
392 Ga0207652_10031020 3300025921 Bacteria 4484
393 Ga0207646_10139287 3300025922 Bacteria 2185
394 Ga0207681_10019299 3300025923 Bacteria 4306
395 Ga0207681_10034599 3300025923 Bacteria 3323
396 Ga0207681_10111158 3300025923 Bacteria 1993
397 Ga0207694_10063078 3300025924 Bacteria 2886
398 Ga0207694_10086261 3300025924 Bacteria 2472
399 Ga0207694_10236808 3300025924 Bacteria 1491
400 Ga0207694_10382764 3300025924 Bacteria 1168
401 Ga0207650_10000348 3300025925 Bacteria 44624
402 Ga0207650_10114538 3300025925 Bacteria 2092
403 Ga0207650_10193841 3300025925 Bacteria 1625
404 Ga0207650_10269060 3300025925 Bacteria 1384
405 Ga0207650_10343913 3300025925 Bacteria 1225
406 Ga0207650_10422564 3300025925 Bacteria 1106
407 Ga0207659_10000398 3300025926 Bacteria 26234
408 Ga0207659_10002553 3300025926 Bacteria 10833
409 Ga0207659_10009530 3300025926 Bacteria 6073
410 Ga0207659_10058624 3300025926 Bacteria 2764
411 Ga0207687_10242066 3300025927 Bacteria 1430
412 Ga0207687_10265219 3300025927 Bacteria 1371
413 Ga0207664_10001410 3300025929 Bacteria 15817
414 Ga0207664_10049045 3300025929 Bacteria 3323
415 Ga0207644_10030506 3300025931 Bacteria 3750
416 Ga0207644_10120019 3300025931 Bacteria 2000
417 Ga0207644_10161069 3300025931 Bacteria 1744
418 Ga0207644_10203866 3300025931 Bacteria 1561
419 Ga0207644_10476177 3300025931 Bacteria 1028
420 Ga0207690_10034240 3300025932 Bacteria 3272
421 Ga0207690_10266031 3300025932 Bacteria 1330
422 Ga0207706_10012196 3300025933 Bacteria 7832
423 Ga0207706_10041354 3300025933 Bacteria 4086
424 Ga0207706_10282416 3300025933 Bacteria 1447
425 Ga0207706_10286748 3300025933 Bacteria 1435
426 Ga0207686_10134942 3300025934 Bacteria 1698
427 Ga0207686_10412438 3300025934 Bacteria 1031
428 Ga0207709_10057779 3300025935 Bacteria 2407
429 Ga0207709_10200718 3300025935 Bacteria 1424
430 Ga0207709_10374331 3300025935 Bacteria 1082
431 Ga0207670_10017145 3300025936 Bacteria 4372
432 Ga0207670_10031511 3300025936 Bacteria 3399
433 Ga0207669_10014606 3300025937 Bacteria 3941
434 Ga0207669_10043009 3300025937 Bacteria 2642
435 Ga0207669_10064893 3300025937 Bacteria 2262
436 Ga0207669_10106757 3300025937 Bacteria 1866
437 Ga0207669_10131692 3300025937 Bacteria 1719
438 Ga0207669_10134668 3300025937 Bacteria 1704
439 Ga0207704_10056001 3300025938 Bacteria 2413
440 Ga0207704_10058303 3300025938 Bacteria 2377
441 Ga0207704_10247517 3300025938 Bacteria 1336
442 Ga0207691_10007412 3300025940 Bacteria 10562
443 Ga0207691_10014572 3300025940 Bacteria 7495
444 Ga0207691_10039958 3300025940 Bacteria 4338
445 Ga0207691_10076858 3300025940 Bacteria 3009
446 Ga0207691_10113339 3300025940 Bacteria 2410
447 Ga0207711_10224493 3300025941 Bacteria 1719
448 Ga0207711_10459093 3300025941 Bacteria 1186
449 Ga0207689_10033844 3300025942 Bacteria 4245
450 Ga0207689_10081758 3300025942 Bacteria 2656
451 Ga0207689_10271790 3300025942 Bacteria 1403
452 Ga0207661_10463018 3300025944 Bacteria 1156
453 Ga0207661_10529540 3300025944 Bacteria 1078
454 Ga0207679_10006286 3300025945 Bacteria 7496
455 Ga0207679_10190674 3300025945 Bacteria 1704
456 Ga0207667_10020124 3300025949 Bacteria 7431
457 Ga0207667_10022600 3300025949 Bacteria 6941
458 Ga0207667_10064363 3300025949 Bacteria 3829
459 Ga0207667_10267706 3300025949 Bacteria 1747
460 Ga0207667_10325921 3300025949 Bacteria 1568
461 Ga0207651_10001308 3300025960 Bacteria 11234
462 Ga0207651_10017078 3300025960 Bacteria 4275
463 Ga0207651_10052248 3300025960 Bacteria 2785
464 Ga0207651_10211830 3300025960 Bacteria 1560
465 Ga0207651_10494342 3300025960 Bacteria 1056
466 Ga0207712_10016627 3300025961 Bacteria 4769
467 Ga0207640_10018591 3300025981 Bacteria 4087
468 Ga0207640_10070506 3300025981 Bacteria 2351
469 Ga0207658_10011281 3300025986 Bacteria 6085
470 Ga0207658_10045809 3300025986 Bacteria 3190
471 Ga0207658_10141500 3300025986 Bacteria 1947
472 Ga0207658_10196643 3300025986 Bacteria 1680
473 Ga0207677_10050706 3300026023 Bacteria 2809
474 Ga0207677_10135477 3300026023 Bacteria 1877
475 Ga0207677_10144798 3300026023 Bacteria 1825
476 Ga0207677_10198704 3300026023 Bacteria 1592
477 Ga0207677_10322691 3300026023 Bacteria 1284
478 Ga0207703_10147189 3300026035 Bacteria 2050
479 Ga0207703_10275791 3300026035 Bacteria 1525
480 Ga0207703_10423842 3300026035 Bacteria 1239
481 Ga0207678_10001200 3300026067 Bacteria 23772
482 Ga0207678_10332300 3300026067 Bacteria 1309
483 Ga0207708_10063766 3300026075 Bacteria 2815
484 Ga0207702_10010769 3300026078 Bacteria 7634
485 Ga0207641_10022148 3300026088 Bacteria 5229
486 Ga0207641_10182251 3300026088 Bacteria 1924
487 Ga0207641_10513143 3300026088 Bacteria 1165
488 Ga0207641_10707041 3300026088 Bacteria 993
489 Ga0207648_10006696 3300026089 Bacteria 11428
490 Ga0207648_10006922 3300026089 Bacteria 11237
491 Ga0207648_10006965 3300026089 Bacteria 11188
492 Ga0207648_10074159 3300026089 Bacteria 2965
493 Ga0207648_10104346 3300026089 Bacteria 2486
494 Ga0207648_10110649 3300026089 Bacteria 2411
495 Ga0207676_10001822 3300026095 Bacteria 15609
496 Ga0207676_10087186 3300026095 Bacteria 2552
497 Ga0207676_10202672 3300026095 Bacteria 1754
498 Ga0207676_10628416 3300026095 Bacteria 1034
499 Ga0207676_10707277 3300026095 Bacteria 977
500 Ga0207674_10017697 3300026116 Bacteria 7767
501 Ga0207674_10044316 3300026116 Bacteria 4582
502 Ga0207674_10116239 3300026116 Bacteria 2646
503 Ga0207674_10224432 3300026116 Bacteria 1827
504 Ga0207674_10457741 3300026116 Bacteria 1233
505 Ga0207675_100004540 3300026118 Bacteria 13390
506 Ga0207675_100028280 3300026118 Bacteria 5220
507 Ga0207675_100065649 3300026118 Bacteria 3392
508 Ga0207675_100514501 3300026118 Bacteria 1193
509 Ga0207683_10065295 3300026121 Bacteria 3208
510 Ga0207683_10122226 3300026121 Bacteria 2338
511 Ga0207683_10171945 3300026121 Bacteria 1962
512 Ga0207683_10210301 3300026121 Bacteria 1770
513 Ga0207683_10330511 3300026121 Bacteria 1397
514 Ga0207683_10449480 3300026121 Bacteria 1188
515 Ga0207698_10034620 3300026142 Bacteria 3684
516 Ga0207698_10145850 3300026142 Bacteria 2047
517 Ga0207698_10146823 3300026142 Bacteria 2041
518 Ga0207698_10277266 3300026142 Bacteria 1549
519 Ga0207698_10310832 3300026142 Bacteria 1472
520 Ga0207698_10399892 3300026142 Bacteria 1312
521 Ga0207698_10462969 3300026142 Bacteria 1226
522 Ga0209281_1000042 3300027111 Bacteria 344748
523 Ga0209996_1006512 3300027395 Bacteria 1510
524 Ga0209968_1001979 3300027526 Bacteria 3117
525 Ga0209971_1002962 3300027682 Bacteria 4062
526 Ga0209966_1000006 3300027695 Bacteria 102095
527 Ga0209813_10022057 3300027866 Bacteria 1796
528 Ga0209813_10037911 3300027866 Bacteria 1454
529 Ga0209974_10012208 3300027876 Bacteria 2875
530 Ga0207428_10002938 3300027907 Bacteria 16889
531 Ga0207428_10009412 3300027907 Bacteria 8760
532 Ga0268266_10019942 3300028379 Bacteria 5713
533 Ga0268266_10135520 3300028379 Bacteria 2205
534 Ga0268266_10596318 3300028379 Bacteria 1061
535 Ga0268266_10805562 3300028379 Bacteria 907
536 Ga0268265_10007045 3300028380 Bacteria 7602
537 Ga0268265_10092356 3300028380 Bacteria 2422
538 Ga0268265_10469763 3300028380 Bacteria 1179
539 Ga0268264_10005037 3300028381 Bacteria 11180
540 Ga0268264_10116586 3300028381 Bacteria 2348
541 Ga0265334_10021442 3300028573 Bacteria 2638
542 Ga0265336_10000085 3300028666 Bacteria 74880
543 Ga0307517_10004982 3300028786 Bacteria 20222
544 Ga0307517_10138760 3300028786 Bacteria 1716
545 Ga0307517_10231275 3300028786 Bacteria 1109
546 Ga0307515_10000020 3300028794 Bacteria 411735
