F487556

General Info

Members Datasets Scaffolds Average Seq Length
987 459 1974 281

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0002521|Ga0496100_0002521_3670_4620
Length 316
Sequence VRHVACKGQDGLLSHRKSRNGPFAFPFDVTARRTGGTTMAKKNGLDEYRVPFFDEGSKSKFSLADVDPSLKPFSTGSKDTDRERLAEIGAALDAQQERLHAQRVQRVLLVLQGMDTSGKDGTIRAVFHEVDPLGLRIVPFKAPTPVELAHDFLWRIHSQAPAAGELTIFNRSHYEDVLVPVVLGSMDKDERLRRYRHIRDFERMLAENGTTIIKCMLHISKDEQRERLQARIDDPTKHWKFDVSDLDARKLWDKYQEAYDEALAATSTDYAPWYVIPANSKTHRNVMVGELLLRAFESLKLEFPPAKESLKGVIVE

Samples

Sample ID Description Type Environment
1 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
17 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
26 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
109 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
118 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
120 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
121 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
122 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
130 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
187 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
193 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
194 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
195 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
196 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
197 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
198 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
199 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
200 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
201 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
202 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
203 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
204 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
205 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
208 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
209 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
210 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
211 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
212 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
213 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
214 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
215 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
216 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
217 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
218 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
219 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
222 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
223 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
224 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
227 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
228 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
229 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
230 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
231 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
232 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
233 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
234 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
235 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
236 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
237 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
238 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
239 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
240 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
241 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
242 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
243 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
244 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
245 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
246 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
247 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
248 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
249 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
250 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
251 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
252 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
253 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
254 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
255 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
256 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
257 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
258 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
259 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
260 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
261 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
262 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
263 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
264 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
265 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
266 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
267 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
268 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
269 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
270 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
271 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
272 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
273 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
274 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
275 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
276 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
277 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
278 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
279 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
280 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
281 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
282 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
283 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
284 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
285 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
286 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
287 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
288 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
289 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
290 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
291 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
292 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
293 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
294 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
295 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
296 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
297 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
298 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
299 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
300 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
301 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
302 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
303 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
304 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
305 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
306 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
307 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
308 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
309 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
310 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
311 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
312 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
313 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
314 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
315 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
316 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
317 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
318 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
319 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
320 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
321 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
322 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
323 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
324 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
325 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
326 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
327 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
328 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
329 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
330 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
331 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
332 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
333 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
334 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
335 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
336 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
337 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
338 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
339 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
340 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
341 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
342 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
343 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
344 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
345 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
346 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
347 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
348 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
349 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
350 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
351 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
352 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
353 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
354 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
355 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
356 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
357 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
358 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
359 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
360 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
361 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
362 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
363 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
364 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
365 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
366 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
367 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
368 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
