F487555
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 987 | 466 | 1974 | 235 |
Family's Representative Sequence
| Representative Sequence | 3300047472|Ga0495686_0009198|Ga0495686_0009198_3478_4299 |
| Length | 273 |
| Sequence | MAREVHAGKRGGGQGLGEFASAEAHRGRPSYPAAFVTIAVMTNADPQELAKFSELAHRWWDQEGEFRPLHQINPLRLDWIDQHARLPGKRVLDVGCGGGILSDSMARRGASVLGIDLAAKPLKVAALHALEAGTANVEYRDVAAEALAAEQPGTYDIVTCMEMLEHVPDPSSIVSACATLAKPGGWLFFSTINRNAKAFAFAIVGAEHVLKLLPKGTHEYAKFIRPSELARWCRSAGLDPIETRGMEYNPLTQRYWLSGDTSVNYLVACRRPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 3 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 4 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 5 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 6 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 20 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 81 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 82 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 83 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 86 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 87 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 88 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 94 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 95 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 96 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 97 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 100 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 101 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 128 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 136 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 137 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 139 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 206 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 213 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 217 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 218 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 219 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 220 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 222 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 224 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 225 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 226 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 227 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 228 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 229 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 230 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 231 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 232 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 233 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 234 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 235 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 236 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 237 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 238 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 239 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 240 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 241 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 242 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 243 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 244 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 245 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 246 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 247 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 248 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 249 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 250 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 251 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 252 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 253 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 254 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 255 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 256 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 257 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 258 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 259 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 260 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 261 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 262 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 263 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 264 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 265 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 266 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 267 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 269 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 270 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 271 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 272 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 273 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 274 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 275 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 276 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 277 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 278 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 279 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 280 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 281 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 282 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 283 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 284 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 285 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 286 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 287 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 288 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 289 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 290 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 291 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 292 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 293 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 294 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 295 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 296 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 297 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 298 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 299 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 300 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 301 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 302 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 303 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 304 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 305 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 306 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 307 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 308 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 309 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 310 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 311 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 312 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 313 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 314 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 315 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 316 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 317 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 318 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 319 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 320 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 373 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 374 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 375 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 376 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 378 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 379 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 380 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 381 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 382 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 401 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 402 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 403 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 406 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 410 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 411 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 412 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 413 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 414 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 415 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 416 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 417 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 427 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 429 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 432 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 433 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 434 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 435 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 436 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 437 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 438 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 439 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 440 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 441 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 442 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 443 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 444 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 445 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 446 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 447 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 448 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 449 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 450 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 451 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 452 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 453 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 454 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 455 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 456 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 457 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 458 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 459 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 460 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 461 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 462 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 463 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 464 | 2690315857 | Rheinheimera sp. EpRS3 | Isolate | Unclassified |
| 465 | 2919534386 | Rheinheimera pacifica 3879 | Isolate | Unclassified |
| 466 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.89 |
| Metatranscriptomes | 0 |
| Isolates | 1.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.39 |
| Nodule | 0.2 |
| Rhizoplane | 2.43 |
| Rhizosphere | 74.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495686_0009198 | 3300047472 | Bacteria | 7152 |
| 2 | JGI25156J39149_1004175 | 3300002705 | Bacteria | 4477 |
| 3 | JGI25156J39149_1010363 | 3300002705 | Bacteria | 2196 |
| 4 | JGI25156J39149_1021359 | 3300002705 | Bacteria | 1121 |
| 5 | JGI25154J39366_1002195 | 3300002738 | Bacteria | 5409 |
| 6 | JGI25157J39369_1000392 | 3300002741 | Bacteria | 30204 |
| 7 | JGI25152J39213_1000905 | 3300002773 | Bacteria | 14528 |
| 8 | JGI25152J39213_1001351 | 3300002773 | Bacteria | 10741 |
| 9 | JGI25150J39212_1006356 | 3300002774 | Bacteria | 2445 |
| 10 | JGI25153J46596_10006194 | 3300003215 | Bacteria | 6120 |
| 11 | JGI25153J46596_10015186 | 3300003215 | Bacteria | 3154 |
| 12 | rootH2_10021208 | 3300003320 | Bacteria | 12225 |
| 13 | rootL2_10052407 | 3300003322 | Bacteria | 8872 |
| 14 | Ga0055539_1000352 | 3300003752 | Bacteria | 20282 |
| 15 | Ga0055539_1002249 | 3300003752 | Unclassified | 3046 |
| 16 | Ga0055533_1000006 | 3300003756 | Bacteria | 635559 |
| 17 | Ga0055525_1000524 | 3300003759 | Bacteria | 18488 |
| 18 | Ga0055535_1000433 | 3300003761 | Bacteria | 38884 |
| 19 | Ga0055529_1000158 | 3300003763 | Bacteria | 93023 |
| 20 | Ga0055526_1002422 | 3300003771 | Bacteria | 12637 |
| 21 | Ga0055524_1000102 | 3300003775 | Bacteria | 105348 |
| 22 | Ga0055530_10006481 | 3300003791 | Bacteria | 5214 |
| 23 | Ga0055540_1010981 | 3300003792 | Bacteria | 2966 |
| 24 | Ga0065165_1001184 | 3300005262 | Bacteria | 30266 |
| 25 | Ga0065707_10118006 | 3300005295 | Bacteria | 2197 |
| 26 | Ga0065707_10140497 | 3300005295 | Bacteria | 1779 |
| 27 | Ga0070658_10001465 | 3300005327 | Bacteria | 20125 |
| 28 | Ga0070658_10076990 | 3300005327 | Bacteria | 2736 |
| 29 | Ga0070658_10096906 | 3300005327 | Bacteria | 2435 |
| 30 | Ga0070658_10306421 | 3300005327 | Bacteria | 1355 |
| 31 | Ga0070676_10035272 | 3300005328 | Bacteria | 2877 |
| 32 | Ga0070676_10068863 | 3300005328 | Bacteria | 2119 |
