F487556
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 987 | 459 | 1974 | 281 |
Family's Representative Sequence
| Representative Sequence | 3300048903|Ga0496100_0002521|Ga0496100_0002521_3670_4620 |
| Length | 316 |
| Sequence | VRHVACKGQDGLLSHRKSRNGPFAFPFDVTARRTGGTTMAKKNGLDEYRVPFFDEGSKSKFSLADVDPSLKPFSTGSKDTDRERLAEIGAALDAQQERLHAQRVQRVLLVLQGMDTSGKDGTIRAVFHEVDPLGLRIVPFKAPTPVELAHDFLWRIHSQAPAAGELTIFNRSHYEDVLVPVVLGSMDKDERLRRYRHIRDFERMLAENGTTIIKCMLHISKDEQRERLQARIDDPTKHWKFDVSDLDARKLWDKYQEAYDEALAATSTDYAPWYVIPANSKTHRNVMVGELLLRAFESLKLEFPPAKESLKGVIVE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 24 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 26 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 80 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 87 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 109 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 120 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 187 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 193 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 194 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 196 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 197 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 198 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 199 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 200 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 201 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 202 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 203 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 204 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 205 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 206 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 207 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 208 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 209 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 210 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 211 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 212 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 213 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 214 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 216 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 219 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 222 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 223 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 224 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 225 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 226 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 227 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 228 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 229 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 231 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 232 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 233 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 234 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 235 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 236 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 237 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 238 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 239 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 240 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 319 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 320 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 321 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 322 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 323 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 324 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 327 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 328 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 329 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 330 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 331 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 332 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 333 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 334 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 335 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 336 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 338 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 339 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 340 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 341 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 342 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 343 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 344 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 345 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 346 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 347 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 348 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 349 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 350 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 351 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 354 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 357 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 358 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 359 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 360 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 361 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 362 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 363 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 364 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 365 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 366 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 367 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 368 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 369 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 370 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 371 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 372 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 373 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 374 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 375 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 376 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 377 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 378 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 379 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 380 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 381 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 382 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 383 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 384 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 385 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 386 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 387 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 388 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 389 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 390 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 391 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 392 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 393 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 394 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 395 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 396 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 397 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 398 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 399 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 400 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 401 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 402 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 403 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 404 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 405 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 406 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 407 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 408 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 409 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 410 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 411 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 412 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 413 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 414 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 415 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 416 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 417 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 418 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 419 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 420 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 421 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 422 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 423 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 424 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 425 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 426 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 427 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 428 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 429 