547 Ga0307515_10000525 3300028794 Bacteria 91297
548 Ga0307515_10001622 3300028794 Bacteria 50061
549 Ga0307515_10015416 3300028794 Bacteria 14081
550 Ga0307515_10030879 3300028794 Bacteria 8969
551 Ga0307515_10035620 3300028794 Bacteria 8086
552 Ga0307515_10062236 3300028794 Bacteria 5275
553 Ga0307515_10085205 3300028794 Bacteria 4047
554 Ga0307515_10255236 3300028794 Bacteria 1499
555 Ga0307515_10260153 3300028794 Bacteria 1473
556 Ga0307515_10377545 3300028794 Bacteria 1051
557 Ga0265324_10002613 3300029957 Bacteria 9041
558 Ga0307512_10095391 3300030522 Bacteria 2047
559 Ga0265330_10004618 3300031235 Bacteria 6963
560 Ga0265332_10000001 3300031238 Bacteria 863783
561 Ga0265325_10001489 3300031241 Bacteria 16484
562 Ga0265340_10021960 3300031247 Bacteria 3268
563 Ga0265327_10000205 3300031251 Bacteria 123596
564 Ga0265316_10004748 3300031344 Bacteria 13437
565 Ga0307513_10000776 3300031456 Bacteria 46244
566 Ga0307513_10002553 3300031456 Bacteria 25147
567 Ga0307513_10024647 3300031456 Bacteria 6994
568 Ga0307513_10055195 3300031456 Bacteria 4253
569 Ga0307513_10157012 3300031456 Bacteria 2173
570 Ga0307513_10316600 3300031456 Bacteria 1320
571 Ga0307509_10005169 3300031507 Bacteria 18309
572 Ga0307509_10044639 3300031507 Bacteria 4787
573 Ga0307509_10071702 3300031507 Bacteria 3612
574 Ga0307509_10116792 3300031507 Bacteria 2657
575 Ga0307509_10153679 3300031507 Bacteria 2212
576 Ga0307509_10186696 3300031507 Bacteria 1930
577 Ga0307509_10203348 3300031507 Bacteria 1814
578 Ga0307408_100062868 3300031548 Bacteria 2714
579 Ga0307408_100196239 3300031548 Bacteria 1630
580 Ga0307408_100465060 3300031548 Bacteria 1100
581 Ga0307408_100538500 3300031548 Bacteria 1028
582 Ga0265313_10008798 3300031595 Bacteria 6650
583 Ga0307508_10000007 3300031616 Bacteria 268359
584 Ga0307508_10056366 3300031616 Bacteria 3479
585 Ga0307508_10108096 3300031616 Bacteria 2380
586 Ga0307508_10370395 3300031616 Bacteria 1023
587 Ga0307514_10010652 3300031649 Bacteria 7684
588 Ga0307514_10188468 3300031649 Bacteria 1317
589 Ga0316579_10066140 3300031691 Bacteria 1706
590 Ga0265314_10000145 3300031711 Bacteria 106541
591 Ga0265314_10284607 3300031711 Bacteria 934
592 Ga0307516_10003350 3300031730 Bacteria 20726
593 Ga0307516_10003396 3300031730 Bacteria 20512
594 Ga0307516_10011403 3300031730 Bacteria 9659
595 Ga0307516_10044529 3300031730 Bacteria 4389
596 Ga0307516_10080452 3300031730 Bacteria 3102
597 Ga0307516_10302338 3300031730 Bacteria 1275
598 Ga0307516_10348762 3300031730 Bacteria 1146
599 Ga0307516_10440958 3300031730 Bacteria 959
600 Ga0307405_10066606 3300031731 Bacteria 2297
601 Ga0307413_10094339 3300031824 Bacteria 1959
602 Ga0307413_10117195 3300031824 Bacteria 1796
603 Ga0307410_10007964 3300031852 Bacteria 5841
604 Ga0307410_10155983 3300031852 Bacteria 1705
605 Ga0307410_10305142 3300031852 Bacteria 1257
606 Ga0307410_10750991 3300031852 Bacteria 826
607 Ga0307406_10184233 3300031901 Bacteria 1523
608 Ga0307406_10197964 3300031901 Bacteria 1476
609 Ga0307407_10142188 3300031903 Bacteria 1549
610 Ga0307412_10021943 3300031911 Bacteria 3906
611 Ga0307412_10124809 3300031911 Bacteria 1860
612 Ga0307412_10184025 3300031911 Bacteria 1574
613 Ga0307412_10348459 3300031911 Bacteria 1188
614 Ga0307409_100175585 3300031995 Bacteria 1890
615 Ga0307416_100236823 3300032002 Bacteria 1765
616 Ga0307416_100283793 3300032002 Bacteria 1634
617 Ga0307416_100814542 3300032002 Bacteria 1030
618 Ga0307416_101287669 3300032002 Bacteria 837
619 Ga0307414_10492773 3300032004 Bacteria 1083
620 Ga0307411_10078530 3300032005 Bacteria 2263
621 Ga0307411_10122068 3300032005 Bacteria 1887
622 Ga0307415_100041727 3300032126 Bacteria 3049
623 Ga0307415_100416245 3300032126 Bacteria 1152
624 Ga0307507_10063973 3300033179 Bacteria 3399
625 Ga0307507_10088284 3300033179 Bacteria 2675
626 Ga0307510_10001909 3300033180 Bacteria 23432
627 Ga0307510_10074139 3300033180 Bacteria 3365
628 Ga0307510_10151620 3300033180 Bacteria 1935
629 Ga0307510_10312324 3300033180 Bacteria 1031
630 Ga0373959_0020459 3300034820 Bacteria 1263
631 Ga0373926_0058338 3300035083 Bacteria 1403
632 Ga0373934_0001853 3300035086 Bacteria 7762
633 Ga0373934_0009661 3300035086 Bacteria 3617
634 Ga0373949_0054361 3300035090 Bacteria 1016
635 Ga0373936_0002471 3300035113 Bacteria 6914
636 Ga0373939_0020749 3300035114 Bacteria 1790
637 Ga0373953_0000906 3300035117 Bacteria 8298
638 Ga0373954_0203579 3300035118 Bacteria 972
639 Ga0373956_0075975 3300035119 Bacteria 1536
640 Ga0373943_0126646 3300035170 Bacteria 1363
641 Ga0373955_0026920 3300035172 Bacteria 2967
642 Ga0316574_0060626 3300035398 Bacteria 2375
643 Ga0373924_0001986 3300035410 Bacteria 6800
644 Ga0373931_0002254 3300035691 Bacteria 8517
645 Ga0373931_0172623 3300035691 Bacteria 1275
646 Ga0373931_0208605 3300035691 Bacteria 1171
647 Ga0373931_0237102 3300035691 Bacteria 1104
648 Ga0373931_0278284 3300035691 Bacteria 1026
649 Ga0373935_0008726 3300035692 Bacteria 6072
650 Ga0373935_0016027 3300035692 Bacteria 4535
651 Ga0373927_0000003 3300035695 Bacteria 480348
652 Ga0373927_0188681 3300035695 Bacteria 1352
653 Ga0373933_0244398 3300035724 Bacteria 1155
654 Ga0373937_0063318 3300036401 Bacteria 3401
655 Ga0316582_0101977 3300036647 Bacteria 1902
656 Ga0316584_0123759 3300036712 Bacteria 1932
657 Ga0373925_0011126 3300037068 Bacteria 6526
658 Ga0373925_0026467 3300037068 Bacteria 4244
659 Ga0373925_0091833 3300037068 Bacteria 2322
660 Ga0373925_0152623 3300037068 Bacteria 1815
661 Ga0373925_0182258 3300037068 Bacteria 1663
662 Ga0395900_0000378 3300037418 Bacteria 64374
663 Ga0395898_0001418 3300037466 Bacteria 34116
664 Ga0395898_0034931 3300037466 Bacteria 5003
665 Ga0395905_0000236 3300037471 Bacteria 83344
666 Ga0395905_0005570 3300037471 Bacteria 12839
667 Ga0395905_0064603 3300037471 Bacteria 3425
668 Ga0395905_0152786 3300037471 Bacteria 2171
669 Ga0395905_0428322 3300037471 Bacteria 1220
670 Ga0395905_0536015 3300037471 Bacteria 1071
671 Ga0395901_0002825 3300038443 Bacteria 17532
672 Ga0395901_0355766 3300038443 Bacteria 1511
673 Ga0400483_098460 3300039062 Bacteria 1659
674 Ga0400483_238624 3300039062 Bacteria 4241
675 Ga0400487_35893 3300039110 Bacteria 53987
676 Ga0400487_45754 3300039110 Bacteria 1115
677 Ga0436365_1917218 3300039437 Bacteria 951
678 Ga0436360_1177354 3300039438 Bacteria 16147
679 Ga0436361_0215417 3300039447 Bacteria 1103
680 Ga0436361_0338760 3300039447 Bacteria 2021
681 Ga0436361_0439659 3300039447 Bacteria 2745
682 Ga0436363_1162970 3300039450 Bacteria 4835
683 Ga0451789_1103105 3300041443 Bacteria 3027
684 Ga0451791_1344885 3300041451 Bacteria 2554
685 Ga0451793_0235702 3300041452 Bacteria 2867
686 Ga0451798_0494322 3300041458 Bacteria 1104
687 Ga0451798_0588047 3300041458 Bacteria 1355
688 Ga0451800_0594548 3300041459 Bacteria 888
689 Ga0451802_1531971 3300041460 Bacteria 1259
690 Ga0451807_1684855 3300041486 Bacteria 1222
691 Ga0451839_0407424 3300041496 Bacteria 857
692 Ga0451849_1115069 3300041505 Bacteria 1056
693 Ga0451853_3158146 3300041512 Bacteria 1100
694 Ga0439450_038876 3300042008 Bacteria 1098
695 Ga0439454_016750 3300042011 Bacteria 1040
696 Ga0439455_0005175 3300042012 Bacteria 2633
697 Ga0450898_004806 3300042134 Bacteria 2016
698 Ga0450898_011562 3300042134 Bacteria 1447
699 Ga0450899_001934 3300042135 Bacteria 2293
700 Ga0439446_0034455 3300042156 Bacteria 1473
701 Ga0439458_0024242 3300042157 Bacteria 1418
702 Ga0439434_0013239 3300042435 Bacteria 2447