| 33 | Ga0070676_10212404 | 3300005328 | Bacteria | 1274 |
| 34 | Ga0070670_100012223 | 3300005331 | Bacteria | 7343 |
| 35 | Ga0070670_100056117 | 3300005331 | Bacteria | 3380 |
| 36 | Ga0070670_100095183 | 3300005331 | Bacteria | 2561 |
| 37 | Ga0070670_100157093 | 3300005331 | Bacteria | 1970 |
| 38 | Ga0070670_100196909 | 3300005331 | Bacteria | 1750 |
| 39 | Ga0070670_100203725 | 3300005331 | Bacteria | 1719 |
| 40 | Ga0070670_100230528 | 3300005331 | Bacteria | 1612 |
| 41 | Ga0070670_100488065 | 3300005331 | Bacteria | 1094 |
| 42 | Ga0070670_100630704 | 3300005331 | Bacteria | 960 |
| 43 | Ga0070677_10029583 | 3300005333 | Bacteria | 2078 |
| 44 | Ga0070677_10066778 | 3300005333 | Bacteria | 1501 |
| 45 | Ga0068869_100039932 | 3300005334 | Bacteria | 3353 |
| 46 | Ga0068869_100188739 | 3300005334 | Bacteria | 1620 |
| 47 | Ga0070666_10008645 | 3300005335 | Bacteria | 6331 |
| 48 | Ga0070680_100065816 | 3300005336 | Bacteria | 2971 |
| 49 | Ga0068868_100046565 | 3300005338 | Bacteria | 3395 |
| 50 | Ga0068868_100136382 | 3300005338 | Bacteria | 2012 |
| 51 | Ga0068868_100193809 | 3300005338 | Bacteria | 1691 |
| 52 | Ga0068868_100288749 | 3300005338 | Bacteria | 1390 |
| 53 | Ga0068868_100489253 | 3300005338 | Bacteria | 1076 |
| 54 | Ga0070660_100066097 | 3300005339 | Bacteria | 2814 |
| 55 | Ga0070660_100231854 | 3300005339 | Bacteria | 1502 |
| 56 | Ga0070689_100001822 | 3300005340 | Bacteria | 13722 |
| 57 | Ga0070689_100259670 | 3300005340 | Bacteria | 1435 |
| 58 | Ga0070687_100388180 | 3300005343 | Bacteria | 912 |
| 59 | Ga0070661_100027147 | 3300005344 | Bacteria | 4121 |
| 60 | Ga0070668_100138568 | 3300005347 | Bacteria | 1959 |
| 61 | Ga0070669_100012328 | 3300005353 | Bacteria | 6064 |
| 62 | Ga0070669_100181771 | 3300005353 | Bacteria | 1645 |
| 63 | Ga0070675_100012792 | 3300005354 | Bacteria | 6584 |
| 64 | Ga0070675_100090045 | 3300005354 | Bacteria | 2569 |
| 65 | Ga0070675_100151094 | 3300005354 | Bacteria | 1991 |
| 66 | Ga0070675_100237260 | 3300005354 | Bacteria | 1592 |
| 67 | Ga0070675_100680710 | 3300005354 | Bacteria | 936 |
| 68 | Ga0070671_100068753 | 3300005355 | Bacteria | 2954 |
| 69 | Ga0070671_100122294 | 3300005355 | Bacteria | 2190 |
| 70 | Ga0070671_100143965 | 3300005355 | Bacteria | 2012 |
| 71 | Ga0070671_100388796 | 3300005355 | Bacteria | 1193 |
| 72 | Ga0070674_100004081 | 3300005356 | Bacteria | 8295 |
| 73 | Ga0070674_100106952 | 3300005356 | Bacteria | 2048 |
| 74 | Ga0070674_100122253 | 3300005356 | Bacteria | 1929 |
| 75 | Ga0070674_100462709 | 3300005356 | Bacteria | 1049 |
| 76 | Ga0070674_100477057 | 3300005356 | Bacteria | 1034 |
| 77 | Ga0070673_100031802 | 3300005364 | Bacteria | 3965 |
| 78 | Ga0070673_100033636 | 3300005364 | Bacteria | 3873 |
| 79 | Ga0070673_100041305 | 3300005364 | Bacteria | 3546 |
| 80 | Ga0070673_100055857 | 3300005364 | Bacteria | 3112 |
| 81 | Ga0070673_100063558 | 3300005364 | Bacteria | 2937 |
| 82 | Ga0070673_100082868 | 3300005364 | Bacteria | 2604 |
| 83 | Ga0070673_100371982 | 3300005364 | Bacteria | 1272 |
| 84 | Ga0070688_100083365 | 3300005365 | Bacteria | 2075 |
| 85 | Ga0070659_100212760 | 3300005366 | Bacteria | 1593 |
| 86 | Ga0070659_100421011 | 3300005366 | Bacteria | 1129 |
| 87 | Ga0070667_100019421 | 3300005367 | Bacteria | 5638 |
| 88 | Ga0070667_100057922 | 3300005367 | Bacteria | 3275 |
| 89 | Ga0070667_100156615 | 3300005367 | Bacteria | 2004 |
| 90 | Ga0070667_100230829 | 3300005367 | Bacteria | 1650 |
| 91 | Ga0070714_100008092 | 3300005435 | Bacteria | 8192 |
| 92 | Ga0070714_100009364 | 3300005435 | Bacteria | 7696 |
| 93 | Ga0070700_100171856 | 3300005441 | Bacteria | 1501 |
| 94 | Ga0070694_100011996 | 3300005444 | Bacteria | 5379 |
| 95 | Ga0070663_100000634 | 3300005455 | Bacteria | 18865 |
| 96 | Ga0070663_100363465 | 3300005455 | Bacteria | 1175 |
| 97 | Ga0070678_100011636 | 3300005456 | Bacteria | 5436 |
| 98 | Ga0070678_100053283 | 3300005456 | Bacteria | 2941 |
| 99 | Ga0070678_100098523 | 3300005456 | Bacteria | 2260 |
| 100 | Ga0070678_100144005 | 3300005456 | Bacteria | 1911 |
| 101 | Ga0070662_100056749 | 3300005457 | Bacteria | 2843 |
| 102 | Ga0070662_100205026 | 3300005457 | Bacteria | 1566 |
| 103 | Ga0070662_100529358 | 3300005457 | Bacteria | 986 |
| 104 | Ga0070681_10403713 | 3300005458 | Bacteria | 1278 |
| 105 | Ga0068867_100004124 | 3300005459 | Bacteria | 10204 |
| 106 | Ga0068867_100014577 | 3300005459 | Bacteria | 5570 |
| 107 | Ga0068867_100016184 | 3300005459 | Bacteria | 5296 |
| 108 | Ga0068867_100027807 | 3300005459 | Bacteria | 4068 |
| 109 | Ga0068867_100051797 | 3300005459 | Bacteria | 3028 |
| 110 | Ga0068867_100085413 | 3300005459 | Bacteria | 2386 |
| 111 | Ga0068867_100157587 | 3300005459 | Bacteria | 1788 |
| 112 | Ga0070685_10076725 | 3300005466 | Bacteria | 1994 |
| 113 | Ga0070706_100002793 | 3300005467 | Bacteria | 17459 |
| 114 | Ga0070706_100061643 | 3300005467 | Bacteria | 3464 |
| 115 | Ga0070707_100490901 | 3300005468 | Bacteria | 1190 |
| 116 | Ga0070707_100936360 | 3300005468 | Bacteria | 831 |
| 117 | Ga0070699_100437364 | 3300005518 | Bacteria | 1185 |
| 118 | Ga0070679_100006218 | 3300005530 | Bacteria | 11123 |
| 119 | Ga0070697_100180184 | 3300005536 | Bacteria | 1791 |
| 120 | Ga0068853_100228317 | 3300005539 | Bacteria | 1702 |
| 121 | Ga0068853_100654113 | 3300005539 | Bacteria | 1000 |
| 122 | Ga0070672_100011823 | 3300005543 | Bacteria | 6097 |
| 123 | Ga0070672_100016450 | 3300005543 | Bacteria | 5296 |
| 124 | Ga0070672_100106565 | 3300005543 | Bacteria | 2280 |
| 125 | Ga0070672_100109760 | 3300005543 | Bacteria | 2247 |
| 126 | Ga0070695_100126007 | 3300005545 | Bacteria | 1759 |
| 127 | Ga0070695_100471274 | 3300005545 | Bacteria | 966 |
| 128 | Ga0070696_100054709 | 3300005546 | Bacteria | 2782 |
| 129 | Ga0070696_100158450 | 3300005546 | Bacteria | 1666 |
| 130 | Ga0070693_100034493 | 3300005547 | Bacteria | 2800 |
| 131 | Ga0070693_100053646 | 3300005547 | Bacteria | 2315 |
| 132 | Ga0070665_100168115 | 3300005548 | Bacteria | 2195 |
| 133 | Ga0070665_100272135 | 3300005548 | Bacteria | 1696 |
| 134 | Ga0070665_100280439 | 3300005548 | Bacteria | 1668 |
| 135 | Ga0070665_100545645 | 3300005548 | Bacteria | 1171 |
| 136 | Ga0070704_100233161 | 3300005549 | Bacteria | 1503 |
| 137 | Ga0068855_100010413 | 3300005563 | Bacteria | 11217 |
| 138 | Ga0068855_100070036 | 3300005563 | Bacteria | 4081 |
| 139 | Ga0068855_100113366 | 3300005563 | Bacteria | 3110 |
| 140 | Ga0068855_100131402 | 3300005563 | Bacteria | 2859 |
| 141 | Ga0068855_100417808 | 3300005563 | Bacteria | 1467 |
| 142 | Ga0068855_100591613 | 3300005563 | Bacteria | 1197 |
| 143 | Ga0070664_100117980 | 3300005564 | Bacteria | 2321 |
| 144 | Ga0070664_100212941 | 3300005564 | Bacteria | 1727 |
| 145 | Ga0070664_100281225 | 3300005564 | Bacteria | 1500 |
| 146 | Ga0070664_100560435 | 3300005564 | Bacteria | 1057 |
| 147 | Ga0068857_100103415 | 3300005577 | Bacteria | 2557 |
| 148 | Ga0068857_100176721 | 3300005577 | Bacteria | 1942 |
| 149 | Ga0068857_100367425 | 3300005577 | Bacteria | 1334 |
| 150 | Ga0068854_100085208 | 3300005578 | Bacteria | 2340 |
| 151 | Ga0068856_100012303 | 3300005614 | Bacteria | 8285 |
| 152 | Ga0068852_100015266 | 3300005616 | Bacteria | 5949 |
| 153 | Ga0068852_100068355 | 3300005616 | Bacteria | 3109 |
| 154 | Ga0068852_100085353 | 3300005616 | Bacteria | 2812 |
| 155 | Ga0068852_100109877 | 3300005616 | Bacteria | 2504 |
| 156 | Ga0068852_100131801 | 3300005616 | Bacteria | 2303 |
| 157 | Ga0068852_100149236 | 3300005616 | Bacteria | 2172 |
| 158 | Ga0068852_100521923 | 3300005616 | Bacteria | 1185 |
| 159 | Ga0068859_100039311 | 3300005617 | Bacteria | 4745 |
| 160 | Ga0068859_100042728 | 3300005617 | Bacteria | 4553 |
| 161 | Ga0068859_100550968 | 3300005617 | Bacteria | 1248 |
| 162 | Ga0068864_100016361 | 3300005618 | Bacteria | 6174 |
| 163 | Ga0068864_100104399 | 3300005618 | Bacteria | 2517 |
| 164 | Ga0068864_100128029 | 3300005618 | Bacteria | 2277 |
| 165 | Ga0068864_100236957 | 3300005618 | Bacteria | 1689 |
| 166 | Ga0068866_10052876 | 3300005718 | Bacteria | 2074 |
| 167 | Ga0068861_100019097 | 3300005719 | Bacteria | 4895 |
| 168 | Ga0068861_100659008 | 3300005719 | Bacteria | 968 |
| 169 | Ga0068851_10129270 | 3300005834 | Bacteria | 1364 |
| 170 | Ga0068851_10155781 | 3300005834 | Bacteria | 1252 |
| 171 | Ga0068870_10022355 | 3300005840 | Bacteria | 3107 |
| 172 | Ga0068870_10154893 | 3300005840 | Bacteria | 1353 |
| 173 | Ga0068870_10261186 | 3300005840 | Bacteria | 1078 |
| 174 | Ga0068863_100022617 | 3300005841 | Bacteria | 6005 |
| 175 | Ga0068863_100085754 | 3300005841 | Bacteria | 2984 |
| 176 | Ga0068863_100566987 | 3300005841 | Bacteria | 1122 |
| 177 | Ga0068863_100633508 | 3300005841 | Bacteria | 1060 |
| 178 | Ga0068858_100002454 | 3300005842 | Bacteria | 18720 |
| 179 | Ga0068858_100053499 | 3300005842 | Bacteria | 3734 |
| 180 | Ga0068858_100234035 | 3300005842 | Bacteria | 1742 |
| 181 | Ga0068860_100001400 | 3300005843 | Bacteria | 26146 |
| 182 | Ga0068860_100064632 | 3300005843 | Bacteria | 3475 |
| 183 | Ga0068862_100005708 | 3300005844 | Bacteria | 10383 |
| 184 | Ga0068862_100283598 | 3300005844 | Bacteria | 1519 |
| 185 | Ga0081539_10158893 | 3300005985 | Bacteria | 1079 |
| 186 | Ga0075365_10304467 | 3300006038 | Bacteria | 1122 |
| 187 | Ga0075368_10037234 | 3300006042 | Bacteria | 1902 |
| 188 | Ga0075368_10132336 | 3300006042 | Bacteria | 1037 |
| 189 | Ga0075363_100052276 | 3300006048 | Bacteria | 2180 |
| 190 | Ga0075363_100064680 | 3300006048 | Bacteria | 1976 |
| 191 | Ga0075363_100113720 | 3300006048 | Bacteria | 1506 |
| 192 | Ga0075364_10066372 | 3300006051 | Bacteria | 2370 |
| 193 | Ga0075364_10067124 | 3300006051 | Bacteria | 2357 |
| 194 | Ga0070712_100163453 | 3300006175 | Bacteria | 1721 |
| 195 | Ga0075362_10032933 | 3300006177 | Bacteria | 2252 |
| 196 | Ga0075362_10047567 | 3300006177 | Bacteria | 1911 |
| 197 | Ga0075367_10054547 | 3300006178 | Bacteria | 2370 |
| 198 | Ga0075367_10055203 | 3300006178 | Bacteria | 2357 |
| 199 | Ga0075367_10056702 | 3300006178 | Bacteria | 2328 |
| 200 | Ga0075367_10228367 | 3300006178 | Bacteria | 1165 |
| 201 | Ga0075369_10040130 | 3300006186 | Bacteria | 2000 |
| 202 | Ga0075369_10052138 | 3300006186 | Bacteria | 1773 |
| 203 | Ga0075366_10004345 | 3300006195 | Bacteria | 7596 |
| 204 | Ga0075366_10055842 | 3300006195 | Bacteria | 2345 |
| 205 | Ga0075366_10055891 | 3300006195 | Bacteria | 2344 |
| 206 | Ga0075366_10061309 | 3300006195 | Bacteria | 2235 |
| 207 | Ga0075366_10071747 | 3300006195 | Bacteria | 2063 |
| 208 | Ga0075366_10079518 | 3300006195 | Bacteria | 1957 |
| 209 | Ga0075366_10079524 | 3300006195 | Bacteria | 1957 |
| 210 | Ga0075366_10091583 | 3300006195 | Bacteria | 1821 |
| 211 | Ga0075366_10099646 | 3300006195 | Bacteria | 1743 |
| 212 | Ga0075366_10208343 | 3300006195 | Bacteria | 1190 |
| 213 | Ga0075366_10258021 | 3300006195 | Bacteria | 1064 |
| 214 | Ga0075366_10277735 | 3300006195 | Bacteria | 1023 |
| 215 | Ga0097621_100072410 | 3300006237 | Bacteria | 2850 |
| 216 | Ga0097621_100530068 | 3300006237 | Bacteria | 1070 |
| 217 | Ga0075370_10010352 | 3300006353 | Bacteria | 4874 |
| 218 | Ga0075370_10029569 | 3300006353 | Bacteria | 3052 |
| 219 | Ga0075370_10051089 | 3300006353 | Bacteria | 2345 |
| 220 | Ga0075370_10052590 | 3300006353 | Bacteria | 2311 |
| 221 | Ga0075370_10053862 | 3300006353 | Bacteria | 2283 |
| 222 | Ga0075370_10067176 | 3300006353 | Bacteria | 2046 |
| 223 | Ga0075370_10074900 | 3300006353 | Bacteria | 1940 |
| 224 | Ga0075370_10099434 | 3300006353 | Bacteria | 1683 |
| 225 | Ga0068871_100063525 | 3300006358 | Bacteria | 3020 |
| 226 | Ga0068871_100139938 | 3300006358 | Bacteria | 2057 |
| 227 | Ga0068871_100186431 | 3300006358 | Bacteria | 1785 |
| 228 | Ga0075428_100009664 | 3300006844 | Bacteria | 10711 |
| 229 | Ga0075428_100040186 | 3300006844 | Bacteria | 5148 |
| 230 | Ga0075430_100023952 | 3300006846 | Bacteria | 5199 |
| 231 | Ga0075431_100195675 | 3300006847 | Bacteria | 2070 |
| 232 | Ga0075429_100014458 | 3300006880 | Bacteria | 6840 |
| 233 | Ga0075429_100026505 | 3300006880 | Bacteria | 5034 |
| 234 | Ga0075429_100056611 | 3300006880 | Bacteria | 3413 |
| 235 | Ga0068865_100006089 | 3300006881 | Bacteria | 7358 |
| 236 | Ga0068865_100041377 | 3300006881 | Bacteria | 3135 |
| 237 | Ga0068865_100160843 | 3300006881 | Bacteria | 1713 |
| 238 | Ga0068865_100486047 | 3300006881 | Bacteria | 1027 |
| 239 | Ga0075436_100040472 | 3300006914 | Bacteria | 3216 |
| 240 | Ga0097620_100039310 | 3300006931 | Bacteria | 4745 |
| 241 | Ga0097620_100042728 | 3300006931 | Bacteria | 4553 |
| 242 | Ga0097620_100550967 | 3300006931 | Bacteria | 1248 |
| 243 | Ga0079104_1000688 | 3300006946 | Bacteria | 31113 |
| 244 | Ga0075435_100032840 | 3300007076 | Bacteria | 4100 |
| 245 | Ga0099794_10235776 | 3300007265 | Bacteria | 942 |
| 246 | Ga0105240_10005231 | 3300009093 | Bacteria | 19405 |
| 247 | Ga0105240_10079444 | 3300009093 | Bacteria | 4036 |
| 248 | Ga0111539_10000243 | 3300009094 | Bacteria | 65363 |
| 249 | Ga0111539_10099768 | 3300009094 | Bacteria | 3409 |
| 250 | Ga0111539_10291450 | 3300009094 | Bacteria | 1899 |
| 251 | Ga0111539_10474150 | 3300009094 | Bacteria | 1457 |