370 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
371 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
372 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
373 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
374 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
375 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
376 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
377 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
378 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
379 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
380 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
381 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
382 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
383 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
384 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
385 2519103095 Burkholderia sp. KJ006 Isolate Nodule
386 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
387 2547132374 Acidovorax radicis N35 Isolate Unclassified
388 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
389 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
390 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
391 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
392 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
393 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
394 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
395 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
396 2643221609 Acidovorax sp. Root217 Isolate Unclassified
397 2643221611 Acidovorax sp. Root219 Isolate Unclassified
398 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
399 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
400 2643221652 Acidovorax sp. Root402 Isolate Unclassified
401 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
402 2643221717 Acidovorax sp. Root267 Isolate Unclassified
403 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
404 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
405 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
406 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
407 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
408 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
409 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
410 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
411 2738543012 Acidovorax sp. CF301 Isolate Unclassified
412 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
413 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
414 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
415 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
416 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
417 2816332133 Acidovorax radicis 2721A Isolate Unclassified
418 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
419 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
420 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
421 2818991450 Burkholderia sp. 604 Isolate Unclassified
422 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
423 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
424 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
425 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
426 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
427 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
428 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
429 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
430 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
431 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
432 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
433 2904564687 Burkholderia sp. 571 Isolate Unclassified
434 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
435 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
436 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
437 2928058823 Ralstonia sp. 1138 Isolate Unclassified
438 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
439 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
440 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
441 2928163908 Burkholderia sp. 567 Isolate Unclassified
442 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
443 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
444 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
445 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
446 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
447 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
448 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
449 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
450 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
451 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
452 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
453 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
454 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
455 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
456 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
457 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
458 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
459 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.78
Metatranscriptomes 0.1
Isolates 9.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.58
Nodule 2.03
Rhizoplane 3.04
Rhizosphere 71.53
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496100_0002521 3300048903 Bacteria 9327
2 JGI24740J21852_10010623 3300001979 Bacteria 3536
3 JGI24739J22299_10002720 3300001989 Bacteria 6808
4 JGI24739J22299_10007403 3300001989 Bacteria 4120
5 JGI24739J22299_10021569 3300001989 Bacteria 2292
6 JGI24739J22299_10027893 3300001989 Bacteria 1971
7 JGI24737J22298_10007144 3300001990 Bacteria 3781
8 JGI24737J22298_10016803 3300001990 Bacteria 2362
9 JGI24737J22298_10025811 3300001990 Bacteria 1856
10 JGI24735J21928_10003917 3300002067 Bacteria 5036
11 JGI24735J21928_10008742 3300002067 Bacteria 3267
12 JGI24735J21928_10026090 3300002067 Bacteria 1759
13 JGI24738J21930_10002518 3300002075 Bacteria 4760
14 JGI25156J39149_1000991 3300002705 Bacteria 13402
15 JGI25156J39149_1001392 3300002705 Bacteria 10339
16 JGI25156J39149_1002249 3300002705 Bacteria 7115
17 JGI25152J39213_1000678 3300002773 Bacteria 17738
18 JGI25150J39212_1011409 3300002774 Bacteria 1612
19 JGI25165J46597_1001300 3300003214 Bacteria 14378
20 JGI25153J46596_10003272 3300003215 Bacteria 9104
21 JGI25153J46596_10004915 3300003215 Bacteria 7104
22 rootH1_10016096 3300003316 Bacteria 4360
23 rootL2_10147844 3300003322 Bacteria 7475
24 rootL2_10196141 3300003322 Bacteria 1491
25 JGI25160J50197_1000016 3300003354 Bacteria 247819
26 Ga0055533_1000587 3300003756 Bacteria 12692
27 Ga0055533_1000634 3300003756 Bacteria 11865
28 Ga0055532_1000022 3300003758 Bacteria 248737
29 Ga0055527_1000016 3300003760 Bacteria 248736
30 Ga0055527_1002497 3300003760 Bacteria 3097
31 Ga0055527_1003486 3300003760 Bacteria 2323
32 Ga0055535_1000017 3300003761 Bacteria 248735
33 Ga0055535_1004554 3300003761 Bacteria 3330
34 Ga0055542_1000030 3300003762 Bacteria 248717
35 Ga0055529_1000033 3300003763 Bacteria 248734
36 Ga0055526_1001068 3300003771 Bacteria 20012
37 Ga0055534_1002118 3300003784 Bacteria 7126
38 Ga0065165_1000154 3300005262 Bacteria 119863
39 Ga0065165_1001461 3300005262 Bacteria 25504
40 Ga0065704_10204710 3300005289 Bacteria 1132
41 Ga0065712_10075384 3300005290 Bacteria 3874
42 Ga0065715_10147267 3300005293 Bacteria 1773
43 Ga0070676_10008679 3300005328 Bacteria 5483
44 Ga0070676_10023341 3300005328 Bacteria 3476
45 Ga0070676_10077477 3300005328 Bacteria 2009
46 Ga0070690_100006989 3300005330 Bacteria 6431
47 Ga0070670_100020778 3300005331 Bacteria 5645
48 Ga0070670_100031757 3300005331 Bacteria 4548
49 Ga0070670_100216823 3300005331 Bacteria 1665
50 Ga0070670_100219025 3300005331 Bacteria 1656
51 Ga0070670_100678085 3300005331 Bacteria 926
52 Ga0070677_10012605 3300005333 Bacteria 2938
53 Ga0070677_10015197 3300005333 Bacteria 2725
54 Ga0068869_100015120 3300005334 Bacteria 5168
55 Ga0068869_100060583 3300005334 Bacteria 2774
56 Ga0068869_100195292 3300005334 Bacteria 1593
57 Ga0070666_10019273 3300005335 Bacteria 4401
58 Ga0070666_10088721 3300005335 Bacteria 2122
59 Ga0070666_10120561 3300005335 Bacteria 1819
60 Ga0070666_10293668 3300005335 Bacteria 1157
61 Ga0068868_100074157 3300005338 Bacteria 2717
62 Ga0068868_100079979 3300005338 Bacteria 2619
63 Ga0068868_100091480 3300005338 Bacteria 2451
64 Ga0068868_100223330 3300005338 Bacteria 1578
65 Ga0070660_100000195 3300005339 Bacteria 40432
66 Ga0070660_100064616 3300005339 Bacteria 2847
67 Ga0070661_100026811 3300005344 Bacteria 4146
68 Ga0070661_100035221 3300005344 Bacteria 3634
69 Ga0070668_100010839 3300005347 Bacteria 6783
70 Ga0070668_100036923 3300005347 Bacteria 3729
71 Ga0070668_100146242 3300005347 Bacteria 1908
72 Ga0070669_100004137 3300005353 Bacteria 10530
73 Ga0070669_100005511 3300005353 Bacteria 9134
74 Ga0070669_100117534 3300005353 Bacteria 2024
75 Ga0070669_100258762 3300005353 Bacteria 1388
76 Ga0070669_100320374 3300005353 Bacteria 1251
77 Ga0070675_100000167 3300005354 Bacteria 40503
78 Ga0070675_100010946 3300005354 Bacteria 7098
79 Ga0070675_100018370 3300005354 Bacteria 5564
80 Ga0070675_100024458 3300005354 Bacteria 4836
81 Ga0070675_100043857 3300005354 Bacteria 3657
82 Ga0070675_100129110 3300005354 Bacteria 2152
83 Ga0070675_100140478 3300005354 Bacteria 2064
84 Ga0070671_100002233 3300005355 Bacteria 14954
85 Ga0070671_100021098 3300005355 Bacteria 5319
86 Ga0070674_100006012 3300005356 Bacteria 7055
87 Ga0070674_100038427 3300005356 Bacteria 3226
88 Ga0070673_100002005 3300005364 Bacteria 12290
89 Ga0070673_100044160 3300005364 Bacteria 3449
90 Ga0070673_100116421 3300005364 Bacteria 2223
91 Ga0070673_100437645 3300005364 Bacteria 1174
92 Ga0070688_100088898 3300005365 Bacteria 2015
93 Ga0070688_100182427 3300005365 Bacteria 1457
94 Ga0070659_100000271 3300005366 Bacteria 40568
95 Ga0070659_100028974 3300005366 Bacteria 4277
96 Ga0070659_100031557 3300005366 Bacteria 4104
97 Ga0070659_100479540 3300005366 Bacteria 1058
98 Ga0070667_100007013 3300005367 Bacteria 9366
99 Ga0070667_100013861 3300005367 Bacteria 6663
100 Ga0070667_100020907 3300005367 Bacteria 5437
101 Ga0070667_100070105 3300005367 Bacteria 2984
102 Ga0070667_100154315 3300005367 Bacteria 2019
103 Ga0070667_100322741 3300005367 Bacteria 1393
104 Ga0070701_10059666 3300005438 Bacteria 2007
105 Ga0070700_100224414 3300005441 Bacteria 1333
106 Ga0070663_100001056 3300005455 Bacteria 15081
107 Ga0070663_100134639 3300005455 Bacteria 1880
108 Ga0070663_100181569 3300005455 Bacteria 1633
109 Ga0070678_100002556 3300005456 Bacteria 9992
110 Ga0070678_100021058 3300005456 Bacteria 4291
111 Ga0070662_100016396 3300005457 Bacteria 4974
112 Ga0070662_100148143 3300005457 Bacteria 1825
113 Ga0068867_100000021 3300005459 Bacteria 92798
114 Ga0068867_100006166 3300005459 Bacteria 8487
115 Ga0068867_100020540 3300005459 Bacteria 4706
116 Ga0068867_100031508 3300005459 Bacteria 3829