703 Ga0439464_0004366 3300042439 Bacteria 3614
704 Ga0439460_0019301 3300042461 Bacteria 1845
705 Ga0450918_000505 3300042531 Bacteria 8381
706 Ga0451577_0010789 3300042876 Bacteria 8690
707 Ga0451577_0019663 3300042876 Bacteria 6207
708 Ga0451577_0031911 3300042876 Bacteria 4749
709 Ga0451577_0052237 3300042876 Bacteria 3649
710 Ga0451577_0559101 3300042876 Bacteria 1039
711 Ga0451577_0589012 3300042876 Bacteria 1009
712 Ga0466969_0000595 3300044656 Bacteria 19624
713 Ga0466969_0004862 3300044656 Bacteria 7156
714 Ga0466969_0133636 3300044656 Bacteria 1149
715 Ga0466972_0004906 3300044658 Bacteria 6712
716 Ga0466972_0019791 3300044658 Bacteria 3365
717 Ga0466965_0023891 3300044683 Bacteria 2954
718 Ga0466965_0043775 3300044683 Bacteria 2211
719 Ga0466965_0069153 3300044683 Bacteria 1774
720 Ga0466965_0072401 3300044683 Bacteria 1734
721 Ga0466966_0009425 3300044684 Bacteria 6466
722 Ga0466966_0025092 3300044684 Bacteria 3896
723 Ga0466966_0027591 3300044684 Bacteria 3701
724 Ga0466966_0342989 3300044684 Bacteria 898
725 Ga0466961_0017789 3300044693 Bacteria 4566
726 Ga0466961_0021262 3300044693 Bacteria 4178
727 Ga0466963_0009809 3300044694 Bacteria 5779
728 Ga0466963_0204008 3300044694 Bacteria 1383
729 Ga0466963_0274221 3300044694 Bacteria 1185
730 Ga0466964_0005066 3300044706 Bacteria 4874
731 Ga0466964_0022522 3300044706 Bacteria 2445
732 Ga0453684_0031281 3300044712 Bacteria 7486
733 Ga0453684_0499040 3300044712 Bacteria 1348
734 Ga0466971_0009376 3300044719 Bacteria 4277
735 Ga0466971_0028886 3300044719 Bacteria 2480
736 Ga0466968_0004989 3300044735 Bacteria 4972
737 Ga0466968_0072002 3300044735 Bacteria 1506
738 Ga0466970_0015954 3300044765 Bacteria 3867
739 Ga0466957_0009895 3300044842 Bacteria 5452
740 Ga0466957_0042962 3300044842 Bacteria 2735
741 Ga0466957_0069412 3300044842 Bacteria 2177
742 Ga0466957_0269121 3300044842 Bacteria 1137
743 Ga0466960_0097234 3300044901 Bacteria 1510
744 Ga0466959_0002753 3300045049 Bacteria 11324
745 Ga0466959_0009873 3300045049 Bacteria 6803
746 Ga0466959_0021408 3300045049 Bacteria 4768
747 Ga0466959_0050399 3300045049 Bacteria 3056
748 Ga0451576_0001886 3300045051 Bacteria 33684
749 Ga0451576_0008786 3300045051 Bacteria 11817
750 Ga0451576_0367454 3300045051 Bacteria 1507
751 Ga0466958_0008038 3300045836 Bacteria 5833
752 Ga0466958_0173677 3300045836 Bacteria 1365
753 Ga0466967_0187304 3300045976 Bacteria 1954
754 Ga0466967_0353637 3300045976 Bacteria 1422
755 Ga0495592_0000387 3300046454 Bacteria 34389
756 Ga0495592_0015259 3300046454 Bacteria 5830
757 Ga0495590_0079575 3300046457 Bacteria 1154
758 Ga0495638_0038336 3300046460 Bacteria 3046
759 Ga0495638_0049447 3300046460 Bacteria 2629
760 Ga0495641_0012932 3300046461 Bacteria 4628
761 Ga0495651_0077532 3300046462 Bacteria 2515
762 Ga0495651_0214483 3300046462 Bacteria 1337
763 Ga0495653_0058754 3300046463 Bacteria 2922
764 Ga0495580_0107086 3300046472 Bacteria 1941
765 Ga0495605_0051829 3300046474 Bacteria 1997
766 Ga0495639_0011352 3300046475 Bacteria 3841
767 Ga0495639_0042252 3300046475 Bacteria 2056
768 Ga0495662_0050105 3300046476 Bacteria 2015
769 Ga0495664_0101113 3300046477 Bacteria 1737
770 Ga0495594_0037152 3300046499 Bacteria 2657
771 Ga0495583_0000376 3300046506 Bacteria 69314
772 Ga0495583_0037775 3300046506 Bacteria 2287
773 Ga0495610_0009033 3300046512 Bacteria 6360
774 Ga0495610_0050463 3300046512 Bacteria 2031
775 Ga0495610_0070906 3300046512 Bacteria 1626
776 Ga0495618_0031724 3300046514 Bacteria 3307
777 Ga0495628_0020483 3300046516 Bacteria 5452
778 Ga0495628_0025641 3300046516 Bacteria 4816
779 Ga0495630_0043086 3300046517 Bacteria 3371
780 Ga0495632_0006390 3300046519 Bacteria 7589
781 Ga0495632_0010747 3300046519 Bacteria 5394
782 Ga0495632_0041765 3300046519 Bacteria 2302
783 Ga0495632_0062489 3300046519 Bacteria 1805
784 Ga0495643_0041469 3300046522 Bacteria 2509
785 Ga0495648_0042933 3300046524 Bacteria 2840
786 Ga0495666_0056838 3300046526 Bacteria 1873
787 Ga0495665_0008462 3300046531 Bacteria 5582
788 Ga0495640_0021293 3300046533 Bacteria 4760
789 Ga0495586_0026745 3300046535 Bacteria 3087
790 Ga0495586_0217061 3300046535 Bacteria 1086
791 Ga0495587_0007209 3300046536 Bacteria 7214
792 Ga0495621_0015844 3300046539 Bacteria 2410
793 Ga0495597_0062421 3300046542 Bacteria 1621
794 Ga0495597_0086417 3300046542 Bacteria 1335
795 Ga0495645_0062323 3300046543 Bacteria 2701
796 Ga0495622_0166713 3300046557 Bacteria 992
797 Ga0495633_0003122 3300046558 Bacteria 11228
798 Ga0495667_0053287 3300046559 Bacteria 2664
799 Ga0495668_0157899 3300046616 Bacteria 1242
800 Ga0495668_0204867 3300046616 Bacteria 1080
801 Ga0495625_0003116 3300046660 Bacteria 16943
802 Ga0495625_0038374 3300046660 Bacteria 3507
803 Ga0495625_0056341 3300046660 Bacteria 2799
804 Ga0495625_0128976 3300046660 Bacteria 1714
805 Ga0495635_0029232 3300046663 Bacteria 3832
806 Ga0495657_0030850 3300046675 Bacteria 3750
807 Ga0495599_0156227 3300046678 Bacteria 1411
808 Ga0495646_0093927 3300046680 Bacteria 1728
809 Ga0495647_0033885 3300046681 Bacteria 1910
810 Ga0495647_0085942 3300046681 Bacteria 1282
811 Ga0495658_0091743 3300046683 Bacteria 1799
812 Ga0495658_0122995 3300046683 Bacteria 1571
813 Ga0495613_0191141 3300046689 Bacteria 1446
814 Ga0495624_0050386 3300046690 Bacteria 2638
815 Ga0495671_0177130 3300046692 Bacteria 1036
816 Ga0495649_0003169 3300046694 Bacteria 11245
817 Ga0495649_0010791 3300046694 Bacteria 5382
818 Ga0495600_0002520 3300046809 Bacteria 10530
819 Ga0495660_0059095 3300046810 Bacteria 2063
820 Ga0495674_0056377 3300047319 Bacteria 3441
821 Ga0495680_0267942 3300047322 Bacteria 1206
822 Ga0495683_0143069 3300047323 Bacteria 1119
823 Ga0495687_000895 3300047443 Bacteria 31294
824 Ga0495687_013838 3300047443 Bacteria 4183
825 Ga0495675_0018143 3300047444 Bacteria 4463
826 Ga0495686_0085640 3300047472 Bacteria 1918
827 Ga0495686_0127752 3300047472 Bacteria 1510
828 Ga0495593_0075399 3300047673 Bacteria 1749
829 Ga0495593_0110387 3300047673 Bacteria 1405
830 Ga0495602_0282612 3300048088 Bacteria 1222
831 Ga0496101_0043246 3300048904 Bacteria 3219
832 Ga0496102_0073646 3300048905 Bacteria 3138
833 Ga0496104_0042136 3300048907 Bacteria 4283
834 Ga0496104_0096070 3300048907 Bacteria 2835
835 Ga0496105_0247674 3300048908 Bacteria 1444
836 Ga0496108_0098399 3300048911 Bacteria 2493
837 Ga0496108_0115719 3300048911 Bacteria 2296
838 Ga0496108_0256504 3300048911 Bacteria 1521
839 Ga0496108_0494663 3300048911 Bacteria 1068
840 Ga0496108_0529160 3300048911 Bacteria 1029
841 Ga0496110_0033734 3300048913 Bacteria 4430
842 Ga0496110_0078869 3300048913 Bacteria 2932
843 Ga0496114_0027012 3300048917 Bacteria 4702
844 Ga0496114_0032678 3300048917 Bacteria 4284
845 Ga0496114_0049082 3300048917 Bacteria 3511
846 Ga0496114_0428228 3300048917 Bacteria 1172
847 Ga0496121_0017040 3300048924 Bacteria 7454
848 Ga0496124_0000161 3300048927 Bacteria 136651
849 Ga0496124_0180555 3300048927 Bacteria 1625
850 Ga0496125_0024913 3300048928 Bacteria 5491
851 Ga0501031_0130440 3300049568 Bacteria 1642
852 Ga0501032_0006906 3300049569 Bacteria 8321
853 Ga0501032_0032501 3300049569 Bacteria 3576
854 Ga0501034_0000487 3300049571 Bacteria 64548
855 Ga0501034_0011695 3300049571 Bacteria 9080
856 Ga0501034_0579065 3300049571 Bacteria 1029
857 Ga0501038_0023064 3300049574 Bacteria 5569
858 Ga0501038_0052996 3300049574 Bacteria 3495
859 Ga0501039_0089380 3300049575 Bacteria 2400
860 Ga0501039_0258159 3300049575 Bacteria 1370