| 252 | Ga0111539_10928310 | 3300009094 | Bacteria | 1012 |
| 253 | Ga0105245_10069829 | 3300009098 | Bacteria | 3186 |
| 254 | Ga0105245_10208407 | 3300009098 | Bacteria | 1880 |
| 255 | Ga0105245_10592922 | 3300009098 | Bacteria | 1134 |
| 256 | Ga0105245_10973293 | 3300009098 | Bacteria | 892 |
| 257 | Ga0114129_10066741 | 3300009147 | Bacteria | 5017 |
| 258 | Ga0114129_10582979 | 3300009147 | Bacteria | 1451 |
| 259 | Ga0105243_10050096 | 3300009148 | Bacteria | 3298 |
| 260 | Ga0105243_10053545 | 3300009148 | Bacteria | 3201 |
| 261 | Ga0105243_10067795 | 3300009148 | Bacteria | 2874 |
| 262 | Ga0105243_10383680 | 3300009148 | Bacteria | 1300 |
| 263 | Ga0105241_10176129 | 3300009174 | Bacteria | 1770 |
| 264 | Ga0105241_10306079 | 3300009174 | Bacteria | 1365 |
| 265 | Ga0105242_10030444 | 3300009176 | Bacteria | 4308 |
| 266 | Ga0105242_10083680 | 3300009176 | Bacteria | 2673 |
| 267 | Ga0105248_10034428 | 3300009177 | Bacteria | 5663 |
| 268 | Ga0105248_10399494 | 3300009177 | Bacteria | 1548 |
| 269 | Ga0105248_10543655 | 3300009177 | Bacteria | 1310 |
| 270 | Ga0105237_10001569 | 3300009545 | Bacteria | 29799 |
| 271 | Ga0105237_10046244 | 3300009545 | Bacteria | 4378 |
| 272 | Ga0105237_10800780 | 3300009545 | Bacteria | 949 |
| 273 | Ga0105238_10047205 | 3300009551 | Bacteria | 4344 |
| 274 | Ga0105238_10132356 | 3300009551 | Bacteria | 2472 |
| 275 | Ga0105238_10230809 | 3300009551 | Bacteria | 1827 |
| 276 | Ga0105249_10141262 | 3300009553 | Bacteria | 2309 |
| 277 | Ga0105249_10261243 | 3300009553 | Bacteria | 1721 |
| 278 | Ga0105239_10000486 | 3300010375 | Bacteria | 57901 |
| 279 | Ga0105239_10053414 | 3300010375 | Bacteria | 4433 |
| 280 | Ga0105239_10069245 | 3300010375 | Bacteria | 3877 |
| 281 | Ga0105246_10075982 | 3300011119 | Bacteria | 2379 |
| 282 | Ga0105246_10219711 | 3300011119 | Bacteria | 1489 |
| 283 | Ga0157370_10017241 | 3300013104 | Bacteria | 7289 |
| 284 | Ga0157370_10214811 | 3300013104 | Bacteria | 1782 |
| 285 | Ga0157369_10009180 | 3300013105 | Bacteria | 11314 |
| 286 | Ga0157374_10042556 | 3300013296 | Bacteria | 4190 |
| 287 | Ga0157374_10139883 | 3300013296 | Bacteria | 2349 |
| 288 | Ga0157374_10304049 | 3300013296 | Bacteria | 1578 |
| 289 | Ga0157374_10652903 | 3300013296 | Bacteria | 1064 |
| 290 | Ga0157378_10021826 | 3300013297 | Bacteria | 5630 |
| 291 | Ga0157378_10028209 | 3300013297 | Bacteria | 4950 |
| 292 | Ga0157378_10052031 | 3300013297 | Bacteria | 3644 |
| 293 | Ga0157378_10133891 | 3300013297 | Bacteria | 2297 |
| 294 | Ga0157378_10221124 | 3300013297 | Bacteria | 1800 |
| 295 | Ga0157378_10230687 | 3300013297 | Bacteria | 1764 |
| 296 | Ga0157378_10389993 | 3300013297 | Bacteria | 1369 |
| 297 | Ga0163162_10003214 | 3300013306 | Bacteria | 15630 |
| 298 | Ga0163162_10131030 | 3300013306 | Bacteria | 2616 |
| 299 | Ga0163162_10161077 | 3300013306 | Bacteria | 2365 |
| 300 | Ga0163162_10748205 | 3300013306 | Bacteria | 1097 |
| 301 | Ga0163162_11143150 | 3300013306 | Bacteria | 883 |
| 302 | Ga0157372_10081759 | 3300013307 | Bacteria | 3657 |
| 303 | Ga0157372_10223867 | 3300013307 | Bacteria | 2181 |
| 304 | Ga0157372_10396553 | 3300013307 | Bacteria | 1608 |
| 305 | Ga0157372_10408023 | 3300013307 | Bacteria | 1583 |
| 306 | Ga0157375_10028646 | 3300013308 | Bacteria | 5225 |
| 307 | Ga0157375_10056335 | 3300013308 | Bacteria | 3881 |
| 308 | Ga0157375_10104691 | 3300013308 | Bacteria | 2919 |
| 309 | Ga0157375_10471622 | 3300013308 | Bacteria | 1420 |
| 310 | Ga0157375_10720202 | 3300013308 | Bacteria | 1150 |
| 311 | Ga0163163_10032862 | 3300014325 | Bacteria | 5013 |
| 312 | Ga0163163_10435022 | 3300014325 | Bacteria | 1371 |
| 313 | Ga0157380_10059818 | 3300014326 | Bacteria | 3042 |
| 314 | Ga0157380_10160367 | 3300014326 | Bacteria | 1954 |
| 315 | Ga0157380_10393650 | 3300014326 | Bacteria | 1312 |
| 316 | Ga0157380_10587063 | 3300014326 | Bacteria | 1100 |
| 317 | Ga0157380_10634194 | 3300014326 | Bacteria | 1063 |
| 318 | Ga0157377_10164241 | 3300014745 | Bacteria | 1383 |
| 319 | Ga0157379_10017321 | 3300014968 | Bacteria | 6349 |
| 320 | Ga0157379_10055575 | 3300014968 | Bacteria | 3537 |
| 321 | Ga0157379_10083358 | 3300014968 | Bacteria | 2865 |
| 322 | Ga0157379_10098107 | 3300014968 | Bacteria | 2631 |
| 323 | Ga0157379_10143611 | 3300014968 | Bacteria | 2152 |
| 324 | Ga0157376_10208888 | 3300014969 | Bacteria | 1801 |
| 325 | Ga0182005_1086174 | 3300015265 | Bacteria | 870 |
| 326 | Ga0163161_10177045 | 3300017792 | Bacteria | 1633 |
| 327 | Ga0163161_10544744 | 3300017792 | Bacteria | 950 |
| 328 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 329 | Ga0209672_110789 | 3300025228 | Bacteria | 1216 |
| 330 | Ga0209563_100010 | 3300025230 | Bacteria | 1337457 |
| 331 | Ga0207427_100530 | 3300025231 | Bacteria | 19851 |
| 332 | Ga0209258_100110 | 3300025242 | Bacteria | 201322 |
| 333 | Ga0209258_101188 | 3300025242 | Bacteria | 10428 |
| 334 | Ga0207425_1000203 | 3300025245 | Bacteria | 47325 |
| 335 | Ga0209646_1000115 | 3300025246 | Bacteria | 152389 |
| 336 | Ga0209026_1000115 | 3300025250 | Bacteria | 136234 |
| 337 | Ga0209677_100026 | 3300025253 | Bacteria | 382520 |
| 338 | Ga0209677_100869 | 3300025253 | Bacteria | 14855 |
| 339 | Ga0209759_1000733 | 3300025256 | Bacteria | 28730 |
| 340 | Ga0209759_1005390 | 3300025256 | Bacteria | 4492 |
| 341 | Ga0209759_1010434 | 3300025256 | Bacteria | 2722 |
| 342 | Ga0209129_1000012 | 3300025258 | Bacteria | 541516 |
| 343 | Ga0209565_1007930 | 3300025263 | Bacteria | 2816 |
| 344 | Ga0209455_1000104 | 3300025272 | Bacteria | 201321 |
| 345 | Ga0209673_1004874 | 3300025273 | Bacteria | 7006 |
| 346 | Ga0209564_1000022 | 3300025295 | Bacteria | 555109 |
| 347 | Ga0209758_1000099 | 3300025297 | Bacteria | 230054 |
| 348 | Ga0209758_1000233 | 3300025297 | Bacteria | 116640 |
| 349 | Ga0209050_1000165 | 3300025298 | Bacteria | 152109 |
| 350 | Ga0209256_1000011 | 3300025299 | Bacteria | 865309 |
| 351 | Ga0209256_1020421 | 3300025299 | Bacteria | 2067 |
| 352 | Ga0209051_1001632 | 3300025303 | Bacteria | 18183 |
| 353 | Ga0209051_1007536 | 3300025303 | Bacteria | 5930 |
| 354 | Ga0209051_1054682 | 3300025303 | Bacteria | 1301 |
| 355 | Ga0207697_10009127 | 3300025315 | Bacteria | 4298 |
| 356 | Ga0207697_10025486 | 3300025315 | Bacteria | 2417 |
| 357 | Ga0207656_10082926 | 3300025321 | Bacteria | 1444 |
| 358 | Ga0207682_10026388 | 3300025893 | Bacteria | 2309 |
| 359 | Ga0207682_10046897 | 3300025893 | Bacteria | 1777 |
| 360 | Ga0207642_10107695 | 3300025899 | Bacteria | 1412 |
| 361 | Ga0207642_10274449 | 3300025899 | Bacteria | 967 |
| 362 | Ga0207688_10243681 | 3300025901 | Bacteria | 1087 |
| 363 | Ga0207688_10251163 | 3300025901 | Bacteria | 1071 |
| 364 | Ga0207680_10002882 | 3300025903 | Bacteria | 8061 |
| 365 | Ga0207680_10447355 | 3300025903 | Bacteria | 917 |
| 366 | Ga0207645_10004234 | 3300025907 | Bacteria | 10652 |
| 367 | Ga0207645_10037680 | 3300025907 | Bacteria | 3102 |
| 368 | Ga0207645_10085360 | 3300025907 | Bacteria | 2027 |
| 369 | Ga0207645_10100271 | 3300025907 | Bacteria | 1868 |
| 370 | Ga0207645_10450712 | 3300025907 | Bacteria | 869 |
| 371 | Ga0207643_10012500 | 3300025908 | Bacteria | 4588 |
| 372 | Ga0207643_10027724 | 3300025908 | Bacteria | 3142 |
| 373 | Ga0207705_10009994 | 3300025909 | Bacteria | 6909 |
| 374 | Ga0207705_10102092 | 3300025909 | Bacteria | 2111 |
| 375 | Ga0207705_10362049 | 3300025909 | Bacteria | 1118 |
| 376 | Ga0207684_10039040 | 3300025910 | Bacteria | 4028 |
| 377 | Ga0207684_10167148 | 3300025910 | Bacteria | 1896 |
| 378 | Ga0207654_10238951 | 3300025911 | Bacteria | 1213 |
| 379 | Ga0207707_10284673 | 3300025912 | Bacteria | 1431 |
| 380 | Ga0207695_10008032 | 3300025913 | Bacteria | 13283 |
| 381 | Ga0207695_10103847 | 3300025913 | Bacteria | 2833 |
| 382 | Ga0207671_10001963 | 3300025914 | Bacteria | 22689 |
| 383 | Ga0207671_10012877 | 3300025914 | Bacteria | 6697 |
| 384 | Ga0207693_10524885 | 3300025915 | Bacteria | 924 |
| 385 | Ga0207660_10045635 | 3300025917 | Bacteria | 3088 |
| 386 | Ga0207662_10258329 | 3300025918 | Bacteria | 1146 |
| 387 | Ga0207662_10290833 | 3300025918 | Bacteria | 1084 |
| 388 | Ga0207657_10135633 | 3300025919 | Bacteria | 2014 |
| 389 | Ga0207657_10250721 | 3300025919 | Bacteria | 1411 |
| 390 | Ga0207657_10412261 | 3300025919 | Bacteria | 1062 |
| 391 | Ga0207649_10160502 | 3300025920 | Bacteria | 1557 |
| 392 | Ga0207652_10031020 | 3300025921 | Bacteria | 4484 |
| 393 | Ga0207646_10139287 | 3300025922 | Bacteria | 2185 |
| 394 | Ga0207681_10019299 | 3300025923 | Bacteria | 4306 |
| 395 | Ga0207681_10034599 | 3300025923 | Bacteria | 3323 |
| 396 | Ga0207681_10111158 | 3300025923 | Bacteria | 1993 |
| 397 | Ga0207694_10063078 | 3300025924 | Bacteria | 2886 |
| 398 | Ga0207694_10086261 | 3300025924 | Bacteria | 2472 |
| 399 | Ga0207694_10236808 | 3300025924 | Bacteria | 1491 |
| 400 | Ga0207694_10382764 | 3300025924 | Bacteria | 1168 |
| 401 | Ga0207650_10000348 | 3300025925 | Bacteria | 44624 |
| 402 | Ga0207650_10114538 | 3300025925 | Bacteria | 2092 |
| 403 | Ga0207650_10193841 | 3300025925 | Bacteria | 1625 |
| 404 | Ga0207650_10269060 | 3300025925 | Bacteria | 1384 |
| 405 | Ga0207650_10343913 | 3300025925 | Bacteria | 1225 |
| 406 | Ga0207650_10422564 | 3300025925 | Bacteria | 1106 |
| 407 | Ga0207659_10000398 | 3300025926 | Bacteria | 26234 |
| 408 | Ga0207659_10002553 | 3300025926 | Bacteria | 10833 |
| 409 | Ga0207659_10009530 | 3300025926 | Bacteria | 6073 |
| 410 | Ga0207659_10058624 | 3300025926 | Bacteria | 2764 |
| 411 | Ga0207687_10242066 | 3300025927 | Bacteria | 1430 |
| 412 | Ga0207687_10265219 | 3300025927 | Bacteria | 1371 |
| 413 | Ga0207664_10001410 | 3300025929 | Bacteria | 15817 |
| 414 | Ga0207664_10049045 | 3300025929 | Bacteria | 3323 |
| 415 | Ga0207644_10030506 | 3300025931 | Bacteria | 3750 |
| 416 | Ga0207644_10120019 | 3300025931 | Bacteria | 2000 |
| 417 | Ga0207644_10161069 | 3300025931 | Bacteria | 1744 |
| 418 | Ga0207644_10203866 | 3300025931 | Bacteria | 1561 |
| 419 | Ga0207644_10476177 | 3300025931 | Bacteria | 1028 |
| 420 | Ga0207690_10034240 | 3300025932 | Bacteria | 3272 |
| 421 | Ga0207690_10266031 | 3300025932 | Bacteria | 1330 |
| 422 | Ga0207706_10012196 | 3300025933 | Bacteria | 7832 |
| 423 | Ga0207706_10041354 | 3300025933 | Bacteria | 4086 |
| 424 | Ga0207706_10282416 | 3300025933 | Bacteria | 1447 |
| 425 | Ga0207706_10286748 | 3300025933 | Bacteria | 1435 |
| 426 | Ga0207686_10134942 | 3300025934 | Bacteria | 1698 |
| 427 | Ga0207686_10412438 | 3300025934 | Bacteria | 1031 |
| 428 | Ga0207709_10057779 | 3300025935 | Bacteria | 2407 |
| 429 | Ga0207709_10200718 | 3300025935 | Bacteria | 1424 |
| 430 | Ga0207709_10374331 | 3300025935 | Bacteria | 1082 |
| 431 | Ga0207670_10017145 | 3300025936 | Bacteria | 4372 |
| 432 | Ga0207670_10031511 | 3300025936 | Bacteria | 3399 |
| 433 | Ga0207669_10014606 | 3300025937 | Bacteria | 3941 |
| 434 | Ga0207669_10043009 | 3300025937 | Bacteria | 2642 |
| 435 | Ga0207669_10064893 | 3300025937 | Bacteria | 2262 |
| 436 | Ga0207669_10106757 | 3300025937 | Bacteria | 1866 |
| 437 | Ga0207669_10131692 | 3300025937 | Bacteria | 1719 |
| 438 | Ga0207669_10134668 | 3300025937 | Bacteria | 1704 |
| 439 | Ga0207704_10056001 | 3300025938 | Bacteria | 2413 |
| 440 | Ga0207704_10058303 | 3300025938 | Bacteria | 2377 |
| 441 | Ga0207704_10247517 | 3300025938 | Bacteria | 1336 |
| 442 | Ga0207691_10007412 | 3300025940 | Bacteria | 10562 |
| 443 | Ga0207691_10014572 | 3300025940 | Bacteria | 7495 |
| 444 | Ga0207691_10039958 | 3300025940 | Bacteria | 4338 |
| 445 | Ga0207691_10076858 | 3300025940 | Bacteria | 3009 |
| 446 | Ga0207691_10113339 | 3300025940 | Bacteria | 2410 |
| 447 | Ga0207711_10224493 | 3300025941 | Bacteria | 1719 |
| 448 | Ga0207711_10459093 | 3300025941 | Bacteria | 1186 |
| 449 | Ga0207689_10033844 | 3300025942 | Bacteria | 4245 |
| 450 | Ga0207689_10081758 | 3300025942 | Bacteria | 2656 |
| 451 | Ga0207689_10271790 | 3300025942 | Bacteria | 1403 |
| 452 | Ga0207661_10463018 | 3300025944 | Bacteria | 1156 |
| 453 | Ga0207661_10529540 | 3300025944 | Bacteria | 1078 |
| 454 | Ga0207679_10006286 | 3300025945 | Bacteria | 7496 |
| 455 | Ga0207679_10190674 | 3300025945 | Bacteria | 1704 |
| 456 | Ga0207667_10020124 | 3300025949 | Bacteria | 7431 |
| 457 | Ga0207667_10022600 | 3300025949 | Bacteria | 6941 |
| 458 | Ga0207667_10064363 | 3300025949 | Bacteria | 3829 |
| 459 | Ga0207667_10267706 | 3300025949 | Bacteria | 1747 |
| 460 | Ga0207667_10325921 | 3300025949 | Bacteria | 1568 |
| 461 | Ga0207651_10001308 | 3300025960 | Bacteria | 11234 |
| 462 | Ga0207651_10017078 | 3300025960 | Bacteria | 4275 |
| 463 | Ga0207651_10052248 | 3300025960 | Bacteria | 2785 |
| 464 | Ga0207651_10211830 | 3300025960 | Bacteria | 1560 |
| 465 | Ga0207651_10494342 | 3300025960 | Bacteria | 1056 |
| 466 | Ga0207712_10016627 | 3300025961 | Bacteria | 4769 |
| 467 | Ga0207640_10018591 | 3300025981 | Bacteria | 4087 |
| 468 | Ga0207640_10070506 | 3300025981 | Bacteria | 2351 |
| 469 | Ga0207658_10011281 | 3300025986 | Bacteria | 6085 |
| 470 | Ga0207658_10045809 | 3300025986 | Bacteria | 3190 |
| 471 | Ga0207658_10141500 | 3300025986 | Bacteria | 1947 |
| 472 | Ga0207658_10196643 | 3300025986 | Bacteria | 1680 |