117 Ga0068867_100071873 3300005459 Bacteria 2589
118 Ga0068867_100135086 3300005459 Bacteria 1922
119 Ga0068867_100177000 3300005459 Bacteria 1693
120 Ga0068867_100189163 3300005459 Bacteria 1642
121 Ga0070685_10032211 3300005466 Bacteria 2935
122 Ga0070706_100001239 3300005467 Bacteria 27289
123 Ga0070707_100090242 3300005468 Bacteria 2966
124 Ga0068853_100124541 3300005539 Bacteria 2302
125 Ga0068853_100147183 3300005539 Bacteria 2117
126 Ga0068853_100152475 3300005539 Bacteria 2081
127 Ga0068853_100260016 3300005539 Bacteria 1595
128 Ga0068853_100707905 3300005539 Bacteria 961
129 Ga0070672_100000544 3300005543 Bacteria 22141
130 Ga0070672_100008374 3300005543 Bacteria 7068
131 Ga0070672_100008511 3300005543 Bacteria 7024
132 Ga0070672_100033996 3300005543 Bacteria 3865
133 Ga0070672_100169035 3300005543 Bacteria 1817
134 Ga0070672_100224494 3300005543 Bacteria 1576
135 Ga0070693_100034611 3300005547 Bacteria 2795
136 Ga0070665_100083986 3300005548 Bacteria 3189
137 Ga0068855_100120311 3300005563 Bacteria 3005
138 Ga0068855_100420232 3300005563 Bacteria 1462
139 Ga0070664_100070688 3300005564 Bacteria 2989
140 Ga0070664_100211452 3300005564 Bacteria 1733
141 Ga0070664_100323041 3300005564 Bacteria 1399
142 Ga0068857_100055452 3300005577 Bacteria 3518
143 Ga0068857_100126896 3300005577 Bacteria 2299
144 Ga0068856_100030945 3300005614 Bacteria 5234
145 Ga0068856_100110976 3300005614 Bacteria 2739
146 Ga0068856_100214645 3300005614 Bacteria 1939
147 Ga0068852_100002004 3300005616 Bacteria 13890
148 Ga0068852_100019888 3300005616 Bacteria 5326
149 Ga0068852_100026230 3300005616 Bacteria 4733
150 Ga0068852_100063804 3300005616 Bacteria 3208
151 Ga0068852_100098919 3300005616 Bacteria 2628
152 Ga0068852_100206481 3300005616 Bacteria 1861
153 Ga0068859_100037861 3300005617 Bacteria 4841
154 Ga0068859_100052151 3300005617 Bacteria 4112
155 Ga0068859_100181967 3300005617 Bacteria 2185
156 Ga0068864_100001568 3300005618 Bacteria 18819
157 Ga0068864_100001586 3300005618 Bacteria 18721
158 Ga0068864_100099792 3300005618 Bacteria 2573
159 Ga0068864_100107264 3300005618 Bacteria 2484
160 Ga0068864_100170649 3300005618 Bacteria 1983
161 Ga0068864_100233300 3300005618 Bacteria 1702
162 Ga0068864_100408943 3300005618 Bacteria 1291
163 Ga0068864_100520148 3300005618 Bacteria 1147
164 Ga0068866_10028879 3300005718 Bacteria 2646
165 Ga0068866_10032952 3300005718 Bacteria 2508
166 Ga0068861_100002195 3300005719 Bacteria 12667
167 Ga0068861_100003200 3300005719 Bacteria 10833
168 Ga0068861_100022248 3300005719 Bacteria 4565
169 Ga0068851_10015256 3300005834 Bacteria 3658
170 Ga0068870_10021558 3300005840 Bacteria 3154
171 Ga0068863_100014146 3300005841 Bacteria 7688
172 Ga0068863_100037402 3300005841 Bacteria 4621
173 Ga0068863_100067500 3300005841 Bacteria 3383
174 Ga0068863_100144847 3300005841 Bacteria 2272
175 Ga0068863_100231961 3300005841 Bacteria 1780
176 Ga0068863_100362334 3300005841 Bacteria 1413
177 Ga0068858_100010259 3300005842 Bacteria 8885
178 Ga0068858_100010997 3300005842 Bacteria 8553
179 Ga0068858_100034019 3300005842 Bacteria 4727
180 Ga0068858_100134534 3300005842 Bacteria 2319
181 Ga0068858_100479892 3300005842 Bacteria 1200
182 Ga0068860_100004773 3300005843 Bacteria 13814
183 Ga0068860_100013190 3300005843 Bacteria 8109
184 Ga0068860_100014652 3300005843 Bacteria 7673
185 Ga0068860_100110562 3300005843 Bacteria 2627
186 Ga0068860_100778495 3300005843 Bacteria 969
187 Ga0068862_100105764 3300005844 Bacteria 2466
188 Ga0068862_100113282 3300005844 Bacteria 2383
189 Ga0075365_10134964 3300006038 Bacteria 1710
190 Ga0075365_10227929 3300006038 Bacteria 1307
191 Ga0075368_10001721 3300006042 Bacteria 7043
192 Ga0075368_10031566 3300006042 Bacteria 2054
193 Ga0075363_100025485 3300006048 Bacteria 3017
194 Ga0075363_100132991 3300006048 Bacteria 1396
195 Ga0075363_100171506 3300006048 Bacteria 1232
196 Ga0075364_10020354 3300006051 Bacteria 4173
197 Ga0075364_10024222 3300006051 Bacteria 3851
198 Ga0075362_10020417 3300006177 Bacteria 2767
199 Ga0075362_10099771 3300006177 Bacteria 1356
200 Ga0075367_10027013 3300006178 Bacteria 3261
201 Ga0075367_10046742 3300006178 Bacteria 2544
202 Ga0075367_10213926 3300006178 Bacteria 1205
203 Ga0075369_10009477 3300006186 Bacteria 3784
204 Ga0075369_10023185 3300006186 Bacteria 2564
205 Ga0075369_10077233 3300006186 Bacteria 1473
206 Ga0075366_10006187 3300006195 Bacteria 6532
207 Ga0075366_10014161 3300006195 Bacteria 4552
208 Ga0075366_10015488 3300006195 Bacteria 4371
209 Ga0075366_10017365 3300006195 Bacteria 4142
210 Ga0075366_10021478 3300006195 Bacteria 3752
211 Ga0075366_10046110 3300006195 Bacteria 2583
212 Ga0075366_10063417 3300006195 Bacteria 2196
213 Ga0075366_10075447 3300006195 Bacteria 2011
214 Ga0075366_10127889 3300006195 Bacteria 1533
215 Ga0075366_10157302 3300006195 Bacteria 1377
216 Ga0097621_100048794 3300006237 Bacteria 3437
217 Ga0097621_100050894 3300006237 Bacteria 3369
218 Ga0097621_100138090 3300006237 Bacteria 2081
219 Ga0097621_100174511 3300006237 Bacteria 1855
220 Ga0097621_100358307 3300006237 Bacteria 1299
221 Ga0075370_10002155 3300006353 Bacteria 9010
222 Ga0075370_10002284 3300006353 Bacteria 8842
223 Ga0075370_10007713 3300006353 Bacteria 5497
224 Ga0075370_10016859 3300006353 Bacteria 3938
225 Ga0075370_10020704 3300006353 Bacteria 3598
226 Ga0075370_10031684 3300006353 Bacteria 2952
227 Ga0075370_10073610 3300006353 Bacteria 1957
228 Ga0068871_100026952 3300006358 Bacteria 4490
229 Ga0068871_100031602 3300006358 Bacteria 4176
230 Ga0068871_100112507 3300006358 Bacteria 2291
231 Ga0068871_100146267 3300006358 Bacteria 2012
232 Ga0068871_100474505 3300006358 Bacteria 1124
233 Ga0068865_100008752 3300006881 Bacteria 6260
234 Ga0068865_100031334 3300006881 Bacteria 3545
235 Ga0068865_100069568 3300006881 Bacteria 2491
236 Ga0068865_100088425 3300006881 Bacteria 2241
237 Ga0097620_100037861 3300006931 Bacteria 4841
238 Ga0097620_100052149 3300006931 Bacteria 4112
239 Ga0097620_100181975 3300006931 Bacteria 2185
240 Ga0079104_1000008 3300006946 Bacteria 371223
241 Ga0105251_10000590 3300009011 Bacteria 33310
242 Ga0105251_10091828 3300009011 Bacteria 1394
243 Ga0105250_10003787 3300009092 Bacteria 7099
244 Ga0105240_10017111 3300009093 Bacteria 9788
245 Ga0105240_10050744 3300009093 Bacteria 5228
246 Ga0105240_10127118 3300009093 Bacteria 3062
247 Ga0105240_10345514 3300009093 Bacteria 1689
248 Ga0105240_10360398 3300009093 Bacteria 1647
249 Ga0105245_10049860 3300009098 Bacteria 3750
250 Ga0105245_10131108 3300009098 Bacteria 2351
251 Ga0105243_10001746 3300009148 Bacteria 18728
252 Ga0105243_10105875 3300009148 Bacteria 2343
253 Ga0105243_10192471 3300009148 Bacteria 1782
254 Ga0105243_10272029 3300009148 Bacteria 1522
255 Ga0105242_10486641 3300009176 Bacteria 1170
256 Ga0105248_10072337 3300009177 Bacteria 3875
257 Ga0105248_10109824 3300009177 Bacteria 3109
258 Ga0105248_10164016 3300009177 Bacteria 2506
259 Ga0105248_10168560 3300009177 Bacteria 2468
260 Ga0105248_10269229 3300009177 Bacteria 1918
261 Ga0105248_10524514 3300009177 Bacteria 1336
262 Ga0105237_10090293 3300009545 Bacteria 3053
263 Ga0105237_10101122 3300009545 Bacteria 2874
264 Ga0105237_10122004 3300009545 Bacteria 2600
265 Ga0105237_10202484 3300009545 Bacteria 1985
266 Ga0105237_10451770 3300009545 Bacteria 1291
267 Ga0105238_10027400 3300009551 Bacteria 5806
268 Ga0105238_10037142 3300009551 Bacteria 4953
269 Ga0105249_10006010 3300009553 Bacteria 10519
270 Ga0105249_10012921 3300009553 Bacteria 7366
271 Ga0105249_10300723 3300009553 Bacteria 1609
272 Ga0105249_10479966 3300009553 Bacteria 1286
273 Ga0105239_10099026 3300010375 Bacteria 3223
274 Ga0105239_10510449 3300010375 Bacteria 1367
275 Ga0157369_10039631 3300013105 Bacteria 5148
276 Ga0157369_10070807 3300013105 Bacteria 3746
277 Ga0157374_10233698 3300013296 Bacteria 1806
278 Ga0157374_10266234 3300013296 Bacteria 1689
279 Ga0157374_10337976 3300013296 Bacteria 1494
280 Ga0163162_10042288 3300013306 Bacteria 4560
281 Ga0163162_10046856 3300013306 Bacteria 4334
282 Ga0163162_10050348 3300013306 Bacteria 4177
283 Ga0163162_10178830 3300013306 Bacteria 2247
284 Ga0163162_10445212 3300013306 Bacteria 1427
285 Ga0157372_10140624 3300013307 Bacteria 2780
286 Ga0157375_10012697 3300013308 Bacteria 7478
287 Ga0157375_10034676 3300013308 Bacteria 4809
288 Ga0157375_10221708 3300013308 Bacteria 2049
289 Ga0157375_10346167 3300013308 Bacteria 1652
290 Ga0163163_10033008 3300014325 Bacteria 5004
291 Ga0157380_10040937 3300014326 Bacteria 3613
292 Ga0157380_10400951 3300014326 Bacteria 1301
293 Ga0157377_10000021 3300014745 Bacteria 147105
294 Ga0157377_10015967 3300014745 Bacteria 3852
295 Ga0157379_10053896 3300014968 Bacteria 3593
296 Ga0157379_10060478 3300014968 Bacteria 3386
297 Ga0157379_10142787 3300014968 Bacteria 2158
298 Ga0157379_10250230 3300014968 Bacteria 1609
299 Ga0157376_10070644 3300014969 Bacteria 2964
300 Ga0157376_10179701 3300014969 Bacteria 1933
301 Ga0182007_10000169 3300015262 Bacteria 44843
302 Ga0183361_10001 3300016635 Bacteria 908583
303 Ga0163161_10034999 3300017792 Bacteria 3593
304 Ga0163161_10036801 3300017792 Bacteria 3506
305 Ga0163161_10057946 3300017792 Bacteria 2815
306 Ga0163161_10091381 3300017792 Bacteria 2253
307 Ga0163161_10097146 3300017792 Bacteria 2188
308 Ga0209674_100017 3300025226 Bacteria 689087
309 Ga0209674_100324 3300025226 Bacteria 30278
310 Ga0209672_100001 3300025228 Bacteria 2828210
311 Ga0209672_100041 3300025228 Bacteria 278535
312 Ga0209672_103713 3300025228 Bacteria 3053
313 Ga0209147_100022 3300025229 Bacteria 443906
314 Ga0209147_100337 3300025229 Bacteria 34955
315 Ga0209147_100649 3300025229 Bacteria 18138
316 Ga0209563_100596 3300025230 Bacteria 11859
317 Ga0209563_107554 3300025230 Bacteria 1775
318 Ga0207427_101122 3300025231 Bacteria 10700
319 Ga0209258_100033 3300025242 Bacteria 443845
320 Ga0209258_100309 3300025242 Bacteria 76791
321 Ga0207425_1000195 3300025245 Bacteria 48597
322 Ga0209148_1000046 3300025254 Bacteria 443881
323 Ga0209148_1002429 3300025254 Bacteria 6428
324 Ga0209759_1000092 3300025256 Bacteria 161238
325 Ga0209759_1000184 3300025256 Bacteria 100691
326 Ga0209759_1001030 3300025256 Bacteria 18717
327 Ga0209129_1000043 3300025258 Bacteria 298978
328 Ga0209129_1008010 3300025258 Bacteria 3012
329 Ga0209233_1000050 3300025261 Bacteria 450736
330 Ga0209455_1000038 3300025272 Bacteria 443899
331 Ga0209130_1003268 3300025284 Bacteria 7076
332 Ga0209675_1001354 3300025291 Bacteria 14457
333 Ga0209676_1015349 3300025292 Bacteria 2822
334 Ga0209564_1000014 3300025295 Bacteria 621501
335 Ga0209564_1004662 3300025295 Bacteria 8233
336 Ga0209758_1000045 3300025297 Bacteria 369174
337 Ga0209758_1000093 3300025297 Bacteria 241169
338 Ga0209050_1000179 3300025298 Bacteria 143878
339 Ga0207426_1000007 3300025302 Bacteria 971011
340 Ga0209051_1004773 3300025303 Bacteria 8180
341 Ga0209051_1028007 3300025303 Bacteria 2234
342 Ga0209257_1008045 3300025304 Bacteria 6139
343 Ga0209257_1037250 3300025304 Bacteria 1484