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 430 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 431 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 432 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 433 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 434 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 435 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 436 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 437 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 438 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 439 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 440 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 441 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 442 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 443 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 444 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 445 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 446 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 447 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 448 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 449 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 450 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 451 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 452 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 453 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 454 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 455 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 456 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 457 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 458 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 459 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.78 |
| Metatranscriptomes | 0.1 |
| Isolates | 9.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.58 |
| Nodule | 2.03 |
| Rhizoplane | 3.04 |
| Rhizosphere | 71.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496100_0002521 | 3300048903 | Bacteria | 9327 |
| 2 | JGI24740J21852_10010623 | 3300001979 | Bacteria | 3536 |
| 3 | JGI24739J22299_10002720 | 3300001989 | Bacteria | 6808 |
| 4 | JGI24739J22299_10007403 | 3300001989 | Bacteria | 4120 |
| 5 | JGI24739J22299_10021569 | 3300001989 | Bacteria | 2292 |
| 6 | JGI24739J22299_10027893 | 3300001989 | Bacteria | 1971 |
| 7 | JGI24737J22298_10007144 | 3300001990 | Bacteria | 3781 |
| 8 | JGI24737J22298_10016803 | 3300001990 | Bacteria | 2362 |
| 9 | JGI24737J22298_10025811 | 3300001990 | Bacteria | 1856 |
| 10 | JGI24735J21928_10003917 | 3300002067 | Bacteria | 5036 |
| 11 | JGI24735J21928_10008742 | 3300002067 | Bacteria | 3267 |
| 12 | JGI24735J21928_10026090 | 3300002067 | Bacteria | 1759 |
| 13 | JGI24738J21930_10002518 | 3300002075 | Bacteria | 4760 |
| 14 | JGI25156J39149_1000991 | 3300002705 | Bacteria | 13402 |
| 15 | JGI25156J39149_1001392 | 3300002705 | Bacteria | 10339 |
| 16 | JGI25156J39149_1002249 | 3300002705 | Bacteria | 7115 |
| 17 | JGI25152J39213_1000678 | 3300002773 | Bacteria | 17738 |
| 18 | JGI25150J39212_1011409 | 3300002774 | Bacteria | 1612 |
| 19 | JGI25165J46597_1001300 | 3300003214 | Bacteria | 14378 |
| 20 | JGI25153J46596_10003272 | 3300003215 | Bacteria | 9104 |
| 21 | JGI25153J46596_10004915 | 3300003215 | Bacteria | 7104 |
| 22 | rootH1_10016096 | 3300003316 | Bacteria | 4360 |
| 23 | rootL2_10147844 | 3300003322 | Bacteria | 7475 |
| 24 | rootL2_10196141 | 3300003322 | Bacteria | 1491 |
| 25 | JGI25160J50197_1000016 | 3300003354 | Bacteria | 247819 |
| 26 | Ga0055533_1000587 | 3300003756 | Bacteria | 12692 |
| 27 | Ga0055533_1000634 | 3300003756 | Bacteria | 11865 |
| 28 | Ga0055532_1000022 | 3300003758 | Bacteria | 248737 |
| 29 | Ga0055527_1000016 | 3300003760 | Bacteria | 248736 |
| 30 | Ga0055527_1002497 | 3300003760 | Bacteria | 3097 |
| 31 | Ga0055527_1003486 | 3300003760 | Bacteria | 2323 |
| 32 | Ga0055535_1000017 | 3300003761 | Bacteria | 248735 |
| 33 | Ga0055535_1004554 | 3300003761 | Bacteria | 3330 |
| 34 | Ga0055542_1000030 | 3300003762 | Bacteria | 248717 |
| 35 | Ga0055529_1000033 | 3300003763 | Bacteria | 248734 |
| 36 | Ga0055526_1001068 | 3300003771 | Bacteria | 20012 |
| 37 | Ga0055534_1002118 | 3300003784 | Bacteria | 7126 |
| 38 | Ga0065165_1000154 | 3300005262 | Bacteria | 119863 |
| 39 | Ga0065165_1001461 | 3300005262 | Bacteria | 25504 |
| 40 | Ga0065704_10204710 | 3300005289 | Bacteria | 1132 |
| 41 | Ga0065712_10075384 | 3300005290 | Bacteria | 3874 |
| 42 | Ga0065715_10147267 | 3300005293 | Bacteria | 1773 |
| 43 | Ga0070676_10008679 | 3300005328 | Bacteria | 5483 |
| 44 | Ga0070676_10023341 | 3300005328 | Bacteria | 3476 |
| 45 | Ga0070676_10077477 | 3300005328 | Bacteria | 2009 |
| 46 | Ga0070690_100006989 | 3300005330 | Bacteria | 6431 |
| 47 | Ga0070670_100020778 | 3300005331 | Bacteria | 5645 |
| 48 | Ga0070670_100031757 | 3300005331 | Bacteria | 4548 |
| 49 | Ga0070670_100216823 | 3300005331 | Bacteria | 1665 |
| 50 | Ga0070670_100219025 | 3300005331 | Bacteria | 1656 |
| 51 | Ga0070670_100678085 | 3300005331 | Bacteria | 926 |
| 52 | Ga0070677_10012605 | 3300005333 | Bacteria | 2938 |
| 53 | Ga0070677_10015197 | 3300005333 | Bacteria | 2725 |
| 54 | Ga0068869_100015120 | 3300005334 | Bacteria | 5168 |
| 55 | Ga0068869_100060583 | 3300005334 | Bacteria | 2774 |
| 56 | Ga0068869_100195292 | 3300005334 | Bacteria | 1593 |
| 57 | Ga0070666_10019273 | 3300005335 | Bacteria | 4401 |
| 58 | Ga0070666_10088721 | 3300005335 | Bacteria | 2122 |
| 59 | Ga0070666_10120561 | 3300005335 | Bacteria | 1819 |
| 60 | Ga0070666_10293668 | 3300005335 | Bacteria | 1157 |
| 61 | Ga0068868_100074157 | 3300005338 | Bacteria | 2717 |
| 62 | Ga0068868_100079979 | 3300005338 | Bacteria | 2619 |
| 63 | Ga0068868_100091480 | 3300005338 | Bacteria | 2451 |
| 64 | Ga0068868_100223330 | 3300005338 | Bacteria | 1578 |
| 65 | Ga0070660_100000195 | 3300005339 | Bacteria | 40432 |
| 66 | Ga0070660_100064616 | 3300005339 | Bacteria | 2847 |
| 67 | Ga0070661_100026811 | 3300005344 | Bacteria | 4146 |
| 68 | Ga0070661_100035221 | 3300005344 | Bacteria | 3634 |
| 69 | Ga0070668_100010839 | 3300005347 | Bacteria | 6783 |
| 70 | Ga0070668_100036923 | 3300005347 | Bacteria | 3729 |
| 71 | Ga0070668_100146242 | 3300005347 | Bacteria | 1908 |
| 72 | Ga0070669_100004137 | 3300005353 | Bacteria | 10530 |
| 73 | Ga0070669_100005511 | 3300005353 | Bacteria | 9134 |
| 74 | Ga0070669_100117534 | 3300005353 | Bacteria | 2024 |
| 75 | Ga0070669_100258762 | 3300005353 | Bacteria | 1388 |
| 76 | Ga0070669_100320374 | 3300005353 | Bacteria | 1251 |
| 77 | Ga0070675_100000167 | 3300005354 | Bacteria | 40503 |
| 78 | Ga0070675_100010946 | 3300005354 | Bacteria | 7098 |
| 79 | Ga0070675_100018370 | 3300005354 | Bacteria | 5564 |
| 80 | Ga0070675_100024458 | 3300005354 | Bacteria | 4836 |
| 81 | Ga0070675_100043857 | 3300005354 | Bacteria | 3657 |
| 82 | Ga0070675_100129110 | 3300005354 | Bacteria | 2152 |
| 83 | Ga0070675_100140478 | 3300005354 | Bacteria | 2064 |
| 84 | Ga0070671_100002233 | 3300005355 | Bacteria | 14954 |
| 85 | Ga0070671_100021098 | 3300005355 | Bacteria | 5319 |
| 86 | Ga0070674_100006012 | 3300005356 | Bacteria | 7055 |
| 87 | Ga0070674_100038427 | 3300005356 | Bacteria | 3226 |
| 88 | Ga0070673_100002005 | 3300005364 | Bacteria | 12290 |
| 89 | Ga0070673_100044160 | 3300005364 | Bacteria | 3449 |
| 90 | Ga0070673_100116421 | 3300005364 | Bacteria | 2223 |
| 91 | Ga0070673_100437645 | 3300005364 | Bacteria | 1174 |
| 92 | Ga0070688_100088898 | 3300005365 | Bacteria | 2015 |
| 93 | Ga0070688_100182427 | 3300005365 | Bacteria | 1457 |
| 94 | Ga0070659_100000271 | 3300005366 | Bacteria | 40568 |
| 95 | Ga0070659_100028974 | 3300005366 | Bacteria | 4277 |
| 96 | Ga0070659_100031557 | 3300005366 | Bacteria | 4104 |
| 97 | Ga0070659_100479540 | 3300005366 | Bacteria | 1058 |
| 98 | Ga0070667_100007013 | 3300005367 | Bacteria | 9366 |
| 99 | Ga0070667_100013861 | 3300005367 | Bacteria | 6663 |
| 100 | Ga0070667_100020907 | 3300005367 | Bacteria | 5437 |
| 101 | Ga0070667_100070105 | 3300005367 | Bacteria | 2984 |
| 102 | Ga0070667_100154315 | 3300005367 | Bacteria | 2019 |
| 103 | Ga0070667_100322741 | 3300005367 | Bacteria | 1393 |
| 104 | Ga0070701_10059666 | 3300005438 | Bacteria | 2007 |
| 105 | Ga0070700_100224414 | 3300005441 | Bacteria | 1333 |
| 106 | Ga0070663_100001056 | 3300005455 | Bacteria | 15081 |
| 107 | Ga0070663_100134639 | 3300005455 | Bacteria | 1880 |
| 108 | Ga0070663_100181569 | 3300005455 | Bacteria | 1633 |
| 109 | Ga0070678_100002556 | 3300005456 | Bacteria | 9992 |
| 110 | Ga0070678_100021058 | 3300005456 | Bacteria | 4291 |
| 111 | Ga0070662_100016396 | 3300005457 | Bacteria | 4974 |
| 112 | Ga0070662_100148143 | 3300005457 | Bacteria | 1825 |
| 113 | Ga0068867_100000021 | 3300005459 | Bacteria | 92798 |
| 114 | Ga0068867_100006166 | 3300005459 | Bacteria | 8487 |
| 115 | Ga0068867_100020540 | 3300005459 | Bacteria | 4706 |
| 116 | Ga0068867_100031508 | 3300005459 | Bacteria | 3829 |
| 117 | Ga0068867_100071873 | 3300005459 | Bacteria | 2589 |
| 118 | Ga0068867_100135086 | 3300005459 | Bacteria | 1922 |
| 119 | Ga0068867_100177000 | 3300005459 | Bacteria | 1693 |
| 120 | Ga0068867_100189163 | 3300005459 | Bacteria | 1642 |
| 121 | Ga0070685_10032211 | 3300005466 | Bacteria | 2935 |
| 122 | Ga0070706_100001239 | 3300005467 | Bacteria | 27289 |