| 473 | Ga0207677_10050706 | 3300026023 | Bacteria | 2809 |
| 474 | Ga0207677_10135477 | 3300026023 | Bacteria | 1877 |
| 475 | Ga0207677_10144798 | 3300026023 | Bacteria | 1825 |
| 476 | Ga0207677_10198704 | 3300026023 | Bacteria | 1592 |
| 477 | Ga0207677_10322691 | 3300026023 | Bacteria | 1284 |
| 478 | Ga0207703_10147189 | 3300026035 | Bacteria | 2050 |
| 479 | Ga0207703_10275791 | 3300026035 | Bacteria | 1525 |
| 480 | Ga0207703_10423842 | 3300026035 | Bacteria | 1239 |
| 481 | Ga0207678_10001200 | 3300026067 | Bacteria | 23772 |
| 482 | Ga0207678_10332300 | 3300026067 | Bacteria | 1309 |
| 483 | Ga0207708_10063766 | 3300026075 | Bacteria | 2815 |
| 484 | Ga0207702_10010769 | 3300026078 | Bacteria | 7634 |
| 485 | Ga0207641_10022148 | 3300026088 | Bacteria | 5229 |
| 486 | Ga0207641_10182251 | 3300026088 | Bacteria | 1924 |
| 487 | Ga0207641_10513143 | 3300026088 | Bacteria | 1165 |
| 488 | Ga0207641_10707041 | 3300026088 | Bacteria | 993 |
| 489 | Ga0207648_10006696 | 3300026089 | Bacteria | 11428 |
| 490 | Ga0207648_10006922 | 3300026089 | Bacteria | 11237 |
| 491 | Ga0207648_10006965 | 3300026089 | Bacteria | 11188 |
| 492 | Ga0207648_10074159 | 3300026089 | Bacteria | 2965 |
| 493 | Ga0207648_10104346 | 3300026089 | Bacteria | 2486 |
| 494 | Ga0207648_10110649 | 3300026089 | Bacteria | 2411 |
| 495 | Ga0207676_10001822 | 3300026095 | Bacteria | 15609 |
| 496 | Ga0207676_10087186 | 3300026095 | Bacteria | 2552 |
| 497 | Ga0207676_10202672 | 3300026095 | Bacteria | 1754 |
| 498 | Ga0207676_10628416 | 3300026095 | Bacteria | 1034 |
| 499 | Ga0207676_10707277 | 3300026095 | Bacteria | 977 |
| 500 | Ga0207674_10017697 | 3300026116 | Bacteria | 7767 |
| 501 | Ga0207674_10044316 | 3300026116 | Bacteria | 4582 |
| 502 | Ga0207674_10116239 | 3300026116 | Bacteria | 2646 |
| 503 | Ga0207674_10224432 | 3300026116 | Bacteria | 1827 |
| 504 | Ga0207674_10457741 | 3300026116 | Bacteria | 1233 |
| 505 | Ga0207675_100004540 | 3300026118 | Bacteria | 13390 |
| 506 | Ga0207675_100028280 | 3300026118 | Bacteria | 5220 |
| 507 | Ga0207675_100065649 | 3300026118 | Bacteria | 3392 |
| 508 | Ga0207675_100514501 | 3300026118 | Bacteria | 1193 |
| 509 | Ga0207683_10065295 | 3300026121 | Bacteria | 3208 |
| 510 | Ga0207683_10122226 | 3300026121 | Bacteria | 2338 |
| 511 | Ga0207683_10171945 | 3300026121 | Bacteria | 1962 |
| 512 | Ga0207683_10210301 | 3300026121 | Bacteria | 1770 |
| 513 | Ga0207683_10330511 | 3300026121 | Bacteria | 1397 |
| 514 | Ga0207683_10449480 | 3300026121 | Bacteria | 1188 |
| 515 | Ga0207698_10034620 | 3300026142 | Bacteria | 3684 |
| 516 | Ga0207698_10145850 | 3300026142 | Bacteria | 2047 |
| 517 | Ga0207698_10146823 | 3300026142 | Bacteria | 2041 |
| 518 | Ga0207698_10277266 | 3300026142 | Bacteria | 1549 |
| 519 | Ga0207698_10310832 | 3300026142 | Bacteria | 1472 |
| 520 | Ga0207698_10399892 | 3300026142 | Bacteria | 1312 |
| 521 | Ga0207698_10462969 | 3300026142 | Bacteria | 1226 |
| 522 | Ga0209281_1000042 | 3300027111 | Bacteria | 344748 |
| 523 | Ga0209996_1006512 | 3300027395 | Bacteria | 1510 |
| 524 | Ga0209968_1001979 | 3300027526 | Bacteria | 3117 |
| 525 | Ga0209971_1002962 | 3300027682 | Bacteria | 4062 |
| 526 | Ga0209966_1000006 | 3300027695 | Bacteria | 102095 |
| 527 | Ga0209813_10022057 | 3300027866 | Bacteria | 1796 |
| 528 | Ga0209813_10037911 | 3300027866 | Bacteria | 1454 |
| 529 | Ga0209974_10012208 | 3300027876 | Bacteria | 2875 |
| 530 | Ga0207428_10002938 | 3300027907 | Bacteria | 16889 |
| 531 | Ga0207428_10009412 | 3300027907 | Bacteria | 8760 |
| 532 | Ga0268266_10019942 | 3300028379 | Bacteria | 5713 |
| 533 | Ga0268266_10135520 | 3300028379 | Bacteria | 2205 |
| 534 | Ga0268266_10596318 | 3300028379 | Bacteria | 1061 |
| 535 | Ga0268266_10805562 | 3300028379 | Bacteria | 907 |
| 536 | Ga0268265_10007045 | 3300028380 | Bacteria | 7602 |
| 537 | Ga0268265_10092356 | 3300028380 | Bacteria | 2422 |
| 538 | Ga0268265_10469763 | 3300028380 | Bacteria | 1179 |
| 539 | Ga0268264_10005037 | 3300028381 | Bacteria | 11180 |
| 540 | Ga0268264_10116586 | 3300028381 | Bacteria | 2348 |
| 541 | Ga0265334_10021442 | 3300028573 | Bacteria | 2638 |
| 542 | Ga0265336_10000085 | 3300028666 | Bacteria | 74880 |
| 543 | Ga0307517_10004982 | 3300028786 | Bacteria | 20222 |
| 544 | Ga0307517_10138760 | 3300028786 | Bacteria | 1716 |
| 545 | Ga0307517_10231275 | 3300028786 | Bacteria | 1109 |
| 546 | Ga0307515_10000020 | 3300028794 | Bacteria | 411735 |
| 547 | Ga0307515_10000525 | 3300028794 | Bacteria | 91297 |
| 548 | Ga0307515_10001622 | 3300028794 | Bacteria | 50061 |
| 549 | Ga0307515_10015416 | 3300028794 | Bacteria | 14081 |
| 550 | Ga0307515_10030879 | 3300028794 | Bacteria | 8969 |
| 551 | Ga0307515_10035620 | 3300028794 | Bacteria | 8086 |
| 552 | Ga0307515_10062236 | 3300028794 | Bacteria | 5275 |
| 553 | Ga0307515_10085205 | 3300028794 | Bacteria | 4047 |
| 554 | Ga0307515_10255236 | 3300028794 | Bacteria | 1499 |
| 555 | Ga0307515_10260153 | 3300028794 | Bacteria | 1473 |
| 556 | Ga0307515_10377545 | 3300028794 | Bacteria | 1051 |
| 557 | Ga0265324_10002613 | 3300029957 | Bacteria | 9041 |
| 558 | Ga0307512_10095391 | 3300030522 | Bacteria | 2047 |
| 559 | Ga0265330_10004618 | 3300031235 | Bacteria | 6963 |
| 560 | Ga0265332_10000001 | 3300031238 | Bacteria | 863783 |
| 561 | Ga0265325_10001489 | 3300031241 | Bacteria | 16484 |
| 562 | Ga0265340_10021960 | 3300031247 | Bacteria | 3268 |
| 563 | Ga0265327_10000205 | 3300031251 | Bacteria | 123596 |
| 564 | Ga0265316_10004748 | 3300031344 | Bacteria | 13437 |
| 565 | Ga0307513_10000776 | 3300031456 | Bacteria | 46244 |
| 566 | Ga0307513_10002553 | 3300031456 | Bacteria | 25147 |
| 567 | Ga0307513_10024647 | 3300031456 | Bacteria | 6994 |
| 568 | Ga0307513_10055195 | 3300031456 | Bacteria | 4253 |
| 569 | Ga0307513_10157012 | 3300031456 | Bacteria | 2173 |
| 570 | Ga0307513_10316600 | 3300031456 | Bacteria | 1320 |
| 571 | Ga0307509_10005169 | 3300031507 | Bacteria | 18309 |
| 572 | Ga0307509_10044639 | 3300031507 | Bacteria | 4787 |
| 573 | Ga0307509_10071702 | 3300031507 | Bacteria | 3612 |
| 574 | Ga0307509_10116792 | 3300031507 | Bacteria | 2657 |
| 575 | Ga0307509_10153679 | 3300031507 | Bacteria | 2212 |
| 576 | Ga0307509_10186696 | 3300031507 | Bacteria | 1930 |
| 577 | Ga0307509_10203348 | 3300031507 | Bacteria | 1814 |
| 578 | Ga0307408_100062868 | 3300031548 | Bacteria | 2714 |
| 579 | Ga0307408_100196239 | 3300031548 | Bacteria | 1630 |
| 580 | Ga0307408_100465060 | 3300031548 | Bacteria | 1100 |
| 581 | Ga0307408_100538500 | 3300031548 | Bacteria | 1028 |
| 582 | Ga0265313_10008798 | 3300031595 | Bacteria | 6650 |
| 583 | Ga0307508_10000007 | 3300031616 | Bacteria | 268359 |
| 584 | Ga0307508_10056366 | 3300031616 | Bacteria | 3479 |
| 585 | Ga0307508_10108096 | 3300031616 | Bacteria | 2380 |
| 586 | Ga0307508_10370395 | 3300031616 | Bacteria | 1023 |
| 587 | Ga0307514_10010652 | 3300031649 | Bacteria | 7684 |
| 588 | Ga0307514_10188468 | 3300031649 | Bacteria | 1317 |
| 589 | Ga0316579_10066140 | 3300031691 | Bacteria | 1706 |
| 590 | Ga0265314_10000145 | 3300031711 | Bacteria | 106541 |
| 591 | Ga0265314_10284607 | 3300031711 | Bacteria | 934 |
| 592 | Ga0307516_10003350 | 3300031730 | Bacteria | 20726 |
| 593 | Ga0307516_10003396 | 3300031730 | Bacteria | 20512 |
| 594 | Ga0307516_10011403 | 3300031730 | Bacteria | 9659 |
| 595 | Ga0307516_10044529 | 3300031730 | Bacteria | 4389 |
| 596 | Ga0307516_10080452 | 3300031730 | Bacteria | 3102 |
| 597 | Ga0307516_10302338 | 3300031730 | Bacteria | 1275 |
| 598 | Ga0307516_10348762 | 3300031730 | Bacteria | 1146 |
| 599 | Ga0307516_10440958 | 3300031730 | Bacteria | 959 |
| 600 | Ga0307405_10066606 | 3300031731 | Bacteria | 2297 |
| 601 | Ga0307413_10094339 | 3300031824 | Bacteria | 1959 |
| 602 | Ga0307413_10117195 | 3300031824 | Bacteria | 1796 |
| 603 | Ga0307410_10007964 | 3300031852 | Bacteria | 5841 |
| 604 | Ga0307410_10155983 | 3300031852 | Bacteria | 1705 |
| 605 | Ga0307410_10305142 | 3300031852 | Bacteria | 1257 |
| 606 | Ga0307410_10750991 | 3300031852 | Bacteria | 826 |
| 607 | Ga0307406_10184233 | 3300031901 | Bacteria | 1523 |
| 608 | Ga0307406_10197964 | 3300031901 | Bacteria | 1476 |
| 609 | Ga0307407_10142188 | 3300031903 | Bacteria | 1549 |
| 610 | Ga0307412_10021943 | 3300031911 | Bacteria | 3906 |
| 611 | Ga0307412_10124809 | 3300031911 | Bacteria | 1860 |
| 612 | Ga0307412_10184025 | 3300031911 | Bacteria | 1574 |
| 613 | Ga0307412_10348459 | 3300031911 | Bacteria | 1188 |
| 614 | Ga0307409_100175585 | 3300031995 | Bacteria | 1890 |
| 615 | Ga0307416_100236823 | 3300032002 | Bacteria | 1765 |
| 616 | Ga0307416_100283793 | 3300032002 | Bacteria | 1634 |
| 617 | Ga0307416_100814542 | 3300032002 | Bacteria | 1030 |
| 618 | Ga0307416_101287669 | 3300032002 | Bacteria | 837 |
| 619 | Ga0307414_10492773 | 3300032004 | Bacteria | 1083 |
| 620 | Ga0307411_10078530 | 3300032005 | Bacteria | 2263 |
| 621 | Ga0307411_10122068 | 3300032005 | Bacteria | 1887 |
| 622 | Ga0307415_100041727 | 3300032126 | Bacteria | 3049 |
| 623 | Ga0307415_100416245 | 3300032126 | Bacteria | 1152 |
| 624 | Ga0307507_10063973 | 3300033179 | Bacteria | 3399 |
| 625 | Ga0307507_10088284 | 3300033179 | Bacteria | 2675 |
| 626 | Ga0307510_10001909 | 3300033180 | Bacteria | 23432 |
| 627 | Ga0307510_10074139 | 3300033180 | Bacteria | 3365 |
| 628 | Ga0307510_10151620 | 3300033180 | Bacteria | 1935 |
| 629 | Ga0307510_10312324 | 3300033180 | Bacteria | 1031 |
| 630 | Ga0373959_0020459 | 3300034820 | Bacteria | 1263 |
| 631 | Ga0373926_0058338 | 3300035083 | Bacteria | 1403 |
| 632 | Ga0373934_0001853 | 3300035086 | Bacteria | 7762 |
| 633 | Ga0373934_0009661 | 3300035086 | Bacteria | 3617 |
| 634 | Ga0373949_0054361 | 3300035090 | Bacteria | 1016 |
| 635 | Ga0373936_0002471 | 3300035113 | Bacteria | 6914 |
| 636 | Ga0373939_0020749 | 3300035114 | Bacteria | 1790 |
| 637 | Ga0373953_0000906 | 3300035117 | Bacteria | 8298 |
| 638 | Ga0373954_0203579 | 3300035118 | Bacteria | 972 |
| 639 | Ga0373956_0075975 | 3300035119 | Bacteria | 1536 |
| 640 | Ga0373943_0126646 | 3300035170 | Bacteria | 1363 |
| 641 | Ga0373955_0026920 | 3300035172 | Bacteria | 2967 |
| 642 | Ga0316574_0060626 | 3300035398 | Bacteria | 2375 |
| 643 | Ga0373924_0001986 | 3300035410 | Bacteria | 6800 |
| 644 | Ga0373931_0002254 | 3300035691 | Bacteria | 8517 |
| 645 | Ga0373931_0172623 | 3300035691 | Bacteria | 1275 |
| 646 | Ga0373931_0208605 | 3300035691 | Bacteria | 1171 |
| 647 | Ga0373931_0237102 | 3300035691 | Bacteria | 1104 |
| 648 | Ga0373931_0278284 | 3300035691 | Bacteria | 1026 |
| 649 | Ga0373935_0008726 | 3300035692 | Bacteria | 6072 |
| 650 | Ga0373935_0016027 | 3300035692 | Bacteria | 4535 |
| 651 | Ga0373927_0000003 | 3300035695 | Bacteria | 480348 |
| 652 | Ga0373927_0188681 | 3300035695 | Bacteria | 1352 |
| 653 | Ga0373933_0244398 | 3300035724 | Bacteria | 1155 |
| 654 | Ga0373937_0063318 | 3300036401 | Bacteria | 3401 |
| 655 | Ga0316582_0101977 | 3300036647 | Bacteria | 1902 |
| 656 | Ga0316584_0123759 | 3300036712 | Bacteria | 1932 |
| 657 | Ga0373925_0011126 | 3300037068 | Bacteria | 6526 |
| 658 | Ga0373925_0026467 | 3300037068 | Bacteria | 4244 |
| 659 | Ga0373925_0091833 | 3300037068 | Bacteria | 2322 |
| 660 | Ga0373925_0152623 | 3300037068 | Bacteria | 1815 |
| 661 | Ga0373925_0182258 | 3300037068 | Bacteria | 1663 |
| 662 | Ga0395900_0000378 | 3300037418 | Bacteria | 64374 |
| 663 | Ga0395898_0001418 | 3300037466 | Bacteria | 34116 |
| 664 | Ga0395898_0034931 | 3300037466 | Bacteria | 5003 |
| 665 | Ga0395905_0000236 | 3300037471 | Bacteria | 83344 |
| 666 | Ga0395905_0005570 | 3300037471 | Bacteria | 12839 |
| 667 | Ga0395905_0064603 | 3300037471 | Bacteria | 3425 |
| 668 | Ga0395905_0152786 | 3300037471 | Bacteria | 2171 |
| 669 | Ga0395905_0428322 | 3300037471 | Bacteria | 1220 |
| 670 | Ga0395905_0536015 | 3300037471 | Bacteria | 1071 |
| 671 | Ga0395901_0002825 | 3300038443 | Bacteria | 17532 |
| 672 | Ga0395901_0355766 | 3300038443 | Bacteria | 1511 |
| 673 | Ga0400483_098460 | 3300039062 | Bacteria | 1659 |
| 674 | Ga0400483_238624 | 3300039062 | Bacteria | 4241 |
| 675 | Ga0400487_35893 | 3300039110 | Bacteria | 53987 |
| 676 | Ga0400487_45754 | 3300039110 | Bacteria | 1115 |
| 677 | Ga0436365_1917218 | 3300039437 | Bacteria | 951 |
| 678 | Ga0436360_1177354 | 3300039438 | Bacteria | 16147 |
| 679 | Ga0436361_0215417 | 3300039447 | Bacteria | 1103 |
| 680 | Ga0436361_0338760 | 3300039447 | Bacteria | 2021 |
| 681 | Ga0436361_0439659 | 3300039447 | Bacteria | 2745 |
| 682 | Ga0436363_1162970 | 3300039450 | Bacteria | 4835 |
| 683 | Ga0451789_1103105 | 3300041443 | Bacteria | 3027 |
| 684 | Ga0451791_1344885 | 3300041451 | Bacteria | 2554 |
| 685 | Ga0451793_0235702 | 3300041452 | Bacteria | 2867 |
| 686 | Ga0451798_0494322 | 3300041458 | Bacteria | 1104 |
| 687 | Ga0451798_0588047 | 3300041458 | Bacteria | 1355 |
| 688 | Ga0451800_0594548 | 3300041459 | Bacteria | 888 |
| 689 | Ga0451802_1531971 | 3300041460 | Bacteria | 1259 |
| 690 | Ga0451807_1684855 | 3300041486 | Bacteria | 1222 |
| 691 | Ga0451839_0407424 | 3300041496 | Bacteria | 857 |
| 692 | Ga0451849_1115069 | 3300041505 | Bacteria | 1056 |
| 693 | Ga0451853_3158146 | 3300041512 | Bacteria | 1100 |
| 694 | Ga0439450_038876 | 3300042008 | Bacteria | 1098 |