344 Ga0207697_10038786 3300025315 Bacteria 1954
345 Ga0207656_10032317 3300025321 Bacteria 2173
346 Ga0207696_1004123 3300025711 Bacteria 6355
347 Ga0207696_1007974 3300025711 Bacteria 4094
348 Ga0207713_1000137 3300025735 Bacteria 111281
349 Ga0207682_10001694 3300025893 Bacteria 10093
350 Ga0207682_10007864 3300025893 Bacteria 4236
351 Ga0207682_10010588 3300025893 Bacteria 3610
352 Ga0207682_10049059 3300025893 Bacteria 1742
353 Ga0207642_10017603 3300025899 Bacteria 2722
354 Ga0207688_10033295 3300025901 Bacteria 2850
355 Ga0207688_10194248 3300025901 Bacteria 1215
356 Ga0207680_10003579 3300025903 Bacteria 7300
357 Ga0207680_10016311 3300025903 Bacteria 3897
358 Ga0207680_10271975 3300025903 Bacteria 1175
359 Ga0207647_10006921 3300025904 Bacteria 8220
360 Ga0207647_10012090 3300025904 Bacteria 6025
361 Ga0207647_10019129 3300025904 Bacteria 4611
362 Ga0207645_10009352 3300025907 Bacteria 6785
363 Ga0207645_10036363 3300025907 Bacteria 3162
364 Ga0207645_10080334 3300025907 Bacteria 2090
365 Ga0207643_10075134 3300025908 Bacteria 1950
366 Ga0207705_10043309 3300025909 Bacteria 3234
367 Ga0207684_10008277 3300025910 Bacteria 9258
368 Ga0207695_10014314 3300025913 Bacteria 9406
369 Ga0207695_10017431 3300025913 Bacteria 8359
370 Ga0207695_10045352 3300025913 Bacteria 4667
371 Ga0207671_10006439 3300025914 Bacteria 10453
372 Ga0207671_10032972 3300025914 Bacteria 3855
373 Ga0207671_10287653 3300025914 Bacteria 1297
374 Ga0207662_10045110 3300025918 Bacteria 2605
375 Ga0207657_10000044 3300025919 Bacteria 116398
376 Ga0207649_10022538 3300025920 Bacteria 3639
377 Ga0207646_10063618 3300025922 Bacteria 3294
378 Ga0207681_10001232 3300025923 Bacteria 16486
379 Ga0207681_10009831 3300025923 Bacteria 5850
380 Ga0207681_10125031 3300025923 Bacteria 1892
381 Ga0207694_10004421 3300025924 Bacteria 10990
382 Ga0207650_10001921 3300025925 Bacteria 14641
383 Ga0207650_10013206 3300025925 Bacteria 5715
384 Ga0207650_10136246 3300025925 Bacteria 1926
385 Ga0207650_10159844 3300025925 Bacteria 1784
386 Ga0207650_10347055 3300025925 Bacteria 1220
387 Ga0207659_10001177 3300025926 Bacteria 15618
388 Ga0207659_10006801 3300025926 Bacteria 7030
389 Ga0207659_10011942 3300025926 Bacteria 5502
390 Ga0207659_10021070 3300025926 Bacteria 4320
391 Ga0207659_10024965 3300025926 Bacteria 4012
392 Ga0207659_10049968 3300025926 Bacteria 2969
393 Ga0207659_10149963 3300025926 Bacteria 1820
394 Ga0207687_10057000 3300025927 Bacteria 2743
395 Ga0207687_10092606 3300025927 Bacteria 2207
396 Ga0207644_10002024 3300025931 Bacteria 13104
397 Ga0207644_10002325 3300025931 Bacteria 12293
398 Ga0207644_10030839 3300025931 Bacteria 3732
399 Ga0207644_10039496 3300025931 Bacteria 3331
400 Ga0207644_10085743 3300025931 Bacteria 2337
401 Ga0207690_10000046 3300025932 Bacteria 116358
402 Ga0207690_10111694 3300025932 Bacteria 1970
403 Ga0207706_10023708 3300025933 Bacteria 5507
404 Ga0207706_10083831 3300025933 Bacteria 2802
405 Ga0207706_10318923 3300025933 Bacteria 1353
406 Ga0207686_10001251 3300025934 Bacteria 14694
407 Ga0207709_10000070 3300025935 Bacteria 183020
408 Ga0207709_10000927 3300025935 Bacteria 22075
409 Ga0207709_10027363 3300025935 Bacteria 3284
410 Ga0207709_10111752 3300025935 Bacteria 1828
411 Ga0207669_10006914 3300025937 Bacteria 5218
412 Ga0207669_10054587 3300025937 Bacteria 2414
413 Ga0207669_10087570 3300025937 Bacteria 2017
414 Ga0207704_10002634 3300025938 Bacteria 8100
415 Ga0207704_10006601 3300025938 Bacteria 5428
416 Ga0207704_10105642 3300025938 Bacteria 1889
417 Ga0207704_10138806 3300025938 Bacteria 1697
418 Ga0207691_10016058 3300025940 Bacteria 7112
419 Ga0207691_10022141 3300025940 Bacteria 5996
420 Ga0207691_10031519 3300025940 Bacteria 4947
421 Ga0207691_10067728 3300025940 Bacteria 3227
422 Ga0207691_10123981 3300025940 Bacteria 2287
423 Ga0207691_10261956 3300025940 Bacteria 1490
424 Ga0207691_10433162 3300025940 Bacteria 1120
425 Ga0207711_10014582 3300025941 Bacteria 6531
426 Ga0207711_10018363 3300025941 Bacteria 5813
427 Ga0207711_10036332 3300025941 Bacteria 4180
428 Ga0207689_10007049 3300025942 Bacteria 9881
429 Ga0207689_10025384 3300025942 Bacteria 4965
430 Ga0207689_10078217 3300025942 Bacteria 2718
431 Ga0207689_10081490 3300025942 Bacteria 2660
432 Ga0207661_10259861 3300025944 Bacteria 1546
433 Ga0207679_10177924 3300025945 Bacteria 1757
434 Ga0207679_10243849 3300025945 Bacteria 1524
435 Ga0207667_10014884 3300025949 Bacteria 8846
436 Ga0207651_10001929 3300025960 Bacteria 9737
437 Ga0207651_10006366 3300025960 Bacteria 6172
438 Ga0207651_10094819 3300025960 Bacteria 2196
439 Ga0207651_10134956 3300025960 Bacteria 1896
440 Ga0207712_10005762 3300025961 Bacteria 7808
441 Ga0207712_10098221 3300025961 Bacteria 2171
442 Ga0207712_10433300 3300025961 Bacteria 1112
443 Ga0207668_10087254 3300025972 Bacteria 2281
444 Ga0207668_10541297 3300025972 Bacteria 1007
445 Ga0207658_10000904 3300025986 Bacteria 24667
446 Ga0207658_10015874 3300025986 Bacteria 5171
447 Ga0207658_10023294 3300025986 Bacteria 4321
448 Ga0207658_10050286 3300025986 Bacteria 3067
449 Ga0207677_10004432 3300026023 Bacteria 7537
450 Ga0207677_10200968 3300026023 Bacteria 1584
451 Ga0207677_10284310 3300026023 Bacteria 1359
452 Ga0207703_10001363 3300026035 Bacteria 22299
453 Ga0207703_10002141 3300026035 Bacteria 17356
454 Ga0207703_10006196 3300026035 Bacteria 9571
455 Ga0207703_10348070 3300026035 Bacteria 1364
456 Ga0207639_10052511 3300026041 Bacteria 3106
457 Ga0207639_10087522 3300026041 Bacteria 2483
458 Ga0207639_10236436 3300026041 Bacteria 1586
459 Ga0207639_10393960 3300026041 Bacteria 1246
460 Ga0207678_10000397 3300026067 Bacteria 39814
461 Ga0207678_10085322 3300026067 Bacteria 2700
462 Ga0207678_10124479 3300026067 Bacteria 2200
463 Ga0207708_10016069 3300026075 Bacteria 5621
464 Ga0207708_10023525 3300026075 Bacteria 4659
465 Ga0207708_10260305 3300026075 Bacteria 1400
466 Ga0207702_10035517 3300026078 Bacteria 4168
467 Ga0207702_10148402 3300026078 Bacteria 2131
468 Ga0207641_10012827 3300026088 Bacteria 6871
469 Ga0207641_10017565 3300026088 Bacteria 5857
470 Ga0207641_10024475 3300026088 Bacteria 4976
471 Ga0207641_10052054 3300026088 Bacteria 3467
472 Ga0207641_10069098 3300026088 Bacteria 3031
473 Ga0207641_10069896 3300026088 Bacteria 3016
474 Ga0207641_10219996 3300026088 Bacteria 1760
475 Ga0207648_10000776 3300026089 Bacteria 35970
476 Ga0207648_10001858 3300026089 Bacteria 23063
477 Ga0207648_10005756 3300026089 Bacteria 12420
478 Ga0207648_10014208 3300026089 Bacteria 7364
479 Ga0207648_10031752 3300026089 Bacteria 4667
480 Ga0207648_10042815 3300026089 Bacteria 3976
481 Ga0207648_10067429 3300026089 Bacteria 3119
482 Ga0207648_10069535 3300026089 Bacteria 3067
483 Ga0207648_10112073 3300026089 Bacteria 2395
484 Ga0207648_10197560 3300026089 Bacteria 1784
485 Ga0207676_10008217 3300026095 Bacteria 7428
486 Ga0207676_10015110 3300026095 Bacteria 5567
487 Ga0207676_10016149 3300026095 Bacteria 5402
488 Ga0207676_10031088 3300026095 Bacteria 4013
489 Ga0207676_10042314 3300026095 Bacteria 3503
490 Ga0207676_10132079 3300026095 Bacteria 2124
491 Ga0207676_10190773 3300026095 Bacteria 1803
492 Ga0207676_10311016 3300026095 Bacteria 1442
493 Ga0207674_10095218 3300026116 Bacteria 2964
494 Ga0207675_100001673 3300026118 Bacteria 22193
495 Ga0207675_100001979 3300026118 Bacteria 20426
496 Ga0207675_100014813 3300026118 Bacteria 7277
497 Ga0207675_100024619 3300026118 Bacteria 5597
498 Ga0207675_100329984 3300026118 Bacteria 1491
499 Ga0207683_10013438 3300026121 Bacteria 6985
500 Ga0207683_10077142 3300026121 Bacteria 2951
501 Ga0207683_10099201 3300026121 Bacteria 2599
502 Ga0207698_10002517 3300026142 Bacteria 10872
503 Ga0207698_10015201 3300026142 Bacteria 5149
504 Ga0207698_10034213 3300026142 Bacteria 3702
505 Ga0207698_10064331 3300026142 Bacteria 2874
506 Ga0207698_10075826 3300026142 Bacteria 2689
507 Ga0207698_10084291 3300026142 Bacteria 2576
508 Ga0207698_10343514 3300026142 Bacteria 1407
509 Ga0209281_1000029 3300027111 Bacteria 431495
510 Ga0209371_1007636 3300027312 Bacteria 3731
511 Ga0209813_10019682 3300027866 Bacteria 1879
512 Ga0268266_10401825 3300028379 Bacteria 1295
513 Ga0268265_10481693 3300028380 Bacteria 1165
514 Ga0268264_10005843 3300028381 Bacteria 10425
515 Ga0268264_10012862 3300028381 Bacteria 6884
516 Ga0268264_10015703 3300028381 Bacteria 6202
517 Ga0268264_10584062 3300028381 Bacteria 1099
518 Ga0307517_10003186 3300028786 Bacteria 25769
519 Ga0307515_10070107 3300028794 Bacteria 4777
520 Ga0307515_10143238 3300028794 Bacteria 2549
521 Ga0307515_10171943 3300028794 Bacteria 2155
522 Ga0265338_10000087 3300028800 Bacteria 174926
523 Ga0265338_10001953 3300028800 Bacteria 32164
524 Ga0268256_1005918 3300030500 Bacteria 4677
525 Ga0307512_10013762 3300030522 Bacteria 7566
526 Ga0307513_10043962 3300031456 Bacteria 4899
527 Ga0307513_10071654 3300031456 Bacteria 3615
528 Ga0307513_10107184 3300031456 Bacteria 2798
529 Ga0307509_10186609 3300031507 Bacteria 1931
530 Ga0307408_100000133 3300031548 Bacteria 82744
531 Ga0307408_100001327 3300031548 Bacteria 18551
532 Ga0307508_10004667 3300031616 Bacteria 13294
533 Ga0307514_10001425 3300031649 Bacteria 29406
534 Ga0307514_10074222 3300031649 Bacteria 2540
535 Ga0307514_10103211 3300031649 Bacteria 2042
536 Ga0307516_10003676 3300031730 Bacteria 19502
537 Ga0307516_10033347 3300031730 Bacteria 5181
538 Ga0307516_10120823 3300031730 Bacteria 2410
539 Ga0307405_10005542 3300031731 Bacteria 6100
540 Ga0307405_10197724 3300031731 Bacteria 1457
541 Ga0307413_10178410 3300031824 Bacteria 1511
542 Ga0307413_10268250 3300031824 Bacteria 1276
543 Ga0307410_10019091 3300031852 Bacteria 4162
544 Ga0307406_10002490 3300031901 Bacteria 10042
545 Ga0307406_10051459 3300031901 Bacteria 2615
546 Ga0307406_10127565 3300031901 Bacteria 1780
547 Ga0307412_10000011 3300031911 Bacteria 405842
548 Ga0307412_10015249 3300031911 Bacteria 4550
549 Ga0307409_100217192 3300031995 Bacteria 1723
550 Ga0307416_100001839 3300032002 Bacteria 11830
551 Ga0307416_100051118 3300032002 Bacteria 3299
552 Ga0307416_100134298 3300032002 Bacteria 2235
553 Ga0307414_10241580 3300032004 Bacteria 1495
554 Ga0307411_10001139 3300032005 Bacteria 10411
555 Ga0307411_10227192 3300032005 Bacteria 1452
556 Ga0307510_10003680 3300033180 Bacteria 17902
557 Ga0373928_0034957 3300035084 Bacteria 1130
558 Ga0373932_0048393 3300035112 Bacteria 1253
559 Ga0373957_0100557 3300035120 Bacteria 1157
560 Ga0373955_0169842 3300035172 Bacteria 1290
561 Ga0373931_0078453 3300035691 Bacteria 1817
562 Ga0373931_0091382 3300035691 Bacteria 1696
563 Ga0373927_0197037 3300035695 Bacteria 1322
564 Ga0373937_0012935 3300036401 Bacteria 7351
565 Ga0373937_0241402 3300036401 Bacteria 1702
566 Ga0373937_0414808 3300036401 Bacteria 1278
567 Ga0373925_0112048 3300037068 Bacteria 2109
568 Ga0395899_0000421 3300037312 Bacteria 49097
569 Ga0395899_0019968 3300037312 Bacteria 5083
570 Ga0395899_0024082 3300037312 Bacteria 4605
571 Ga0395900_0000159 3300037418 Bacteria 111486
572 Ga0395900_0019146 3300037418 Bacteria 6981