| 123 | Ga0070707_100090242 | 3300005468 | Bacteria | 2966 |
| 124 | Ga0068853_100124541 | 3300005539 | Bacteria | 2302 |
| 125 | Ga0068853_100147183 | 3300005539 | Bacteria | 2117 |
| 126 | Ga0068853_100152475 | 3300005539 | Bacteria | 2081 |
| 127 | Ga0068853_100260016 | 3300005539 | Bacteria | 1595 |
| 128 | Ga0068853_100707905 | 3300005539 | Bacteria | 961 |
| 129 | Ga0070672_100000544 | 3300005543 | Bacteria | 22141 |
| 130 | Ga0070672_100008374 | 3300005543 | Bacteria | 7068 |
| 131 | Ga0070672_100008511 | 3300005543 | Bacteria | 7024 |
| 132 | Ga0070672_100033996 | 3300005543 | Bacteria | 3865 |
| 133 | Ga0070672_100169035 | 3300005543 | Bacteria | 1817 |
| 134 | Ga0070672_100224494 | 3300005543 | Bacteria | 1576 |
| 135 | Ga0070693_100034611 | 3300005547 | Bacteria | 2795 |
| 136 | Ga0070665_100083986 | 3300005548 | Bacteria | 3189 |
| 137 | Ga0068855_100120311 | 3300005563 | Bacteria | 3005 |
| 138 | Ga0068855_100420232 | 3300005563 | Bacteria | 1462 |
| 139 | Ga0070664_100070688 | 3300005564 | Bacteria | 2989 |
| 140 | Ga0070664_100211452 | 3300005564 | Bacteria | 1733 |
| 141 | Ga0070664_100323041 | 3300005564 | Bacteria | 1399 |
| 142 | Ga0068857_100055452 | 3300005577 | Bacteria | 3518 |
| 143 | Ga0068857_100126896 | 3300005577 | Bacteria | 2299 |
| 144 | Ga0068856_100030945 | 3300005614 | Bacteria | 5234 |
| 145 | Ga0068856_100110976 | 3300005614 | Bacteria | 2739 |
| 146 | Ga0068856_100214645 | 3300005614 | Bacteria | 1939 |
| 147 | Ga0068852_100002004 | 3300005616 | Bacteria | 13890 |
| 148 | Ga0068852_100019888 | 3300005616 | Bacteria | 5326 |
| 149 | Ga0068852_100026230 | 3300005616 | Bacteria | 4733 |
| 150 | Ga0068852_100063804 | 3300005616 | Bacteria | 3208 |
| 151 | Ga0068852_100098919 | 3300005616 | Bacteria | 2628 |
| 152 | Ga0068852_100206481 | 3300005616 | Bacteria | 1861 |
| 153 | Ga0068859_100037861 | 3300005617 | Bacteria | 4841 |
| 154 | Ga0068859_100052151 | 3300005617 | Bacteria | 4112 |
| 155 | Ga0068859_100181967 | 3300005617 | Bacteria | 2185 |
| 156 | Ga0068864_100001568 | 3300005618 | Bacteria | 18819 |
| 157 | Ga0068864_100001586 | 3300005618 | Bacteria | 18721 |
| 158 | Ga0068864_100099792 | 3300005618 | Bacteria | 2573 |
| 159 | Ga0068864_100107264 | 3300005618 | Bacteria | 2484 |
| 160 | Ga0068864_100170649 | 3300005618 | Bacteria | 1983 |
| 161 | Ga0068864_100233300 | 3300005618 | Bacteria | 1702 |
| 162 | Ga0068864_100408943 | 3300005618 | Bacteria | 1291 |
| 163 | Ga0068864_100520148 | 3300005618 | Bacteria | 1147 |
| 164 | Ga0068866_10028879 | 3300005718 | Bacteria | 2646 |
| 165 | Ga0068866_10032952 | 3300005718 | Bacteria | 2508 |
| 166 | Ga0068861_100002195 | 3300005719 | Bacteria | 12667 |
| 167 | Ga0068861_100003200 | 3300005719 | Bacteria | 10833 |
| 168 | Ga0068861_100022248 | 3300005719 | Bacteria | 4565 |
| 169 | Ga0068851_10015256 | 3300005834 | Bacteria | 3658 |
| 170 | Ga0068870_10021558 | 3300005840 | Bacteria | 3154 |
| 171 | Ga0068863_100014146 | 3300005841 | Bacteria | 7688 |
| 172 | Ga0068863_100037402 | 3300005841 | Bacteria | 4621 |
| 173 | Ga0068863_100067500 | 3300005841 | Bacteria | 3383 |
| 174 | Ga0068863_100144847 | 3300005841 | Bacteria | 2272 |
| 175 | Ga0068863_100231961 | 3300005841 | Bacteria | 1780 |
| 176 | Ga0068863_100362334 | 3300005841 | Bacteria | 1413 |
| 177 | Ga0068858_100010259 | 3300005842 | Bacteria | 8885 |
| 178 | Ga0068858_100010997 | 3300005842 | Bacteria | 8553 |
| 179 | Ga0068858_100034019 | 3300005842 | Bacteria | 4727 |
| 180 | Ga0068858_100134534 | 3300005842 | Bacteria | 2319 |
| 181 | Ga0068858_100479892 | 3300005842 | Bacteria | 1200 |
| 182 | Ga0068860_100004773 | 3300005843 | Bacteria | 13814 |
| 183 | Ga0068860_100013190 | 3300005843 | Bacteria | 8109 |
| 184 | Ga0068860_100014652 | 3300005843 | Bacteria | 7673 |
| 185 | Ga0068860_100110562 | 3300005843 | Bacteria | 2627 |
| 186 | Ga0068860_100778495 | 3300005843 | Bacteria | 969 |
| 187 | Ga0068862_100105764 | 3300005844 | Bacteria | 2466 |
| 188 | Ga0068862_100113282 | 3300005844 | Bacteria | 2383 |
| 189 | Ga0075365_10134964 | 3300006038 | Bacteria | 1710 |
| 190 | Ga0075365_10227929 | 3300006038 | Bacteria | 1307 |
| 191 | Ga0075368_10001721 | 3300006042 | Bacteria | 7043 |
| 192 | Ga0075368_10031566 | 3300006042 | Bacteria | 2054 |
| 193 | Ga0075363_100025485 | 3300006048 | Bacteria | 3017 |
| 194 | Ga0075363_100132991 | 3300006048 | Bacteria | 1396 |
| 195 | Ga0075363_100171506 | 3300006048 | Bacteria | 1232 |
| 196 | Ga0075364_10020354 | 3300006051 | Bacteria | 4173 |
| 197 | Ga0075364_10024222 | 3300006051 | Bacteria | 3851 |
| 198 | Ga0075362_10020417 | 3300006177 | Bacteria | 2767 |
| 199 | Ga0075362_10099771 | 3300006177 | Bacteria | 1356 |
| 200 | Ga0075367_10027013 | 3300006178 | Bacteria | 3261 |
| 201 | Ga0075367_10046742 | 3300006178 | Bacteria | 2544 |
| 202 | Ga0075367_10213926 | 3300006178 | Bacteria | 1205 |
| 203 | Ga0075369_10009477 | 3300006186 | Bacteria | 3784 |
| 204 | Ga0075369_10023185 | 3300006186 | Bacteria | 2564 |
| 205 | Ga0075369_10077233 | 3300006186 | Bacteria | 1473 |
| 206 | Ga0075366_10006187 | 3300006195 | Bacteria | 6532 |
| 207 | Ga0075366_10014161 | 3300006195 | Bacteria | 4552 |
| 208 | Ga0075366_10015488 | 3300006195 | Bacteria | 4371 |
| 209 | Ga0075366_10017365 | 3300006195 | Bacteria | 4142 |
| 210 | Ga0075366_10021478 | 3300006195 | Bacteria | 3752 |
| 211 | Ga0075366_10046110 | 3300006195 | Bacteria | 2583 |
| 212 | Ga0075366_10063417 | 3300006195 | Bacteria | 2196 |
| 213 | Ga0075366_10075447 | 3300006195 | Bacteria | 2011 |
| 214 | Ga0075366_10127889 | 3300006195 | Bacteria | 1533 |
| 215 | Ga0075366_10157302 | 3300006195 | Bacteria | 1377 |
| 216 | Ga0097621_100048794 | 3300006237 | Bacteria | 3437 |
| 217 | Ga0097621_100050894 | 3300006237 | Bacteria | 3369 |
| 218 | Ga0097621_100138090 | 3300006237 | Bacteria | 2081 |
| 219 | Ga0097621_100174511 | 3300006237 | Bacteria | 1855 |
| 220 | Ga0097621_100358307 | 3300006237 | Bacteria | 1299 |
| 221 | Ga0075370_10002155 | 3300006353 | Bacteria | 9010 |
| 222 | Ga0075370_10002284 | 3300006353 | Bacteria | 8842 |
| 223 | Ga0075370_10007713 | 3300006353 | Bacteria | 5497 |
| 224 | Ga0075370_10016859 | 3300006353 | Bacteria | 3938 |
| 225 | Ga0075370_10020704 | 3300006353 | Bacteria | 3598 |
| 226 | Ga0075370_10031684 | 3300006353 | Bacteria | 2952 |
| 227 | Ga0075370_10073610 | 3300006353 | Bacteria | 1957 |
| 228 | Ga0068871_100026952 | 3300006358 | Bacteria | 4490 |
| 229 | Ga0068871_100031602 | 3300006358 | Bacteria | 4176 |
| 230 | Ga0068871_100112507 | 3300006358 | Bacteria | 2291 |
| 231 | Ga0068871_100146267 | 3300006358 | Bacteria | 2012 |
| 232 | Ga0068871_100474505 | 3300006358 | Bacteria | 1124 |
| 233 | Ga0068865_100008752 | 3300006881 | Bacteria | 6260 |
| 234 | Ga0068865_100031334 | 3300006881 | Bacteria | 3545 |
| 235 | Ga0068865_100069568 | 3300006881 | Bacteria | 2491 |
| 236 | Ga0068865_100088425 | 3300006881 | Bacteria | 2241 |
| 237 | Ga0097620_100037861 | 3300006931 | Bacteria | 4841 |
| 238 | Ga0097620_100052149 | 3300006931 | Bacteria | 4112 |
| 239 | Ga0097620_100181975 | 3300006931 | Bacteria | 2185 |
| 240 | Ga0079104_1000008 | 3300006946 | Bacteria | 371223 |
| 241 | Ga0105251_10000590 | 3300009011 | Bacteria | 33310 |
| 242 | Ga0105251_10091828 | 3300009011 | Bacteria | 1394 |
| 243 | Ga0105250_10003787 | 3300009092 | Bacteria | 7099 |
| 244 | Ga0105240_10017111 | 3300009093 | Bacteria | 9788 |
| 245 | Ga0105240_10050744 | 3300009093 | Bacteria | 5228 |
| 246 | Ga0105240_10127118 | 3300009093 | Bacteria | 3062 |
| 247 | Ga0105240_10345514 | 3300009093 | Bacteria | 1689 |
| 248 | Ga0105240_10360398 | 3300009093 | Bacteria | 1647 |
| 249 | Ga0105245_10049860 | 3300009098 | Bacteria | 3750 |
| 250 | Ga0105245_10131108 | 3300009098 | Bacteria | 2351 |
| 251 | Ga0105243_10001746 | 3300009148 | Bacteria | 18728 |
| 252 | Ga0105243_10105875 | 3300009148 | Bacteria | 2343 |
| 253 | Ga0105243_10192471 | 3300009148 | Bacteria | 1782 |
| 254 | Ga0105243_10272029 | 3300009148 | Bacteria | 1522 |
| 255 | Ga0105242_10486641 | 3300009176 | Bacteria | 1170 |
| 256 | Ga0105248_10072337 | 3300009177 | Bacteria | 3875 |
| 257 | Ga0105248_10109824 | 3300009177 | Bacteria | 3109 |
| 258 | Ga0105248_10164016 | 3300009177 | Bacteria | 2506 |
| 259 | Ga0105248_10168560 | 3300009177 | Bacteria | 2468 |
| 260 | Ga0105248_10269229 | 3300009177 | Bacteria | 1918 |
| 261 | Ga0105248_10524514 | 3300009177 | Bacteria | 1336 |
| 262 | Ga0105237_10090293 | 3300009545 | Bacteria | 3053 |
| 263 | Ga0105237_10101122 | 3300009545 | Bacteria | 2874 |
| 264 | Ga0105237_10122004 | 3300009545 | Bacteria | 2600 |
| 265 | Ga0105237_10202484 | 3300009545 | Bacteria | 1985 |
| 266 | Ga0105237_10451770 | 3300009545 | Bacteria | 1291 |
| 267 | Ga0105238_10027400 | 3300009551 | Bacteria | 5806 |
| 268 | Ga0105238_10037142 | 3300009551 | Bacteria | 4953 |
| 269 | Ga0105249_10006010 | 3300009553 | Bacteria | 10519 |
| 270 | Ga0105249_10012921 | 3300009553 | Bacteria | 7366 |
| 271 | Ga0105249_10300723 | 3300009553 | Bacteria | 1609 |
| 272 | Ga0105249_10479966 | 3300009553 | Bacteria | 1286 |
| 273 | Ga0105239_10099026 | 3300010375 | Bacteria | 3223 |
| 274 | Ga0105239_10510449 | 3300010375 | Bacteria | 1367 |
| 275 | Ga0157369_10039631 | 3300013105 | Bacteria | 5148 |
| 276 | Ga0157369_10070807 | 3300013105 | Bacteria | 3746 |
| 277 | Ga0157374_10233698 | 3300013296 | Bacteria | 1806 |