| 695 | Ga0439454_016750 | 3300042011 | Bacteria | 1040 |
| 696 | Ga0439455_0005175 | 3300042012 | Bacteria | 2633 |
| 697 | Ga0450898_004806 | 3300042134 | Bacteria | 2016 |
| 698 | Ga0450898_011562 | 3300042134 | Bacteria | 1447 |
| 699 | Ga0450899_001934 | 3300042135 | Bacteria | 2293 |
| 700 | Ga0439446_0034455 | 3300042156 | Bacteria | 1473 |
| 701 | Ga0439458_0024242 | 3300042157 | Bacteria | 1418 |
| 702 | Ga0439434_0013239 | 3300042435 | Bacteria | 2447 |
| 703 | Ga0439464_0004366 | 3300042439 | Bacteria | 3614 |
| 704 | Ga0439460_0019301 | 3300042461 | Bacteria | 1845 |
| 705 | Ga0450918_000505 | 3300042531 | Bacteria | 8381 |
| 706 | Ga0451577_0010789 | 3300042876 | Bacteria | 8690 |
| 707 | Ga0451577_0019663 | 3300042876 | Bacteria | 6207 |
| 708 | Ga0451577_0031911 | 3300042876 | Bacteria | 4749 |
| 709 | Ga0451577_0052237 | 3300042876 | Bacteria | 3649 |
| 710 | Ga0451577_0559101 | 3300042876 | Bacteria | 1039 |
| 711 | Ga0451577_0589012 | 3300042876 | Bacteria | 1009 |
| 712 | Ga0466969_0000595 | 3300044656 | Bacteria | 19624 |
| 713 | Ga0466969_0004862 | 3300044656 | Bacteria | 7156 |
| 714 | Ga0466969_0133636 | 3300044656 | Bacteria | 1149 |
| 715 | Ga0466972_0004906 | 3300044658 | Bacteria | 6712 |
| 716 | Ga0466972_0019791 | 3300044658 | Bacteria | 3365 |
| 717 | Ga0466965_0023891 | 3300044683 | Bacteria | 2954 |
| 718 | Ga0466965_0043775 | 3300044683 | Bacteria | 2211 |
| 719 | Ga0466965_0069153 | 3300044683 | Bacteria | 1774 |
| 720 | Ga0466965_0072401 | 3300044683 | Bacteria | 1734 |
| 721 | Ga0466966_0009425 | 3300044684 | Bacteria | 6466 |
| 722 | Ga0466966_0025092 | 3300044684 | Bacteria | 3896 |
| 723 | Ga0466966_0027591 | 3300044684 | Bacteria | 3701 |
| 724 | Ga0466966_0342989 | 3300044684 | Bacteria | 898 |
| 725 | Ga0466961_0017789 | 3300044693 | Bacteria | 4566 |
| 726 | Ga0466961_0021262 | 3300044693 | Bacteria | 4178 |
| 727 | Ga0466963_0009809 | 3300044694 | Bacteria | 5779 |
| 728 | Ga0466963_0204008 | 3300044694 | Bacteria | 1383 |
| 729 | Ga0466963_0274221 | 3300044694 | Bacteria | 1185 |
| 730 | Ga0466964_0005066 | 3300044706 | Bacteria | 4874 |
| 731 | Ga0466964_0022522 | 3300044706 | Bacteria | 2445 |
| 732 | Ga0453684_0031281 | 3300044712 | Bacteria | 7486 |
| 733 | Ga0453684_0499040 | 3300044712 | Bacteria | 1348 |
| 734 | Ga0466971_0009376 | 3300044719 | Bacteria | 4277 |
| 735 | Ga0466971_0028886 | 3300044719 | Bacteria | 2480 |
| 736 | Ga0466968_0004989 | 3300044735 | Bacteria | 4972 |
| 737 | Ga0466968_0072002 | 3300044735 | Bacteria | 1506 |
| 738 | Ga0466970_0015954 | 3300044765 | Bacteria | 3867 |
| 739 | Ga0466957_0009895 | 3300044842 | Bacteria | 5452 |
| 740 | Ga0466957_0042962 | 3300044842 | Bacteria | 2735 |
| 741 | Ga0466957_0069412 | 3300044842 | Bacteria | 2177 |
| 742 | Ga0466957_0269121 | 3300044842 | Bacteria | 1137 |
| 743 | Ga0466960_0097234 | 3300044901 | Bacteria | 1510 |
| 744 | Ga0466959_0002753 | 3300045049 | Bacteria | 11324 |
| 745 | Ga0466959_0009873 | 3300045049 | Bacteria | 6803 |
| 746 | Ga0466959_0021408 | 3300045049 | Bacteria | 4768 |
| 747 | Ga0466959_0050399 | 3300045049 | Bacteria | 3056 |
| 748 | Ga0451576_0001886 | 3300045051 | Bacteria | 33684 |
| 749 | Ga0451576_0008786 | 3300045051 | Bacteria | 11817 |
| 750 | Ga0451576_0367454 | 3300045051 | Bacteria | 1507 |
| 751 | Ga0466958_0008038 | 3300045836 | Bacteria | 5833 |
| 752 | Ga0466958_0173677 | 3300045836 | Bacteria | 1365 |
| 753 | Ga0466967_0187304 | 3300045976 | Bacteria | 1954 |
| 754 | Ga0466967_0353637 | 3300045976 | Bacteria | 1422 |
| 755 | Ga0495592_0000387 | 3300046454 | Bacteria | 34389 |
| 756 | Ga0495592_0015259 | 3300046454 | Bacteria | 5830 |
| 757 | Ga0495590_0079575 | 3300046457 | Bacteria | 1154 |
| 758 | Ga0495638_0038336 | 3300046460 | Bacteria | 3046 |
| 759 | Ga0495638_0049447 | 3300046460 | Bacteria | 2629 |
| 760 | Ga0495641_0012932 | 3300046461 | Bacteria | 4628 |
| 761 | Ga0495651_0077532 | 3300046462 | Bacteria | 2515 |
| 762 | Ga0495651_0214483 | 3300046462 | Bacteria | 1337 |
| 763 | Ga0495653_0058754 | 3300046463 | Bacteria | 2922 |
| 764 | Ga0495580_0107086 | 3300046472 | Bacteria | 1941 |
| 765 | Ga0495605_0051829 | 3300046474 | Bacteria | 1997 |
| 766 | Ga0495639_0011352 | 3300046475 | Bacteria | 3841 |
| 767 | Ga0495639_0042252 | 3300046475 | Bacteria | 2056 |
| 768 | Ga0495662_0050105 | 3300046476 | Bacteria | 2015 |
| 769 | Ga0495664_0101113 | 3300046477 | Bacteria | 1737 |
| 770 | Ga0495594_0037152 | 3300046499 | Bacteria | 2657 |
| 771 | Ga0495583_0000376 | 3300046506 | Bacteria | 69314 |
| 772 | Ga0495583_0037775 | 3300046506 | Bacteria | 2287 |
| 773 | Ga0495610_0009033 | 3300046512 | Bacteria | 6360 |
| 774 | Ga0495610_0050463 | 3300046512 | Bacteria | 2031 |
| 775 | Ga0495610_0070906 | 3300046512 | Bacteria | 1626 |
| 776 | Ga0495618_0031724 | 3300046514 | Bacteria | 3307 |
| 777 | Ga0495628_0020483 | 3300046516 | Bacteria | 5452 |
| 778 | Ga0495628_0025641 | 3300046516 | Bacteria | 4816 |
| 779 | Ga0495630_0043086 | 3300046517 | Bacteria | 3371 |
| 780 | Ga0495632_0006390 | 3300046519 | Bacteria | 7589 |
| 781 | Ga0495632_0010747 | 3300046519 | Bacteria | 5394 |
| 782 | Ga0495632_0041765 | 3300046519 | Bacteria | 2302 |
| 783 | Ga0495632_0062489 | 3300046519 | Bacteria | 1805 |
| 784 | Ga0495643_0041469 | 3300046522 | Bacteria | 2509 |
| 785 | Ga0495648_0042933 | 3300046524 | Bacteria | 2840 |
| 786 | Ga0495666_0056838 | 3300046526 | Bacteria | 1873 |
| 787 | Ga0495665_0008462 | 3300046531 | Bacteria | 5582 |
| 788 | Ga0495640_0021293 | 3300046533 | Bacteria | 4760 |
| 789 | Ga0495586_0026745 | 3300046535 | Bacteria | 3087 |
| 790 | Ga0495586_0217061 | 3300046535 | Bacteria | 1086 |
| 791 | Ga0495587_0007209 | 3300046536 | Bacteria | 7214 |
| 792 | Ga0495621_0015844 | 3300046539 | Bacteria | 2410 |
| 793 | Ga0495597_0062421 | 3300046542 | Bacteria | 1621 |
| 794 | Ga0495597_0086417 | 3300046542 | Bacteria | 1335 |
| 795 | Ga0495645_0062323 | 3300046543 | Bacteria | 2701 |
| 796 | Ga0495622_0166713 | 3300046557 | Bacteria | 992 |
| 797 | Ga0495633_0003122 | 3300046558 | Bacteria | 11228 |
| 798 | Ga0495667_0053287 | 3300046559 | Bacteria | 2664 |
| 799 | Ga0495668_0157899 | 3300046616 | Bacteria | 1242 |
| 800 | Ga0495668_0204867 | 3300046616 | Bacteria | 1080 |
| 801 | Ga0495625_0003116 | 3300046660 | Bacteria | 16943 |
| 802 | Ga0495625_0038374 | 3300046660 | Bacteria | 3507 |
| 803 | Ga0495625_0056341 | 3300046660 | Bacteria | 2799 |
| 804 | Ga0495625_0128976 | 3300046660 | Bacteria | 1714 |
| 805 | Ga0495635_0029232 | 3300046663 | Bacteria | 3832 |
| 806 | Ga0495657_0030850 | 3300046675 | Bacteria | 3750 |
| 807 | Ga0495599_0156227 | 3300046678 | Bacteria | 1411 |
| 808 | Ga0495646_0093927 | 3300046680 | Bacteria | 1728 |
| 809 | Ga0495647_0033885 | 3300046681 | Bacteria | 1910 |
| 810 | Ga0495647_0085942 | 3300046681 | Bacteria | 1282 |
| 811 | Ga0495658_0091743 | 3300046683 | Bacteria | 1799 |
| 812 | Ga0495658_0122995 | 3300046683 | Bacteria | 1571 |
| 813 | Ga0495613_0191141 | 3300046689 | Bacteria | 1446 |
| 814 | Ga0495624_0050386 | 3300046690 | Bacteria | 2638 |
| 815 | Ga0495671_0177130 | 3300046692 | Bacteria | 1036 |
| 816 | Ga0495649_0003169 | 3300046694 | Bacteria | 11245 |
| 817 | Ga0495649_0010791 | 3300046694 | Bacteria | 5382 |
| 818 | Ga0495600_0002520 | 3300046809 | Bacteria | 10530 |
| 819 | Ga0495660_0059095 | 3300046810 | Bacteria | 2063 |
| 820 | Ga0495674_0056377 | 3300047319 | Bacteria | 3441 |
| 821 | Ga0495680_0267942 | 3300047322 | Bacteria | 1206 |
| 822 | Ga0495683_0143069 | 3300047323 | Bacteria | 1119 |
| 823 | Ga0495687_000895 | 3300047443 | Bacteria | 31294 |
| 824 | Ga0495687_013838 | 3300047443 | Bacteria | 4183 |
| 825 | Ga0495675_0018143 | 3300047444 | Bacteria | 4463 |
| 826 | Ga0495686_0085640 | 3300047472 | Bacteria | 1918 |
| 827 | Ga0495686_0127752 | 3300047472 | Bacteria | 1510 |
| 828 | Ga0495593_0075399 | 3300047673 | Bacteria | 1749 |
| 829 | Ga0495593_0110387 | 3300047673 | Bacteria | 1405 |
| 830 | Ga0495602_0282612 | 3300048088 | Bacteria | 1222 |
| 831 | Ga0496101_0043246 | 3300048904 | Bacteria | 3219 |
| 832 | Ga0496102_0073646 | 3300048905 | Bacteria | 3138 |
| 833 | Ga0496104_0042136 | 3300048907 | Bacteria | 4283 |
| 834 | Ga0496104_0096070 | 3300048907 | Bacteria | 2835 |
| 835 | Ga0496105_0247674 | 3300048908 | Bacteria | 1444 |
| 836 | Ga0496108_0098399 | 3300048911 | Bacteria | 2493 |
| 837 | Ga0496108_0115719 | 3300048911 | Bacteria | 2296 |
| 838 | Ga0496108_0256504 | 3300048911 | Bacteria | 1521 |
| 839 | Ga0496108_0494663 | 3300048911 | Bacteria | 1068 |
| 840 | Ga0496108_0529160 | 3300048911 | Bacteria | 1029 |
| 841 | Ga0496110_0033734 | 3300048913 | Bacteria | 4430 |
| 842 | Ga0496110_0078869 | 3300048913 | Bacteria | 2932 |
| 843 | Ga0496114_0027012 | 3300048917 | Bacteria | 4702 |
| 844 | Ga0496114_0032678 | 3300048917 | Bacteria | 4284 |
| 845 | Ga0496114_0049082 | 3300048917 | Bacteria | 3511 |
| 846 | Ga0496114_0428228 | 3300048917 | Bacteria | 1172 |
| 847 | Ga0496121_0017040 | 3300048924 | Bacteria | 7454 |
| 848 | Ga0496124_0000161 | 3300048927 | Bacteria | 136651 |
| 849 | Ga0496124_0180555 | 3300048927 | Bacteria | 1625 |
| 850 | Ga0496125_0024913 | 3300048928 | Bacteria | 5491 |
| 851 | Ga0501031_0130440 | 3300049568 | Bacteria | 1642 |
| 852 | Ga0501032_0006906 | 3300049569 | Bacteria | 8321 |
| 853 | Ga0501032_0032501 | 3300049569 | Bacteria | 3576 |
| 854 | Ga0501034_0000487 | 3300049571 | Bacteria | 64548 |
| 855 | Ga0501034_0011695 | 3300049571 | Bacteria | 9080 |
| 856 | Ga0501034_0579065 | 3300049571 | Bacteria | 1029 |
| 857 | Ga0501038_0023064 | 3300049574 | Bacteria | 5569 |
| 858 | Ga0501038_0052996 | 3300049574 | Bacteria | 3495 |
| 859 | Ga0501039_0089380 | 3300049575 | Bacteria | 2400 |
| 860 | Ga0501039_0258159 | 3300049575 | Bacteria | 1370 |
| 861 | Ga0501040_0036751 | 3300049576 | Bacteria | 3326 |
| 862 | Ga0501043_0000052 | 3300049579 | Bacteria | 106686 |
| 863 | Ga0501046_0000430 | 3300049580 | Bacteria | 42066 |
| 864 | Ga0501046_0149724 | 3300049580 | Bacteria | 1761 |
| 865 | Ga0501047_0000039 | 3300049581 | Bacteria | 187849 |
| 866 | Ga0501047_0071107 | 3300049581 | Bacteria | 3349 |
| 867 | Ga0501048_0040372 | 3300049582 | Bacteria | 3344 |
| 868 | Ga0501069_0043526 | 3300049585 | Bacteria | 2485 |
| 869 | Ga0501069_0079656 | 3300049585 | Bacteria | 1844 |
| 870 | Ga0501070_0014474 | 3300049586 | Bacteria | 6639 |
| 871 | Ga0501070_0082311 | 3300049586 | Bacteria | 2664 |
| 872 | Ga0501070_0277714 | 3300049586 | Bacteria | 1367 |
| 873 | Ga0501071_0194019 | 3300049587 | Bacteria | 1524 |
| 874 | Ga0501072_0035658 | 3300049588 | Bacteria | 3897 |
| 875 | Ga0501073_0001502 | 3300049589 | Bacteria | 17266 |
| 876 | Ga0501074_0006518 | 3300049590 | Bacteria | 8428 |
| 877 | Ga0501074_0102476 | 3300049590 | Bacteria | 2049 |
| 878 | Ga0501075_0152260 | 3300049591 | Bacteria | 1763 |
| 879 | Ga0501076_0697566 | 3300049592 | Bacteria | 838 |
| 880 | Ga0501198_000132 | 3300049649 | Bacteria | 11059 |
| 881 | Ga0501222_000189 | 3300049662 | Bacteria | 11054 |
| 882 | Ga0501253_009491 | 3300049683 | Bacteria | 1436 |
| 883 | Ga0501080_0017464 | 3300049742 | Bacteria | 6635 |
| 884 | Ga0501080_0433226 | 3300049742 | Bacteria | 1180 |
| 885 | Ga0501083_0001806 | 3300049744 | Bacteria | 14649 |
| 886 | Ga0501262_016955 | 3300049759 | Bacteria | 968 |
| 887 | Ga0501035_0145547 | 3300049822 | Bacteria | 2058 |
| 888 | Ga0501035_0184777 | 3300049822 | Bacteria | 1794 |
| 889 | Ga0501044_0098995 | 3300049823 | Bacteria | 2935 |
| 890 | Ga0501045_0017773 | 3300049824 | Bacteria | 5050 |
| 891 | nmdc:mga03683_110270_c1 | 3300050489 | Bacteria | 1216 |
| 892 | nmdc:mga03683_21912_c1 | 3300050489 | Bacteria | 2471 |
| 893 | nmdc:mga03683_24427_c1 | 3300050489 | Bacteria | 2365 |
| 894 | nmdc:mga03683_34934_c1 | 3300050489 | Bacteria | 2036 |
| 895 | nmdc:mga03n38_194499_c1 | 3300050490 | Bacteria | 1046 |
| 896 | nmdc:mga00v17_49568_c1 | 3300050491 | Bacteria | 2548 |
| 897 | nmdc:mga00v17_79021_c1 | 3300050491 | Bacteria | 2051 |
| 898 | nmdc:mga0yw44_222887_c1 | 3300050492 | Bacteria | 1250 |
| 899 | nmdc:mga0k408_1102_c1 | 3300050493 | Bacteria | 14783 |
| 900 | nmdc:mga0k408_16823_c1 | 3300050493 | Bacteria | 4066 |
| 901 | nmdc:mga0k408_170907_c1 | 3300050493 | Bacteria | 1296 |
| 902 | nmdc:mga0k408_2080_c1 | 3300050493 | Bacteria | 10706 |
| 903 | nmdc:mga0k408_31371_c1 | 3300050493 | Bacteria | 3034 |
| 904 | nmdc:mga0k408_3241_c1 | 3300050493 | Bacteria | 8614 |
| 905 | nmdc:mga0k408_57201_c1 | 3300050493 | Bacteria | 2264 |
| 906 | nmdc:mga0k408_57791_c1 | 3300050493 | Bacteria | 2253 |
| 907 | nmdc:mga0k408_73662_c1 | 3300050493 | Bacteria | 1995 |
| 908 | nmdc:mga0k408_99861_c2 | 3300050493 | Bacteria | 1260 |
| 909 | nmdc:mga06z11_10178_c1 | 3300050494 | Bacteria | 3994 |
| 910 | nmdc:mga06z11_16631_c1 | 3300050494 | Bacteria | 3318 |
| 911 | nmdc:mga04h51_142015_c1 | 3300050495 | Bacteria | 911 |
| 912 | nmdc:mga04h51_72599_c1 | 3300050495 | Bacteria | 1205 |
| 913 | nmdc:mga07m45_10292_c1 | 3300050496 | Bacteria | 4880 |
| 914 | nmdc:mga07m45_21586_c1 | 3300050496 | Bacteria | 3508 |
| 915 | nmdc:mga07m45_26205_c1 | 3300050496 | Bacteria | 3204 |
| 916 | nmdc:mga07m45_416481_c1 | 3300050496 | Bacteria | 779 |