573 Ga0395900_0050398 3300037418 Bacteria 4288
574 Ga0395898_0000425 3300037466 Bacteria 89768
575 Ga0395898_0007545 3300037466 Bacteria 11551
576 Ga0395898_0029225 3300037466 Bacteria 5523
577 Ga0395905_0000079 3300037471 Bacteria 160663
578 Ga0395905_0000235 3300037471 Bacteria 83772
579 Ga0395905_0044852 3300037471 Bacteria 4147
580 Ga0395905_0102595 3300037471 Bacteria 2685
581 Ga0395905_0162640 3300037471 Bacteria 2097
582 Ga0395901_0000109 3300038443 Bacteria 112882
583 Ga0395901_0072550 3300038443 Bacteria 3589
584 Ga0436360_0682679 3300039438 Bacteria 2970
585 Ga0436361_0621765 3300039447 Bacteria 1432
586 Ga0436363_0993833 3300039450 Bacteria 1875
587 Ga0451798_0026603 3300041458 Bacteria 2013
588 Ga0451849_0292172 3300041505 Bacteria 997
589 Ga0466964_0053842 3300044706 Bacteria 1657
590 Ga0453684_0016340 3300044712 Bacteria 11615
591 Ga0466971_0025669 3300044719 Bacteria 2631
592 Ga0466970_0128725 3300044765 Bacteria 1390
593 Ga0466957_0040153 3300044842 Bacteria 2826
594 Ga0466957_0131084 3300044842 Bacteria 1606
595 Ga0466960_0245797 3300044901 Bacteria 992
596 Ga0466959_0031417 3300045049 Bacteria 3928
597 Ga0451576_0288014 3300045051 Bacteria 1717
598 Ga0466958_0123287 3300045836 Bacteria 1623
599 Ga0466958_0191280 3300045836 Bacteria 1301
600 Ga0495592_0000418 3300046454 Bacteria 32266
601 Ga0495592_0007034 3300046454 Bacteria 8413
602 Ga0495592_0103513 3300046454 Bacteria 2025
603 Ga0495603_0037029 3300046455 Bacteria 2927
604 Ga0495590_0021156 3300046457 Bacteria 2308
605 Ga0495591_003062 3300046458 Bacteria 8878
606 Ga0495629_0000350 3300046459 Bacteria 39162
607 Ga0495629_0001209 3300046459 Bacteria 20272
608 Ga0495629_0038290 3300046459 Bacteria 3378
609 Ga0495629_0157943 3300046459 Bacteria 1575
610 Ga0495638_0013760 3300046460 Bacteria 5494
611 Ga0495641_0009348 3300046461 Bacteria 5831
612 Ga0495651_0076444 3300046462 Bacteria 2536
613 Ga0495651_0084160 3300046462 Bacteria 2397
614 Ga0495651_0114900 3300046462 Bacteria 1985
615 Ga0495653_0003248 3300046463 Bacteria 13043
616 Ga0495653_0046903 3300046463 Bacteria 3343
617 Ga0495653_0110072 3300046463 Bacteria 1981
618 Ga0495650_0026543 3300046471 Bacteria 2692
619 Ga0495650_0027151 3300046471 Bacteria 2651
620 Ga0495650_0035337 3300046471 Bacteria 2200
621 Ga0495650_0076264 3300046471 Bacteria 1303
622 Ga0495580_0000001 3300046472 Bacteria 180598
623 Ga0495580_0002480 3300046472 Bacteria 16100
624 Ga0495580_0063709 3300046472 Bacteria 2584
625 Ga0495580_0334664 3300046472 Bacteria 1027
626 Ga0495582_0004973 3300046473 Bacteria 7447
627 Ga0495582_0014067 3300046473 Bacteria 4404
628 Ga0495582_0035867 3300046473 Bacteria 2728
629 Ga0495582_0229203 3300046473 Bacteria 1063
630 Ga0495605_0001893 3300046474 Bacteria 13371
631 Ga0495662_0026903 3300046476 Bacteria 2778
632 Ga0495664_0020285 3300046477 Bacteria 3832
633 Ga0495664_0023953 3300046477 Bacteria 3544
634 Ga0495664_0153708 3300046477 Bacteria 1396
635 Ga0495584_0079282 3300046491 Bacteria 1652
636 Ga0495596_0005022 3300046500 Bacteria 6328
637 Ga0495583_0020828 3300046506 Bacteria 3385
638 Ga0495583_0057200 3300046506 Bacteria 1755
639 Ga0495606_0015750 3300046507 Bacteria 5806
640 Ga0495606_0024992 3300046507 Bacteria 4288
641 Ga0495606_0050987 3300046507 Bacteria 2702
642 Ga0495608_0004602 3300046511 Bacteria 9848
643 Ga0495608_0005829 3300046511 Bacteria 8774
644 Ga0495610_0005342 3300046512 Bacteria 9168
645 Ga0495610_0030325 3300046512 Bacteria 2836
646 Ga0495618_0000415 3300046514 Bacteria 30705
647 Ga0495618_0014000 3300046514 Bacteria 4883
648 Ga0495620_0032334 3300046515 Bacteria 2385
649 Ga0495620_0036672 3300046515 Bacteria 2192
650 Ga0495620_0040499 3300046515 Bacteria 2049
651 Ga0495628_0019378 3300046516 Bacteria 5625
652 Ga0495628_0137787 3300046516 Bacteria 1864
653 Ga0495628_0139498 3300046516 Bacteria 1850
654 Ga0495628_0187322 3300046516 Bacteria 1563
655 Ga0495630_0018394 3300046517 Bacteria 5134
656 Ga0495630_0089207 3300046517 Bacteria 2329
657 Ga0495630_0120123 3300046517 Bacteria 1993
658 Ga0495630_0274257 3300046517 Bacteria 1288
659 Ga0495631_0125023 3300046518 Bacteria 1106
660 Ga0495632_0005034 3300046519 Bacteria 8845
661 Ga0495643_0039315 3300046522 Bacteria 2588
662 Ga0495648_0008606 3300046524 Bacteria 8004
663 Ga0495648_0021032 3300046524 Bacteria 4531
664 Ga0495648_0034993 3300046524 Bacteria 3260
665 Ga0495648_0170953 3300046524 Bacteria 1114
666 Ga0495666_0063871 3300046526 Bacteria 1757
667 Ga0495652_0027306 3300046529 Bacteria 5030
668 Ga0495652_0041987 3300046529 Bacteria 3944
669 Ga0495665_0003698 3300046531 Bacteria 8292
670 Ga0495665_0016798 3300046531 Bacteria 3939
671 Ga0495665_0028597 3300046531 Bacteria 2988
672 Ga0495665_0048732 3300046531 Bacteria 2246
673 Ga0495640_0001146 3300046533 Bacteria 20691
674 Ga0495640_0012264 3300046533 Bacteria 6557
675 Ga0495640_0055085 3300046533 Bacteria 2721
676 Ga0495586_0020369 3300046535 Bacteria 3532
677 Ga0495587_0003091 3300046536 Bacteria 11119
678 Ga0495598_0075374 3300046537 Bacteria 1071
679 Ga0495609_0095884 3300046538 Bacteria 1287
680 Ga0495621_0023505 3300046539 Bacteria 2051
681 Ga0495597_0014933 3300046542 Bacteria 3688
682 Ga0495597_0042423 3300046542 Bacteria 2029
683 Ga0495597_0129708 3300046542 Bacteria 1046
684 Ga0495645_0031906 3300046543 Bacteria 3841
685 Ga0495645_0052270 3300046543 Bacteria 2973
686 Ga0495645_0140066 3300046543 Bacteria 1688
687 Ga0495622_0000323 3300046557 Bacteria 35189
688 Ga0495634_0012967 3300046642 Bacteria 6031
689 Ga0495634_0124082 3300046642 Bacteria 1651
690 Ga0495634_0185989 3300046642 Bacteria 1298
691 Ga0495611_0059503 3300046648 Bacteria 1734
692 Ga0495625_0031755 3300046660 Bacteria 3925
693 Ga0495625_0072125 3300046660 Bacteria 2422
694 Ga0495635_0000381 3300046663 Bacteria 28175
695 Ga0495635_0014539 3300046663 Bacteria 5505
696 Ga0495635_0049797 3300046663 Bacteria 2888
697 Ga0495635_0202067 3300046663 Bacteria 1347
698 Ga0495661_0005116 3300046665 Bacteria 9347
699 Ga0495588_0070491 3300046674 Bacteria 1817
700 Ga0495588_0213223 3300046674 Bacteria 1019
701 Ga0495657_0033057 3300046675 Bacteria 3605
702 Ga0495599_0018350 3300046678 Bacteria 4359
703 Ga0495599_0058678 3300046678 Bacteria 2407
704 Ga0495623_0036924 3300046679 Bacteria 3129
705 Ga0495623_0051850 3300046679 Bacteria 2594
706 Ga0495623_0073104 3300046679 Bacteria 2131
707 Ga0495623_0126886 3300046679 Bacteria 1531
708 Ga0495646_0003092 3300046680 Bacteria 10325
709 Ga0495646_0004800 3300046680 Bacteria 8535
710 Ga0495646_0007653 3300046680 Bacteria 6865
711 Ga0495647_0055566 3300046681 Bacteria 1550
712 Ga0495658_0005455 3300046683 Bacteria 6253
713 Ga0495613_0002613 3300046689 Bacteria 13546
714 Ga0495613_0010209 3300046689 Bacteria 6976
715 Ga0495613_0076364 3300046689 Bacteria 2438
716 Ga0495624_0001552 3300046690 Bacteria 17745
717 Ga0495624_0022060 3300046690 Bacteria 4214
718 Ga0495624_0032776 3300046690 Bacteria 3367
719 Ga0495624_0037196 3300046690 Bacteria 3134
720 Ga0495624_0223455 3300046690 Bacteria 1141
721 Ga0495671_0035075 3300046692 Bacteria 2549
722 Ga0495671_0101963 3300046692 Bacteria 1402
723 Ga0495671_0144278 3300046692 Bacteria 1160
724 Ga0495649_0006372 3300046694 Bacteria 7345
725 Ga0495649_0020638 3300046694 Bacteria 3693
726 Ga0495649_0137747 3300046694 Bacteria 1286
727 Ga0495649_0237482 3300046694 Bacteria 939
728 Ga0495589_0003386 3300046794 Bacteria 8644
729 Ga0495589_0017621 3300046794 Bacteria 3665
730 Ga0495589_0066001 3300046794 Bacteria 1773
731 Ga0495600_0007815 3300046809 Bacteria 6548
732 Ga0495600_0012622 3300046809 Bacteria 5288
733 Ga0495660_0032774 3300046810 Bacteria 2917
734 Ga0495660_0086243 3300046810 Bacteria 1639
735 Ga0495581_0022908 3300047315 Bacteria 3618
736 Ga0495581_0025220 3300047315 Bacteria 3447
737 Ga0495604_0001718 3300047317 Bacteria 17961
738 Ga0495604_0048198 3300047317 Bacteria 3314
739 Ga0495604_0101071 3300047317 Bacteria 2119
740 Ga0495604_0251980 3300047317 Bacteria 1203
741 Ga0495674_0024129 3300047319 Bacteria 5596
742 Ga0495674_0028979 3300047319 Bacteria 5043
743 Ga0495674_0030646 3300047319 Bacteria 4889
744 Ga0495674_0265431 3300047319 Bacteria 1409
745 Ga0495672_0001486 3300047320 Bacteria 22986
746 Ga0495672_0107830 3300047320 Bacteria 1499
747 Ga0495676_0024342 3300047321 Bacteria 5243
748 Ga0495676_0094485 3300047321 Bacteria 2227
749 Ga0495676_0178137 3300047321 Bacteria 1491
750 Ga0495676_0209718 3300047321 Bacteria 1348
751 Ga0495680_0048068 3300047322 Bacteria 3352
752 Ga0495680_0054890 3300047322 Bacteria 3091
753 Ga0495680_0060598 3300047322 Bacteria 2916
754 Ga0495680_0078177 3300047322 Bacteria 2504
755 Ga0495683_0001965 3300047323 Bacteria 12832
756 Ga0495683_0019876 3300047323 Bacteria 3464
757 Ga0495683_0032511 3300047323 Bacteria 2657
758 Ga0495683_0049973 3300047323 Bacteria 2093
759 Ga0495687_000292 3300047443 Bacteria 65859
760 Ga0495687_004028 3300047443 Bacteria 10202
761 Ga0495687_053989 3300047443 Bacteria 1689
762 Ga0495687_055158 3300047443 Bacteria 1663
763 Ga0495675_0000784 3300047444 Bacteria 19640
764 Ga0495675_0006186 3300047444 Bacteria 7324
765 Ga0495675_0009654 3300047444 Bacteria 6011
766 Ga0495675_0134339 3300047444 Bacteria 1536
767 Ga0495679_000342 3300047446 Bacteria 36534
768 Ga0495679_001336 3300047446 Bacteria 14249
769 Ga0495679_006514 3300047446 Bacteria 5005
770 Ga0495673_0008672 3300047469 Bacteria 5687
771 Ga0495673_0017547 3300047469 Bacteria 3629
772 Ga0495684_0064932 3300047471 Bacteria 2774
773 Ga0495684_0148529 3300047471 Bacteria 1754
774 Ga0495686_0001715 3300047472 Bacteria 22608
775 Ga0495686_0009644 3300047472 Bacteria 6935
776 Ga0495593_0008485 3300047673 Bacteria 5972
777 Ga0495593_0042701 3300047673 Bacteria 2433
778 Ga0495602_0004174 3300048088 Bacteria 15032
779 Ga0495602_0110178 3300048088 Bacteria 2238
780 Ga0495602_0134587 3300048088 Bacteria 1966
781 Ga0495614_0002311 3300048089 Bacteria 8473
782 Ga0495614_0010363 3300048089 Bacteria 4110
783 Ga0495614_0015494 3300048089 Bacteria 3323
784 Ga0495626_0008575 3300048091 Bacteria 5590
785 Ga0495626_0072060 3300048091 Bacteria 1551
786 Ga0496100_0112035 3300048903 Bacteria 1897
787 Ga0496101_0001250 3300048904 Bacteria 15203
788 Ga0496101_0090419 3300048904 Bacteria 2277
789 Ga0496101_0364172 3300048904 Bacteria 1137
790 Ga0496102_0002193 3300048905 Bacteria 16763
791 Ga0496102_0190228 3300048905 Bacteria 1934
792 Ga0496103_0002317 3300048906 Bacteria 12041
793 Ga0496103_0009680 3300048906 Bacteria 5704
794 Ga0496103_0275839 3300048906 Bacteria 1082
795 Ga0496104_0007665 3300048907 Bacteria 9557
796 Ga0496105_0077564 3300048908 Bacteria 2744
797 Ga0496105_0416377 3300048908 Bacteria 1064
798 Ga0496106_0000051 3300048909 Bacteria 95750
799 Ga0496106_0048008 3300048909 Bacteria 3214
800 Ga0496107_0061373 3300048910 Bacteria 2722
801 Ga0496108_0036075 3300048911 Bacteria 4112
802 Ga0496108_0117169 3300048911 Bacteria 2282
803 Ga0496109_0284672 3300048912 Bacteria 1558
804 Ga0496110_0169121 3300048913 Bacteria 1983
805 Ga0496110_0679806 3300048913 Bacteria 930