| 278 | Ga0157374_10266234 | 3300013296 | Bacteria | 1689 |
| 279 | Ga0157374_10337976 | 3300013296 | Bacteria | 1494 |
| 280 | Ga0163162_10042288 | 3300013306 | Bacteria | 4560 |
| 281 | Ga0163162_10046856 | 3300013306 | Bacteria | 4334 |
| 282 | Ga0163162_10050348 | 3300013306 | Bacteria | 4177 |
| 283 | Ga0163162_10178830 | 3300013306 | Bacteria | 2247 |
| 284 | Ga0163162_10445212 | 3300013306 | Bacteria | 1427 |
| 285 | Ga0157372_10140624 | 3300013307 | Bacteria | 2780 |
| 286 | Ga0157375_10012697 | 3300013308 | Bacteria | 7478 |
| 287 | Ga0157375_10034676 | 3300013308 | Bacteria | 4809 |
| 288 | Ga0157375_10221708 | 3300013308 | Bacteria | 2049 |
| 289 | Ga0157375_10346167 | 3300013308 | Bacteria | 1652 |
| 290 | Ga0163163_10033008 | 3300014325 | Bacteria | 5004 |
| 291 | Ga0157380_10040937 | 3300014326 | Bacteria | 3613 |
| 292 | Ga0157380_10400951 | 3300014326 | Bacteria | 1301 |
| 293 | Ga0157377_10000021 | 3300014745 | Bacteria | 147105 |
| 294 | Ga0157377_10015967 | 3300014745 | Bacteria | 3852 |
| 295 | Ga0157379_10053896 | 3300014968 | Bacteria | 3593 |
| 296 | Ga0157379_10060478 | 3300014968 | Bacteria | 3386 |
| 297 | Ga0157379_10142787 | 3300014968 | Bacteria | 2158 |
| 298 | Ga0157379_10250230 | 3300014968 | Bacteria | 1609 |
| 299 | Ga0157376_10070644 | 3300014969 | Bacteria | 2964 |
| 300 | Ga0157376_10179701 | 3300014969 | Bacteria | 1933 |
| 301 | Ga0182007_10000169 | 3300015262 | Bacteria | 44843 |
| 302 | Ga0183361_10001 | 3300016635 | Bacteria | 908583 |
| 303 | Ga0163161_10034999 | 3300017792 | Bacteria | 3593 |
| 304 | Ga0163161_10036801 | 3300017792 | Bacteria | 3506 |
| 305 | Ga0163161_10057946 | 3300017792 | Bacteria | 2815 |
| 306 | Ga0163161_10091381 | 3300017792 | Bacteria | 2253 |
| 307 | Ga0163161_10097146 | 3300017792 | Bacteria | 2188 |
| 308 | Ga0209674_100017 | 3300025226 | Bacteria | 689087 |
| 309 | Ga0209674_100324 | 3300025226 | Bacteria | 30278 |
| 310 | Ga0209672_100001 | 3300025228 | Bacteria | 2828210 |
| 311 | Ga0209672_100041 | 3300025228 | Bacteria | 278535 |
| 312 | Ga0209672_103713 | 3300025228 | Bacteria | 3053 |
| 313 | Ga0209147_100022 | 3300025229 | Bacteria | 443906 |
| 314 | Ga0209147_100337 | 3300025229 | Bacteria | 34955 |
| 315 | Ga0209147_100649 | 3300025229 | Bacteria | 18138 |
| 316 | Ga0209563_100596 | 3300025230 | Bacteria | 11859 |
| 317 | Ga0209563_107554 | 3300025230 | Bacteria | 1775 |
| 318 | Ga0207427_101122 | 3300025231 | Bacteria | 10700 |
| 319 | Ga0209258_100033 | 3300025242 | Bacteria | 443845 |
| 320 | Ga0209258_100309 | 3300025242 | Bacteria | 76791 |
| 321 | Ga0207425_1000195 | 3300025245 | Bacteria | 48597 |
| 322 | Ga0209148_1000046 | 3300025254 | Bacteria | 443881 |
| 323 | Ga0209148_1002429 | 3300025254 | Bacteria | 6428 |
| 324 | Ga0209759_1000092 | 3300025256 | Bacteria | 161238 |
| 325 | Ga0209759_1000184 | 3300025256 | Bacteria | 100691 |
| 326 | Ga0209759_1001030 | 3300025256 | Bacteria | 18717 |
| 327 | Ga0209129_1000043 | 3300025258 | Bacteria | 298978 |
| 328 | Ga0209129_1008010 | 3300025258 | Bacteria | 3012 |
| 329 | Ga0209233_1000050 | 3300025261 | Bacteria | 450736 |
| 330 | Ga0209455_1000038 | 3300025272 | Bacteria | 443899 |
| 331 | Ga0209130_1003268 | 3300025284 | Bacteria | 7076 |
| 332 | Ga0209675_1001354 | 3300025291 | Bacteria | 14457 |
| 333 | Ga0209676_1015349 | 3300025292 | Bacteria | 2822 |
| 334 | Ga0209564_1000014 | 3300025295 | Bacteria | 621501 |
| 335 | Ga0209564_1004662 | 3300025295 | Bacteria | 8233 |
| 336 | Ga0209758_1000045 | 3300025297 | Bacteria | 369174 |
| 337 | Ga0209758_1000093 | 3300025297 | Bacteria | 241169 |
| 338 | Ga0209050_1000179 | 3300025298 | Bacteria | 143878 |
| 339 | Ga0207426_1000007 | 3300025302 | Bacteria | 971011 |
| 340 | Ga0209051_1004773 | 3300025303 | Bacteria | 8180 |
| 341 | Ga0209051_1028007 | 3300025303 | Bacteria | 2234 |
| 342 | Ga0209257_1008045 | 3300025304 | Bacteria | 6139 |
| 343 | Ga0209257_1037250 | 3300025304 | Bacteria | 1484 |
| 344 | Ga0207697_10038786 | 3300025315 | Bacteria | 1954 |
| 345 | Ga0207656_10032317 | 3300025321 | Bacteria | 2173 |
| 346 | Ga0207696_1004123 | 3300025711 | Bacteria | 6355 |
| 347 | Ga0207696_1007974 | 3300025711 | Bacteria | 4094 |
| 348 | Ga0207713_1000137 | 3300025735 | Bacteria | 111281 |
| 349 | Ga0207682_10001694 | 3300025893 | Bacteria | 10093 |
| 350 | Ga0207682_10007864 | 3300025893 | Bacteria | 4236 |
| 351 | Ga0207682_10010588 | 3300025893 | Bacteria | 3610 |
| 352 | Ga0207682_10049059 | 3300025893 | Bacteria | 1742 |
| 353 | Ga0207642_10017603 | 3300025899 | Bacteria | 2722 |
| 354 | Ga0207688_10033295 | 3300025901 | Bacteria | 2850 |
| 355 | Ga0207688_10194248 | 3300025901 | Bacteria | 1215 |
| 356 | Ga0207680_10003579 | 3300025903 | Bacteria | 7300 |
| 357 | Ga0207680_10016311 | 3300025903 | Bacteria | 3897 |
| 358 | Ga0207680_10271975 | 3300025903 | Bacteria | 1175 |
| 359 | Ga0207647_10006921 | 3300025904 | Bacteria | 8220 |
| 360 | Ga0207647_10012090 | 3300025904 | Bacteria | 6025 |
| 361 | Ga0207647_10019129 | 3300025904 | Bacteria | 4611 |
| 362 | Ga0207645_10009352 | 3300025907 | Bacteria | 6785 |
| 363 | Ga0207645_10036363 | 3300025907 | Bacteria | 3162 |
| 364 | Ga0207645_10080334 | 3300025907 | Bacteria | 2090 |
| 365 | Ga0207643_10075134 | 3300025908 | Bacteria | 1950 |
| 366 | Ga0207705_10043309 | 3300025909 | Bacteria | 3234 |
| 367 | Ga0207684_10008277 | 3300025910 | Bacteria | 9258 |
| 368 | Ga0207695_10014314 | 3300025913 | Bacteria | 9406 |
| 369 | Ga0207695_10017431 | 3300025913 | Bacteria | 8359 |
| 370 | Ga0207695_10045352 | 3300025913 | Bacteria | 4667 |
| 371 | Ga0207671_10006439 | 3300025914 | Bacteria | 10453 |
| 372 | Ga0207671_10032972 | 3300025914 | Bacteria | 3855 |
| 373 | Ga0207671_10287653 | 3300025914 | Bacteria | 1297 |
| 374 | Ga0207662_10045110 | 3300025918 | Bacteria | 2605 |
| 375 | Ga0207657_10000044 | 3300025919 | Bacteria | 116398 |
| 376 | Ga0207649_10022538 | 3300025920 | Bacteria | 3639 |
| 377 | Ga0207646_10063618 | 3300025922 | Bacteria | 3294 |
| 378 | Ga0207681_10001232 | 3300025923 | Bacteria | 16486 |
| 379 | Ga0207681_10009831 | 3300025923 | Bacteria | 5850 |
| 380 | Ga0207681_10125031 | 3300025923 | Bacteria | 1892 |
| 381 | Ga0207694_10004421 | 3300025924 | Bacteria | 10990 |
| 382 | Ga0207650_10001921 | 3300025925 | Bacteria | 14641 |
| 383 | Ga0207650_10013206 | 3300025925 | Bacteria | 5715 |
| 384 | Ga0207650_10136246 | 3300025925 | Bacteria | 1926 |
| 385 | Ga0207650_10159844 | 3300025925 | Bacteria | 1784 |
| 386 | Ga0207650_10347055 | 3300025925 | Bacteria | 1220 |
| 387 | Ga0207659_10001177 | 3300025926 | Bacteria | 15618 |
| 388 | Ga0207659_10006801 | 3300025926 | Bacteria | 7030 |
| 389 | Ga0207659_10011942 | 3300025926 | Bacteria | 5502 |
| 390 | Ga0207659_10021070 | 3300025926 | Bacteria | 4320 |
| 391 | Ga0207659_10024965 | 3300025926 | Bacteria | 4012 |
| 392 | Ga0207659_10049968 | 3300025926 | Bacteria | 2969 |
| 393 | Ga0207659_10149963 | 3300025926 | Bacteria | 1820 |
| 394 | Ga0207687_10057000 | 3300025927 | Bacteria | 2743 |
| 395 | Ga0207687_10092606 | 3300025927 | Bacteria | 2207 |
| 396 | Ga0207644_10002024 | 3300025931 | Bacteria | 13104 |
| 397 | Ga0207644_10002325 | 3300025931 | Bacteria | 12293 |
| 398 | Ga0207644_10030839 | 3300025931 | Bacteria | 3732 |
| 399 | Ga0207644_10039496 | 3300025931 | Bacteria | 3331 |
| 400 | Ga0207644_10085743 | 3300025931 | Bacteria | 2337 |
| 401 | Ga0207690_10000046 | 3300025932 | Bacteria | 116358 |
| 402 | Ga0207690_10111694 | 3300025932 | Bacteria | 1970 |
| 403 | Ga0207706_10023708 | 3300025933 | Bacteria | 5507 |
| 404 | Ga0207706_10083831 | 3300025933 | Bacteria | 2802 |
| 405 | Ga0207706_10318923 | 3300025933 | Bacteria | 1353 |
| 406 | Ga0207686_10001251 | 3300025934 | Bacteria | 14694 |
| 407 | Ga0207709_10000070 | 3300025935 | Bacteria | 183020 |
| 408 | Ga0207709_10000927 | 3300025935 | Bacteria | 22075 |
| 409 | Ga0207709_10027363 | 3300025935 | Bacteria | 3284 |
| 410 | Ga0207709_10111752 | 3300025935 | Bacteria | 1828 |
| 411 | Ga0207669_10006914 | 3300025937 | Bacteria | 5218 |
| 412 | Ga0207669_10054587 | 3300025937 | Bacteria | 2414 |
| 413 | Ga0207669_10087570 | 3300025937 | Bacteria | 2017 |
| 414 | Ga0207704_10002634 | 3300025938 | Bacteria | 8100 |
| 415 | Ga0207704_10006601 | 3300025938 | Bacteria | 5428 |
| 416 | Ga0207704_10105642 | 3300025938 | Bacteria | 1889 |
| 417 | Ga0207704_10138806 | 3300025938 | Bacteria | 1697 |
| 418 | Ga0207691_10016058 | 3300025940 | Bacteria | 7112 |
| 419 | Ga0207691_10022141 | 3300025940 | Bacteria | 5996 |
| 420 | Ga0207691_10031519 | 3300025940 | Bacteria | 4947 |
| 421 | Ga0207691_10067728 | 3300025940 | Bacteria | 3227 |
| 422 | Ga0207691_10123981 | 3300025940 | Bacteria | 2287 |
| 423 | Ga0207691_10261956 | 3300025940 | Bacteria | 1490 |
| 424 | Ga0207691_10433162 | 3300025940 | Bacteria | 1120 |
| 425 | Ga0207711_10014582 | 3300025941 | Bacteria | 6531 |
| 426 | Ga0207711_10018363 | 3300025941 | Bacteria | 5813 |
| 427 | Ga0207711_10036332 | 3300025941 | Bacteria | 4180 |
| 428 | Ga0207689_10007049 | 3300025942 | Bacteria | 9881 |
| 429 | Ga0207689_10025384 | 3300025942 | Bacteria | 4965 |
| 430 | Ga0207689_10078217 | 3300025942 | Bacteria | 2718 |
| 431 | Ga0207689_10081490 | 3300025942 | Bacteria | 2660 |
| 432 | Ga0207661_10259861 | 3300025944 | Bacteria | 1546 |
| 433 | Ga0207679_10177924 | 3300025945 | Bacteria | 1757 |