861 Ga0501040_0036751 3300049576 Bacteria 3326
862 Ga0501043_0000052 3300049579 Bacteria 106686
863 Ga0501046_0000430 3300049580 Bacteria 42066
864 Ga0501046_0149724 3300049580 Bacteria 1761
865 Ga0501047_0000039 3300049581 Bacteria 187849
866 Ga0501047_0071107 3300049581 Bacteria 3349
867 Ga0501048_0040372 3300049582 Bacteria 3344
868 Ga0501069_0043526 3300049585 Bacteria 2485
869 Ga0501069_0079656 3300049585 Bacteria 1844
870 Ga0501070_0014474 3300049586 Bacteria 6639
871 Ga0501070_0082311 3300049586 Bacteria 2664
872 Ga0501070_0277714 3300049586 Bacteria 1367
873 Ga0501071_0194019 3300049587 Bacteria 1524
874 Ga0501072_0035658 3300049588 Bacteria 3897
875 Ga0501073_0001502 3300049589 Bacteria 17266
876 Ga0501074_0006518 3300049590 Bacteria 8428
877 Ga0501074_0102476 3300049590 Bacteria 2049
878 Ga0501075_0152260 3300049591 Bacteria 1763
879 Ga0501076_0697566 3300049592 Bacteria 838
880 Ga0501198_000132 3300049649 Bacteria 11059
881 Ga0501222_000189 3300049662 Bacteria 11054
882 Ga0501253_009491 3300049683 Bacteria 1436
883 Ga0501080_0017464 3300049742 Bacteria 6635
884 Ga0501080_0433226 3300049742 Bacteria 1180
885 Ga0501083_0001806 3300049744 Bacteria 14649
886 Ga0501262_016955 3300049759 Bacteria 968
887 Ga0501035_0145547 3300049822 Bacteria 2058
888 Ga0501035_0184777 3300049822 Bacteria 1794
889 Ga0501044_0098995 3300049823 Bacteria 2935
890 Ga0501045_0017773 3300049824 Bacteria 5050
891 nmdc:mga03683_110270_c1 3300050489 Bacteria 1216
892 nmdc:mga03683_21912_c1 3300050489 Bacteria 2471
893 nmdc:mga03683_24427_c1 3300050489 Bacteria 2365
894 nmdc:mga03683_34934_c1 3300050489 Bacteria 2036
895 nmdc:mga03n38_194499_c1 3300050490 Bacteria 1046
896 nmdc:mga00v17_49568_c1 3300050491 Bacteria 2548
897 nmdc:mga00v17_79021_c1 3300050491 Bacteria 2051
898 nmdc:mga0yw44_222887_c1 3300050492 Bacteria 1250
899 nmdc:mga0k408_1102_c1 3300050493 Bacteria 14783
900 nmdc:mga0k408_16823_c1 3300050493 Bacteria 4066
901 nmdc:mga0k408_170907_c1 3300050493 Bacteria 1296
902 nmdc:mga0k408_2080_c1 3300050493 Bacteria 10706
903 nmdc:mga0k408_31371_c1 3300050493 Bacteria 3034
904 nmdc:mga0k408_3241_c1 3300050493 Bacteria 8614
905 nmdc:mga0k408_57201_c1 3300050493 Bacteria 2264
906 nmdc:mga0k408_57791_c1 3300050493 Bacteria 2253
907 nmdc:mga0k408_73662_c1 3300050493 Bacteria 1995
908 nmdc:mga0k408_99861_c2 3300050493 Bacteria 1260
909 nmdc:mga06z11_10178_c1 3300050494 Bacteria 3994
910 nmdc:mga06z11_16631_c1 3300050494 Bacteria 3318
911 nmdc:mga04h51_142015_c1 3300050495 Bacteria 911
912 nmdc:mga04h51_72599_c1 3300050495 Bacteria 1205
913 nmdc:mga07m45_10292_c1 3300050496 Bacteria 4880
914 nmdc:mga07m45_21586_c1 3300050496 Bacteria 3508
915 nmdc:mga07m45_26205_c1 3300050496 Bacteria 3204
916 nmdc:mga07m45_416481_c1 3300050496 Bacteria 779
917 nmdc:mga07m45_49715_c1 3300050496 Bacteria 2361
918 nmdc:mga07m45_521_c1 3300050496 Bacteria 16326
919 nmdc:mga07m45_53555_c1 3300050496 Bacteria 2280
920 nmdc:mga07m45_65931_c1 3300050496 Bacteria 2057
921 nmdc:mga07m45_76067_c1 3300050496 Bacteria 1914
922 nmdc:mga05p37_2801_c1 3300050507 Bacteria 20272
923 nmdc:mga09592_10994_c1 3300050508 Bacteria 7362
924 nmdc:mga09592_14926_c1 3300050508 Bacteria 6345
925 nmdc:mga0qj67_10472_c1 3300050509 Bacteria 6926
926 nmdc:mga0qj67_146689_c1 3300050509 Bacteria 1913
927 nmdc:mga06r32_287020_c1 3300050510 Bacteria 1632
928 nmdc:mga08y16_1570_c1 3300050511 Bacteria 23061
929 nmdc:mga08y16_356723_c1 3300050511 Bacteria 1501
930 nmdc:mga08y16_603_c1 3300050511 Bacteria 33534
931 nmdc:mga0n895_350699_c1 3300050512 Bacteria 1495
932 nmdc:mga0rr50_138425_c1 3300050513 Bacteria 1956
933 nmdc:mga08x19_31277_c1 3300050514 Bacteria 3348
934 nmdc:mga0a205_316753_c1 3300050515 Bacteria 1431
935 nmdc:mga0sz30_15726_c1 3300050516 Bacteria 2993
936 Ga0495601_0013741 3300053077 Bacteria 4872
937 Ga0495601_0035607 3300053077 Bacteria 3108
938 Ga0495601_0044755 3300053077 Bacteria 2782
939 Ga0500635_0000121 3300053080 Bacteria 45993
940 Ga0495595_0009542 3300053084 Bacteria 4018
941 Ga0495619_0009855 3300053085 Bacteria 6022
942 Ga0495619_0193359 3300053085 Bacteria 1408
943 Ga0500578_0000007 3300053086 Bacteria 229642
944 Ga0500644_0024652 3300053088 Bacteria 1841
945 Ga0500646_0094425 3300053090 Bacteria 930
946 Ga0500583_0024471 3300053092 Bacteria 2562
947 Ga0500651_0009548 3300053093 Bacteria 5773
948 Ga0500651_0045258 3300053093 Bacteria 2769
949 Ga0500651_0206903 3300053093 Bacteria 1156
950 Ga0500593_003361 3300053117 Bacteria 6029
951 Ga0500608_144726 3300053122 Bacteria 1049
952 Ga0500623_056329 3300053127 Bacteria 1958
953 Ga0500628_003585 3300053129 Bacteria 2564
954 Ga0500652_000097 3300053131 Bacteria 35527
955 Ga0500652_016036 3300053131 Bacteria 2718
956 Ga0500655_003228 3300053133 Bacteria 2954
957 Ga0500658_0006551 3300053134 Bacteria 4318
958 Ga0500559_0000262 3300053136 Bacteria 41173
959 Ga0500559_0121277 3300053136 Bacteria 1216
960 Ga0500564_044993 3300053138 Bacteria 2026
961 Ga0500568_0008721 3300053139 Bacteria 4864
962 Ga0500568_0012380 3300053139 Bacteria 3927
963 Ga0500577_0190973 3300053142 Bacteria 881
964 Ga0500589_063237 3300053147 Bacteria 1691
965 Ga0500600_0035917 3300053149 Bacteria 2885
966 Ga0500604_0024840 3300053151 Bacteria 1718
967 Ga0500619_002116 3300053154 Bacteria 3740
968 Ga0500619_078881 3300053154 Bacteria 1104
969 Ga0500622_0000359 3300053156 Bacteria 44261
970 Ga0500622_0003431 3300053156 Bacteria 10597
971 Ga0500627_0078761 3300053158 Bacteria 1467
972 Ga0500636_0019889 3300053177 Bacteria 3970
973 Ga0500636_0162650 3300053177 Bacteria 1215
974 Ga0500570_051476 3300053724 Bacteria 2068
975 Ga0500570_081453 3300053724 Bacteria 1456
976 Ga0501082_0402881 3300060353 Bacteria 1194
977 2587728238 2585428057 Bacteria 6737412
978 2587734556 2585428058 Bacteria 6853932
979 2587755472 2585428062 Bacteria 6842168
980 2643971107 2643221592 Bacteria 6608788
981 2644142126 2643221625 Bacteria 6512927
982 2644246038 2643221644 Bacteria 6865017
983 2644275378 2643221648 Bacteria 6521465
984 2644304100 2643221654 Bacteria 5273570
985 2691332906 2690315857 Bacteria 4396207
986 2919535923 2919534386 Bacteria 4577686
987 2932424149 2932422444 Bacteria 4678430
988 Ga0495686_0009198
989 JGI25156J39149_1004175
990 JGI25156J39149_1010363
991 JGI25156J39149_1021359
992 JGI25154J39366_1002195
993 JGI25157J39369_1000392
994 JGI25152J39213_1000905
995 JGI25152J39213_1001351
996 JGI25150J39212_1006356
997 JGI25153J46596_10006194
998 JGI25153J46596_10015186
999 rootH2_10021208
1000 rootL2_10052407
1001 Ga0055539_1000352
1002 Ga0055539_1002249
1003 Ga0055533_1000006
1004 Ga0055525_1000524
1005 Ga0055535_1000433
1006 Ga0055529_1000158
1007 Ga0055526_1002422
1008 Ga0055524_1000102
1009 Ga0055530_10006481
1010 Ga0055540_1010981
1011 Ga0065165_1001184
1012 Ga0065707_10118006
1013 Ga0065707_10140497
1014 Ga0070658_10001465
1015 Ga0070658_10076990
1016 Ga0070658_10096906
1017 Ga0070658_10306421
1018 Ga0070676_10035272
1019 Ga0070676_10068863
1020 Ga0070676_10212404
1021 Ga0070670_100012223
1022 Ga0070670_100056117
1023 Ga0070670_100095183
1024 Ga0070670_100157093
1025 Ga0070670_100196909
1026 Ga0070670_100203725
1027 Ga0070670_100230528
1028 Ga0070670_100488065
1029 Ga0070670_100630704
1030 Ga0070677_10029583
1031 Ga0070677_10066778
1032 Ga0068869_100039932
1033 Ga0068869_100188739
1034 Ga0070666_10008645
1035 Ga0070680_100065816
1036 Ga0068868_100046565
1037 Ga0068868_100136382
1038 Ga0068868_100193809
1039 Ga0068868_100288749