806 Ga0496112_0085244 3300048915 Bacteria 3126
807 Ga0496113_0038065 3300048916 Bacteria 3534
808 Ga0496113_0099632 3300048916 Bacteria 2251
809 Ga0496114_0152801 3300048917 Bacteria 2003
810 Ga0496116_0088893 3300048919 Bacteria 1886
811 Ga0496116_0124794 3300048919 Bacteria 1481
812 Ga0496116_0172593 3300048919 Bacteria 1170
813 Ga0496117_0001476 3300048920 Bacteria 33776
814 Ga0496117_0002745 3300048920 Bacteria 21589
815 Ga0496117_0074720 3300048920 Bacteria 2255
816 Ga0496117_0105394 3300048920 Bacteria 1772
817 Ga0496117_0131554 3300048920 Bacteria 1515
818 Ga0496118_0001841 3300048921 Bacteria 30372
819 Ga0496118_0002994 3300048921 Bacteria 21830
820 Ga0496118_0003375 3300048921 Bacteria 20179
821 Ga0496118_0012483 3300048921 Bacteria 8145
822 Ga0496118_0014012 3300048921 Bacteria 7530
823 Ga0496118_0020217 3300048921 Bacteria 5913
824 Ga0496118_0112447 3300048921 Bacteria 1802
825 Ga0496119_0042024 3300048922 Bacteria 2903
826 Ga0496121_0000639 3300048924 Bacteria 65359
827 Ga0496121_0003125 3300048924 Bacteria 23912
828 Ga0496121_0004422 3300048924 Bacteria 18925
829 Ga0496121_0009350 3300048924 Bacteria 11291
830 Ga0496121_0032381 3300048924 Bacteria 4753
831 Ga0496126_0001778 3300048929 Bacteria 31840
832 Ga0496126_0002490 3300048929 Bacteria 24787
833 Ga0496126_0006608 3300048929 Bacteria 12910
834 Ga0496126_0010712 3300048929 Bacteria 9578
835 Ga0496126_0219721 3300048929 Bacteria 1597
836 Ga0495682_0007651 3300049460 Bacteria 4288
837 Ga0495682_0017449 3300049460 Bacteria 2708
838 Ga0495682_0071906 3300049460 Bacteria 1245
839 Ga0501206_002502 3300049653 Bacteria 2316
840 Ga0501223_020910 3300049663 Bacteria 1281
841 Ga0501252_006389 3300049682 Bacteria 1309
842 Ga0501253_037805 3300049683 Bacteria 957
843 Ga0501257_053152 3300049686 Bacteria 1013
844 Ga0501265_001018 3300049762 Bacteria 3141
845 nmdc:mga03683_14596_c1 3300050489 Bacteria 2319
846 nmdc:mga03683_2386_c1 3300050489 Bacteria 5824
847 nmdc:mga03n38_80742_c1 3300050490 Bacteria 1528
848 nmdc:mga00v17_37965_c1 3300050491 Bacteria 2878
849 nmdc:mga0yw44_144797_c1 3300050492 Bacteria 1546
850 nmdc:mga0yw44_287378_c1 3300050492 Bacteria 1100
851 nmdc:mga0k408_10932_c1 3300050493 Bacteria 4925
852 nmdc:mga0k408_17492_c1 3300050493 Bacteria 3995
853 nmdc:mga0k408_19702_c1 3300050493 Bacteria 3773
854 nmdc:mga0k408_2227_c1 3300050493 Bacteria 10372
855 nmdc:mga0k408_23154_c1 3300050493 Bacteria 3502
856 nmdc:mga0k408_252_c1 3300050493 Bacteria 29077
857 nmdc:mga0k408_2779_c1 3300050493 Bacteria 9306
858 nmdc:mga0k408_4961_c1 3300050493 Bacteria 7053
859 nmdc:mga0k408_6822_c1 3300050493 Bacteria 6089
860 nmdc:mga0k408_83681_c1 3300050493 Bacteria 1871
861 nmdc:mga0k408_9425_c1 3300050493 Bacteria 5260
862 nmdc:mga06z11_181485_c1 3300050494 Bacteria 1214
863 nmdc:mga06z11_192219_c1 3300050494 Bacteria 1182
864 nmdc:mga06z11_263623_c1 3300050494 Bacteria 1017
865 nmdc:mga04h51_23445_c1 3300050495 Bacteria 1879
866 nmdc:mga07m45_134813_c1 3300050496 Bacteria 1429
867 nmdc:mga07m45_143861_c1 3300050496 Bacteria 1382
868 nmdc:mga07m45_1560_c1 3300050496 Bacteria 10545
869 nmdc:mga07m45_37873_c1 3300050496 Bacteria 2691
870 nmdc:mga07m45_4097_c1 3300050496 Bacteria 7112
871 nmdc:mga07m45_55769_c1 3300050496 Bacteria 2234
872 nmdc:mga07m45_8094_c1 3300050496 Bacteria 5391
873 nmdc:mga05p37_602287_c1 3300050507 Bacteria 1240
874 nmdc:mga0n895_179513_c1 3300050512 Bacteria 2148
875 nmdc:mga0sz30_45608_c1 3300050516 Bacteria 1849
876 nmdc:mga0sz30_55362_c1 3300050516 Bacteria 1688
877 Ga0495601_0091512 3300053077 Bacteria 1958
878 Ga0495595_0078578 3300053084 Bacteria 1569
879 Ga0500578_0000039 3300053086 Bacteria 134602
880 Ga0500578_0015477 3300053086 Bacteria 4901
881 Ga0500644_0001167 3300053088 Bacteria 7607
882 Ga0500644_0012107 3300053088 Bacteria 2377
883 Ga0500594_0000907 3300053118 Bacteria 6356
884 Ga0500628_008513 3300053129 Bacteria 1786
885 Ga0500652_000804 3300053131 Bacteria 10512
886 Ga0500559_0000176 3300053136 Bacteria 50699
887 Ga0500568_0016616 3300053139 Bacteria 3266
888 Ga0500568_0026693 3300053139 Bacteria 2422
889 Ga0500590_002860 3300053148 Bacteria 7810
890 Ga0500604_0022550 3300053151 Bacteria 1788
891 Ga0500620_014684 3300053155 Bacteria 2194
892 Ga0500622_0000770 3300053156 Bacteria 27847
893 Ga0500622_0001562 3300053156 Bacteria 18102
894 Ga0500645_006427 3300053730 Bacteria 4196
895 Ga0587072_011357 3300059643 Bacteria 1456
896 Ga0466962_0003292 3300061719 Bacteria 7676
897 Ga0466962_0030813 3300061719 Bacteria 2568
898 2501073708 2501025501 Bacteria 7768574
899 2501078223 2501025502 Bacteria 9641094
900 2501409988 2501025504 Bacteria 8008976
901 2509131831 2508501125 Bacteria 7208311
902 2510252947 2510065045 Bacteria 7761063
903 2511089938 2510917013 Bacteria 9951648
904 2511095314 2510917014 Bacteria 8296963
905 2511104986 2510917015 Bacteria 7950052
906 2512346823 2512047030 Bacteria 9031815
907 2513554431 2513237082 Bacteria 8640282
908 2513561211 2513237083 Bacteria 8410967
909 2513959421 2513237151 Bacteria 6309801
910 2514046762 2513237166 Bacteria 10373764
911 2515681903 2515154122 Bacteria 8609520
912 2516018373 2515154189 Bacteria 9629850
913 2519460148 2519103095 Bacteria 6629912
914 2527079518 2526164713 Bacteria 6780608
915 2548500867 2547132374 Bacteria 5530232
916 2563055375 2562617112 Bacteria 10918404
917 2585290354 2582581311 Bacteria 6763856
918 2587725722 2585428057 Bacteria 6737412
919 2587736646 2585428058 Bacteria 6853932
920 2588290652 2588253510 Bacteria 6901809
921 2599744424 2599185240 Bacteria 7968121
922 2600206461 2599185355 Bacteria 7968906
923 2643972666 2643221592 Bacteria 6608788
924 2644057832 2643221609 Bacteria 6756331
925 2644072869 2643221611 Bacteria 6820941
926 2644143487 2643221625 Bacteria 6512927
927 2644276076 2643221648 Bacteria 6521465
928 2644292118 2643221652 Bacteria 5140275
929 2644303437 2643221654 Bacteria 5273570
930 2644646587 2643221717 Bacteria 5676132
931 2676744699 2675903129 Bacteria 7964495
932 2713478982 2711768613 Bacteria 11048459
933 2719638749 2718217991 Bacteria 7829542
934 2738822289 2738541296 Bacteria 7285013
935 2738836575 2738541298 Bacteria 7286732
936 2738875975 2738541306 Bacteria 7284992
937 2739187927 2738543002 Bacteria 7284546
938 2739222573 2738543008 Bacteria 7282815
939 2739242089 2738543012 Bacteria 7115078
940 2753565538 2751185846 Bacteria 7242164
941 2792832607 2791355137 Bacteria 9654227
942 2808968619 2808606384 Bacteria 8474373
943 2809003450 2808606390 Bacteria 8476311
944 2809010727 2808606391 Bacteria 8308166
945 2816470293 2816332133 Bacteria 7249298
946 2817262415 2816332253 Bacteria 6764532
947 2817280134 2816332256 Bacteria 6891714
948 2817455278 2816332286 Bacteria 6853759
949 2819624087 2818991450 Bacteria 6962147
950 2842328947 2842324504 Bacteria 9364110
951 2842353634 2842348783 Bacteria 9002918
952 2842720514 2842718218 Bacteria 4560148
953 2856293047 2856287931 Bacteria 7223934
954 2857361783 2857357740 Bacteria 9937880
955 2883093280 2883087390 Bacteria 9532701
956 2885276289 2885270888 Bacteria 9831543
957 2900578307 2900577576 Bacteria 5438534
958 2900636657 2900634093 Bacteria 10263517
959 2902688860 2902682994 Bacteria 8951596
960 2904488272 2904483920 Bacteria 7545285
961 2904570820 2904564687 Bacteria 7609577
962 2904617997 2904615490 Bacteria 10047340
963 2919530965 2919527303 Bacteria 7718827
964 2921648851 2921643360 Bacteria 11448031
965 2928060924 2928058823 Bacteria 5520022
966 2928112810 2928108538 Bacteria 7360024
967 2928141741 2928135762 Bacteria 7259641
968 2928161738 2928157003 Bacteria 7522202
969 2928170761 2928163908 Bacteria 7561269
970 2928508342 2928503688 Bacteria 7268108
971 2945934997 2945934425 Bacteria 7444609
972 2974321625 2974320154 Bacteria 4571377
973 2981993097 2981990288 Bacteria 7590678
974 2990704445 2990703756 Bacteria 7715990
975 2990714792 2990710928 Bacteria 5002431
976 642424833 641736151 Bacteria 7477263
977 642419984 641736154 Bacteria 7689995
978 642591819 642555112 Bacteria 8676562
979 642619893 642555113 Bacteria 8214658
980 8003958887 8003955200 Bacteria 8601927
981 8020809836 8020807995 Bacteria 6801506
982 8020948995 8020945358 Bacteria 8467355
983 8039098897 8039098773 Bacteria 6602928
984 8040171013 8040167225 Bacteria 6542727
985 8040175562 8040173305 Bacteria 6827067
986 8055267925 8055266321 Bacteria 7999742
987 8055304346 8055301274 Bacteria 8587385
988 Ga0496100_0002521
989 JGI24740J21852_10010623
990 JGI24739J22299_10002720
991 JGI24739J22299_10007403
992 JGI24739J22299_10021569
993 JGI24739J22299_10027893
994 JGI24737J22298_10007144
995 JGI24737J22298_10016803
996 JGI24737J22298_10025811
997 JGI24735J21928_10003917
998 JGI24735J21928_10008742
999 JGI24735J21928_10026090
1000 JGI24738J21930_10002518
1001 JGI25156J39149_1000991
1002 JGI25156J39149_1001392
1003 JGI25156J39149_1002249
1004 JGI25152J39213_1000678
1005 JGI25150J39212_1011409
1006 JGI25165J46597_1001300
1007 JGI25153J46596_10003272
1008 JGI25153J46596_10004915
1009 rootH1_10016096
1010 rootL2_10147844
1011 rootL2_10196141
1012 JGI25160J50197_1000016
1013 Ga0055533_1000587
1014 Ga0055533_1000634
1015 Ga0055532_1000022
1016 Ga0055527_1000016
1017 Ga0055527_1002497
1018 Ga0055527_1003486
1019 Ga0055535_1000017
1020 Ga0055535_1004554
1021 Ga0055542_1000030
1022 Ga0055529_1000033
1023 Ga0055526_1001068
1024 Ga0055534_1002118
1025 Ga0065165_1000154
1026 Ga0065165_1001461
1027 Ga0065704_10204710
1028 Ga0065712_10075384
1029 Ga0065715_10147267
1030 Ga0070676_10008679
1031 Ga0070676_10023341
1032 Ga0070676_10077477
1033 Ga0070690_100006989
1034 Ga0070670_100020778
1035 Ga0070670_100031757
1036 Ga0070670_100216823
1037 Ga0070670_100219025
1038 Ga0070670_100678085
1039 Ga0070677_10012605
1040 Ga0070677_10015197
1041 Ga0068869_100015120
1042 Ga0068869_100060583
1043 Ga0068869_100195292
1044 Ga0070666_10019273
1045 Ga0070666_10088721
1046 Ga0070666_10120561
1047 Ga0070666_10293668
1048 Ga0068868_100074157
1049 Ga0068868_100079979
1050 Ga0068868_100091480
1051 Ga0068868_100223330
1052 Ga0070660_100000195
1053 Ga0070660_100064616
1054 Ga0070661_100026811
1055 Ga0070661_100035221
1056 Ga0070668_100010839
1057 Ga0070668_100036923
1058 Ga0070668_100146242
1059 Ga0070669_100004137
1060 Ga0070669_100005511
1061 Ga0070669_100117534
1062 Ga0070669_100258762
1063 Ga0070669_100320374
1064 Ga0070675_100000167
1065 Ga0070675_100010946
1066 Ga0070675_100018370
1067 Ga0070675_100024458
1068 Ga0070675_100043857
1069 Ga0070675_100129110
1070 Ga0070675_100140478
1071 Ga0070671_100002233
1072 Ga0070671_100021098
1073 Ga0070674_100006012
1074 Ga0070674_100038427
1075 Ga0070673_100002005
1076 Ga0070673_100044160
1077 Ga0070673_100116421
1078 Ga0070673_100437645
1079 Ga0070688_100088898
1080 Ga0070688_100182427
1081 Ga0070659_100000271
1082 Ga0070659_100028974
1083 Ga0070659_100031557
1084 Ga0070659_100479540
1085 Ga0070667_100007013
1086 Ga0070667_100013861
1087 Ga0070667_100020907
1088 Ga0070667_100070105
1089 Ga0070667_100154315
1090 Ga0070667_100322741
1091 Ga0070701_10059666
1092 Ga0070700_100224414
1093 Ga0070663_100001056