| 434 | Ga0207679_10243849 | 3300025945 | Bacteria | 1524 |
| 435 | Ga0207667_10014884 | 3300025949 | Bacteria | 8846 |
| 436 | Ga0207651_10001929 | 3300025960 | Bacteria | 9737 |
| 437 | Ga0207651_10006366 | 3300025960 | Bacteria | 6172 |
| 438 | Ga0207651_10094819 | 3300025960 | Bacteria | 2196 |
| 439 | Ga0207651_10134956 | 3300025960 | Bacteria | 1896 |
| 440 | Ga0207712_10005762 | 3300025961 | Bacteria | 7808 |
| 441 | Ga0207712_10098221 | 3300025961 | Bacteria | 2171 |
| 442 | Ga0207712_10433300 | 3300025961 | Bacteria | 1112 |
| 443 | Ga0207668_10087254 | 3300025972 | Bacteria | 2281 |
| 444 | Ga0207668_10541297 | 3300025972 | Bacteria | 1007 |
| 445 | Ga0207658_10000904 | 3300025986 | Bacteria | 24667 |
| 446 | Ga0207658_10015874 | 3300025986 | Bacteria | 5171 |
| 447 | Ga0207658_10023294 | 3300025986 | Bacteria | 4321 |
| 448 | Ga0207658_10050286 | 3300025986 | Bacteria | 3067 |
| 449 | Ga0207677_10004432 | 3300026023 | Bacteria | 7537 |
| 450 | Ga0207677_10200968 | 3300026023 | Bacteria | 1584 |
| 451 | Ga0207677_10284310 | 3300026023 | Bacteria | 1359 |
| 452 | Ga0207703_10001363 | 3300026035 | Bacteria | 22299 |
| 453 | Ga0207703_10002141 | 3300026035 | Bacteria | 17356 |
| 454 | Ga0207703_10006196 | 3300026035 | Bacteria | 9571 |
| 455 | Ga0207703_10348070 | 3300026035 | Bacteria | 1364 |
| 456 | Ga0207639_10052511 | 3300026041 | Bacteria | 3106 |
| 457 | Ga0207639_10087522 | 3300026041 | Bacteria | 2483 |
| 458 | Ga0207639_10236436 | 3300026041 | Bacteria | 1586 |
| 459 | Ga0207639_10393960 | 3300026041 | Bacteria | 1246 |
| 460 | Ga0207678_10000397 | 3300026067 | Bacteria | 39814 |
| 461 | Ga0207678_10085322 | 3300026067 | Bacteria | 2700 |
| 462 | Ga0207678_10124479 | 3300026067 | Bacteria | 2200 |
| 463 | Ga0207708_10016069 | 3300026075 | Bacteria | 5621 |
| 464 | Ga0207708_10023525 | 3300026075 | Bacteria | 4659 |
| 465 | Ga0207708_10260305 | 3300026075 | Bacteria | 1400 |
| 466 | Ga0207702_10035517 | 3300026078 | Bacteria | 4168 |
| 467 | Ga0207702_10148402 | 3300026078 | Bacteria | 2131 |
| 468 | Ga0207641_10012827 | 3300026088 | Bacteria | 6871 |
| 469 | Ga0207641_10017565 | 3300026088 | Bacteria | 5857 |
| 470 | Ga0207641_10024475 | 3300026088 | Bacteria | 4976 |
| 471 | Ga0207641_10052054 | 3300026088 | Bacteria | 3467 |
| 472 | Ga0207641_10069098 | 3300026088 | Bacteria | 3031 |
| 473 | Ga0207641_10069896 | 3300026088 | Bacteria | 3016 |
| 474 | Ga0207641_10219996 | 3300026088 | Bacteria | 1760 |
| 475 | Ga0207648_10000776 | 3300026089 | Bacteria | 35970 |
| 476 | Ga0207648_10001858 | 3300026089 | Bacteria | 23063 |
| 477 | Ga0207648_10005756 | 3300026089 | Bacteria | 12420 |
| 478 | Ga0207648_10014208 | 3300026089 | Bacteria | 7364 |
| 479 | Ga0207648_10031752 | 3300026089 | Bacteria | 4667 |
| 480 | Ga0207648_10042815 | 3300026089 | Bacteria | 3976 |
| 481 | Ga0207648_10067429 | 3300026089 | Bacteria | 3119 |
| 482 | Ga0207648_10069535 | 3300026089 | Bacteria | 3067 |
| 483 | Ga0207648_10112073 | 3300026089 | Bacteria | 2395 |
| 484 | Ga0207648_10197560 | 3300026089 | Bacteria | 1784 |
| 485 | Ga0207676_10008217 | 3300026095 | Bacteria | 7428 |
| 486 | Ga0207676_10015110 | 3300026095 | Bacteria | 5567 |
| 487 | Ga0207676_10016149 | 3300026095 | Bacteria | 5402 |
| 488 | Ga0207676_10031088 | 3300026095 | Bacteria | 4013 |
| 489 | Ga0207676_10042314 | 3300026095 | Bacteria | 3503 |
| 490 | Ga0207676_10132079 | 3300026095 | Bacteria | 2124 |
| 491 | Ga0207676_10190773 | 3300026095 | Bacteria | 1803 |
| 492 | Ga0207676_10311016 | 3300026095 | Bacteria | 1442 |
| 493 | Ga0207674_10095218 | 3300026116 | Bacteria | 2964 |
| 494 | Ga0207675_100001673 | 3300026118 | Bacteria | 22193 |
| 495 | Ga0207675_100001979 | 3300026118 | Bacteria | 20426 |
| 496 | Ga0207675_100014813 | 3300026118 | Bacteria | 7277 |
| 497 | Ga0207675_100024619 | 3300026118 | Bacteria | 5597 |
| 498 | Ga0207675_100329984 | 3300026118 | Bacteria | 1491 |
| 499 | Ga0207683_10013438 | 3300026121 | Bacteria | 6985 |
| 500 | Ga0207683_10077142 | 3300026121 | Bacteria | 2951 |
| 501 | Ga0207683_10099201 | 3300026121 | Bacteria | 2599 |
| 502 | Ga0207698_10002517 | 3300026142 | Bacteria | 10872 |
| 503 | Ga0207698_10015201 | 3300026142 | Bacteria | 5149 |
| 504 | Ga0207698_10034213 | 3300026142 | Bacteria | 3702 |
| 505 | Ga0207698_10064331 | 3300026142 | Bacteria | 2874 |
| 506 | Ga0207698_10075826 | 3300026142 | Bacteria | 2689 |
| 507 | Ga0207698_10084291 | 3300026142 | Bacteria | 2576 |
| 508 | Ga0207698_10343514 | 3300026142 | Bacteria | 1407 |
| 509 | Ga0209281_1000029 | 3300027111 | Bacteria | 431495 |
| 510 | Ga0209371_1007636 | 3300027312 | Bacteria | 3731 |
| 511 | Ga0209813_10019682 | 3300027866 | Bacteria | 1879 |
| 512 | Ga0268266_10401825 | 3300028379 | Bacteria | 1295 |
| 513 | Ga0268265_10481693 | 3300028380 | Bacteria | 1165 |
| 514 | Ga0268264_10005843 | 3300028381 | Bacteria | 10425 |
| 515 | Ga0268264_10012862 | 3300028381 | Bacteria | 6884 |
| 516 | Ga0268264_10015703 | 3300028381 | Bacteria | 6202 |
| 517 | Ga0268264_10584062 | 3300028381 | Bacteria | 1099 |
| 518 | Ga0307517_10003186 | 3300028786 | Bacteria | 25769 |
| 519 | Ga0307515_10070107 | 3300028794 | Bacteria | 4777 |
| 520 | Ga0307515_10143238 | 3300028794 | Bacteria | 2549 |
| 521 | Ga0307515_10171943 | 3300028794 | Bacteria | 2155 |
| 522 | Ga0265338_10000087 | 3300028800 | Bacteria | 174926 |
| 523 | Ga0265338_10001953 | 3300028800 | Bacteria | 32164 |
| 524 | Ga0268256_1005918 | 3300030500 | Bacteria | 4677 |
| 525 | Ga0307512_10013762 | 3300030522 | Bacteria | 7566 |
| 526 | Ga0307513_10043962 | 3300031456 | Bacteria | 4899 |
| 527 | Ga0307513_10071654 | 3300031456 | Bacteria | 3615 |
| 528 | Ga0307513_10107184 | 3300031456 | Bacteria | 2798 |
| 529 | Ga0307509_10186609 | 3300031507 | Bacteria | 1931 |
| 530 | Ga0307408_100000133 | 3300031548 | Bacteria | 82744 |
| 531 | Ga0307408_100001327 | 3300031548 | Bacteria | 18551 |
| 532 | Ga0307508_10004667 | 3300031616 | Bacteria | 13294 |
| 533 | Ga0307514_10001425 | 3300031649 | Bacteria | 29406 |
| 534 | Ga0307514_10074222 | 3300031649 | Bacteria | 2540 |
| 535 | Ga0307514_10103211 | 3300031649 | Bacteria | 2042 |
| 536 | Ga0307516_10003676 | 3300031730 | Bacteria | 19502 |
| 537 | Ga0307516_10033347 | 3300031730 | Bacteria | 5181 |
| 538 | Ga0307516_10120823 | 3300031730 | Bacteria | 2410 |
| 539 | Ga0307405_10005542 | 3300031731 | Bacteria | 6100 |
| 540 | Ga0307405_10197724 | 3300031731 | Bacteria | 1457 |
| 541 | Ga0307413_10178410 | 3300031824 | Bacteria | 1511 |
| 542 | Ga0307413_10268250 | 3300031824 | Bacteria | 1276 |
| 543 | Ga0307410_10019091 | 3300031852 | Bacteria | 4162 |
| 544 | Ga0307406_10002490 | 3300031901 | Bacteria | 10042 |
| 545 | Ga0307406_10051459 | 3300031901 | Bacteria | 2615 |
| 546 | Ga0307406_10127565 | 3300031901 | Bacteria | 1780 |
| 547 | Ga0307412_10000011 | 3300031911 | Bacteria | 405842 |
| 548 | Ga0307412_10015249 | 3300031911 | Bacteria | 4550 |
| 549 | Ga0307409_100217192 | 3300031995 | Bacteria | 1723 |
| 550 | Ga0307416_100001839 | 3300032002 | Bacteria | 11830 |
| 551 | Ga0307416_100051118 | 3300032002 | Bacteria | 3299 |
| 552 | Ga0307416_100134298 | 3300032002 | Bacteria | 2235 |
| 553 | Ga0307414_10241580 | 3300032004 | Bacteria | 1495 |
| 554 | Ga0307411_10001139 | 3300032005 | Bacteria | 10411 |
| 555 | Ga0307411_10227192 | 3300032005 | Bacteria | 1452 |
| 556 | Ga0307510_10003680 | 3300033180 | Bacteria | 17902 |
| 557 | Ga0373928_0034957 | 3300035084 | Bacteria | 1130 |
| 558 | Ga0373932_0048393 | 3300035112 | Bacteria | 1253 |
| 559 | Ga0373957_0100557 | 3300035120 | Bacteria | 1157 |
| 560 | Ga0373955_0169842 | 3300035172 | Bacteria | 1290 |
| 561 | Ga0373931_0078453 | 3300035691 | Bacteria | 1817 |
| 562 | Ga0373931_0091382 | 3300035691 | Bacteria | 1696 |
| 563 | Ga0373927_0197037 | 3300035695 | Bacteria | 1322 |
| 564 | Ga0373937_0012935 | 3300036401 | Bacteria | 7351 |
| 565 | Ga0373937_0241402 | 3300036401 | Bacteria | 1702 |
| 566 | Ga0373937_0414808 | 3300036401 | Bacteria | 1278 |
| 567 | Ga0373925_0112048 | 3300037068 | Bacteria | 2109 |
| 568 | Ga0395899_0000421 | 3300037312 | Bacteria | 49097 |
| 569 | Ga0395899_0019968 | 3300037312 | Bacteria | 5083 |
| 570 | Ga0395899_0024082 | 3300037312 | Bacteria | 4605 |
| 571 | Ga0395900_0000159 | 3300037418 | Bacteria | 111486 |
| 572 | Ga0395900_0019146 | 3300037418 | Bacteria | 6981 |
| 573 | Ga0395900_0050398 | 3300037418 | Bacteria | 4288 |
| 574 | Ga0395898_0000425 | 3300037466 | Bacteria | 89768 |
| 575 | Ga0395898_0007545 | 3300037466 | Bacteria | 11551 |
| 576 | Ga0395898_0029225 | 3300037466 | Bacteria | 5523 |
| 577 | Ga0395905_0000079 | 3300037471 | Bacteria | 160663 |
| 578 | Ga0395905_0000235 | 3300037471 | Bacteria | 83772 |
| 579 | Ga0395905_0044852 | 3300037471 | Bacteria | 4147 |
| 580 | Ga0395905_0102595 | 3300037471 | Bacteria | 2685 |
| 581 | Ga0395905_0162640 | 3300037471 | Bacteria | 2097 |
| 582 | Ga0395901_0000109 | 3300038443 | Bacteria | 112882 |
| 583 | Ga0395901_0072550 | 3300038443 | Bacteria | 3589 |
| 584 | Ga0436360_0682679 | 3300039438 | Bacteria | 2970 |
| 585 | Ga0436361_0621765 | 3300039447 | Bacteria | 1432 |
| 586 | Ga0436363_0993833 | 3300039450 | Bacteria | 1875 |
| 587 | Ga0451798_0026603 | 3300041458 | Bacteria | 2013 |
| 588 | Ga0451849_0292172 | 3300041505 | Bacteria | 997 |
| 589 | Ga0466964_0053842 | 3300044706 | Bacteria | 1657 |