1040 Ga0068868_100489253
1041 Ga0070660_100066097
1042 Ga0070660_100231854
1043 Ga0070689_100001822
1044 Ga0070689_100259670
1045 Ga0070687_100388180
1046 Ga0070661_100027147
1047 Ga0070668_100138568
1048 Ga0070669_100012328
1049 Ga0070669_100181771
1050 Ga0070675_100012792
1051 Ga0070675_100090045
1052 Ga0070675_100151094
1053 Ga0070675_100237260
1054 Ga0070675_100680710
1055 Ga0070671_100068753
1056 Ga0070671_100122294
1057 Ga0070671_100143965
1058 Ga0070671_100388796
1059 Ga0070674_100004081
1060 Ga0070674_100106952
1061 Ga0070674_100122253
1062 Ga0070674_100462709
1063 Ga0070674_100477057
1064 Ga0070673_100031802
1065 Ga0070673_100033636
1066 Ga0070673_100041305
1067 Ga0070673_100055857
1068 Ga0070673_100063558
1069 Ga0070673_100082868
1070 Ga0070673_100371982
1071 Ga0070688_100083365
1072 Ga0070659_100212760
1073 Ga0070659_100421011
1074 Ga0070667_100019421
1075 Ga0070667_100057922
1076 Ga0070667_100156615
1077 Ga0070667_100230829
1078 Ga0070714_100008092
1079 Ga0070714_100009364
1080 Ga0070700_100171856
1081 Ga0070694_100011996
1082 Ga0070663_100000634
1083 Ga0070663_100363465
1084 Ga0070678_100011636
1085 Ga0070678_100053283
1086 Ga0070678_100098523
1087 Ga0070678_100144005
1088 Ga0070662_100056749
1089 Ga0070662_100205026
1090 Ga0070662_100529358
1091 Ga0070681_10403713
1092 Ga0068867_100004124
1093 Ga0068867_100014577
1094 Ga0068867_100016184
1095 Ga0068867_100027807
1096 Ga0068867_100051797
1097 Ga0068867_100085413
1098 Ga0068867_100157587
1099 Ga0070685_10076725
1100 Ga0070706_100002793
1101 Ga0070706_100061643
1102 Ga0070707_100490901
1103 Ga0070707_100936360
1104 Ga0070699_100437364
1105 Ga0070679_100006218
1106 Ga0070697_100180184
1107 Ga0068853_100228317
1108 Ga0068853_100654113
1109 Ga0070672_100011823
1110 Ga0070672_100016450
1111 Ga0070672_100106565
1112 Ga0070672_100109760
1113 Ga0070695_100126007
1114 Ga0070695_100471274
1115 Ga0070696_100054709
1116 Ga0070696_100158450
1117 Ga0070693_100034493
1118 Ga0070693_100053646
1119 Ga0070665_100168115
1120 Ga0070665_100272135
1121 Ga0070665_100280439
1122 Ga0070665_100545645
1123 Ga0070704_100233161
1124 Ga0068855_100010413
1125 Ga0068855_100070036
1126 Ga0068855_100113366
1127 Ga0068855_100131402
1128 Ga0068855_100417808
1129 Ga0068855_100591613
1130 Ga0070664_100117980
1131 Ga0070664_100212941
1132 Ga0070664_100281225
1133 Ga0070664_100560435
1134 Ga0068857_100103415
1135 Ga0068857_100176721
1136 Ga0068857_100367425
1137 Ga0068854_100085208
1138 Ga0068856_100012303
1139 Ga0068852_100015266
1140 Ga0068852_100068355
1141 Ga0068852_100085353
1142 Ga0068852_100109877
1143 Ga0068852_100131801
1144 Ga0068852_100149236
1145 Ga0068852_100521923
1146 Ga0068859_100039311
1147 Ga0068859_100042728
1148 Ga0068859_100550968
1149 Ga0068864_100016361
1150 Ga0068864_100104399
1151 Ga0068864_100128029
1152 Ga0068864_100236957
1153 Ga0068866_10052876
1154 Ga0068861_100019097
1155 Ga0068861_100659008
1156 Ga0068851_10129270
1157 Ga0068851_10155781
1158 Ga0068870_10022355
1159 Ga0068870_10154893
1160 Ga0068870_10261186
1161 Ga0068863_100022617
1162 Ga0068863_100085754
1163 Ga0068863_100566987
1164 Ga0068863_100633508
1165 Ga0068858_100002454
1166 Ga0068858_100053499
1167 Ga0068858_100234035
1168 Ga0068860_100001400
1169 Ga0068860_100064632
1170 Ga0068862_100005708
1171 Ga0068862_100283598
1172 Ga0081539_10158893
1173 Ga0075365_10304467
1174 Ga0075368_10037234
1175 Ga0075368_10132336
1176 Ga0075363_100052276
1177 Ga0075363_100064680
1178 Ga0075363_100113720
1179 Ga0075364_10066372
1180 Ga0075364_10067124
1181 Ga0070712_100163453
1182 Ga0075362_10032933
1183 Ga0075362_10047567
1184 Ga0075367_10054547
1185 Ga0075367_10055203
1186 Ga0075367_10056702
1187 Ga0075367_10228367
1188 Ga0075369_10040130
1189 Ga0075369_10052138
1190 Ga0075366_10004345
1191 Ga0075366_10055842
1192 Ga0075366_10055891
1193 Ga0075366_10061309
1194 Ga0075366_10071747
1195 Ga0075366_10079518
1196 Ga0075366_10079524
1197 Ga0075366_10091583
1198 Ga0075366_10099646
1199 Ga0075366_10208343
1200 Ga0075366_10258021
1201 Ga0075366_10277735
1202 Ga0097621_100072410
1203 Ga0097621_100530068
1204 Ga0075370_10010352
1205 Ga0075370_10029569
1206 Ga0075370_10051089
1207 Ga0075370_10052590
1208 Ga0075370_10053862
1209 Ga0075370_10067176
1210 Ga0075370_10074900
1211 Ga0075370_10099434
1212 Ga0068871_100063525
1213 Ga0068871_100139938
1214 Ga0068871_100186431
1215 Ga0075428_100009664
1216 Ga0075428_100040186
1217 Ga0075430_100023952
1218 Ga0075431_100195675
1219 Ga0075429_100014458
1220 Ga0075429_100026505
1221 Ga0075429_100056611
1222 Ga0068865_100006089
1223 Ga0068865_100041377
1224 Ga0068865_100160843
1225 Ga0068865_100486047
1226 Ga0075436_100040472
1227 Ga0097620_100039310
1228 Ga0097620_100042728
1229 Ga0097620_100550967
1230 Ga0079104_1000688
1231 Ga0075435_100032840
1232 Ga0099794_10235776
1233 Ga0105240_10005231
1234 Ga0105240_10079444
1235 Ga0111539_10000243
1236 Ga0111539_10099768
1237 Ga0111539_10291450
1238 Ga0111539_10474150
1239 Ga0111539_10928310
1240 Ga0105245_10069829
1241 Ga0105245_10208407
1242 Ga0105245_10592922
1243 Ga0105245_10973293
1244 Ga0114129_10066741
1245 Ga0114129_10582979
1246 Ga0105243_10050096
1247 Ga0105243_10053545
1248 Ga0105243_10067795
1249 Ga0105243_10383680
1250 Ga0105241_10176129
1251 Ga0105241_10306079
1252 Ga0105242_10030444
1253 Ga0105242_10083680
1254 Ga0105248_10034428
1255 Ga0105248_10399494
1256 Ga0105248_10543655
1257 Ga0105237_10001569
1258 Ga0105237_10046244
1259 Ga0105237_10800780
1260 Ga0105238_10047205
1261 Ga0105238_10132356
1262 Ga0105238_10230809
1263 Ga0105249_10141262
1264 Ga0105249_10261243
1265 Ga0105239_10000486
1266 Ga0105239_10053414
1267 Ga0105239_10069245
1268 Ga0105246_10075982
1269 Ga0105246_10219711
1270 Ga0157370_10017241
1271 Ga0157370_10214811
1272 Ga0157369_10009180
1273 Ga0157374_10042556
1274 Ga0157374_10139883
1275 Ga0157374_10304049
1276 Ga0157374_10652903
1277 Ga0157378_10021826
1278 Ga0157378_10028209
1279 Ga0157378_10052031
1280 Ga0157378_10133891
1281 Ga0157378_10221124
1282 Ga0157378_10230687
1283 Ga0157378_10389993
1284 Ga0163162_10003214
1285 Ga0163162_10131030
1286 Ga0163162_10161077
1287 Ga0163162_10748205
1288 Ga0163162_11143150
1289 Ga0157372_10081759
1290 Ga0157372_10223867
1291 Ga0157372_10396553
1292 Ga0157372_10408023
1293 Ga0157375_10028646
1294 Ga0157375_10056335
1295 Ga0157375_10104691
1296 Ga0157375_10471622
1297 Ga0157375_10720202
1298 Ga0163163_10032862
1299 Ga0163163_10435022
1300 Ga0157380_10059818
1301 Ga0157380_10160367
1302 Ga0157380_10393650
1303 Ga0157380_10587063
1304 Ga0157380_10634194
1305 Ga0157377_10164241
1306 Ga0157379_10017321
1307 Ga0157379_10055575
1308 Ga0157379_10083358
1309 Ga0157379_10098107
1310 Ga0157379_10143611
1311 Ga0157376_10208888
1312 Ga0182005_1086174
1313 Ga0163161_10177045
1314 Ga0163161_10544744
1315 Ga0209674_100003
1316 Ga0209672_110789
1317 Ga0209563_100010
1318 Ga0207427_100530
1319 Ga0209258_100110
1320 Ga0209258_101188
1321 Ga0207425_1000203
1322 Ga0209646_1000115
1323 Ga0209026_1000115
1324 Ga0209677_100026
1325 Ga0209677_100869
1326 Ga0209759_1000733
1327 Ga0209759_1005390
1328 Ga0209759_1010434
1329 Ga0209129_1000012
1330 Ga0209565_1007930
1331 Ga0209455_1000104
1332 Ga0209673_1004874
1333 Ga0209564_1000022
1334 Ga0209758_1000099
1335 Ga0209758_1000233
1336 Ga0209050_1000165
1337 Ga0209256_1000011
1338 Ga0209256_1020421
1339 Ga0209051_1001632
1340 Ga0209051_1007536
1341 Ga0209051_1054682
1342 Ga0207697_10009127
1343 Ga0207697_10025486
1344 Ga0207656_10082926
1345 Ga0207682_10026388