| 917 | nmdc:mga07m45_49715_c1 | 3300050496 | Bacteria | 2361 |
| 918 | nmdc:mga07m45_521_c1 | 3300050496 | Bacteria | 16326 |
| 919 | nmdc:mga07m45_53555_c1 | 3300050496 | Bacteria | 2280 |
| 920 | nmdc:mga07m45_65931_c1 | 3300050496 | Bacteria | 2057 |
| 921 | nmdc:mga07m45_76067_c1 | 3300050496 | Bacteria | 1914 |
| 922 | nmdc:mga05p37_2801_c1 | 3300050507 | Bacteria | 20272 |
| 923 | nmdc:mga09592_10994_c1 | 3300050508 | Bacteria | 7362 |
| 924 | nmdc:mga09592_14926_c1 | 3300050508 | Bacteria | 6345 |
| 925 | nmdc:mga0qj67_10472_c1 | 3300050509 | Bacteria | 6926 |
| 926 | nmdc:mga0qj67_146689_c1 | 3300050509 | Bacteria | 1913 |
| 927 | nmdc:mga06r32_287020_c1 | 3300050510 | Bacteria | 1632 |
| 928 | nmdc:mga08y16_1570_c1 | 3300050511 | Bacteria | 23061 |
| 929 | nmdc:mga08y16_356723_c1 | 3300050511 | Bacteria | 1501 |
| 930 | nmdc:mga08y16_603_c1 | 3300050511 | Bacteria | 33534 |
| 931 | nmdc:mga0n895_350699_c1 | 3300050512 | Bacteria | 1495 |
| 932 | nmdc:mga0rr50_138425_c1 | 3300050513 | Bacteria | 1956 |
| 933 | nmdc:mga08x19_31277_c1 | 3300050514 | Bacteria | 3348 |
| 934 | nmdc:mga0a205_316753_c1 | 3300050515 | Bacteria | 1431 |
| 935 | nmdc:mga0sz30_15726_c1 | 3300050516 | Bacteria | 2993 |
| 936 | Ga0495601_0013741 | 3300053077 | Bacteria | 4872 |
| 937 | Ga0495601_0035607 | 3300053077 | Bacteria | 3108 |
| 938 | Ga0495601_0044755 | 3300053077 | Bacteria | 2782 |
| 939 | Ga0500635_0000121 | 3300053080 | Bacteria | 45993 |
| 940 | Ga0495595_0009542 | 3300053084 | Bacteria | 4018 |
| 941 | Ga0495619_0009855 | 3300053085 | Bacteria | 6022 |
| 942 | Ga0495619_0193359 | 3300053085 | Bacteria | 1408 |
| 943 | Ga0500578_0000007 | 3300053086 | Bacteria | 229642 |
| 944 | Ga0500644_0024652 | 3300053088 | Bacteria | 1841 |
| 945 | Ga0500646_0094425 | 3300053090 | Bacteria | 930 |
| 946 | Ga0500583_0024471 | 3300053092 | Bacteria | 2562 |
| 947 | Ga0500651_0009548 | 3300053093 | Bacteria | 5773 |
| 948 | Ga0500651_0045258 | 3300053093 | Bacteria | 2769 |
| 949 | Ga0500651_0206903 | 3300053093 | Bacteria | 1156 |
| 950 | Ga0500593_003361 | 3300053117 | Bacteria | 6029 |
| 951 | Ga0500608_144726 | 3300053122 | Bacteria | 1049 |
| 952 | Ga0500623_056329 | 3300053127 | Bacteria | 1958 |
| 953 | Ga0500628_003585 | 3300053129 | Bacteria | 2564 |
| 954 | Ga0500652_000097 | 3300053131 | Bacteria | 35527 |
| 955 | Ga0500652_016036 | 3300053131 | Bacteria | 2718 |
| 956 | Ga0500655_003228 | 3300053133 | Bacteria | 2954 |
| 957 | Ga0500658_0006551 | 3300053134 | Bacteria | 4318 |
| 958 | Ga0500559_0000262 | 3300053136 | Bacteria | 41173 |
| 959 | Ga0500559_0121277 | 3300053136 | Bacteria | 1216 |
| 960 | Ga0500564_044993 | 3300053138 | Bacteria | 2026 |
| 961 | Ga0500568_0008721 | 3300053139 | Bacteria | 4864 |
| 962 | Ga0500568_0012380 | 3300053139 | Bacteria | 3927 |
| 963 | Ga0500577_0190973 | 3300053142 | Bacteria | 881 |
| 964 | Ga0500589_063237 | 3300053147 | Bacteria | 1691 |
| 965 | Ga0500600_0035917 | 3300053149 | Bacteria | 2885 |
| 966 | Ga0500604_0024840 | 3300053151 | Bacteria | 1718 |
| 967 | Ga0500619_002116 | 3300053154 | Bacteria | 3740 |
| 968 | Ga0500619_078881 | 3300053154 | Bacteria | 1104 |
| 969 | Ga0500622_0000359 | 3300053156 | Bacteria | 44261 |
| 970 | Ga0500622_0003431 | 3300053156 | Bacteria | 10597 |
| 971 | Ga0500627_0078761 | 3300053158 | Bacteria | 1467 |
| 972 | Ga0500636_0019889 | 3300053177 | Bacteria | 3970 |
| 973 | Ga0500636_0162650 | 3300053177 | Bacteria | 1215 |
| 974 | Ga0500570_051476 | 3300053724 | Bacteria | 2068 |
| 975 | Ga0500570_081453 | 3300053724 | Bacteria | 1456 |
| 976 | Ga0501082_0402881 | 3300060353 | Bacteria | 1194 |
| 977 | 2587728238 | 2585428057 | Bacteria | 6737412 |
| 978 | 2587734556 | 2585428058 | Bacteria | 6853932 |
| 979 | 2587755472 | 2585428062 | Bacteria | 6842168 |
| 980 | 2643971107 | 2643221592 | Bacteria | 6608788 |
| 981 | 2644142126 | 2643221625 | Bacteria | 6512927 |
| 982 | 2644246038 | 2643221644 | Bacteria | 6865017 |
| 983 | 2644275378 | 2643221648 | Bacteria | 6521465 |
| 984 | 2644304100 | 2643221654 | Bacteria | 5273570 |
| 985 | 2691332906 | 2690315857 | Bacteria | 4396207 |
| 986 | 2919535923 | 2919534386 | Bacteria | 4577686 |
| 987 | 2932424149 | 2932422444 | Bacteria | 4678430 |
| 988 | Ga0495686_0009198 | |||
| 989 | JGI25156J39149_1004175 | |||
| 990 | JGI25156J39149_1010363 | |||
| 991 | JGI25156J39149_1021359 | |||
| 992 | JGI25154J39366_1002195 | |||
| 993 | JGI25157J39369_1000392 | |||
| 994 | JGI25152J39213_1000905 | |||
| 995 | JGI25152J39213_1001351 | |||
| 996 | JGI25150J39212_1006356 | |||
| 997 | JGI25153J46596_10006194 | |||
| 998 | JGI25153J46596_10015186 | |||
| 999 | rootH2_10021208 | |||
| 1000 | rootL2_10052407 | |||
| 1001 | Ga0055539_1000352 | |||
| 1002 | Ga0055539_1002249 | |||
| 1003 | Ga0055533_1000006 | |||
| 1004 | Ga0055525_1000524 | |||
| 1005 | Ga0055535_1000433 | |||
| 1006 | Ga0055529_1000158 | |||
| 1007 | Ga0055526_1002422 | |||
| 1008 | Ga0055524_1000102 | |||
| 1009 | Ga0055530_10006481 | |||
| 1010 | Ga0055540_1010981 | |||
| 1011 | Ga0065165_1001184 | |||
| 1012 | Ga0065707_10118006 | |||
| 1013 | Ga0065707_10140497 | |||
| 1014 | Ga0070658_10001465 | |||
| 1015 | Ga0070658_10076990 | |||
| 1016 | Ga0070658_10096906 | |||
| 1017 | Ga0070658_10306421 | |||
| 1018 | Ga0070676_10035272 | |||
| 1019 | Ga0070676_10068863 | |||
| 1020 | Ga0070676_10212404 | |||
| 1021 | Ga0070670_100012223 | |||
| 1022 | Ga0070670_100056117 | |||
| 1023 | Ga0070670_100095183 | |||
| 1024 | Ga0070670_100157093 | |||
| 1025 | Ga0070670_100196909 | |||
| 1026 | Ga0070670_100203725 | |||
| 1027 | Ga0070670_100230528 | |||
| 1028 | Ga0070670_100488065 | |||
| 1029 | Ga0070670_100630704 | |||
| 1030 | Ga0070677_10029583 | |||
| 1031 | Ga0070677_10066778 | |||
| 1032 | Ga0068869_100039932 | |||
| 1033 | Ga0068869_100188739 | |||
| 1034 | Ga0070666_10008645 | |||
| 1035 | Ga0070680_100065816 | |||
| 1036 | Ga0068868_100046565 | |||
| 1037 | Ga0068868_100136382 | |||
| 1038 | Ga0068868_100193809 | |||
| 1039 | Ga0068868_100288749 | |||
| 1040 | Ga0068868_100489253 | |||
| 1041 | Ga0070660_100066097 | |||
| 1042 | Ga0070660_100231854 | |||
| 1043 | Ga0070689_100001822 | |||
| 1044 | Ga0070689_100259670 | |||
| 1045 | Ga0070687_100388180 | |||
| 1046 | Ga0070661_100027147 | |||
| 1047 | Ga0070668_100138568 | |||
| 1048 | Ga0070669_100012328 | |||
| 1049 | Ga0070669_100181771 | |||
| 1050 | Ga0070675_100012792 | |||
| 1051 | Ga0070675_100090045 | |||
| 1052 | Ga0070675_100151094 | |||
| 1053 | Ga0070675_100237260 | |||
| 1054 | Ga0070675_100680710 | |||
| 1055 | Ga0070671_100068753 | |||
| 1056 | Ga0070671_100122294 | |||
| 1057 | Ga0070671_100143965 | |||
| 1058 | Ga0070671_100388796 | |||
| 1059 | Ga0070674_100004081 | |||
| 1060 | Ga0070674_100106952 | |||
| 1061 | Ga0070674_100122253 | |||
| 1062 | Ga0070674_100462709 | |||
| 1063 | Ga0070674_100477057 | |||
| 1064 | Ga0070673_100031802 | |||
| 1065 | Ga0070673_100033636 | |||
| 1066 | Ga0070673_100041305 | |||
| 1067 | Ga0070673_100055857 | |||
| 1068 | Ga0070673_100063558 | |||
| 1069 | Ga0070673_100082868 | |||
| 1070 | Ga0070673_100371982 | |||
| 1071 | Ga0070688_100083365 | |||
| 1072 | Ga0070659_100212760 | |||
| 1073 | Ga0070659_100421011 | |||
| 1074 | Ga0070667_100019421 | |||
| 1075 | Ga0070667_100057922 | |||
| 1076 | Ga0070667_100156615 | |||
| 1077 | Ga0070667_100230829 | |||
| 1078 | Ga0070714_100008092 | |||
| 1079 | Ga0070714_100009364 | |||
| 1080 | Ga0070700_100171856 | |||
| 1081 | Ga0070694_100011996 | |||
| 1082 | Ga0070663_100000634 | |||
| 1083 | Ga0070663_100363465 | |||
| 1084 | Ga0070678_100011636 | |||
| 1085 | Ga0070678_100053283 | |||
| 1086 | Ga0070678_100098523 | |||
| 1087 | Ga0070678_100144005 | |||
| 1088 | Ga0070662_100056749 | |||
| 1089 | Ga0070662_100205026 | |||
| 1090 | Ga0070662_100529358 | |||
| 1091 | Ga0070681_10403713 | |||
| 1092 | Ga0068867_100004124 | |||
| 1093 | Ga0068867_100014577 | |||
| 1094 | Ga0068867_100016184 | |||
| 1095 | Ga0068867_100027807 | |||
| 1096 | Ga0068867_100051797 | |||
| 1097 | Ga0068867_100085413 | |||
| 1098 | Ga0068867_100157587 | |||
| 1099 | Ga0070685_10076725 | |||
| 1100 | Ga0070706_100002793 | |||
| 1101 | Ga0070706_100061643 | |||
| 1102 | Ga0070707_100490901 | |||
| 1103 | Ga0070707_100936360 | |||
| 1104 | Ga0070699_100437364 | |||
| 1105 | Ga0070679_100006218 | |||
| 1106 | Ga0070697_100180184 | |||
| 1107 | Ga0068853_100228317 | |||
| 1108 | Ga0068853_100654113 | |||
| 1109 | Ga0070672_100011823 | |||
| 1110 | Ga0070672_100016450 | |||
| 1111 | Ga0070672_100106565 | |||
| 1112 | Ga0070672_100109760 | |||
| 1113 | Ga0070695_100126007 | |||
| 1114 | Ga0070695_100471274 | |||
| 1115 | Ga0070696_100054709 | |||
| 1116 | Ga0070696_100158450 | |||
| 1117 | Ga0070693_100034493 | |||
| 1118 | Ga0070693_100053646 | |||
| 1119 | Ga0070665_100168115 | |||
| 1120 | Ga0070665_100272135 | |||
| 1121 | Ga0070665_100280439 | |||
| 1122 | Ga0070665_100545645 | |||
| 1123 | Ga0070704_100233161 | |||
| 1124 | Ga0068855_100010413 | |||
| 1125 | Ga0068855_100070036 | |||
| 1126 | Ga0068855_100113366 | |||
| 1127 | Ga0068855_100131402 | |||
| 1128 | Ga0068855_100417808 | |||
| 1129 | Ga0068855_100591613 | |||
| 1130 | Ga0070664_100117980 | |||
| 1131 | Ga0070664_100212941 | |||
| 1132 | Ga0070664_100281225 | |||
| 1133 | Ga0070664_100560435 | |||
| 1134 | Ga0068857_100103415 | |||
| 1135 | Ga0068857_100176721 | |||
| 1136 | Ga0068857_100367425 | |||
| 1137 | Ga0068854_100085208 | |||
| 1138 | Ga0068856_100012303 | |||
| 1139 | Ga0068852_100015266 | |||
| 1140 | Ga0068852_100068355 | |||
| 1141 | Ga0068852_100085353 | |||
| 1142 | Ga0068852_100109877 | |||
| 1143 | Ga0068852_100131801 | |||
| 1144 | Ga0068852_100149236 | |||
| 1145 | Ga0068852_100521923 | |||
| 1146 | Ga0068859_100039311 | |||
| 1147 | Ga0068859_100042728 | |||
| 1148 | Ga0068859_100550968 | |||
| 1149 | Ga0068864_100016361 | |||
| 1150 | Ga0068864_100104399 | |||
| 1151 | Ga0068864_100128029 | |||
| 1152 | Ga0068864_100236957 | |||
| 1153 | Ga0068866_10052876 | |||
| 1154 | Ga0068861_100019097 | |||
| 1155 | Ga0068861_100659008 | |||
| 1156 | Ga0068851_10129270 | |||
| 1157 | Ga0068851_10155781 | |||
| 1158 | Ga0068870_10022355 | |||
| 1159 | Ga0068870_10154893 | |||
| 1160 | Ga0068870_10261186 | |||
| 1161 | Ga0068863_100022617 | |||
| 1162 | Ga0068863_100085754 | |||
| 1163 | Ga0068863_100566987 | |||
| 1164 | Ga0068863_100633508 | |||
| 1165 | Ga0068858_100002454 | |||
| 1166 | Ga0068858_100053499 | |||
| 1167 | Ga0068858_100234035 | |||
| 1168 | Ga0068860_100001400 | |||
| 1169 | Ga0068860_100064632 | |||
| 1170 | Ga0068862_100005708 | |||
| 1171 | Ga0068862_100283598 | |||
| 1172 | Ga0081539_10158893 | |||
| 1173 | Ga0075365_10304467 | |||
| 1174 | Ga0075368_10037234 | |||
| 1175 | Ga0075368_10132336 | |||
| 1176 | Ga0075363_100052276 | |||
| 1177 | Ga0075363_100064680 | |||
| 1178 | Ga0075363_100113720 | |||
| 1179 | Ga0075364_10066372 | |||
| 1180 | Ga0075364_10067124 | |||
| 1181 | Ga0070712_100163453 | |||
| 1182 | Ga0075362_10032933 | |||
| 1183 | Ga0075362_10047567 | |||
| 1184 | Ga0075367_10054547 | |||
| 1185 | Ga0075367_10055203 | |||
| 1186 | Ga0075367_10056702 | |||
| 1187 | Ga0075367_10228367 | |||
| 1188 | Ga0075369_10040130 | |||
| 1189 | Ga0075369_10052138 | |||
| 1190 | Ga0075366_10004345 | |||
| 1191 | Ga0075366_10055842 | |||
| 1192 | Ga0075366_10055891 | |||
| 1193 | Ga0075366_10061309 | |||
| 1194 | Ga0075366_10071747 | |||
| 1195 | Ga0075366_10079518 | |||
| 1196 | Ga0075366_10079524 | |||
| 1197 | Ga0075366_10091583 | |||
| 1198 | Ga0075366_10099646 | |||
| 1199 | Ga0075366_10208343 | |||
| 1200 | Ga0075366_10258021 | |||
| 1201 | Ga0075366_10277735 | |||
| 1202 | Ga0097621_100072410 | |||
| 1203 | Ga0097621_100530068 | |||
| 1204 | Ga0075370_10010352 | |||
| 1205 | Ga0075370_10029569 | |||
| 1206 | Ga0075370_10051089 | |||
| 1207 | Ga0075370_10052590 | |||
| 1208 | Ga0075370_10053862 | |||
| 1209 | Ga0075370_10067176 | |||
| 1210 | Ga0075370_10074900 | |||
| 1211 | Ga0075370_10099434 | |||
| 1212 | Ga0068871_100063525 | |||
| 1213 | Ga0068871_100139938 | |||
| 1214 | Ga0068871_100186431 | |||
| 1215 | Ga0075428_100009664 | |||
| 1216 | Ga0075428_100040186 | |||
| 1217 | Ga0075430_100023952 | |||
| 1218 | Ga0075431_100195675 | |||
| 1219 | Ga0075429_100014458 | |||
| 1220 | Ga0075429_100026505 | |||
| 1221 | Ga0075429_100056611 | |||
| 1222 | Ga0068865_100006089 | |||
| 1223 | Ga0068865_100041377 | |||
| 1224 | Ga0068865_100160843 | |||
| 1225 | Ga0068865_100486047 | |||
| 1226 | Ga0075436_100040472 | |||
| 1227 | Ga0097620_100039310 | |||
| 1228 | Ga0097620_100042728 | |||
| 1229 | Ga0097620_100550967 | |||
| 1230 | Ga0079104_1000688 | |||
| 1231 | Ga0075435_100032840 | |||
| 1232 | Ga0099794_10235776 | |||
| 1233 | Ga0105240_10005231 | |||
| 1234 | Ga0105240_10079444 | |||
| 1235 | Ga0111539_10000243 | |||
| 1236 | Ga0111539_10099768 | |||
| 1237 | Ga0111539_10291450 | |||
| 1238 | Ga0111539_10474150 | |||
| 1239 | Ga0111539_10928310 | |||
| 1240 | Ga0105245_10069829 | |||
| 1241 | Ga0105245_10208407 | |||
| 1242 | Ga0105245_10592922 | |||
| 1243 | Ga0105245_10973293 | |||
| 1244 | Ga0114129_10066741 | |||
| 1245 | Ga0114129_10582979 | |||
| 1246 | Ga0105243_10050096 | |||
| 1247 | Ga0105243_10053545 | |||