| 590 | Ga0453684_0016340 | 3300044712 | Bacteria | 11615 |
| 591 | Ga0466971_0025669 | 3300044719 | Bacteria | 2631 |
| 592 | Ga0466970_0128725 | 3300044765 | Bacteria | 1390 |
| 593 | Ga0466957_0040153 | 3300044842 | Bacteria | 2826 |
| 594 | Ga0466957_0131084 | 3300044842 | Bacteria | 1606 |
| 595 | Ga0466960_0245797 | 3300044901 | Bacteria | 992 |
| 596 | Ga0466959_0031417 | 3300045049 | Bacteria | 3928 |
| 597 | Ga0451576_0288014 | 3300045051 | Bacteria | 1717 |
| 598 | Ga0466958_0123287 | 3300045836 | Bacteria | 1623 |
| 599 | Ga0466958_0191280 | 3300045836 | Bacteria | 1301 |
| 600 | Ga0495592_0000418 | 3300046454 | Bacteria | 32266 |
| 601 | Ga0495592_0007034 | 3300046454 | Bacteria | 8413 |
| 602 | Ga0495592_0103513 | 3300046454 | Bacteria | 2025 |
| 603 | Ga0495603_0037029 | 3300046455 | Bacteria | 2927 |
| 604 | Ga0495590_0021156 | 3300046457 | Bacteria | 2308 |
| 605 | Ga0495591_003062 | 3300046458 | Bacteria | 8878 |
| 606 | Ga0495629_0000350 | 3300046459 | Bacteria | 39162 |
| 607 | Ga0495629_0001209 | 3300046459 | Bacteria | 20272 |
| 608 | Ga0495629_0038290 | 3300046459 | Bacteria | 3378 |
| 609 | Ga0495629_0157943 | 3300046459 | Bacteria | 1575 |
| 610 | Ga0495638_0013760 | 3300046460 | Bacteria | 5494 |
| 611 | Ga0495641_0009348 | 3300046461 | Bacteria | 5831 |
| 612 | Ga0495651_0076444 | 3300046462 | Bacteria | 2536 |
| 613 | Ga0495651_0084160 | 3300046462 | Bacteria | 2397 |
| 614 | Ga0495651_0114900 | 3300046462 | Bacteria | 1985 |
| 615 | Ga0495653_0003248 | 3300046463 | Bacteria | 13043 |
| 616 | Ga0495653_0046903 | 3300046463 | Bacteria | 3343 |
| 617 | Ga0495653_0110072 | 3300046463 | Bacteria | 1981 |
| 618 | Ga0495650_0026543 | 3300046471 | Bacteria | 2692 |
| 619 | Ga0495650_0027151 | 3300046471 | Bacteria | 2651 |
| 620 | Ga0495650_0035337 | 3300046471 | Bacteria | 2200 |
| 621 | Ga0495650_0076264 | 3300046471 | Bacteria | 1303 |
| 622 | Ga0495580_0000001 | 3300046472 | Bacteria | 180598 |
| 623 | Ga0495580_0002480 | 3300046472 | Bacteria | 16100 |
| 624 | Ga0495580_0063709 | 3300046472 | Bacteria | 2584 |
| 625 | Ga0495580_0334664 | 3300046472 | Bacteria | 1027 |
| 626 | Ga0495582_0004973 | 3300046473 | Bacteria | 7447 |
| 627 | Ga0495582_0014067 | 3300046473 | Bacteria | 4404 |
| 628 | Ga0495582_0035867 | 3300046473 | Bacteria | 2728 |
| 629 | Ga0495582_0229203 | 3300046473 | Bacteria | 1063 |
| 630 | Ga0495605_0001893 | 3300046474 | Bacteria | 13371 |
| 631 | Ga0495662_0026903 | 3300046476 | Bacteria | 2778 |
| 632 | Ga0495664_0020285 | 3300046477 | Bacteria | 3832 |
| 633 | Ga0495664_0023953 | 3300046477 | Bacteria | 3544 |
| 634 | Ga0495664_0153708 | 3300046477 | Bacteria | 1396 |
| 635 | Ga0495584_0079282 | 3300046491 | Bacteria | 1652 |
| 636 | Ga0495596_0005022 | 3300046500 | Bacteria | 6328 |
| 637 | Ga0495583_0020828 | 3300046506 | Bacteria | 3385 |
| 638 | Ga0495583_0057200 | 3300046506 | Bacteria | 1755 |
| 639 | Ga0495606_0015750 | 3300046507 | Bacteria | 5806 |
| 640 | Ga0495606_0024992 | 3300046507 | Bacteria | 4288 |
| 641 | Ga0495606_0050987 | 3300046507 | Bacteria | 2702 |
| 642 | Ga0495608_0004602 | 3300046511 | Bacteria | 9848 |
| 643 | Ga0495608_0005829 | 3300046511 | Bacteria | 8774 |
| 644 | Ga0495610_0005342 | 3300046512 | Bacteria | 9168 |
| 645 | Ga0495610_0030325 | 3300046512 | Bacteria | 2836 |
| 646 | Ga0495618_0000415 | 3300046514 | Bacteria | 30705 |
| 647 | Ga0495618_0014000 | 3300046514 | Bacteria | 4883 |
| 648 | Ga0495620_0032334 | 3300046515 | Bacteria | 2385 |
| 649 | Ga0495620_0036672 | 3300046515 | Bacteria | 2192 |
| 650 | Ga0495620_0040499 | 3300046515 | Bacteria | 2049 |
| 651 | Ga0495628_0019378 | 3300046516 | Bacteria | 5625 |
| 652 | Ga0495628_0137787 | 3300046516 | Bacteria | 1864 |
| 653 | Ga0495628_0139498 | 3300046516 | Bacteria | 1850 |
| 654 | Ga0495628_0187322 | 3300046516 | Bacteria | 1563 |
| 655 | Ga0495630_0018394 | 3300046517 | Bacteria | 5134 |
| 656 | Ga0495630_0089207 | 3300046517 | Bacteria | 2329 |
| 657 | Ga0495630_0120123 | 3300046517 | Bacteria | 1993 |
| 658 | Ga0495630_0274257 | 3300046517 | Bacteria | 1288 |
| 659 | Ga0495631_0125023 | 3300046518 | Bacteria | 1106 |
| 660 | Ga0495632_0005034 | 3300046519 | Bacteria | 8845 |
| 661 | Ga0495643_0039315 | 3300046522 | Bacteria | 2588 |
| 662 | Ga0495648_0008606 | 3300046524 | Bacteria | 8004 |
| 663 | Ga0495648_0021032 | 3300046524 | Bacteria | 4531 |
| 664 | Ga0495648_0034993 | 3300046524 | Bacteria | 3260 |
| 665 | Ga0495648_0170953 | 3300046524 | Bacteria | 1114 |
| 666 | Ga0495666_0063871 | 3300046526 | Bacteria | 1757 |
| 667 | Ga0495652_0027306 | 3300046529 | Bacteria | 5030 |
| 668 | Ga0495652_0041987 | 3300046529 | Bacteria | 3944 |
| 669 | Ga0495665_0003698 | 3300046531 | Bacteria | 8292 |
| 670 | Ga0495665_0016798 | 3300046531 | Bacteria | 3939 |
| 671 | Ga0495665_0028597 | 3300046531 | Bacteria | 2988 |
| 672 | Ga0495665_0048732 | 3300046531 | Bacteria | 2246 |
| 673 | Ga0495640_0001146 | 3300046533 | Bacteria | 20691 |
| 674 | Ga0495640_0012264 | 3300046533 | Bacteria | 6557 |
| 675 | Ga0495640_0055085 | 3300046533 | Bacteria | 2721 |
| 676 | Ga0495586_0020369 | 3300046535 | Bacteria | 3532 |
| 677 | Ga0495587_0003091 | 3300046536 | Bacteria | 11119 |
| 678 | Ga0495598_0075374 | 3300046537 | Bacteria | 1071 |
| 679 | Ga0495609_0095884 | 3300046538 | Bacteria | 1287 |
| 680 | Ga0495621_0023505 | 3300046539 | Bacteria | 2051 |
| 681 | Ga0495597_0014933 | 3300046542 | Bacteria | 3688 |
| 682 | Ga0495597_0042423 | 3300046542 | Bacteria | 2029 |
| 683 | Ga0495597_0129708 | 3300046542 | Bacteria | 1046 |
| 684 | Ga0495645_0031906 | 3300046543 | Bacteria | 3841 |
| 685 | Ga0495645_0052270 | 3300046543 | Bacteria | 2973 |
| 686 | Ga0495645_0140066 | 3300046543 | Bacteria | 1688 |
| 687 | Ga0495622_0000323 | 3300046557 | Bacteria | 35189 |
| 688 | Ga0495634_0012967 | 3300046642 | Bacteria | 6031 |
| 689 | Ga0495634_0124082 | 3300046642 | Bacteria | 1651 |
| 690 | Ga0495634_0185989 | 3300046642 | Bacteria | 1298 |
| 691 | Ga0495611_0059503 | 3300046648 | Bacteria | 1734 |
| 692 | Ga0495625_0031755 | 3300046660 | Bacteria | 3925 |
| 693 | Ga0495625_0072125 | 3300046660 | Bacteria | 2422 |
| 694 | Ga0495635_0000381 | 3300046663 | Bacteria | 28175 |
| 695 | Ga0495635_0014539 | 3300046663 | Bacteria | 5505 |
| 696 | Ga0495635_0049797 | 3300046663 | Bacteria | 2888 |
| 697 | Ga0495635_0202067 | 3300046663 | Bacteria | 1347 |
| 698 | Ga0495661_0005116 | 3300046665 | Bacteria | 9347 |
| 699 | Ga0495588_0070491 | 3300046674 | Bacteria | 1817 |
| 700 | Ga0495588_0213223 | 3300046674 | Bacteria | 1019 |
| 701 | Ga0495657_0033057 | 3300046675 | Bacteria | 3605 |
| 702 | Ga0495599_0018350 | 3300046678 | Bacteria | 4359 |
| 703 | Ga0495599_0058678 | 3300046678 | Bacteria | 2407 |
| 704 | Ga0495623_0036924 | 3300046679 | Bacteria | 3129 |
| 705 | Ga0495623_0051850 | 3300046679 | Bacteria | 2594 |
| 706 | Ga0495623_0073104 | 3300046679 | Bacteria | 2131 |
| 707 | Ga0495623_0126886 | 3300046679 | Bacteria | 1531 |
| 708 | Ga0495646_0003092 | 3300046680 | Bacteria | 10325 |
| 709 | Ga0495646_0004800 | 3300046680 | Bacteria | 8535 |
| 710 | Ga0495646_0007653 | 3300046680 | Bacteria | 6865 |
| 711 | Ga0495647_0055566 | 3300046681 | Bacteria | 1550 |
| 712 | Ga0495658_0005455 | 3300046683 | Bacteria | 6253 |
| 713 | Ga0495613_0002613 | 3300046689 | Bacteria | 13546 |
| 714 | Ga0495613_0010209 | 3300046689 | Bacteria | 6976 |
| 715 | Ga0495613_0076364 | 3300046689 | Bacteria | 2438 |
| 716 | Ga0495624_0001552 | 3300046690 | Bacteria | 17745 |
| 717 | Ga0495624_0022060 | 3300046690 | Bacteria | 4214 |
| 718 | Ga0495624_0032776 | 3300046690 | Bacteria | 3367 |
| 719 | Ga0495624_0037196 | 3300046690 | Bacteria | 3134 |
| 720 | Ga0495624_0223455 | 3300046690 | Bacteria | 1141 |
| 721 | Ga0495671_0035075 | 3300046692 | Bacteria | 2549 |
| 722 | Ga0495671_0101963 | 3300046692 | Bacteria | 1402 |
| 723 | Ga0495671_0144278 | 3300046692 | Bacteria | 1160 |
| 724 | Ga0495649_0006372 | 3300046694 | Bacteria | 7345 |
| 725 | Ga0495649_0020638 | 3300046694 | Bacteria | 3693 |
| 726 | Ga0495649_0137747 | 3300046694 | Bacteria | 1286 |
| 727 | Ga0495649_0237482 | 3300046694 | Bacteria | 939 |
| 728 | Ga0495589_0003386 | 3300046794 | Bacteria | 8644 |
| 729 | Ga0495589_0017621 | 3300046794 | Bacteria | 3665 |
| 730 | Ga0495589_0066001 | 3300046794 | Bacteria | 1773 |
| 731 | Ga0495600_0007815 | 3300046809 | Bacteria | 6548 |
| 732 | Ga0495600_0012622 | 3300046809 | Bacteria | 5288 |
| 733 | Ga0495660_0032774 | 3300046810 | Bacteria | 2917 |
| 734 | Ga0495660_0086243 | 3300046810 | Bacteria | 1639 |
| 735 | Ga0495581_0022908 | 3300047315 | Bacteria | 3618 |
| 736 | Ga0495581_0025220 | 3300047315 | Bacteria | 3447 |
| 737 | Ga0495604_0001718 | 3300047317 | Bacteria | 17961 |
| 738 | Ga0495604_0048198 | 3300047317 | Bacteria | 3314 |
| 739 | Ga0495604_0101071 | 3300047317 | Bacteria | 2119 |
| 740 | Ga0495604_0251980 | 3300047317 | Bacteria | 1203 |
| 741 | Ga0495674_0024129 | 3300047319 | Bacteria | 5596 |
| 742 | Ga0495674_0028979 | 3300047319 | Bacteria | 5043 |
| 743 | Ga0495674_0030646 | 3300047319 | Bacteria | 4889 |
| 744 | Ga0495674_0265431 | 3300047319 | Bacteria | 1409 |
| 745 | Ga0495672_0001486 | 3300047320 | Bacteria | 22986 |
| 746 | Ga0495672_0107830 | 3300047320 | Bacteria | 1499 |
| 747 | Ga0495676_0024342 | 3300047321 | Bacteria | 5243 |
| 748 | Ga0495676_0094485 | 3300047321 | Bacteria | 2227 |