1346 Ga0207682_10046897
1347 Ga0207642_10107695
1348 Ga0207642_10274449
1349 Ga0207688_10243681
1350 Ga0207688_10251163
1351 Ga0207680_10002882
1352 Ga0207680_10447355
1353 Ga0207645_10004234
1354 Ga0207645_10037680
1355 Ga0207645_10085360
1356 Ga0207645_10100271
1357 Ga0207645_10450712
1358 Ga0207643_10012500
1359 Ga0207643_10027724
1360 Ga0207705_10009994
1361 Ga0207705_10102092
1362 Ga0207705_10362049
1363 Ga0207684_10039040
1364 Ga0207684_10167148
1365 Ga0207654_10238951
1366 Ga0207707_10284673
1367 Ga0207695_10008032
1368 Ga0207695_10103847
1369 Ga0207671_10001963
1370 Ga0207671_10012877
1371 Ga0207693_10524885
1372 Ga0207660_10045635
1373 Ga0207662_10258329
1374 Ga0207662_10290833
1375 Ga0207657_10135633
1376 Ga0207657_10250721
1377 Ga0207657_10412261
1378 Ga0207649_10160502
1379 Ga0207652_10031020
1380 Ga0207646_10139287
1381 Ga0207681_10019299
1382 Ga0207681_10034599
1383 Ga0207681_10111158
1384 Ga0207694_10063078
1385 Ga0207694_10086261
1386 Ga0207694_10236808
1387 Ga0207694_10382764
1388 Ga0207650_10000348
1389 Ga0207650_10114538
1390 Ga0207650_10193841
1391 Ga0207650_10269060
1392 Ga0207650_10343913
1393 Ga0207650_10422564
1394 Ga0207659_10000398
1395 Ga0207659_10002553
1396 Ga0207659_10009530
1397 Ga0207659_10058624
1398 Ga0207687_10242066
1399 Ga0207687_10265219
1400 Ga0207664_10001410
1401 Ga0207664_10049045
1402 Ga0207644_10030506
1403 Ga0207644_10120019
1404 Ga0207644_10161069
1405 Ga0207644_10203866
1406 Ga0207644_10476177
1407 Ga0207690_10034240
1408 Ga0207690_10266031
1409 Ga0207706_10012196
1410 Ga0207706_10041354
1411 Ga0207706_10282416
1412 Ga0207706_10286748
1413 Ga0207686_10134942
1414 Ga0207686_10412438
1415 Ga0207709_10057779
1416 Ga0207709_10200718
1417 Ga0207709_10374331
1418 Ga0207670_10017145
1419 Ga0207670_10031511
1420 Ga0207669_10014606
1421 Ga0207669_10043009
1422 Ga0207669_10064893
1423 Ga0207669_10106757
1424 Ga0207669_10131692
1425 Ga0207669_10134668
1426 Ga0207704_10056001
1427 Ga0207704_10058303
1428 Ga0207704_10247517
1429 Ga0207691_10007412
1430 Ga0207691_10014572
1431 Ga0207691_10039958
1432 Ga0207691_10076858
1433 Ga0207691_10113339
1434 Ga0207711_10224493
1435 Ga0207711_10459093
1436 Ga0207689_10033844
1437 Ga0207689_10081758
1438 Ga0207689_10271790
1439 Ga0207661_10463018
1440 Ga0207661_10529540
1441 Ga0207679_10006286
1442 Ga0207679_10190674
1443 Ga0207667_10020124
1444 Ga0207667_10022600
1445 Ga0207667_10064363
1446 Ga0207667_10267706
1447 Ga0207667_10325921
1448 Ga0207651_10001308
1449 Ga0207651_10017078
1450 Ga0207651_10052248
1451 Ga0207651_10211830
1452 Ga0207651_10494342
1453 Ga0207712_10016627
1454 Ga0207640_10018591
1455 Ga0207640_10070506
1456 Ga0207658_10011281
1457 Ga0207658_10045809
1458 Ga0207658_10141500
1459 Ga0207658_10196643
1460 Ga0207677_10050706
1461 Ga0207677_10135477
1462 Ga0207677_10144798
1463 Ga0207677_10198704
1464 Ga0207677_10322691
1465 Ga0207703_10147189
1466 Ga0207703_10275791
1467 Ga0207703_10423842
1468 Ga0207678_10001200
1469 Ga0207678_10332300
1470 Ga0207708_10063766
1471 Ga0207702_10010769
1472 Ga0207641_10022148
1473 Ga0207641_10182251
1474 Ga0207641_10513143
1475 Ga0207641_10707041
1476 Ga0207648_10006696
1477 Ga0207648_10006922
1478 Ga0207648_10006965
1479 Ga0207648_10074159
1480 Ga0207648_10104346
1481 Ga0207648_10110649
1482 Ga0207676_10001822
1483 Ga0207676_10087186
1484 Ga0207676_10202672
1485 Ga0207676_10628416
1486 Ga0207676_10707277
1487 Ga0207674_10017697
1488 Ga0207674_10044316
1489 Ga0207674_10116239
1490 Ga0207674_10224432
1491 Ga0207674_10457741
1492 Ga0207675_100004540
1493 Ga0207675_100028280
1494 Ga0207675_100065649
1495 Ga0207675_100514501
1496 Ga0207683_10065295
1497 Ga0207683_10122226
1498 Ga0207683_10171945
1499 Ga0207683_10210301
1500 Ga0207683_10330511
1501 Ga0207683_10449480
1502 Ga0207698_10034620
1503 Ga0207698_10145850
1504 Ga0207698_10146823
1505 Ga0207698_10277266
1506 Ga0207698_10310832
1507 Ga0207698_10399892
1508 Ga0207698_10462969
1509 Ga0209281_1000042
1510 Ga0209996_1006512
1511 Ga0209968_1001979
1512 Ga0209971_1002962
1513 Ga0209966_1000006
1514 Ga0209813_10022057
1515 Ga0209813_10037911
1516 Ga0209974_10012208
1517 Ga0207428_10002938
1518 Ga0207428_10009412
1519 Ga0268266_10019942
1520 Ga0268266_10135520
1521 Ga0268266_10596318
1522 Ga0268266_10805562
1523 Ga0268265_10007045
1524 Ga0268265_10092356
1525 Ga0268265_10469763
1526 Ga0268264_10005037
1527 Ga0268264_10116586
1528 Ga0265334_10021442
1529 Ga0265336_10000085
1530 Ga0307517_10004982
1531 Ga0307517_10138760
1532 Ga0307517_10231275
1533 Ga0307515_10000020
1534 Ga0307515_10000525
1535 Ga0307515_10001622
1536 Ga0307515_10015416
1537 Ga0307515_10030879
1538 Ga0307515_10035620
1539 Ga0307515_10062236
1540 Ga0307515_10085205
1541 Ga0307515_10255236
1542 Ga0307515_10260153
1543 Ga0307515_10377545
1544 Ga0265324_10002613
1545 Ga0307512_10095391
1546 Ga0265330_10004618
1547 Ga0265332_10000001
1548 Ga0265325_10001489
1549 Ga0265340_10021960
1550 Ga0265327_10000205
1551 Ga0265316_10004748
1552 Ga0307513_10000776
1553 Ga0307513_10002553
1554 Ga0307513_10024647
1555 Ga0307513_10055195
1556 Ga0307513_10157012
1557 Ga0307513_10316600
1558 Ga0307509_10005169
1559 Ga0307509_10044639
1560 Ga0307509_10071702
1561 Ga0307509_10116792
1562 Ga0307509_10153679
1563 Ga0307509_10186696
1564 Ga0307509_10203348
1565 Ga0307408_100062868
1566 Ga0307408_100196239
1567 Ga0307408_100465060
1568 Ga0307408_100538500
1569 Ga0265313_10008798
1570 Ga0307508_10000007
1571 Ga0307508_10056366
1572 Ga0307508_10108096
1573 Ga0307508_10370395
1574 Ga0307514_10010652
1575 Ga0307514_10188468
1576 Ga0316579_10066140
1577 Ga0265314_10000145
1578 Ga0265314_10284607
1579 Ga0307516_10003350
1580 Ga0307516_10003396
1581 Ga0307516_10011403
1582 Ga0307516_10044529
1583 Ga0307516_10080452
1584 Ga0307516_10302338
1585 Ga0307516_10348762
1586 Ga0307516_10440958
1587 Ga0307405_10066606
1588 Ga0307413_10094339
1589 Ga0307413_10117195
1590 Ga0307410_10007964
1591 Ga0307410_10155983
1592 Ga0307410_10305142
1593 Ga0307410_10750991
1594 Ga0307406_10184233
1595 Ga0307406_10197964
1596 Ga0307407_10142188
1597 Ga0307412_10021943
1598 Ga0307412_10124809
1599 Ga0307412_10184025
1600 Ga0307412_10348459
1601 Ga0307409_100175585
1602 Ga0307416_100236823
1603 Ga0307416_100283793
1604 Ga0307416_100814542
1605 Ga0307416_101287669
1606 Ga0307414_10492773
1607 Ga0307411_10078530
1608 Ga0307411_10122068
1609 Ga0307415_100041727
1610 Ga0307415_100416245
1611 Ga0307507_10063973
1612 Ga0307507_10088284
1613 Ga0307510_10001909
1614 Ga0307510_10074139
1615 Ga0307510_10151620
1616 Ga0307510_10312324
1617 Ga0373959_0020459
1618 Ga0373926_0058338
1619 Ga0373934_0001853
1620 Ga0373934_0009661
1621 Ga0373949_0054361
1622 Ga0373936_0002471
1623 Ga0373939_0020749
1624 Ga0373953_0000906
1625 Ga0373954_0203579
1626 Ga0373956_0075975
1627 Ga0373943_0126646
1628 Ga0373955_0026920
1629 Ga0316574_0060626
1630 Ga0373924_0001986
1631 Ga0373931_0002254
1632 Ga0373931_0172623
1633 Ga0373931_0208605
1634 Ga0373931_0237102
1635 Ga0373931_0278284
1636 Ga0373935_0008726
1637 Ga0373935_0016027
1638 Ga0373927_0000003
1639 Ga0373927_0188681
1640 Ga0373933_0244398
1641 Ga0373937_0063318
1642 Ga0316582_0101977
1643 Ga0316584_0123759
1644 Ga0373925_0011126
1645 Ga0373925_0026467
1646 Ga0373925_0091833
1647 Ga0373925_0152623
1648 Ga0373925_0182258
1649 Ga0395900_0000378
1650 Ga0395898_0001418
1651 Ga0395898_0034931
1652 Ga0395905_0000236
1653 Ga0395905_0005570
1654 Ga0395905_0064603
1655 Ga0395905_0152786
1656 Ga0395905_0428322