1094 Ga0070663_100134639
1095 Ga0070663_100181569
1096 Ga0070678_100002556
1097 Ga0070678_100021058
1098 Ga0070662_100016396
1099 Ga0070662_100148143
1100 Ga0068867_100000021
1101 Ga0068867_100006166
1102 Ga0068867_100020540
1103 Ga0068867_100031508
1104 Ga0068867_100071873
1105 Ga0068867_100135086
1106 Ga0068867_100177000
1107 Ga0068867_100189163
1108 Ga0070685_10032211
1109 Ga0070706_100001239
1110 Ga0070707_100090242
1111 Ga0068853_100124541
1112 Ga0068853_100147183
1113 Ga0068853_100152475
1114 Ga0068853_100260016
1115 Ga0068853_100707905
1116 Ga0070672_100000544
1117 Ga0070672_100008374
1118 Ga0070672_100008511
1119 Ga0070672_100033996
1120 Ga0070672_100169035
1121 Ga0070672_100224494
1122 Ga0070693_100034611
1123 Ga0070665_100083986
1124 Ga0068855_100120311
1125 Ga0068855_100420232
1126 Ga0070664_100070688
1127 Ga0070664_100211452
1128 Ga0070664_100323041
1129 Ga0068857_100055452
1130 Ga0068857_100126896
1131 Ga0068856_100030945
1132 Ga0068856_100110976
1133 Ga0068856_100214645
1134 Ga0068852_100002004
1135 Ga0068852_100019888
1136 Ga0068852_100026230
1137 Ga0068852_100063804
1138 Ga0068852_100098919
1139 Ga0068852_100206481
1140 Ga0068859_100037861
1141 Ga0068859_100052151
1142 Ga0068859_100181967
1143 Ga0068864_100001568
1144 Ga0068864_100001586
1145 Ga0068864_100099792
1146 Ga0068864_100107264
1147 Ga0068864_100170649
1148 Ga0068864_100233300
1149 Ga0068864_100408943
1150 Ga0068864_100520148
1151 Ga0068866_10028879
1152 Ga0068866_10032952
1153 Ga0068861_100002195
1154 Ga0068861_100003200
1155 Ga0068861_100022248
1156 Ga0068851_10015256
1157 Ga0068870_10021558
1158 Ga0068863_100014146
1159 Ga0068863_100037402
1160 Ga0068863_100067500
1161 Ga0068863_100144847
1162 Ga0068863_100231961
1163 Ga0068863_100362334
1164 Ga0068858_100010259
1165 Ga0068858_100010997
1166 Ga0068858_100034019
1167 Ga0068858_100134534
1168 Ga0068858_100479892
1169 Ga0068860_100004773
1170 Ga0068860_100013190
1171 Ga0068860_100014652
1172 Ga0068860_100110562
1173 Ga0068860_100778495
1174 Ga0068862_100105764
1175 Ga0068862_100113282
1176 Ga0075365_10134964
1177 Ga0075365_10227929
1178 Ga0075368_10001721
1179 Ga0075368_10031566
1180 Ga0075363_100025485
1181 Ga0075363_100132991
1182 Ga0075363_100171506
1183 Ga0075364_10020354
1184 Ga0075364_10024222
1185 Ga0075362_10020417
1186 Ga0075362_10099771
1187 Ga0075367_10027013
1188 Ga0075367_10046742
1189 Ga0075367_10213926
1190 Ga0075369_10009477
1191 Ga0075369_10023185
1192 Ga0075369_10077233
1193 Ga0075366_10006187
1194 Ga0075366_10014161
1195 Ga0075366_10015488
1196 Ga0075366_10017365
1197 Ga0075366_10021478
1198 Ga0075366_10046110
1199 Ga0075366_10063417
1200 Ga0075366_10075447
1201 Ga0075366_10127889
1202 Ga0075366_10157302
1203 Ga0097621_100048794
1204 Ga0097621_100050894
1205 Ga0097621_100138090
1206 Ga0097621_100174511
1207 Ga0097621_100358307
1208 Ga0075370_10002155
1209 Ga0075370_10002284
1210 Ga0075370_10007713
1211 Ga0075370_10016859
1212 Ga0075370_10020704
1213 Ga0075370_10031684
1214 Ga0075370_10073610
1215 Ga0068871_100026952
1216 Ga0068871_100031602
1217 Ga0068871_100112507
1218 Ga0068871_100146267
1219 Ga0068871_100474505
1220 Ga0068865_100008752
1221 Ga0068865_100031334
1222 Ga0068865_100069568
1223 Ga0068865_100088425
1224 Ga0097620_100037861
1225 Ga0097620_100052149
1226 Ga0097620_100181975
1227 Ga0079104_1000008
1228 Ga0105251_10000590
1229 Ga0105251_10091828
1230 Ga0105250_10003787
1231 Ga0105240_10017111
1232 Ga0105240_10050744
1233 Ga0105240_10127118
1234 Ga0105240_10345514
1235 Ga0105240_10360398
1236 Ga0105245_10049860
1237 Ga0105245_10131108
1238 Ga0105243_10001746
1239 Ga0105243_10105875
1240 Ga0105243_10192471
1241 Ga0105243_10272029
1242 Ga0105242_10486641
1243 Ga0105248_10072337
1244 Ga0105248_10109824
1245 Ga0105248_10164016
1246 Ga0105248_10168560
1247 Ga0105248_10269229
1248 Ga0105248_10524514
1249 Ga0105237_10090293
1250 Ga0105237_10101122
1251 Ga0105237_10122004
1252 Ga0105237_10202484
1253 Ga0105237_10451770
1254 Ga0105238_10027400
1255 Ga0105238_10037142
1256 Ga0105249_10006010
1257 Ga0105249_10012921
1258 Ga0105249_10300723
1259 Ga0105249_10479966
1260 Ga0105239_10099026
1261 Ga0105239_10510449
1262 Ga0157369_10039631
1263 Ga0157369_10070807
1264 Ga0157374_10233698
1265 Ga0157374_10266234
1266 Ga0157374_10337976
1267 Ga0163162_10042288
1268 Ga0163162_10046856
1269 Ga0163162_10050348
1270 Ga0163162_10178830
1271 Ga0163162_10445212
1272 Ga0157372_10140624
1273 Ga0157375_10012697
1274 Ga0157375_10034676
1275 Ga0157375_10221708
1276 Ga0157375_10346167
1277 Ga0163163_10033008
1278 Ga0157380_10040937
1279 Ga0157380_10400951
1280 Ga0157377_10000021
1281 Ga0157377_10015967
1282 Ga0157379_10053896
1283 Ga0157379_10060478
1284 Ga0157379_10142787
1285 Ga0157379_10250230
1286 Ga0157376_10070644
1287 Ga0157376_10179701
1288 Ga0182007_10000169
1289 Ga0183361_10001
1290 Ga0163161_10034999
1291 Ga0163161_10036801
1292 Ga0163161_10057946
1293 Ga0163161_10091381
1294 Ga0163161_10097146
1295 Ga0209674_100017
1296 Ga0209674_100324
1297 Ga0209672_100001
1298 Ga0209672_100041
1299 Ga0209672_103713
1300 Ga0209147_100022
1301 Ga0209147_100337
1302 Ga0209147_100649
1303 Ga0209563_100596
1304 Ga0209563_107554
1305 Ga0207427_101122
1306 Ga0209258_100033
1307 Ga0209258_100309
1308 Ga0207425_1000195
1309 Ga0209148_1000046
1310 Ga0209148_1002429
1311 Ga0209759_1000092
1312 Ga0209759_1000184
1313 Ga0209759_1001030
1314 Ga0209129_1000043
1315 Ga0209129_1008010
1316 Ga0209233_1000050
1317 Ga0209455_1000038
1318 Ga0209130_1003268
1319 Ga0209675_1001354
1320 Ga0209676_1015349
1321 Ga0209564_1000014
1322 Ga0209564_1004662
1323 Ga0209758_1000045
1324 Ga0209758_1000093
1325 Ga0209050_1000179
1326 Ga0207426_1000007
1327 Ga0209051_1004773
1328 Ga0209051_1028007
1329 Ga0209257_1008045
1330 Ga0209257_1037250
1331 Ga0207697_10038786
1332 Ga0207656_10032317
1333 Ga0207696_1004123
1334 Ga0207696_1007974
1335 Ga0207713_1000137
1336 Ga0207682_10001694
1337 Ga0207682_10007864
1338 Ga0207682_10010588
1339 Ga0207682_10049059
1340 Ga0207642_10017603
1341 Ga0207688_10033295
1342 Ga0207688_10194248
1343 Ga0207680_10003579
1344 Ga0207680_10016311
1345 Ga0207680_10271975
1346 Ga0207647_10006921
1347 Ga0207647_10012090
1348 Ga0207647_10019129
1349 Ga0207645_10009352
1350 Ga0207645_10036363
1351 Ga0207645_10080334
1352 Ga0207643_10075134
1353 Ga0207705_10043309
1354 Ga0207684_10008277
1355 Ga0207695_10014314
1356 Ga0207695_10017431
1357 Ga0207695_10045352
1358 Ga0207671_10006439
1359 Ga0207671_10032972
1360 Ga0207671_10287653
1361 Ga0207662_10045110
1362 Ga0207657_10000044
1363 Ga0207649_10022538
1364 Ga0207646_10063618
1365 Ga0207681_10001232
1366 Ga0207681_10009831
1367 Ga0207681_10125031
1368 Ga0207694_10004421
1369 Ga0207650_10001921
1370 Ga0207650_10013206
1371 Ga0207650_10136246
1372 Ga0207650_10159844
1373 Ga0207650_10347055
1374 Ga0207659_10001177
1375 Ga0207659_10006801
1376 Ga0207659_10011942
1377 Ga0207659_10021070
1378 Ga0207659_10024965
1379 Ga0207659_10049968
1380 Ga0207659_10149963
1381 Ga0207687_10057000
1382 Ga0207687_10092606
1383 Ga0207644_10002024
1384 Ga0207644_10002325
1385 Ga0207644_10030839
1386 Ga0207644_10039496
1387 Ga0207644_10085743
1388 Ga0207690_10000046
1389 Ga0207690_10111694
1390 Ga0207706_10023708
1391 Ga0207706_10083831
1392 Ga0207706_10318923
1393 Ga0207686_10001251
1394 Ga0207709_10000070
1395 Ga0207709_10000927
1396 Ga0207709_10027363
1397 Ga0207709_10111752
1398 Ga0207669_10006914
1399 Ga0207669_10054587
1400 Ga0207669_10087570
1401 Ga0207704_10002634
1402 Ga0207704_10006601
1403 Ga0207704_10105642
1404 Ga0207704_10138806
1405 Ga0207691_10016058
1406 Ga0207691_10022141
1407 Ga0207691_10031519
1408 Ga0207691_10067728
1409 Ga0207691_10123981
1410 Ga0207691_10261956
1411 Ga0207691_10433162
1412 Ga0207711_10014582
1413 Ga0207711_10018363
1414 Ga0207711_10036332
1415 Ga0207689_10007049
1416 Ga0207689_10025384
1417 Ga0207689_10078217
1418 Ga0207689_10081490
1419 Ga0207661_10259861
1420 Ga0207679_10177924
1421 Ga0207679_10243849
1422 Ga0207667_10014884
1423 Ga0207651_10001929
1424 Ga0207651_10006366
1425 Ga0207651_10094819
1426 Ga0207651_10134956
1427 Ga0207712_10005762
1428 Ga0207712_10098221
1429 Ga0207712_10433300
1430 Ga0207668_10087254
1431 Ga0207668_10541297
1432 Ga0207658_10000904
1433 Ga0207658_10015874
1434 Ga0207658_10023294
1435 Ga0207658_10050286
1436 Ga0207677_10004432
1437 Ga0207677_10200968
1438 Ga0207677_10284310
1439 Ga0207703_10001363
1440 Ga0207703_10002141
1441 Ga0207703_10006196
1442 Ga0207703_10348070
1443 Ga0207639_10052511
1444 Ga0207639_10087522
1445 Ga0207639_10236436
1446 Ga0207639_10393960
1447 Ga0207678_10000397
1448 Ga0207678_10085322
1449 Ga0207678_10124479
1450 Ga0207708_10016069
1451 Ga0207708_10023525
1452 Ga0207708_10260305
1453 Ga0207702_10035517
1454 Ga0207702_10148402
1455 Ga0207641_10012827
1456 Ga0207641_10017565
1457 Ga0207641_10024475
1458 Ga0207641_10052054
1459 Ga0207641_10069098
1460 Ga0207641_10069896
1461 Ga0207641_10219996
1462 Ga0207648_10000776
1463 Ga0207648_10001858
1464 Ga0207648_10005756
1465 Ga0207648_10014208
1466 Ga0207648_10031752
1467 Ga0207648_10042815
1468 Ga0207648_10067429
1469 Ga0207648_10069535
1470 Ga0207648_10112073
1471 Ga0207648_10197560
1472 Ga0207676_10008217
1473 Ga0207676_10015110
1474 Ga0207676_10016149
1475 Ga0207676_10031088
1476 Ga0207676_10042314
1477 Ga0207676_10132079
1478 Ga0207676_10190773
1479 Ga0207676_10311016
1480 Ga0207674_10095218
1481 Ga0207675_100001673
1482 Ga0207675_100001979
1483 Ga0207675_100014813
1484 Ga0207675_100024619
1485 Ga0207675_100329984
1486 Ga0207683_10013438
1487 Ga0207683_10077142
1488 Ga0207683_10099201
1489 Ga0207698_10002517
1490 Ga0207698_10015201
1491 Ga0207698_10034213
1492 Ga0207698_10064331
1493 Ga0207698_10075826
1494 Ga0207698_10084291
1495 Ga0207698_10343514
1496 Ga0209281_1000029
1497 Ga0209371_1007636
1498 Ga0209813_10019682
1499 Ga0268266_10401825
1500 Ga0268265_10481693
1501 Ga0268264_10005843
1502 Ga0268264_10012862
1503 Ga0268264_10015703
1504 Ga0268264_10584062
1505 Ga0307517_10003186
1506 Ga0307515_10070107
1507 Ga0307515_10143238
1508 Ga0307515_10171943
1509 Ga0265338_10000087
1510 Ga0265338_10001953
1511 Ga0268256_1005918
1512 Ga0307512_10013762
1513 Ga0307513_10043962
1514 Ga0307513_10071654
1515 Ga0307513_10107184
1516 Ga0307509_10186609
1517 Ga0307408_100000133
1518 Ga0307408_100001327
1519 Ga0307508_10004667
1520 Ga0307514_10001425
1521 Ga0307514_10074222
1522 Ga0307514_10103211
1523 Ga0307516_10003676
1524 Ga0307516_10033347
1525 Ga0307516_10120823
1526 Ga0307405_10005542
1527 Ga0307405_10197724
1528 Ga0307413_10178410
1529 Ga0307413_10268250
1530 Ga0307410_10019091
1531 Ga0307406_10002490
1532 Ga0307406_10051459
1533 Ga0307406_10127565
1534 Ga0307412_10000011
1535 Ga0307412_10015249
1536 Ga0307409_100217192
1537 Ga0307416_100001839
1538 Ga0307416_100051118
1539 Ga0307416_100134298
1540 Ga0307414_10241580
1541 Ga0307411_10001139
1542 Ga0307411_10227192
1543 Ga0307510_10003680
1544 Ga0373928_0034957
1545 Ga0373932_0048393
1546 Ga0373957_0100557
1547 Ga0373955_0169842
1548 Ga0373931_0078453
1549 Ga0373931_0091382
1550 Ga0373927_0197037