| 749 | Ga0495676_0178137 | 3300047321 | Bacteria | 1491 |
| 750 | Ga0495676_0209718 | 3300047321 | Bacteria | 1348 |
| 751 | Ga0495680_0048068 | 3300047322 | Bacteria | 3352 |
| 752 | Ga0495680_0054890 | 3300047322 | Bacteria | 3091 |
| 753 | Ga0495680_0060598 | 3300047322 | Bacteria | 2916 |
| 754 | Ga0495680_0078177 | 3300047322 | Bacteria | 2504 |
| 755 | Ga0495683_0001965 | 3300047323 | Bacteria | 12832 |
| 756 | Ga0495683_0019876 | 3300047323 | Bacteria | 3464 |
| 757 | Ga0495683_0032511 | 3300047323 | Bacteria | 2657 |
| 758 | Ga0495683_0049973 | 3300047323 | Bacteria | 2093 |
| 759 | Ga0495687_000292 | 3300047443 | Bacteria | 65859 |
| 760 | Ga0495687_004028 | 3300047443 | Bacteria | 10202 |
| 761 | Ga0495687_053989 | 3300047443 | Bacteria | 1689 |
| 762 | Ga0495687_055158 | 3300047443 | Bacteria | 1663 |
| 763 | Ga0495675_0000784 | 3300047444 | Bacteria | 19640 |
| 764 | Ga0495675_0006186 | 3300047444 | Bacteria | 7324 |
| 765 | Ga0495675_0009654 | 3300047444 | Bacteria | 6011 |
| 766 | Ga0495675_0134339 | 3300047444 | Bacteria | 1536 |
| 767 | Ga0495679_000342 | 3300047446 | Bacteria | 36534 |
| 768 | Ga0495679_001336 | 3300047446 | Bacteria | 14249 |
| 769 | Ga0495679_006514 | 3300047446 | Bacteria | 5005 |
| 770 | Ga0495673_0008672 | 3300047469 | Bacteria | 5687 |
| 771 | Ga0495673_0017547 | 3300047469 | Bacteria | 3629 |
| 772 | Ga0495684_0064932 | 3300047471 | Bacteria | 2774 |
| 773 | Ga0495684_0148529 | 3300047471 | Bacteria | 1754 |
| 774 | Ga0495686_0001715 | 3300047472 | Bacteria | 22608 |
| 775 | Ga0495686_0009644 | 3300047472 | Bacteria | 6935 |
| 776 | Ga0495593_0008485 | 3300047673 | Bacteria | 5972 |
| 777 | Ga0495593_0042701 | 3300047673 | Bacteria | 2433 |
| 778 | Ga0495602_0004174 | 3300048088 | Bacteria | 15032 |
| 779 | Ga0495602_0110178 | 3300048088 | Bacteria | 2238 |
| 780 | Ga0495602_0134587 | 3300048088 | Bacteria | 1966 |
| 781 | Ga0495614_0002311 | 3300048089 | Bacteria | 8473 |
| 782 | Ga0495614_0010363 | 3300048089 | Bacteria | 4110 |
| 783 | Ga0495614_0015494 | 3300048089 | Bacteria | 3323 |
| 784 | Ga0495626_0008575 | 3300048091 | Bacteria | 5590 |
| 785 | Ga0495626_0072060 | 3300048091 | Bacteria | 1551 |
| 786 | Ga0496100_0112035 | 3300048903 | Bacteria | 1897 |
| 787 | Ga0496101_0001250 | 3300048904 | Bacteria | 15203 |
| 788 | Ga0496101_0090419 | 3300048904 | Bacteria | 2277 |
| 789 | Ga0496101_0364172 | 3300048904 | Bacteria | 1137 |
| 790 | Ga0496102_0002193 | 3300048905 | Bacteria | 16763 |
| 791 | Ga0496102_0190228 | 3300048905 | Bacteria | 1934 |
| 792 | Ga0496103_0002317 | 3300048906 | Bacteria | 12041 |
| 793 | Ga0496103_0009680 | 3300048906 | Bacteria | 5704 |
| 794 | Ga0496103_0275839 | 3300048906 | Bacteria | 1082 |
| 795 | Ga0496104_0007665 | 3300048907 | Bacteria | 9557 |
| 796 | Ga0496105_0077564 | 3300048908 | Bacteria | 2744 |
| 797 | Ga0496105_0416377 | 3300048908 | Bacteria | 1064 |
| 798 | Ga0496106_0000051 | 3300048909 | Bacteria | 95750 |
| 799 | Ga0496106_0048008 | 3300048909 | Bacteria | 3214 |
| 800 | Ga0496107_0061373 | 3300048910 | Bacteria | 2722 |
| 801 | Ga0496108_0036075 | 3300048911 | Bacteria | 4112 |
| 802 | Ga0496108_0117169 | 3300048911 | Bacteria | 2282 |
| 803 | Ga0496109_0284672 | 3300048912 | Bacteria | 1558 |
| 804 | Ga0496110_0169121 | 3300048913 | Bacteria | 1983 |
| 805 | Ga0496110_0679806 | 3300048913 | Bacteria | 930 |
| 806 | Ga0496112_0085244 | 3300048915 | Bacteria | 3126 |
| 807 | Ga0496113_0038065 | 3300048916 | Bacteria | 3534 |
| 808 | Ga0496113_0099632 | 3300048916 | Bacteria | 2251 |
| 809 | Ga0496114_0152801 | 3300048917 | Bacteria | 2003 |
| 810 | Ga0496116_0088893 | 3300048919 | Bacteria | 1886 |
| 811 | Ga0496116_0124794 | 3300048919 | Bacteria | 1481 |
| 812 | Ga0496116_0172593 | 3300048919 | Bacteria | 1170 |
| 813 | Ga0496117_0001476 | 3300048920 | Bacteria | 33776 |
| 814 | Ga0496117_0002745 | 3300048920 | Bacteria | 21589 |
| 815 | Ga0496117_0074720 | 3300048920 | Bacteria | 2255 |
| 816 | Ga0496117_0105394 | 3300048920 | Bacteria | 1772 |
| 817 | Ga0496117_0131554 | 3300048920 | Bacteria | 1515 |
| 818 | Ga0496118_0001841 | 3300048921 | Bacteria | 30372 |
| 819 | Ga0496118_0002994 | 3300048921 | Bacteria | 21830 |
| 820 | Ga0496118_0003375 | 3300048921 | Bacteria | 20179 |
| 821 | Ga0496118_0012483 | 3300048921 | Bacteria | 8145 |
| 822 | Ga0496118_0014012 | 3300048921 | Bacteria | 7530 |
| 823 | Ga0496118_0020217 | 3300048921 | Bacteria | 5913 |
| 824 | Ga0496118_0112447 | 3300048921 | Bacteria | 1802 |
| 825 | Ga0496119_0042024 | 3300048922 | Bacteria | 2903 |
| 826 | Ga0496121_0000639 | 3300048924 | Bacteria | 65359 |
| 827 | Ga0496121_0003125 | 3300048924 | Bacteria | 23912 |
| 828 | Ga0496121_0004422 | 3300048924 | Bacteria | 18925 |
| 829 | Ga0496121_0009350 | 3300048924 | Bacteria | 11291 |
| 830 | Ga0496121_0032381 | 3300048924 | Bacteria | 4753 |
| 831 | Ga0496126_0001778 | 3300048929 | Bacteria | 31840 |
| 832 | Ga0496126_0002490 | 3300048929 | Bacteria | 24787 |
| 833 | Ga0496126_0006608 | 3300048929 | Bacteria | 12910 |
| 834 | Ga0496126_0010712 | 3300048929 | Bacteria | 9578 |
| 835 | Ga0496126_0219721 | 3300048929 | Bacteria | 1597 |
| 836 | Ga0495682_0007651 | 3300049460 | Bacteria | 4288 |
| 837 | Ga0495682_0017449 | 3300049460 | Bacteria | 2708 |
| 838 | Ga0495682_0071906 | 3300049460 | Bacteria | 1245 |
| 839 | Ga0501206_002502 | 3300049653 | Bacteria | 2316 |
| 840 | Ga0501223_020910 | 3300049663 | Bacteria | 1281 |
| 841 | Ga0501252_006389 | 3300049682 | Bacteria | 1309 |
| 842 | Ga0501253_037805 | 3300049683 | Bacteria | 957 |
| 843 | Ga0501257_053152 | 3300049686 | Bacteria | 1013 |
| 844 | Ga0501265_001018 | 3300049762 | Bacteria | 3141 |
| 845 | nmdc:mga03683_14596_c1 | 3300050489 | Bacteria | 2319 |
| 846 | nmdc:mga03683_2386_c1 | 3300050489 | Bacteria | 5824 |
| 847 | nmdc:mga03n38_80742_c1 | 3300050490 | Bacteria | 1528 |
| 848 | nmdc:mga00v17_37965_c1 | 3300050491 | Bacteria | 2878 |
| 849 | nmdc:mga0yw44_144797_c1 | 3300050492 | Bacteria | 1546 |
| 850 | nmdc:mga0yw44_287378_c1 | 3300050492 | Bacteria | 1100 |
| 851 | nmdc:mga0k408_10932_c1 | 3300050493 | Bacteria | 4925 |
| 852 | nmdc:mga0k408_17492_c1 | 3300050493 | Bacteria | 3995 |
| 853 | nmdc:mga0k408_19702_c1 | 3300050493 | Bacteria | 3773 |
| 854 | nmdc:mga0k408_2227_c1 | 3300050493 | Bacteria | 10372 |
| 855 | nmdc:mga0k408_23154_c1 | 3300050493 | Bacteria | 3502 |
| 856 | nmdc:mga0k408_252_c1 | 3300050493 | Bacteria | 29077 |
| 857 | nmdc:mga0k408_2779_c1 | 3300050493 | Bacteria | 9306 |
| 858 | nmdc:mga0k408_4961_c1 | 3300050493 | Bacteria | 7053 |
| 859 | nmdc:mga0k408_6822_c1 | 3300050493 | Bacteria | 6089 |
| 860 | nmdc:mga0k408_83681_c1 | 3300050493 | Bacteria | 1871 |
| 861 | nmdc:mga0k408_9425_c1 | 3300050493 | Bacteria | 5260 |
| 862 | nmdc:mga06z11_181485_c1 | 3300050494 | Bacteria | 1214 |
| 863 | nmdc:mga06z11_192219_c1 | 3300050494 | Bacteria | 1182 |
| 864 | nmdc:mga06z11_263623_c1 | 3300050494 | Bacteria | 1017 |
| 865 | nmdc:mga04h51_23445_c1 | 3300050495 | Bacteria | 1879 |
| 866 | nmdc:mga07m45_134813_c1 | 3300050496 | Bacteria | 1429 |
| 867 | nmdc:mga07m45_143861_c1 | 3300050496 | Bacteria | 1382 |
| 868 | nmdc:mga07m45_1560_c1 | 3300050496 | Bacteria | 10545 |
| 869 | nmdc:mga07m45_37873_c1 | 3300050496 | Bacteria | 2691 |
| 870 | nmdc:mga07m45_4097_c1 | 3300050496 | Bacteria | 7112 |
| 871 | nmdc:mga07m45_55769_c1 | 3300050496 | Bacteria | 2234 |
| 872 | nmdc:mga07m45_8094_c1 | 3300050496 | Bacteria | 5391 |
| 873 | nmdc:mga05p37_602287_c1 | 3300050507 | Bacteria | 1240 |
| 874 | nmdc:mga0n895_179513_c1 | 3300050512 | Bacteria | 2148 |
| 875 | nmdc:mga0sz30_45608_c1 | 3300050516 | Bacteria | 1849 |
| 876 | nmdc:mga0sz30_55362_c1 | 3300050516 | Bacteria | 1688 |
| 877 | Ga0495601_0091512 | 3300053077 | Bacteria | 1958 |
| 878 | Ga0495595_0078578 | 3300053084 | Bacteria | 1569 |
| 879 | Ga0500578_0000039 | 3300053086 | Bacteria | 134602 |
| 880 | Ga0500578_0015477 | 3300053086 | Bacteria | 4901 |
| 881 | Ga0500644_0001167 | 3300053088 | Bacteria | 7607 |
| 882 | Ga0500644_0012107 | 3300053088 | Bacteria | 2377 |
| 883 | Ga0500594_0000907 | 3300053118 | Bacteria | 6356 |
| 884 | Ga0500628_008513 | 3300053129 | Bacteria | 1786 |
| 885 | Ga0500652_000804 | 3300053131 | Bacteria | 10512 |
| 886 | Ga0500559_0000176 | 3300053136 | Bacteria | 50699 |
| 887 | Ga0500568_0016616 | 3300053139 | Bacteria | 3266 |
| 888 | Ga0500568_0026693 | 3300053139 | Bacteria | 2422 |
| 889 | Ga0500590_002860 | 3300053148 | Bacteria | 7810 |
| 890 | Ga0500604_0022550 | 3300053151 | Bacteria | 1788 |
| 891 | Ga0500620_014684 | 3300053155 | Bacteria | 2194 |
| 892 | Ga0500622_0000770 | 3300053156 | Bacteria | 27847 |
| 893 | Ga0500622_0001562 | 3300053156 | Bacteria | 18102 |
| 894 | Ga0500645_006427 | 3300053730 | Bacteria | 4196 |
| 895 | Ga0587072_011357 | 3300059643 | Bacteria | 1456 |
| 896 | Ga0466962_0003292 | 3300061719 | Bacteria | 7676 |
| 897 | Ga0466962_0030813 | 3300061719 | Bacteria | 2568 |
| 898 | 2501073708 | 2501025501 | Bacteria | 7768574 |
| 899 | 2501078223 | 2501025502 | Bacteria | 9641094 |
| 900 | 2501409988 | 2501025504 | Bacteria | 8008976 |
| 901 | 2509131831 | 2508501125 | Bacteria | 7208311 |
| 902 | 2510252947 | 2510065045 | Bacteria | 7761063 |
| 903 | 2511089938 | 2510917013 | Bacteria | 9951648 |
| 904 | 2511095314 | 2510917014 | Bacteria | 8296963 |
| 905 | 2511104986 | 2510917015 | Bacteria | 7950052 |