1657 Ga0395905_0536015
1658 Ga0395901_0002825
1659 Ga0395901_0355766
1660 Ga0400483_098460
1661 Ga0400483_238624
1662 Ga0400487_35893
1663 Ga0400487_45754
1664 Ga0436365_1917218
1665 Ga0436360_1177354
1666 Ga0436361_0215417
1667 Ga0436361_0338760
1668 Ga0436361_0439659
1669 Ga0436363_1162970
1670 Ga0451789_1103105
1671 Ga0451791_1344885
1672 Ga0451793_0235702
1673 Ga0451798_0494322
1674 Ga0451798_0588047
1675 Ga0451800_0594548
1676 Ga0451802_1531971
1677 Ga0451807_1684855
1678 Ga0451839_0407424
1679 Ga0451849_1115069
1680 Ga0451853_3158146
1681 Ga0439450_038876
1682 Ga0439454_016750
1683 Ga0439455_0005175
1684 Ga0450898_004806
1685 Ga0450898_011562
1686 Ga0450899_001934
1687 Ga0439446_0034455
1688 Ga0439458_0024242
1689 Ga0439434_0013239
1690 Ga0439464_0004366
1691 Ga0439460_0019301
1692 Ga0450918_000505
1693 Ga0451577_0010789
1694 Ga0451577_0019663
1695 Ga0451577_0031911
1696 Ga0451577_0052237
1697 Ga0451577_0559101
1698 Ga0451577_0589012
1699 Ga0466969_0000595
1700 Ga0466969_0004862
1701 Ga0466969_0133636
1702 Ga0466972_0004906
1703 Ga0466972_0019791
1704 Ga0466965_0023891
1705 Ga0466965_0043775
1706 Ga0466965_0069153
1707 Ga0466965_0072401
1708 Ga0466966_0009425
1709 Ga0466966_0025092
1710 Ga0466966_0027591
1711 Ga0466966_0342989
1712 Ga0466961_0017789
1713 Ga0466961_0021262
1714 Ga0466963_0009809
1715 Ga0466963_0204008
1716 Ga0466963_0274221
1717 Ga0466964_0005066
1718 Ga0466964_0022522
1719 Ga0453684_0031281
1720 Ga0453684_0499040
1721 Ga0466971_0009376
1722 Ga0466971_0028886
1723 Ga0466968_0004989
1724 Ga0466968_0072002
1725 Ga0466970_0015954
1726 Ga0466957_0009895
1727 Ga0466957_0042962
1728 Ga0466957_0069412
1729 Ga0466957_0269121
1730 Ga0466960_0097234
1731 Ga0466959_0002753
1732 Ga0466959_0009873
1733 Ga0466959_0021408
1734 Ga0466959_0050399
1735 Ga0451576_0001886
1736 Ga0451576_0008786
1737 Ga0451576_0367454
1738 Ga0466958_0008038
1739 Ga0466958_0173677
1740 Ga0466967_0187304
1741 Ga0466967_0353637
1742 Ga0495592_0000387
1743 Ga0495592_0015259
1744 Ga0495590_0079575
1745 Ga0495638_0038336
1746 Ga0495638_0049447
1747 Ga0495641_0012932
1748 Ga0495651_0077532
1749 Ga0495651_0214483
1750 Ga0495653_0058754
1751 Ga0495580_0107086
1752 Ga0495605_0051829
1753 Ga0495639_0011352
1754 Ga0495639_0042252
1755 Ga0495662_0050105
1756 Ga0495664_0101113
1757 Ga0495594_0037152
1758 Ga0495583_0000376
1759 Ga0495583_0037775
1760 Ga0495610_0009033
1761 Ga0495610_0050463
1762 Ga0495610_0070906
1763 Ga0495618_0031724
1764 Ga0495628_0020483
1765 Ga0495628_0025641
1766 Ga0495630_0043086
1767 Ga0495632_0006390
1768 Ga0495632_0010747
1769 Ga0495632_0041765
1770 Ga0495632_0062489
1771 Ga0495643_0041469
1772 Ga0495648_0042933
1773 Ga0495666_0056838
1774 Ga0495665_0008462
1775 Ga0495640_0021293
1776 Ga0495586_0026745
1777 Ga0495586_0217061
1778 Ga0495587_0007209
1779 Ga0495621_0015844
1780 Ga0495597_0062421
1781 Ga0495597_0086417
1782 Ga0495645_0062323
1783 Ga0495622_0166713
1784 Ga0495633_0003122
1785 Ga0495667_0053287
1786 Ga0495668_0157899
1787 Ga0495668_0204867
1788 Ga0495625_0003116
1789 Ga0495625_0038374
1790 Ga0495625_0056341
1791 Ga0495625_0128976
1792 Ga0495635_0029232
1793 Ga0495657_0030850
1794 Ga0495599_0156227
1795 Ga0495646_0093927
1796 Ga0495647_0033885
1797 Ga0495647_0085942
1798 Ga0495658_0091743
1799 Ga0495658_0122995
1800 Ga0495613_0191141
1801 Ga0495624_0050386
1802 Ga0495671_0177130
1803 Ga0495649_0003169
1804 Ga0495649_0010791
1805 Ga0495600_0002520
1806 Ga0495660_0059095
1807 Ga0495674_0056377
1808 Ga0495680_0267942
1809 Ga0495683_0143069
1810 Ga0495687_000895
1811 Ga0495687_013838
1812 Ga0495675_0018143
1813 Ga0495686_0085640
1814 Ga0495686_0127752
1815 Ga0495593_0075399
1816 Ga0495593_0110387
1817 Ga0495602_0282612
1818 Ga0496101_0043246
1819 Ga0496102_0073646
1820 Ga0496104_0042136
1821 Ga0496104_0096070
1822 Ga0496105_0247674
1823 Ga0496108_0098399
1824 Ga0496108_0115719
1825 Ga0496108_0256504
1826 Ga0496108_0494663
1827 Ga0496108_0529160
1828 Ga0496110_0033734
1829 Ga0496110_0078869
1830 Ga0496114_0027012
1831 Ga0496114_0032678
1832 Ga0496114_0049082
1833 Ga0496114_0428228
1834 Ga0496121_0017040
1835 Ga0496124_0000161
1836 Ga0496124_0180555
1837 Ga0496125_0024913
1838 Ga0501031_0130440
1839 Ga0501032_0006906
1840 Ga0501032_0032501
1841 Ga0501034_0000487
1842 Ga0501034_0011695
1843 Ga0501034_0579065
1844 Ga0501038_0023064
1845 Ga0501038_0052996
1846 Ga0501039_0089380
1847 Ga0501039_0258159
1848 Ga0501040_0036751
1849 Ga0501043_0000052
1850 Ga0501046_0000430
1851 Ga0501046_0149724
1852 Ga0501047_0000039
1853 Ga0501047_0071107
1854 Ga0501048_0040372
1855 Ga0501069_0043526
1856 Ga0501069_0079656
1857 Ga0501070_0014474
1858 Ga0501070_0082311
1859 Ga0501070_0277714
1860 Ga0501071_0194019
1861 Ga0501072_0035658
1862 Ga0501073_0001502
1863 Ga0501074_0006518
1864 Ga0501074_0102476
1865 Ga0501075_0152260
1866 Ga0501076_0697566
1867 Ga0501198_000132
1868 Ga0501222_000189
1869 Ga0501253_009491
1870 Ga0501080_0017464
1871 Ga0501080_0433226
1872 Ga0501083_0001806
1873 Ga0501262_016955
1874 Ga0501035_0145547
1875 Ga0501035_0184777
1876 Ga0501044_0098995
1877 Ga0501045_0017773
1878 nmdc:mga03683_110270_c1
1879 nmdc:mga03683_21912_c1
1880 nmdc:mga03683_24427_c1
1881 nmdc:mga03683_34934_c1
1882 nmdc:mga03n38_194499_c1
1883 nmdc:mga00v17_49568_c1
1884 nmdc:mga00v17_79021_c1
1885 nmdc:mga0yw44_222887_c1
1886 nmdc:mga0k408_1102_c1
1887 nmdc:mga0k408_16823_c1
1888 nmdc:mga0k408_170907_c1
1889 nmdc:mga0k408_2080_c1
1890 nmdc:mga0k408_31371_c1
1891 nmdc:mga0k408_3241_c1
1892 nmdc:mga0k408_57201_c1
1893 nmdc:mga0k408_57791_c1
1894 nmdc:mga0k408_73662_c1
1895 nmdc:mga0k408_99861_c2
1896 nmdc:mga06z11_10178_c1
1897 nmdc:mga06z11_16631_c1
1898 nmdc:mga04h51_142015_c1
1899 nmdc:mga04h51_72599_c1
1900 nmdc:mga07m45_10292_c1
1901 nmdc:mga07m45_21586_c1
1902 nmdc:mga07m45_26205_c1
1903 nmdc:mga07m45_416481_c1
1904 nmdc:mga07m45_49715_c1
1905 nmdc:mga07m45_521_c1
1906 nmdc:mga07m45_53555_c1
1907 nmdc:mga07m45_65931_c1
1908 nmdc:mga07m45_76067_c1
1909 nmdc:mga05p37_2801_c1
1910 nmdc:mga09592_10994_c1
1911 nmdc:mga09592_14926_c1
1912 nmdc:mga0qj67_10472_c1
1913 nmdc:mga0qj67_146689_c1
1914 nmdc:mga06r32_287020_c1
1915 nmdc:mga08y16_1570_c1
1916 nmdc:mga08y16_356723_c1
1917 nmdc:mga08y16_603_c1
1918 nmdc:mga0n895_350699_c1
1919 nmdc:mga0rr50_138425_c1
1920 nmdc:mga08x19_31277_c1
1921 nmdc:mga0a205_316753_c1
1922 nmdc:mga0sz30_15726_c1
1923 Ga0495601_0013741
1924 Ga0495601_0035607
1925 Ga0495601_0044755
1926 Ga0500635_0000121
1927 Ga0495595_0009542
1928 Ga0495619_0009855
1929 Ga0495619_0193359
1930 Ga0500578_0000007
1931 Ga0500644_0024652
1932 Ga0500646_0094425
1933 Ga0500583_0024471
1934 Ga0500651_0009548
1935 Ga0500651_0045258
1936 Ga0500651_0206903
1937 Ga0500593_003361
1938 Ga0500608_144726
1939 Ga0500623_056329
1940 Ga0500628_003585
1941 Ga0500652_000097
1942 Ga0500652_016036
1943 Ga0500655_003228
1944 Ga0500658_0006551
1945 Ga0500559_0000262
1946 Ga0500559_0121277
1947 Ga0500564_044993
1948 Ga0500568_0008721
1949 Ga0500568_0012380
1950 Ga0500577_0190973
1951 Ga0500589_063237
1952 Ga0500600_0035917
1953 Ga0500604_0024840
1954 Ga0500619_002116
1955 Ga0500619_078881
1956 Ga0500622_0000359
1957 Ga0500622_0003431
1958 Ga0500627_0078761
1959 Ga0500636_0019889
1960 Ga0500636_0162650
1961 Ga0500570_051476
1962 Ga0500570_081453
1963 Ga0501082_0402881
1964 2587728238
1965 2587734556
1966 2587755472
1967 2643971107
1968 2644142126
1969 2644246038
1970 2644275378
1971 2644304100
1972 2691332906
1973 2919535923
1974 2932424149