| 1248 | Ga0105243_10067795 | |||
| 1249 | Ga0105243_10383680 | |||
| 1250 | Ga0105241_10176129 | |||
| 1251 | Ga0105241_10306079 | |||
| 1252 | Ga0105242_10030444 | |||
| 1253 | Ga0105242_10083680 | |||
| 1254 | Ga0105248_10034428 | |||
| 1255 | Ga0105248_10399494 | |||
| 1256 | Ga0105248_10543655 | |||
| 1257 | Ga0105237_10001569 | |||
| 1258 | Ga0105237_10046244 | |||
| 1259 | Ga0105237_10800780 | |||
| 1260 | Ga0105238_10047205 | |||
| 1261 | Ga0105238_10132356 | |||
| 1262 | Ga0105238_10230809 | |||
| 1263 | Ga0105249_10141262 | |||
| 1264 | Ga0105249_10261243 | |||
| 1265 | Ga0105239_10000486 | |||
| 1266 | Ga0105239_10053414 | |||
| 1267 | Ga0105239_10069245 | |||
| 1268 | Ga0105246_10075982 | |||
| 1269 | Ga0105246_10219711 | |||
| 1270 | Ga0157370_10017241 | |||
| 1271 | Ga0157370_10214811 | |||
| 1272 | Ga0157369_10009180 | |||
| 1273 | Ga0157374_10042556 | |||
| 1274 | Ga0157374_10139883 | |||
| 1275 | Ga0157374_10304049 | |||
| 1276 | Ga0157374_10652903 | |||
| 1277 | Ga0157378_10021826 | |||
| 1278 | Ga0157378_10028209 | |||
| 1279 | Ga0157378_10052031 | |||
| 1280 | Ga0157378_10133891 | |||
| 1281 | Ga0157378_10221124 | |||
| 1282 | Ga0157378_10230687 | |||
| 1283 | Ga0157378_10389993 | |||
| 1284 | Ga0163162_10003214 | |||
| 1285 | Ga0163162_10131030 | |||
| 1286 | Ga0163162_10161077 | |||
| 1287 | Ga0163162_10748205 | |||
| 1288 | Ga0163162_11143150 | |||
| 1289 | Ga0157372_10081759 | |||
| 1290 | Ga0157372_10223867 | |||
| 1291 | Ga0157372_10396553 | |||
| 1292 | Ga0157372_10408023 | |||
| 1293 | Ga0157375_10028646 | |||
| 1294 | Ga0157375_10056335 | |||
| 1295 | Ga0157375_10104691 | |||
| 1296 | Ga0157375_10471622 | |||
| 1297 | Ga0157375_10720202 | |||
| 1298 | Ga0163163_10032862 | |||
| 1299 | Ga0163163_10435022 | |||
| 1300 | Ga0157380_10059818 | |||
| 1301 | Ga0157380_10160367 | |||
| 1302 | Ga0157380_10393650 | |||
| 1303 | Ga0157380_10587063 | |||
| 1304 | Ga0157380_10634194 | |||
| 1305 | Ga0157377_10164241 | |||
| 1306 | Ga0157379_10017321 | |||
| 1307 | Ga0157379_10055575 | |||
| 1308 | Ga0157379_10083358 | |||
| 1309 | Ga0157379_10098107 | |||
| 1310 | Ga0157379_10143611 | |||
| 1311 | Ga0157376_10208888 | |||
| 1312 | Ga0182005_1086174 | |||
| 1313 | Ga0163161_10177045 | |||
| 1314 | Ga0163161_10544744 | |||
| 1315 | Ga0209674_100003 | |||
| 1316 | Ga0209672_110789 | |||
| 1317 | Ga0209563_100010 | |||
| 1318 | Ga0207427_100530 | |||
| 1319 | Ga0209258_100110 | |||
| 1320 | Ga0209258_101188 | |||
| 1321 | Ga0207425_1000203 | |||
| 1322 | Ga0209646_1000115 | |||
| 1323 | Ga0209026_1000115 | |||
| 1324 | Ga0209677_100026 | |||
| 1325 | Ga0209677_100869 | |||
| 1326 | Ga0209759_1000733 | |||
| 1327 | Ga0209759_1005390 | |||
| 1328 | Ga0209759_1010434 | |||
| 1329 | Ga0209129_1000012 | |||
| 1330 | Ga0209565_1007930 | |||
| 1331 | Ga0209455_1000104 | |||
| 1332 | Ga0209673_1004874 | |||
| 1333 | Ga0209564_1000022 | |||
| 1334 | Ga0209758_1000099 | |||
| 1335 | Ga0209758_1000233 | |||
| 1336 | Ga0209050_1000165 | |||
| 1337 | Ga0209256_1000011 | |||
| 1338 | Ga0209256_1020421 | |||
| 1339 | Ga0209051_1001632 | |||
| 1340 | Ga0209051_1007536 | |||
| 1341 | Ga0209051_1054682 | |||
| 1342 | Ga0207697_10009127 | |||
| 1343 | Ga0207697_10025486 | |||
| 1344 | Ga0207656_10082926 | |||
| 1345 | Ga0207682_10026388 | |||
| 1346 | Ga0207682_10046897 | |||
| 1347 | Ga0207642_10107695 | |||
| 1348 | Ga0207642_10274449 | |||
| 1349 | Ga0207688_10243681 | |||
| 1350 | Ga0207688_10251163 | |||
| 1351 | Ga0207680_10002882 | |||
| 1352 | Ga0207680_10447355 | |||
| 1353 | Ga0207645_10004234 | |||
| 1354 | Ga0207645_10037680 | |||
| 1355 | Ga0207645_10085360 | |||
| 1356 | Ga0207645_10100271 | |||
| 1357 | Ga0207645_10450712 | |||
| 1358 | Ga0207643_10012500 | |||
| 1359 | Ga0207643_10027724 | |||
| 1360 | Ga0207705_10009994 | |||
| 1361 | Ga0207705_10102092 | |||
| 1362 | Ga0207705_10362049 | |||
| 1363 | Ga0207684_10039040 | |||
| 1364 | Ga0207684_10167148 | |||
| 1365 | Ga0207654_10238951 | |||
| 1366 | Ga0207707_10284673 | |||
| 1367 | Ga0207695_10008032 | |||
| 1368 | Ga0207695_10103847 | |||
| 1369 | Ga0207671_10001963 | |||
| 1370 | Ga0207671_10012877 | |||
| 1371 | Ga0207693_10524885 | |||
| 1372 | Ga0207660_10045635 | |||
| 1373 | Ga0207662_10258329 | |||
| 1374 | Ga0207662_10290833 | |||
| 1375 | Ga0207657_10135633 | |||
| 1376 | Ga0207657_10250721 | |||
| 1377 | Ga0207657_10412261 | |||
| 1378 | Ga0207649_10160502 | |||
| 1379 | Ga0207652_10031020 | |||
| 1380 | Ga0207646_10139287 | |||
| 1381 | Ga0207681_10019299 | |||
| 1382 | Ga0207681_10034599 | |||
| 1383 | Ga0207681_10111158 | |||
| 1384 | Ga0207694_10063078 | |||
| 1385 | Ga0207694_10086261 | |||
| 1386 | Ga0207694_10236808 | |||
| 1387 | Ga0207694_10382764 | |||
| 1388 | Ga0207650_10000348 | |||
| 1389 | Ga0207650_10114538 | |||
| 1390 | Ga0207650_10193841 | |||
| 1391 | Ga0207650_10269060 | |||
| 1392 | Ga0207650_10343913 | |||
| 1393 | Ga0207650_10422564 | |||
| 1394 | Ga0207659_10000398 | |||
| 1395 | Ga0207659_10002553 | |||
| 1396 | Ga0207659_10009530 | |||
| 1397 | Ga0207659_10058624 | |||
| 1398 | Ga0207687_10242066 | |||
| 1399 | Ga0207687_10265219 | |||
| 1400 | Ga0207664_10001410 | |||
| 1401 | Ga0207664_10049045 | |||
| 1402 | Ga0207644_10030506 | |||
| 1403 | Ga0207644_10120019 | |||
| 1404 | Ga0207644_10161069 | |||
| 1405 | Ga0207644_10203866 | |||
| 1406 | Ga0207644_10476177 | |||
| 1407 | Ga0207690_10034240 | |||
| 1408 | Ga0207690_10266031 | |||
| 1409 | Ga0207706_10012196 | |||
| 1410 | Ga0207706_10041354 | |||
| 1411 | Ga0207706_10282416 | |||
| 1412 | Ga0207706_10286748 | |||
| 1413 | Ga0207686_10134942 | |||
| 1414 | Ga0207686_10412438 | |||
| 1415 | Ga0207709_10057779 | |||
| 1416 | Ga0207709_10200718 | |||
| 1417 | Ga0207709_10374331 | |||
| 1418 | Ga0207670_10017145 | |||
| 1419 | Ga0207670_10031511 | |||
| 1420 | Ga0207669_10014606 | |||
| 1421 | Ga0207669_10043009 | |||
| 1422 | Ga0207669_10064893 | |||
| 1423 | Ga0207669_10106757 | |||
| 1424 | Ga0207669_10131692 | |||
| 1425 | Ga0207669_10134668 | |||
| 1426 | Ga0207704_10056001 | |||
| 1427 | Ga0207704_10058303 | |||
| 1428 | Ga0207704_10247517 | |||
| 1429 | Ga0207691_10007412 | |||
| 1430 | Ga0207691_10014572 | |||
| 1431 | Ga0207691_10039958 | |||
| 1432 | Ga0207691_10076858 | |||
| 1433 | Ga0207691_10113339 | |||
| 1434 | Ga0207711_10224493 | |||
| 1435 | Ga0207711_10459093 | |||
| 1436 | Ga0207689_10033844 | |||
| 1437 | Ga0207689_10081758 | |||
| 1438 | Ga0207689_10271790 | |||
| 1439 | Ga0207661_10463018 | |||
| 1440 | Ga0207661_10529540 | |||
| 1441 | Ga0207679_10006286 | |||
| 1442 | Ga0207679_10190674 | |||
| 1443 | Ga0207667_10020124 | |||
| 1444 | Ga0207667_10022600 | |||
| 1445 | Ga0207667_10064363 | |||
| 1446 | Ga0207667_10267706 | |||
| 1447 | Ga0207667_10325921 | |||
| 1448 | Ga0207651_10001308 | |||
| 1449 | Ga0207651_10017078 | |||
| 1450 | Ga0207651_10052248 | |||
| 1451 | Ga0207651_10211830 | |||
| 1452 | Ga0207651_10494342 | |||
| 1453 | Ga0207712_10016627 | |||
| 1454 | Ga0207640_10018591 | |||
| 1455 | Ga0207640_10070506 | |||
| 1456 | Ga0207658_10011281 | |||
| 1457 | Ga0207658_10045809 | |||
| 1458 | Ga0207658_10141500 | |||
| 1459 | Ga0207658_10196643 | |||
| 1460 | Ga0207677_10050706 | |||
| 1461 | Ga0207677_10135477 | |||
| 1462 | Ga0207677_10144798 | |||
| 1463 | Ga0207677_10198704 | |||
| 1464 | Ga0207677_10322691 | |||
| 1465 | Ga0207703_10147189 | |||
| 1466 | Ga0207703_10275791 | |||
| 1467 | Ga0207703_10423842 | |||
| 1468 | Ga0207678_10001200 | |||
| 1469 | Ga0207678_10332300 | |||
| 1470 | Ga0207708_10063766 | |||
| 1471 | Ga0207702_10010769 | |||
| 1472 | Ga0207641_10022148 | |||
| 1473 | Ga0207641_10182251 | |||
| 1474 | Ga0207641_10513143 | |||
| 1475 | Ga0207641_10707041 | |||
| 1476 | Ga0207648_10006696 | |||
| 1477 | Ga0207648_10006922 | |||
| 1478 | Ga0207648_10006965 | |||
| 1479 | Ga0207648_10074159 | |||
| 1480 | Ga0207648_10104346 | |||
| 1481 | Ga0207648_10110649 | |||
| 1482 | Ga0207676_10001822 | |||
| 1483 | Ga0207676_10087186 | |||
| 1484 | Ga0207676_10202672 | |||
| 1485 | Ga0207676_10628416 | |||
| 1486 | Ga0207676_10707277 | |||
| 1487 | Ga0207674_10017697 | |||
| 1488 | Ga0207674_10044316 | |||
| 1489 | Ga0207674_10116239 | |||
| 1490 | Ga0207674_10224432 | |||
| 1491 | Ga0207674_10457741 | |||
| 1492 | Ga0207675_100004540 | |||
| 1493 | Ga0207675_100028280 | |||
| 1494 | Ga0207675_100065649 | |||
| 1495 | Ga0207675_100514501 | |||
| 1496 | Ga0207683_10065295 | |||
| 1497 | Ga0207683_10122226 | |||
| 1498 | Ga0207683_10171945 | |||
| 1499 | Ga0207683_10210301 | |||
| 1500 | Ga0207683_10330511 | |||
| 1501 | Ga0207683_10449480 | |||
| 1502 | Ga0207698_10034620 | |||
| 1503 | Ga0207698_10145850 | |||
| 1504 | Ga0207698_10146823 | |||
| 1505 | Ga0207698_10277266 | |||
| 1506 | Ga0207698_10310832 | |||
| 1507 | Ga0207698_10399892 | |||
| 1508 | Ga0207698_10462969 | |||
| 1509 | Ga0209281_1000042 | |||
| 1510 | Ga0209996_1006512 | |||
| 1511 | Ga0209968_1001979 | |||
| 1512 | Ga0209971_1002962 | |||
| 1513 | Ga0209966_1000006 | |||
| 1514 | Ga0209813_10022057 | |||
| 1515 | Ga0209813_10037911 | |||
| 1516 | Ga0209974_10012208 | |||
| 1517 | Ga0207428_10002938 | |||
| 1518 | Ga0207428_10009412 | |||
| 1519 | Ga0268266_10019942 | |||
| 1520 | Ga0268266_10135520 | |||
| 1521 | Ga0268266_10596318 | |||
| 1522 | Ga0268266_10805562 | |||
| 1523 | Ga0268265_10007045 | |||
| 1524 | Ga0268265_10092356 | |||
| 1525 | Ga0268265_10469763 | |||
| 1526 | Ga0268264_10005037 | |||
| 1527 | Ga0268264_10116586 | |||
| 1528 | Ga0265334_10021442 | |||
| 1529 | Ga0265336_10000085 | |||
| 1530 | Ga0307517_10004982 | |||
| 1531 | Ga0307517_10138760 | |||
| 1532 | Ga0307517_10231275 | |||
| 1533 | Ga0307515_10000020 | |||
| 1534 | Ga0307515_10000525 | |||
| 1535 | Ga0307515_10001622 | |||
| 1536 | Ga0307515_10015416 | |||
| 1537 | Ga0307515_10030879 | |||
| 1538 | Ga0307515_10035620 | |||
| 1539 | Ga0307515_10062236 | |||
| 1540 | Ga0307515_10085205 | |||
| 1541 | Ga0307515_10255236 | |||
| 1542 | Ga0307515_10260153 | |||
| 1543 | Ga0307515_10377545 | |||
| 1544 | Ga0265324_10002613 | |||
| 1545 | Ga0307512_10095391 | |||
| 1546 | Ga0265330_10004618 | |||
| 1547 | Ga0265332_10000001 | |||
| 1548 | Ga0265325_10001489 | |||
| 1549 | Ga0265340_10021960 | |||
| 1550 | Ga0265327_10000205 | |||
| 1551 | Ga0265316_10004748 | |||
| 1552 | Ga0307513_10000776 | |||
| 1553 | Ga0307513_10002553 | |||
| 1554 | Ga0307513_10024647 | |||
| 1555 | Ga0307513_10055195 | |||
| 1556 | Ga0307513_10157012 | |||
| 1557 | Ga0307513_10316600 | |||
| 1558 | Ga0307509_10005169 | |||
| 1559 | Ga0307509_10044639 | |||
| 1560 | Ga0307509_10071702 | |||
| 1561 | Ga0307509_10116792 | |||
| 1562 | Ga0307509_10153679 | |||
| 1563 | Ga0307509_10186696 | |||
| 1564 | Ga0307509_10203348 | |||
| 1565 | Ga0307408_100062868 | |||
| 1566 | Ga0307408_100196239 | |||
| 1567 | Ga0307408_100465060 | |||
| 1568 | Ga0307408_100538500 | |||
| 1569 | Ga0265313_10008798 | |||
| 1570 | Ga0307508_10000007 | |||
| 1571 | Ga0307508_10056366 | |||
| 1572 | Ga0307508_10108096 | |||
| 1573 | Ga0307508_10370395 | |||
| 1574 | Ga0307514_10010652 | |||
| 1575 | Ga0307514_10188468 | |||
| 1576 | Ga0316579_10066140 | |||
| 1577 | Ga0265314_10000145 | |||
| 1578 | Ga0265314_10284607 | |||
| 1579 | Ga0307516_10003350 | |||
| 1580 | Ga0307516_10003396 | |||
| 1581 | Ga0307516_10011403 | |||
| 1582 | Ga0307516_10044529 | |||
| 1583 | Ga0307516_10080452 | |||
| 1584 | Ga0307516_10302338 | |||
| 1585 | Ga0307516_10348762 | |||
| 1586 | Ga0307516_10440958 | |||
| 1587 | Ga0307405_10066606 | |||
| 1588 | Ga0307413_10094339 | |||
| 1589 | Ga0307413_10117195 | |||
| 1590 | Ga0307410_10007964 | |||
| 1591 | Ga0307410_10155983 | |||
| 1592 | Ga0307410_10305142 | |||
| 1593 | Ga0307410_10750991 | |||
| 1594 | Ga0307406_10184233 | |||
| 1595 | Ga0307406_10197964 | |||
| 1596 | Ga0307407_10142188 | |||
| 1597 | Ga0307412_10021943 | |||
| 1598 | Ga0307412_10124809 | |||
| 1599 | Ga0307412_10184025 | |||
| 1600 | Ga0307412_10348459 | |||
| 1601 | Ga0307409_100175585 | |||
| 1602 | Ga0307416_100236823 | |||
| 1603 | Ga0307416_100283793 | |||
| 1604 | Ga0307416_100814542 | |||
| 1605 | Ga0307416_101287669 | |||
| 1606 | Ga0307414_10492773 | |||
| 1607 | Ga0307411_10078530 | |||
| 1608 | Ga0307411_10122068 | |||
| 1609 | Ga0307415_100041727 | |||
| 1610 | Ga0307415_100416245 | |||
| 1611 | Ga0307507_10063973 | |||
| 1612 | Ga0307507_10088284 | |||
| 1613 | Ga0307510_10001909 | |||
| 1614 | Ga0307510_10074139 | |||
| 1615 | Ga0307510_10151620 | |||
| 1616 | Ga0307510_10312324 | |||
| 1617 | Ga0373959_0020459 | |||
| 1618 | Ga0373926_0058338 | |||
| 1619 | Ga0373934_0001853 | |||
| 1620 | Ga0373934_0009661 | |||
| 1621 | Ga0373949_0054361 | |||
| 1622 | Ga0373936_0002471 | |||
| 1623 | Ga0373939_0020749 | |||
| 1624 | Ga0373953_0000906 | |||
| 1625 | Ga0373954_0203579 | |||
| 1626 | Ga0373956_0075975 | |||
| 1627 | Ga0373943_0126646 | |||
| 1628 | Ga0373955_0026920 | |||
| 1629 | Ga0316574_0060626 | |||
| 1630 | Ga0373924_0001986 | |||
| 1631 | Ga0373931_0002254 | |||
| 1632 | Ga0373931_0172623 | |||
| 1633 | Ga0373931_0208605 | |||
| 1634 | Ga0373931_0237102 | |||
| 1635 | Ga0373931_0278284 | |||
| 1636 | Ga0373935_0008726 | |||
| 1637 | Ga0373935_0016027 | |||
| 1638 | Ga0373927_0000003 | |||
| 1639 | Ga0373927_0188681 | |||