1551 Ga0373937_0012935
1552 Ga0373937_0241402
1553 Ga0373937_0414808
1554 Ga0373925_0112048
1555 Ga0395899_0000421
1556 Ga0395899_0019968
1557 Ga0395899_0024082
1558 Ga0395900_0000159
1559 Ga0395900_0019146
1560 Ga0395900_0050398
1561 Ga0395898_0000425
1562 Ga0395898_0007545
1563 Ga0395898_0029225
1564 Ga0395905_0000079
1565 Ga0395905_0000235
1566 Ga0395905_0044852
1567 Ga0395905_0102595
1568 Ga0395905_0162640
1569 Ga0395901_0000109
1570 Ga0395901_0072550
1571 Ga0436360_0682679
1572 Ga0436361_0621765
1573 Ga0436363_0993833
1574 Ga0451798_0026603
1575 Ga0451849_0292172
1576 Ga0466964_0053842
1577 Ga0453684_0016340
1578 Ga0466971_0025669
1579 Ga0466970_0128725
1580 Ga0466957_0040153
1581 Ga0466957_0131084
1582 Ga0466960_0245797
1583 Ga0466959_0031417
1584 Ga0451576_0288014
1585 Ga0466958_0123287
1586 Ga0466958_0191280
1587 Ga0495592_0000418
1588 Ga0495592_0007034
1589 Ga0495592_0103513
1590 Ga0495603_0037029
1591 Ga0495590_0021156
1592 Ga0495591_003062
1593 Ga0495629_0000350
1594 Ga0495629_0001209
1595 Ga0495629_0038290
1596 Ga0495629_0157943
1597 Ga0495638_0013760
1598 Ga0495641_0009348
1599 Ga0495651_0076444
1600 Ga0495651_0084160
1601 Ga0495651_0114900
1602 Ga0495653_0003248
1603 Ga0495653_0046903
1604 Ga0495653_0110072
1605 Ga0495650_0026543
1606 Ga0495650_0027151
1607 Ga0495650_0035337
1608 Ga0495650_0076264
1609 Ga0495580_0000001
1610 Ga0495580_0002480
1611 Ga0495580_0063709
1612 Ga0495580_0334664
1613 Ga0495582_0004973
1614 Ga0495582_0014067
1615 Ga0495582_0035867
1616 Ga0495582_0229203
1617 Ga0495605_0001893
1618 Ga0495662_0026903
1619 Ga0495664_0020285
1620 Ga0495664_0023953
1621 Ga0495664_0153708
1622 Ga0495584_0079282
1623 Ga0495596_0005022
1624 Ga0495583_0020828
1625 Ga0495583_0057200
1626 Ga0495606_0015750
1627 Ga0495606_0024992
1628 Ga0495606_0050987
1629 Ga0495608_0004602
1630 Ga0495608_0005829
1631 Ga0495610_0005342
1632 Ga0495610_0030325
1633 Ga0495618_0000415
1634 Ga0495618_0014000
1635 Ga0495620_0032334
1636 Ga0495620_0036672
1637 Ga0495620_0040499
1638 Ga0495628_0019378
1639 Ga0495628_0137787
1640 Ga0495628_0139498
1641 Ga0495628_0187322
1642 Ga0495630_0018394
1643 Ga0495630_0089207
1644 Ga0495630_0120123
1645 Ga0495630_0274257
1646 Ga0495631_0125023
1647 Ga0495632_0005034
1648 Ga0495643_0039315
1649 Ga0495648_0008606
1650 Ga0495648_0021032
1651 Ga0495648_0034993
1652 Ga0495648_0170953
1653 Ga0495666_0063871
1654 Ga0495652_0027306
1655 Ga0495652_0041987
1656 Ga0495665_0003698
1657 Ga0495665_0016798
1658 Ga0495665_0028597
1659 Ga0495665_0048732
1660 Ga0495640_0001146
1661 Ga0495640_0012264
1662 Ga0495640_0055085
1663 Ga0495586_0020369
1664 Ga0495587_0003091
1665 Ga0495598_0075374
1666 Ga0495609_0095884
1667 Ga0495621_0023505
1668 Ga0495597_0014933
1669 Ga0495597_0042423
1670 Ga0495597_0129708
1671 Ga0495645_0031906
1672 Ga0495645_0052270
1673 Ga0495645_0140066
1674 Ga0495622_0000323
1675 Ga0495634_0012967
1676 Ga0495634_0124082
1677 Ga0495634_0185989
1678 Ga0495611_0059503
1679 Ga0495625_0031755
1680 Ga0495625_0072125
1681 Ga0495635_0000381
1682 Ga0495635_0014539
1683 Ga0495635_0049797
1684 Ga0495635_0202067
1685 Ga0495661_0005116
1686 Ga0495588_0070491
1687 Ga0495588_0213223
1688 Ga0495657_0033057
1689 Ga0495599_0018350
1690 Ga0495599_0058678
1691 Ga0495623_0036924
1692 Ga0495623_0051850
1693 Ga0495623_0073104
1694 Ga0495623_0126886
1695 Ga0495646_0003092
1696 Ga0495646_0004800
1697 Ga0495646_0007653
1698 Ga0495647_0055566
1699 Ga0495658_0005455
1700 Ga0495613_0002613
1701 Ga0495613_0010209
1702 Ga0495613_0076364
1703 Ga0495624_0001552
1704 Ga0495624_0022060
1705 Ga0495624_0032776
1706 Ga0495624_0037196
1707 Ga0495624_0223455
1708 Ga0495671_0035075
1709 Ga0495671_0101963
1710 Ga0495671_0144278
1711 Ga0495649_0006372
1712 Ga0495649_0020638
1713 Ga0495649_0137747
1714 Ga0495649_0237482
1715 Ga0495589_0003386
1716 Ga0495589_0017621
1717 Ga0495589_0066001
1718 Ga0495600_0007815
1719 Ga0495600_0012622
1720 Ga0495660_0032774
1721 Ga0495660_0086243
1722 Ga0495581_0022908
1723 Ga0495581_0025220
1724 Ga0495604_0001718
1725 Ga0495604_0048198
1726 Ga0495604_0101071
1727 Ga0495604_0251980
1728 Ga0495674_0024129
1729 Ga0495674_0028979
1730 Ga0495674_0030646
1731 Ga0495674_0265431
1732 Ga0495672_0001486
1733 Ga0495672_0107830
1734 Ga0495676_0024342
1735 Ga0495676_0094485
1736 Ga0495676_0178137
1737 Ga0495676_0209718
1738 Ga0495680_0048068
1739 Ga0495680_0054890
1740 Ga0495680_0060598
1741 Ga0495680_0078177
1742 Ga0495683_0001965
1743 Ga0495683_0019876
1744 Ga0495683_0032511
1745 Ga0495683_0049973
1746 Ga0495687_000292
1747 Ga0495687_004028
1748 Ga0495687_053989
1749 Ga0495687_055158
1750 Ga0495675_0000784
1751 Ga0495675_0006186
1752 Ga0495675_0009654
1753 Ga0495675_0134339
1754 Ga0495679_000342
1755 Ga0495679_001336
1756 Ga0495679_006514
1757 Ga0495673_0008672
1758 Ga0495673_0017547
1759 Ga0495684_0064932
1760 Ga0495684_0148529
1761 Ga0495686_0001715
1762 Ga0495686_0009644
1763 Ga0495593_0008485
1764 Ga0495593_0042701
1765 Ga0495602_0004174
1766 Ga0495602_0110178
1767 Ga0495602_0134587
1768 Ga0495614_0002311
1769 Ga0495614_0010363
1770 Ga0495614_0015494
1771 Ga0495626_0008575
1772 Ga0495626_0072060
1773 Ga0496100_0112035
1774 Ga0496101_0001250
1775 Ga0496101_0090419
1776 Ga0496101_0364172
1777 Ga0496102_0002193
1778 Ga0496102_0190228
1779 Ga0496103_0002317
1780 Ga0496103_0009680
1781 Ga0496103_0275839
1782 Ga0496104_0007665
1783 Ga0496105_0077564
1784 Ga0496105_0416377
1785 Ga0496106_0000051
1786 Ga0496106_0048008
1787 Ga0496107_0061373
1788 Ga0496108_0036075
1789 Ga0496108_0117169
1790 Ga0496109_0284672
1791 Ga0496110_0169121
1792 Ga0496110_0679806
1793 Ga0496112_0085244
1794 Ga0496113_0038065
1795 Ga0496113_0099632
1796 Ga0496114_0152801
1797 Ga0496116_0088893
1798 Ga0496116_0124794
1799 Ga0496116_0172593
1800 Ga0496117_0001476
1801 Ga0496117_0002745
1802 Ga0496117_0074720
1803 Ga0496117_0105394
1804 Ga0496117_0131554
1805 Ga0496118_0001841
1806 Ga0496118_0002994
1807 Ga0496118_0003375
1808 Ga0496118_0012483
1809 Ga0496118_0014012
1810 Ga0496118_0020217
1811 Ga0496118_0112447
1812 Ga0496119_0042024
1813 Ga0496121_0000639
1814 Ga0496121_0003125
1815 Ga0496121_0004422
1816 Ga0496121_0009350
1817 Ga0496121_0032381
1818 Ga0496126_0001778
1819 Ga0496126_0002490
1820 Ga0496126_0006608
1821 Ga0496126_0010712
1822 Ga0496126_0219721
1823 Ga0495682_0007651
1824 Ga0495682_0017449
1825 Ga0495682_0071906
1826 Ga0501206_002502
1827 Ga0501223_020910
1828 Ga0501252_006389
1829 Ga0501253_037805
1830 Ga0501257_053152
1831 Ga0501265_001018
1832 nmdc:mga03683_14596_c1
1833 nmdc:mga03683_2386_c1
1834 nmdc:mga03n38_80742_c1
1835 nmdc:mga00v17_37965_c1
1836 nmdc:mga0yw44_144797_c1
1837 nmdc:mga0yw44_287378_c1
1838 nmdc:mga0k408_10932_c1
1839 nmdc:mga0k408_17492_c1
1840 nmdc:mga0k408_19702_c1
1841 nmdc:mga0k408_2227_c1
1842 nmdc:mga0k408_23154_c1
1843 nmdc:mga0k408_252_c1
1844 nmdc:mga0k408_2779_c1
1845 nmdc:mga0k408_4961_c1
1846 nmdc:mga0k408_6822_c1
1847 nmdc:mga0k408_83681_c1
1848 nmdc:mga0k408_9425_c1
1849 nmdc:mga06z11_181485_c1
1850 nmdc:mga06z11_192219_c1
1851 nmdc:mga06z11_263623_c1
1852 nmdc:mga04h51_23445_c1
1853 nmdc:mga07m45_134813_c1
1854 nmdc:mga07m45_143861_c1
1855 nmdc:mga07m45_1560_c1
1856 nmdc:mga07m45_37873_c1
1857 nmdc:mga07m45_4097_c1
1858 nmdc:mga07m45_55769_c1
1859 nmdc:mga07m45_8094_c1
1860 nmdc:mga05p37_602287_c1
1861 nmdc:mga0n895_179513_c1
1862 nmdc:mga0sz30_45608_c1
1863 nmdc:mga0sz30_55362_c1
1864 Ga0495601_0091512
1865 Ga0495595_0078578
1866 Ga0500578_0000039
1867 Ga0500578_0015477
1868 Ga0500644_0001167
1869 Ga0500644_0012107
1870 Ga0500594_0000907
1871 Ga0500628_008513
1872 Ga0500652_000804
1873 Ga0500559_0000176
1874 Ga0500568_0016616
1875 Ga0500568_0026693
1876 Ga0500590_002860
1877 Ga0500604_0022550
1878 Ga0500620_014684
1879 Ga0500622_0000770
1880 Ga0500622_0001562
1881 Ga0500645_006427
1882 Ga0587072_011357
1883 Ga0466962_0003292
1884 Ga0466962_0030813
1885 2501073708
1886 2501078223
1887 2501409988
1888 2509131831
1889 2510252947
1890 2511089938
1891 2511095314
1892 2511104986
1893 2512346823
1894 2513554431
1895 2513561211
1896 2513959421
1897 2514046762
1898 2515681903
1899 2516018373
1900 2519460148
1901 2527079518
1902 2548500867
1903 2563055375
1904 2585290354
1905 2587725722
1906 2587736646
1907 2588290652
1908 2599744424
1909 2600206461
1910 2643972666
1911 2644057832
1912 2644072869
1913 2644143487
1914 2644276076
1915 2644292118
1916 2644303437
1917 2644646587
1918 2676744699
1919 2713478982
1920 2719638749
1921 2738822289
1922 2738836575
1923 2738875975
1924 2739187927
1925 2739222573
1926 2739242089
1927 2753565538
1928 2792832607
1929 2808968619
1930 2809003450
1931 2809010727
1932 2816470293
1933 2817262415
1934 2817280134
1935 2817455278
1936 2819624087
1937 2842328947
1938 2842353634
1939 2842720514
1940 2856293047
1941 2857361783
1942 2883093280
1943 2885276289
1944 2900578307
1945 2900636657
1946 2902688860
1947 2904488272
1948 2904570820
1949 2904617997
1950 2919530965
1951 2921648851
1952 2928060924
1953 2928112810
1954 2928141741
1955 2928161738
1956 2928170761
1957 2928508342
1958 2945934997
1959 2974321625
1960 2981993097
1961 2990704445
1962 2990714792
1963 642424833
1964 642419984
1965 642591819
1966 642619893
1967 8003958887
1968 8020809836
1969 8020948995
1970 8039098897
1971 8040171013
1972 8040175562
1973 8055267925
1974 8055304346

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03976

PPK2

Polyphosphate kinase 2 (PPK2)

75

304

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6an9-assembly2.cif.gz_A crystal structure of ppk2 class iii in complex with adp from cytophaga hutchinsonii atcc 33406 0.9375 7 265
6au0-assembly1.cif.gz_A crystal structure of ppk2 (class iii) in complex with bisphosphonate inhibitor (2-((3,5-dichlorophenyl)amino)ethane-1,1-diyl)diphosphonic acid 0.9369 7 265
7bmm-assembly2.cif.gz_C crystal structure of polyphosphate kinase 2 from deinococcus radiodurans in apo form 0.9364 5 269
7bmm-assembly2.cif.gz_C crystal structure of polyphosphate kinase 2 from deinococcus radiodurans in apo form 0.9296 5 269
5o6m-assembly1.cif.gz_A structure of polyphosphate kinase from meiothermus ruber n121d bound to atp 0.9219 9 258
ID Description Score Start End Superfamily
5ldbC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9513 8 260 3.40.50.300
6aqeA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9459 6 269 3.40.50.300
6aqeA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.939 6 269 3.40.50.300
6angA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9389 7 265 3.40.50.300
3czpB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9291 29 251 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7W0HG63-F1-model_v4 Polyphosphate kinase 2 family protein 0.9845 145 262 GO:0016301
AF-A0A7W9H9L7-F1-model_v4 Polyphosphate kinase 2 (PPK2 family) 0.9813 146 260 GO:0016301
AF-Q09C39-F1-model_v4 PvdS 0.9771 62 253 GO:0006797
GO:0008976
AF-A0A2V7MJT5-F1-model_v4 Polyphosphate kinase 2 0.9763 146 269 GO:0016301
AF-A0A7W1IA79-F1-model_v4 Polyphosphate kinase 2 family protein 0.9757 60 260 GO:0006797
GO:0016301
GO:0016776

Map