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08242

Methyltransf_12

Methyltransferase domain

92

187

0.97

PF08241

Methyltransf_11

Methyltransferase domain

92

189

0.96

PF13649

Methyltransf_25

Methyltransferase domain

91

185

0.94

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

52

222

0.86

PF13847

Methyltransf_31

Methyltransferase domain

86

237

0.86

PF13489

Methyltransf_23

Methyltransferase domain

69

243

0.85

PF02353

CMAS

Mycolic acid cyclopropane synthetase

63

224

0.78

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

69

200

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dpm-assembly1.cif.gz_A crystal structure of ubig mutant in complex with sah 0.9432 3 231
4kdr-assembly1.cif.gz_A crystal structure of ubig/sah complex 0.9353 3 231
5dpm-assembly1.cif.gz_A crystal structure of ubig mutant in complex with sah 0.9297 3 231
4kdr-assembly1.cif.gz_A crystal structure of ubig/sah complex 0.9221 3 231
4kdc-assembly1.cif.gz_A crystal structure of ubig 0.8727 9 230
ID Description Score Start End Superfamily
af_A0A1D6FP65_72_359_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9569 4 231 3.40.50.150
af_A0A1D6FP61_65_209_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9539 1 90 3.40.50.150
af_Q0DEH4_83_317_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9528 9 229 3.40.50.150
af_Q9NZJ6_96_332_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9448 9 230 3.40.50.150
af_Q54XD0_74_321_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9448 9 231 3.40.50.150
ID Description Score Start End GO Terms
AF-B8CMG5-F1-model_v4 Ubiquinone biosynthesis O-methyltransferase (2-polyprenyl-6-hydroxyphenol methylase) (EC 2.1.1.222) (3-demethylubiquinone 3-O-methyltransferase) (EC 2.1.1.64) 0.9906 3 232 GO:0010420
GO:0032259
GO:0061542
GO:0102208
AF-A0A2D8RA11-F1-model_v4 Ubiquinone biosynthesis O-methyltransferase (2-polyprenyl-6-hydroxyphenol methylase) (EC 2.1.1.222) (3-demethylubiquinone 3-O-methyltransferase) (EC 2.1.1.64) 0.9832 1 235 GO:0010420
GO:0032259
GO:0061542
GO:0102208
AF-A0A193KBS2-F1-model_v4 deleted 0.9789 3 235
AF-A0A1E5C2G2-F1-model_v4 Ubiquinone biosynthesis O-methyltransferase (2-polyprenyl-6-hydroxyphenol methylase) (EC 2.1.1.222) (3-demethylubiquinone 3-O-methyltransferase) (EC 2.1.1.64) 0.9769 1 232 GO:0010420
GO:0032259
GO:0061542
GO:0102208
AF-A0A0V1CKJ4-F1-model_v4 Sec1 family domain-containing protein 1 0.972 2 234 GO:0003735
GO:0005763
GO:0010420
GO:0016192
GO:0045271
GO:0061542

Map