| 1640 | Ga0373933_0244398 | |||
| 1641 | Ga0373937_0063318 | |||
| 1642 | Ga0316582_0101977 | |||
| 1643 | Ga0316584_0123759 | |||
| 1644 | Ga0373925_0011126 | |||
| 1645 | Ga0373925_0026467 | |||
| 1646 | Ga0373925_0091833 | |||
| 1647 | Ga0373925_0152623 | |||
| 1648 | Ga0373925_0182258 | |||
| 1649 | Ga0395900_0000378 | |||
| 1650 | Ga0395898_0001418 | |||
| 1651 | Ga0395898_0034931 | |||
| 1652 | Ga0395905_0000236 | |||
| 1653 | Ga0395905_0005570 | |||
| 1654 | Ga0395905_0064603 | |||
| 1655 | Ga0395905_0152786 | |||
| 1656 | Ga0395905_0428322 | |||
| 1657 | Ga0395905_0536015 | |||
| 1658 | Ga0395901_0002825 | |||
| 1659 | Ga0395901_0355766 | |||
| 1660 | Ga0400483_098460 | |||
| 1661 | Ga0400483_238624 | |||
| 1662 | Ga0400487_35893 | |||
| 1663 | Ga0400487_45754 | |||
| 1664 | Ga0436365_1917218 | |||
| 1665 | Ga0436360_1177354 | |||
| 1666 | Ga0436361_0215417 | |||
| 1667 | Ga0436361_0338760 | |||
| 1668 | Ga0436361_0439659 | |||
| 1669 | Ga0436363_1162970 | |||
| 1670 | Ga0451789_1103105 | |||
| 1671 | Ga0451791_1344885 | |||
| 1672 | Ga0451793_0235702 | |||
| 1673 | Ga0451798_0494322 | |||
| 1674 | Ga0451798_0588047 | |||
| 1675 | Ga0451800_0594548 | |||
| 1676 | Ga0451802_1531971 | |||
| 1677 | Ga0451807_1684855 | |||
| 1678 | Ga0451839_0407424 | |||
| 1679 | Ga0451849_1115069 | |||
| 1680 | Ga0451853_3158146 | |||
| 1681 | Ga0439450_038876 | |||
| 1682 | Ga0439454_016750 | |||
| 1683 | Ga0439455_0005175 | |||
| 1684 | Ga0450898_004806 | |||
| 1685 | Ga0450898_011562 | |||
| 1686 | Ga0450899_001934 | |||
| 1687 | Ga0439446_0034455 | |||
| 1688 | Ga0439458_0024242 | |||
| 1689 | Ga0439434_0013239 | |||
| 1690 | Ga0439464_0004366 | |||
| 1691 | Ga0439460_0019301 | |||
| 1692 | Ga0450918_000505 | |||
| 1693 | Ga0451577_0010789 | |||
| 1694 | Ga0451577_0019663 | |||
| 1695 | Ga0451577_0031911 | |||
| 1696 | Ga0451577_0052237 | |||
| 1697 | Ga0451577_0559101 | |||
| 1698 | Ga0451577_0589012 | |||
| 1699 | Ga0466969_0000595 | |||
| 1700 | Ga0466969_0004862 | |||
| 1701 | Ga0466969_0133636 | |||
| 1702 | Ga0466972_0004906 | |||
| 1703 | Ga0466972_0019791 | |||
| 1704 | Ga0466965_0023891 | |||
| 1705 | Ga0466965_0043775 | |||
| 1706 | Ga0466965_0069153 | |||
| 1707 | Ga0466965_0072401 | |||
| 1708 | Ga0466966_0009425 | |||
| 1709 | Ga0466966_0025092 | |||
| 1710 | Ga0466966_0027591 | |||
| 1711 | Ga0466966_0342989 | |||
| 1712 | Ga0466961_0017789 | |||
| 1713 | Ga0466961_0021262 | |||
| 1714 | Ga0466963_0009809 | |||
| 1715 | Ga0466963_0204008 | |||
| 1716 | Ga0466963_0274221 | |||
| 1717 | Ga0466964_0005066 | |||
| 1718 | Ga0466964_0022522 | |||
| 1719 | Ga0453684_0031281 | |||
| 1720 | Ga0453684_0499040 | |||
| 1721 | Ga0466971_0009376 | |||
| 1722 | Ga0466971_0028886 | |||
| 1723 | Ga0466968_0004989 | |||
| 1724 | Ga0466968_0072002 | |||
| 1725 | Ga0466970_0015954 | |||
| 1726 | Ga0466957_0009895 | |||
| 1727 | Ga0466957_0042962 | |||
| 1728 | Ga0466957_0069412 | |||
| 1729 | Ga0466957_0269121 | |||
| 1730 | Ga0466960_0097234 | |||
| 1731 | Ga0466959_0002753 | |||
| 1732 | Ga0466959_0009873 | |||
| 1733 | Ga0466959_0021408 | |||
| 1734 | Ga0466959_0050399 | |||
| 1735 | Ga0451576_0001886 | |||
| 1736 | Ga0451576_0008786 | |||
| 1737 | Ga0451576_0367454 | |||
| 1738 | Ga0466958_0008038 | |||
| 1739 | Ga0466958_0173677 | |||
| 1740 | Ga0466967_0187304 | |||
| 1741 | Ga0466967_0353637 | |||
| 1742 | Ga0495592_0000387 | |||
| 1743 | Ga0495592_0015259 | |||
| 1744 | Ga0495590_0079575 | |||
| 1745 | Ga0495638_0038336 | |||
| 1746 | Ga0495638_0049447 | |||
| 1747 | Ga0495641_0012932 | |||
| 1748 | Ga0495651_0077532 | |||
| 1749 | Ga0495651_0214483 | |||
| 1750 | Ga0495653_0058754 | |||
| 1751 | Ga0495580_0107086 | |||
| 1752 | Ga0495605_0051829 | |||
| 1753 | Ga0495639_0011352 | |||
| 1754 | Ga0495639_0042252 | |||
| 1755 | Ga0495662_0050105 | |||
| 1756 | Ga0495664_0101113 | |||
| 1757 | Ga0495594_0037152 | |||
| 1758 | Ga0495583_0000376 | |||
| 1759 | Ga0495583_0037775 | |||
| 1760 | Ga0495610_0009033 | |||
| 1761 | Ga0495610_0050463 | |||
| 1762 | Ga0495610_0070906 | |||
| 1763 | Ga0495618_0031724 | |||
| 1764 | Ga0495628_0020483 | |||
| 1765 | Ga0495628_0025641 | |||
| 1766 | Ga0495630_0043086 | |||
| 1767 | Ga0495632_0006390 | |||
| 1768 | Ga0495632_0010747 | |||
| 1769 | Ga0495632_0041765 | |||
| 1770 | Ga0495632_0062489 | |||
| 1771 | Ga0495643_0041469 | |||
| 1772 | Ga0495648_0042933 | |||
| 1773 | Ga0495666_0056838 | |||
| 1774 | Ga0495665_0008462 | |||
| 1775 | Ga0495640_0021293 | |||
| 1776 | Ga0495586_0026745 | |||
| 1777 | Ga0495586_0217061 | |||
| 1778 | Ga0495587_0007209 | |||
| 1779 | Ga0495621_0015844 | |||
| 1780 | Ga0495597_0062421 | |||
| 1781 | Ga0495597_0086417 | |||
| 1782 | Ga0495645_0062323 | |||
| 1783 | Ga0495622_0166713 | |||
| 1784 | Ga0495633_0003122 | |||
| 1785 | Ga0495667_0053287 | |||
| 1786 | Ga0495668_0157899 | |||
| 1787 | Ga0495668_0204867 | |||
| 1788 | Ga0495625_0003116 | |||
| 1789 | Ga0495625_0038374 | |||
| 1790 | Ga0495625_0056341 | |||
| 1791 | Ga0495625_0128976 | |||
| 1792 | Ga0495635_0029232 | |||
| 1793 | Ga0495657_0030850 | |||
| 1794 | Ga0495599_0156227 | |||
| 1795 | Ga0495646_0093927 | |||
| 1796 | Ga0495647_0033885 | |||
| 1797 | Ga0495647_0085942 | |||
| 1798 | Ga0495658_0091743 | |||
| 1799 | Ga0495658_0122995 | |||
| 1800 | Ga0495613_0191141 | |||
| 1801 | Ga0495624_0050386 | |||
| 1802 | Ga0495671_0177130 | |||
| 1803 | Ga0495649_0003169 | |||
| 1804 | Ga0495649_0010791 | |||
| 1805 | Ga0495600_0002520 | |||
| 1806 | Ga0495660_0059095 | |||
| 1807 | Ga0495674_0056377 | |||
| 1808 | Ga0495680_0267942 | |||
| 1809 | Ga0495683_0143069 | |||
| 1810 | Ga0495687_000895 | |||
| 1811 | Ga0495687_013838 | |||
| 1812 | Ga0495675_0018143 | |||
| 1813 | Ga0495686_0085640 | |||
| 1814 | Ga0495686_0127752 | |||
| 1815 | Ga0495593_0075399 | |||
| 1816 | Ga0495593_0110387 | |||
| 1817 | Ga0495602_0282612 | |||
| 1818 | Ga0496101_0043246 | |||
| 1819 | Ga0496102_0073646 | |||
| 1820 | Ga0496104_0042136 | |||
| 1821 | Ga0496104_0096070 | |||
| 1822 | Ga0496105_0247674 | |||
| 1823 | Ga0496108_0098399 | |||
| 1824 | Ga0496108_0115719 | |||
| 1825 | Ga0496108_0256504 | |||
| 1826 | Ga0496108_0494663 | |||
| 1827 | Ga0496108_0529160 | |||
| 1828 | Ga0496110_0033734 | |||
| 1829 | Ga0496110_0078869 | |||
| 1830 | Ga0496114_0027012 | |||
| 1831 | Ga0496114_0032678 | |||
| 1832 | Ga0496114_0049082 | |||
| 1833 | Ga0496114_0428228 | |||
| 1834 | Ga0496121_0017040 | |||
| 1835 | Ga0496124_0000161 | |||
| 1836 | Ga0496124_0180555 | |||
| 1837 | Ga0496125_0024913 | |||
| 1838 | Ga0501031_0130440 | |||
| 1839 | Ga0501032_0006906 | |||
| 1840 | Ga0501032_0032501 | |||
| 1841 | Ga0501034_0000487 | |||
| 1842 | Ga0501034_0011695 | |||
| 1843 | Ga0501034_0579065 | |||
| 1844 | Ga0501038_0023064 | |||
| 1845 | Ga0501038_0052996 | |||
| 1846 | Ga0501039_0089380 | |||
| 1847 | Ga0501039_0258159 | |||
| 1848 | Ga0501040_0036751 | |||
| 1849 | Ga0501043_0000052 | |||
| 1850 | Ga0501046_0000430 | |||
| 1851 | Ga0501046_0149724 | |||
| 1852 | Ga0501047_0000039 | |||
| 1853 | Ga0501047_0071107 | |||
| 1854 | Ga0501048_0040372 | |||
| 1855 | Ga0501069_0043526 | |||
| 1856 | Ga0501069_0079656 | |||
| 1857 | Ga0501070_0014474 | |||
| 1858 | Ga0501070_0082311 | |||
| 1859 | Ga0501070_0277714 | |||
| 1860 | Ga0501071_0194019 | |||
| 1861 | Ga0501072_0035658 | |||
| 1862 | Ga0501073_0001502 | |||
| 1863 | Ga0501074_0006518 | |||
| 1864 | Ga0501074_0102476 | |||
| 1865 | Ga0501075_0152260 | |||
| 1866 | Ga0501076_0697566 | |||
| 1867 | Ga0501198_000132 | |||
| 1868 | Ga0501222_000189 | |||
| 1869 | Ga0501253_009491 | |||
| 1870 | Ga0501080_0017464 | |||
| 1871 | Ga0501080_0433226 | |||
| 1872 | Ga0501083_0001806 | |||
| 1873 | Ga0501262_016955 | |||
| 1874 | Ga0501035_0145547 | |||
| 1875 | Ga0501035_0184777 | |||
| 1876 | Ga0501044_0098995 | |||
| 1877 | Ga0501045_0017773 | |||
| 1878 | nmdc:mga03683_110270_c1 | |||
| 1879 | nmdc:mga03683_21912_c1 | |||
| 1880 | nmdc:mga03683_24427_c1 | |||
| 1881 | nmdc:mga03683_34934_c1 | |||
| 1882 | nmdc:mga03n38_194499_c1 | |||
| 1883 | nmdc:mga00v17_49568_c1 | |||
| 1884 | nmdc:mga00v17_79021_c1 | |||
| 1885 | nmdc:mga0yw44_222887_c1 | |||
| 1886 | nmdc:mga0k408_1102_c1 | |||
| 1887 | nmdc:mga0k408_16823_c1 | |||
| 1888 | nmdc:mga0k408_170907_c1 | |||
| 1889 | nmdc:mga0k408_2080_c1 | |||
| 1890 | nmdc:mga0k408_31371_c1 | |||
| 1891 | nmdc:mga0k408_3241_c1 | |||
| 1892 | nmdc:mga0k408_57201_c1 | |||
| 1893 | nmdc:mga0k408_57791_c1 | |||
| 1894 | nmdc:mga0k408_73662_c1 | |||
| 1895 | nmdc:mga0k408_99861_c2 | |||
| 1896 | nmdc:mga06z11_10178_c1 | |||
| 1897 | nmdc:mga06z11_16631_c1 | |||
| 1898 | nmdc:mga04h51_142015_c1 | |||
| 1899 | nmdc:mga04h51_72599_c1 | |||
| 1900 | nmdc:mga07m45_10292_c1 | |||
| 1901 | nmdc:mga07m45_21586_c1 | |||
| 1902 | nmdc:mga07m45_26205_c1 | |||
| 1903 | nmdc:mga07m45_416481_c1 | |||
| 1904 | nmdc:mga07m45_49715_c1 | |||
| 1905 | nmdc:mga07m45_521_c1 | |||
| 1906 | nmdc:mga07m45_53555_c1 | |||
| 1907 | nmdc:mga07m45_65931_c1 | |||
| 1908 | nmdc:mga07m45_76067_c1 | |||
| 1909 | nmdc:mga05p37_2801_c1 | |||
| 1910 | nmdc:mga09592_10994_c1 | |||
| 1911 | nmdc:mga09592_14926_c1 | |||
| 1912 | nmdc:mga0qj67_10472_c1 | |||
| 1913 | nmdc:mga0qj67_146689_c1 | |||
| 1914 | nmdc:mga06r32_287020_c1 | |||
| 1915 | nmdc:mga08y16_1570_c1 | |||
| 1916 | nmdc:mga08y16_356723_c1 | |||
| 1917 | nmdc:mga08y16_603_c1 | |||
| 1918 | nmdc:mga0n895_350699_c1 | |||
| 1919 | nmdc:mga0rr50_138425_c1 | |||
| 1920 | nmdc:mga08x19_31277_c1 | |||
| 1921 | nmdc:mga0a205_316753_c1 | |||
| 1922 | nmdc:mga0sz30_15726_c1 | |||
| 1923 | Ga0495601_0013741 | |||
| 1924 | Ga0495601_0035607 | |||
| 1925 | Ga0495601_0044755 | |||
| 1926 | Ga0500635_0000121 | |||
| 1927 | Ga0495595_0009542 | |||
| 1928 | Ga0495619_0009855 | |||
| 1929 | Ga0495619_0193359 | |||
| 1930 | Ga0500578_0000007 | |||
| 1931 | Ga0500644_0024652 | |||
| 1932 | Ga0500646_0094425 | |||
| 1933 | Ga0500583_0024471 | |||
| 1934 | Ga0500651_0009548 | |||
| 1935 | Ga0500651_0045258 | |||
| 1936 | Ga0500651_0206903 | |||
| 1937 | Ga0500593_003361 | |||
| 1938 | Ga0500608_144726 | |||
| 1939 | Ga0500623_056329 | |||
| 1940 | Ga0500628_003585 | |||
| 1941 | Ga0500652_000097 | |||
| 1942 | Ga0500652_016036 | |||
| 1943 | Ga0500655_003228 | |||
| 1944 | Ga0500658_0006551 | |||
| 1945 | Ga0500559_0000262 | |||
| 1946 | Ga0500559_0121277 | |||
| 1947 | Ga0500564_044993 | |||
| 1948 | Ga0500568_0008721 | |||
| 1949 | Ga0500568_0012380 | |||
| 1950 | Ga0500577_0190973 | |||
| 1951 | Ga0500589_063237 | |||
| 1952 | Ga0500600_0035917 | |||
| 1953 | Ga0500604_0024840 | |||
| 1954 | Ga0500619_002116 | |||
| 1955 | Ga0500619_078881 | |||
| 1956 | Ga0500622_0000359 | |||
| 1957 | Ga0500622_0003431 | |||
| 1958 | Ga0500627_0078761 | |||
| 1959 | Ga0500636_0019889 | |||
| 1960 | Ga0500636_0162650 | |||
| 1961 | Ga0500570_051476 | |||
| 1962 | Ga0500570_081453 | |||
| 1963 | Ga0501082_0402881 | |||
| 1964 | 2587728238 | |||
| 1965 | 2587734556 | |||
| 1966 | 2587755472 | |||
| 1967 | 2643971107 | |||
| 1968 | 2644142126 | |||
| 1969 | 2644246038 | |||
| 1970 | 2644275378 | |||
| 1971 | 2644304100 | |||
| 1972 | 2691332906 | |||
| 1973 | 2919535923 | |||
| 1974 | 2932424149 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5dpm-assembly1.cif.gz_A | crystal structure of ubig mutant in complex with sah | 0.9432 | 3 | 231 |
| 4kdr-assembly1.cif.gz_A | crystal structure of ubig/sah complex | 0.9353 | 3 | 231 |
| 5dpm-assembly1.cif.gz_A | crystal structure of ubig mutant in complex with sah | 0.9297 | 3 | 231 |
| 4kdr-assembly1.cif.gz_A | crystal structure of ubig/sah complex | 0.9221 | 3 | 231 |
| 4kdc-assembly1.cif.gz_A | crystal structure of ubig | 0.8727 | 9 | 230 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6FP65_72_359_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9569 | 4 | 231 | 3.40.50.150 |
| af_A0A1D6FP61_65_209_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9539 | 1 | 90 | 3.40.50.150 |
| af_Q0DEH4_83_317_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9528 | 9 | 229 | 3.40.50.150 |
| af_Q9NZJ6_96_332_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9448 | 9 | 230 | 3.40.50.150 |
| af_Q54XD0_74_321_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9448 | 9 | 231 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-B8CMG5-F1-model_v4 | Ubiquinone biosynthesis O-methyltransferase (2-polyprenyl-6-hydroxyphenol methylase) (EC 2.1.1.222) (3-demethylubiquinone 3-O-methyltransferase) (EC 2.1.1.64) | 0.9906 | 3 | 232 |
GO:0010420
GO:0032259 GO:0061542 GO:0102208 |
| AF-A0A2D8RA11-F1-model_v4 | Ubiquinone biosynthesis O-methyltransferase (2-polyprenyl-6-hydroxyphenol methylase) (EC 2.1.1.222) (3-demethylubiquinone 3-O-methyltransferase) (EC 2.1.1.64) | 0.9832 | 1 | 235 |
GO:0010420
GO:0032259 GO:0061542 GO:0102208 |
| AF-A0A193KBS2-F1-model_v4 | deleted | 0.9789 | 3 | 235 |
|
| AF-A0A1E5C2G2-F1-model_v4 | Ubiquinone biosynthesis O-methyltransferase (2-polyprenyl-6-hydroxyphenol methylase) (EC 2.1.1.222) (3-demethylubiquinone 3-O-methyltransferase) (EC 2.1.1.64) | 0.9769 | 1 | 232 |
GO:0010420
GO:0032259 GO:0061542 GO:0102208 |
| AF-A0A0V1CKJ4-F1-model_v4 | Sec1 family domain-containing protein 1 | 0.972 | 2 | 234 |
GO:0003735
GO:0005763 GO:0010420 GO:0016192 GO:0045271 GO:0061542 |