| 906 | 2512346823 | 2512047030 | Bacteria | 9031815 |
| 907 | 2513554431 | 2513237082 | Bacteria | 8640282 |
| 908 | 2513561211 | 2513237083 | Bacteria | 8410967 |
| 909 | 2513959421 | 2513237151 | Bacteria | 6309801 |
| 910 | 2514046762 | 2513237166 | Bacteria | 10373764 |
| 911 | 2515681903 | 2515154122 | Bacteria | 8609520 |
| 912 | 2516018373 | 2515154189 | Bacteria | 9629850 |
| 913 | 2519460148 | 2519103095 | Bacteria | 6629912 |
| 914 | 2527079518 | 2526164713 | Bacteria | 6780608 |
| 915 | 2548500867 | 2547132374 | Bacteria | 5530232 |
| 916 | 2563055375 | 2562617112 | Bacteria | 10918404 |
| 917 | 2585290354 | 2582581311 | Bacteria | 6763856 |
| 918 | 2587725722 | 2585428057 | Bacteria | 6737412 |
| 919 | 2587736646 | 2585428058 | Bacteria | 6853932 |
| 920 | 2588290652 | 2588253510 | Bacteria | 6901809 |
| 921 | 2599744424 | 2599185240 | Bacteria | 7968121 |
| 922 | 2600206461 | 2599185355 | Bacteria | 7968906 |
| 923 | 2643972666 | 2643221592 | Bacteria | 6608788 |
| 924 | 2644057832 | 2643221609 | Bacteria | 6756331 |
| 925 | 2644072869 | 2643221611 | Bacteria | 6820941 |
| 926 | 2644143487 | 2643221625 | Bacteria | 6512927 |
| 927 | 2644276076 | 2643221648 | Bacteria | 6521465 |
| 928 | 2644292118 | 2643221652 | Bacteria | 5140275 |
| 929 | 2644303437 | 2643221654 | Bacteria | 5273570 |
| 930 | 2644646587 | 2643221717 | Bacteria | 5676132 |
| 931 | 2676744699 | 2675903129 | Bacteria | 7964495 |
| 932 | 2713478982 | 2711768613 | Bacteria | 11048459 |
| 933 | 2719638749 | 2718217991 | Bacteria | 7829542 |
| 934 | 2738822289 | 2738541296 | Bacteria | 7285013 |
| 935 | 2738836575 | 2738541298 | Bacteria | 7286732 |
| 936 | 2738875975 | 2738541306 | Bacteria | 7284992 |
| 937 | 2739187927 | 2738543002 | Bacteria | 7284546 |
| 938 | 2739222573 | 2738543008 | Bacteria | 7282815 |
| 939 | 2739242089 | 2738543012 | Bacteria | 7115078 |
| 940 | 2753565538 | 2751185846 | Bacteria | 7242164 |
| 941 | 2792832607 | 2791355137 | Bacteria | 9654227 |
| 942 | 2808968619 | 2808606384 | Bacteria | 8474373 |
| 943 | 2809003450 | 2808606390 | Bacteria | 8476311 |
| 944 | 2809010727 | 2808606391 | Bacteria | 8308166 |
| 945 | 2816470293 | 2816332133 | Bacteria | 7249298 |
| 946 | 2817262415 | 2816332253 | Bacteria | 6764532 |
| 947 | 2817280134 | 2816332256 | Bacteria | 6891714 |
| 948 | 2817455278 | 2816332286 | Bacteria | 6853759 |
| 949 | 2819624087 | 2818991450 | Bacteria | 6962147 |
| 950 | 2842328947 | 2842324504 | Bacteria | 9364110 |
| 951 | 2842353634 | 2842348783 | Bacteria | 9002918 |
| 952 | 2842720514 | 2842718218 | Bacteria | 4560148 |
| 953 | 2856293047 | 2856287931 | Bacteria | 7223934 |
| 954 | 2857361783 | 2857357740 | Bacteria | 9937880 |
| 955 | 2883093280 | 2883087390 | Bacteria | 9532701 |
| 956 | 2885276289 | 2885270888 | Bacteria | 9831543 |
| 957 | 2900578307 | 2900577576 | Bacteria | 5438534 |
| 958 | 2900636657 | 2900634093 | Bacteria | 10263517 |
| 959 | 2902688860 | 2902682994 | Bacteria | 8951596 |
| 960 | 2904488272 | 2904483920 | Bacteria | 7545285 |
| 961 | 2904570820 | 2904564687 | Bacteria | 7609577 |
| 962 | 2904617997 | 2904615490 | Bacteria | 10047340 |
| 963 | 2919530965 | 2919527303 | Bacteria | 7718827 |
| 964 | 2921648851 | 2921643360 | Bacteria | 11448031 |
| 965 | 2928060924 | 2928058823 | Bacteria | 5520022 |
| 966 | 2928112810 | 2928108538 | Bacteria | 7360024 |
| 967 | 2928141741 | 2928135762 | Bacteria | 7259641 |
| 968 | 2928161738 | 2928157003 | Bacteria | 7522202 |
| 969 | 2928170761 | 2928163908 | Bacteria | 7561269 |
| 970 | 2928508342 | 2928503688 | Bacteria | 7268108 |
| 971 | 2945934997 | 2945934425 | Bacteria | 7444609 |
| 972 | 2974321625 | 2974320154 | Bacteria | 4571377 |
| 973 | 2981993097 | 2981990288 | Bacteria | 7590678 |
| 974 | 2990704445 | 2990703756 | Bacteria | 7715990 |
| 975 | 2990714792 | 2990710928 | Bacteria | 5002431 |
| 976 | 642424833 | 641736151 | Bacteria | 7477263 |
| 977 | 642419984 | 641736154 | Bacteria | 7689995 |
| 978 | 642591819 | 642555112 | Bacteria | 8676562 |
| 979 | 642619893 | 642555113 | Bacteria | 8214658 |
| 980 | 8003958887 | 8003955200 | Bacteria | 8601927 |
| 981 | 8020809836 | 8020807995 | Bacteria | 6801506 |
| 982 | 8020948995 | 8020945358 | Bacteria | 8467355 |
| 983 | 8039098897 | 8039098773 | Bacteria | 6602928 |
| 984 | 8040171013 | 8040167225 | Bacteria | 6542727 |
| 985 | 8040175562 | 8040173305 | Bacteria | 6827067 |
| 986 | 8055267925 | 8055266321 | Bacteria | 7999742 |
| 987 | 8055304346 | 8055301274 | Bacteria | 8587385 |
| 988 | Ga0496100_0002521 | |||
| 989 | JGI24740J21852_10010623 | |||
| 990 | JGI24739J22299_10002720 | |||
| 991 | JGI24739J22299_10007403 | |||
| 992 | JGI24739J22299_10021569 | |||
| 993 | JGI24739J22299_10027893 | |||
| 994 | JGI24737J22298_10007144 | |||
| 995 | JGI24737J22298_10016803 | |||
| 996 | JGI24737J22298_10025811 | |||
| 997 | JGI24735J21928_10003917 | |||
| 998 | JGI24735J21928_10008742 | |||
| 999 | JGI24735J21928_10026090 | |||
| 1000 | JGI24738J21930_10002518 | |||
| 1001 | JGI25156J39149_1000991 | |||
| 1002 | JGI25156J39149_1001392 | |||
| 1003 | JGI25156J39149_1002249 | |||
| 1004 | JGI25152J39213_1000678 | |||
| 1005 | JGI25150J39212_1011409 | |||
| 1006 | JGI25165J46597_1001300 | |||
| 1007 | JGI25153J46596_10003272 | |||
| 1008 | JGI25153J46596_10004915 | |||
| 1009 | rootH1_10016096 | |||
| 1010 | rootL2_10147844 | |||
| 1011 | rootL2_10196141 | |||
| 1012 | JGI25160J50197_1000016 | |||
| 1013 | Ga0055533_1000587 | |||
| 1014 | Ga0055533_1000634 | |||
| 1015 | Ga0055532_1000022 | |||
| 1016 | Ga0055527_1000016 | |||
| 1017 | Ga0055527_1002497 | |||
| 1018 | Ga0055527_1003486 | |||
| 1019 | Ga0055535_1000017 | |||
| 1020 | Ga0055535_1004554 | |||
| 1021 | Ga0055542_1000030 | |||
| 1022 | Ga0055529_1000033 | |||
| 1023 | Ga0055526_1001068 | |||
| 1024 | Ga0055534_1002118 | |||
| 1025 | Ga0065165_1000154 | |||
| 1026 | Ga0065165_1001461 | |||
| 1027 | Ga0065704_10204710 | |||
| 1028 | Ga0065712_10075384 | |||
| 1029 | Ga0065715_10147267 | |||
| 1030 | Ga0070676_10008679 | |||
| 1031 | Ga0070676_10023341 | |||
| 1032 | Ga0070676_10077477 | |||
| 1033 | Ga0070690_100006989 | |||
| 1034 | Ga0070670_100020778 | |||
| 1035 | Ga0070670_100031757 | |||
| 1036 | Ga0070670_100216823 | |||
| 1037 | Ga0070670_100219025 | |||
| 1038 | Ga0070670_100678085 | |||
| 1039 | Ga0070677_10012605 | |||
| 1040 | Ga0070677_10015197 | |||
| 1041 | Ga0068869_100015120 | |||
| 1042 | Ga0068869_100060583 | |||
| 1043 | Ga0068869_100195292 | |||
| 1044 | Ga0070666_10019273 | |||
| 1045 | Ga0070666_10088721 | |||
| 1046 | Ga0070666_10120561 | |||
| 1047 | Ga0070666_10293668 | |||
| 1048 | Ga0068868_100074157 | |||
| 1049 | Ga0068868_100079979 | |||
| 1050 | Ga0068868_100091480 | |||
| 1051 | Ga0068868_100223330 | |||
| 1052 | Ga0070660_100000195 | |||
| 1053 | Ga0070660_100064616 | |||
| 1054 | Ga0070661_100026811 | |||
| 1055 | Ga0070661_100035221 | |||
| 1056 | Ga0070668_100010839 | |||
| 1057 | Ga0070668_100036923 | |||
| 1058 | Ga0070668_100146242 | |||
| 1059 | Ga0070669_100004137 | |||
| 1060 | Ga0070669_100005511 | |||
| 1061 | Ga0070669_100117534 | |||
| 1062 | Ga0070669_100258762 | |||
| 1063 | Ga0070669_100320374 | |||
| 1064 | Ga0070675_100000167 | |||
| 1065 | Ga0070675_100010946 | |||
| 1066 | Ga0070675_100018370 | |||
| 1067 | Ga0070675_100024458 | |||
| 1068 | Ga0070675_100043857 | |||
| 1069 | Ga0070675_100129110 | |||
| 1070 | Ga0070675_100140478 | |||
| 1071 | Ga0070671_100002233 | |||
| 1072 | Ga0070671_100021098 | |||
| 1073 | Ga0070674_100006012 | |||
| 1074 | Ga0070674_100038427 | |||
| 1075 | Ga0070673_100002005 | |||
| 1076 | Ga0070673_100044160 | |||
| 1077 | Ga0070673_100116421 | |||
| 1078 | Ga0070673_100437645 | |||
| 1079 | Ga0070688_100088898 | |||
| 1080 | Ga0070688_100182427 | |||
| 1081 | Ga0070659_100000271 | |||
| 1082 | Ga0070659_100028974 | |||
| 1083 | Ga0070659_100031557 | |||
| 1084 | Ga0070659_100479540 | |||
| 1085 | Ga0070667_100007013 | |||
| 1086 | Ga0070667_100013861 | |||
| 1087 | Ga0070667_100020907 | |||
| 1088 | Ga0070667_100070105 | |||
| 1089 | Ga0070667_100154315 | |||
| 1090 | Ga0070667_100322741 | |||
| 1091 | Ga0070701_10059666 | |||
| 1092 | Ga0070700_100224414 | |||
| 1093 | Ga0070663_100001056 | |||
| 1094 | Ga0070663_100134639 | |||
| 1095 | Ga0070663_100181569 | |||
| 1096 | Ga0070678_100002556 | |||
| 1097 | Ga0070678_100021058 | |||
| 1098 | Ga0070662_100016396 | |||
| 1099 | Ga0070662_100148143 | |||
| 1100 | Ga0068867_100000021 | |||
| 1101 | Ga0068867_100006166 | |||
| 1102 | Ga0068867_100020540 | |||
| 1103 | Ga0068867_100031508 | |||
| 1104 | Ga0068867_100071873 | |||
| 1105 | Ga0068867_100135086 | |||
| 1106 | Ga0068867_100177000 | |||
| 1107 | Ga0068867_100189163 | |||
| 1108 | Ga0070685_10032211 | |||
| 1109 | Ga0070706_100001239 | |||
| 1110 | Ga0070707_100090242 | |||
| 1111 | Ga0068853_100124541 | |||
| 1112 | Ga0068853_100147183 | |||
| 1113 | Ga0068853_100152475 | |||
| 1114 | Ga0068853_100260016 | |||
| 1115 | Ga0068853_100707905 | |||
| 1116 | Ga0070672_100000544 | |||
| 1117 | Ga0070672_100008374 | |||
| 1118 | Ga0070672_100008511 | |||
| 1119 | Ga0070672_100033996 | |||
| 1120 | Ga0070672_100169035 | |||
| 1121 | Ga0070672_100224494 | |||
| 1122 | Ga0070693_100034611 | |||
| 1123 | Ga0070665_100083986 | |||
| 1124 | Ga0068855_100120311 | |||
| 1125 | Ga0068855_100420232 | |||
| 1126 | Ga0070664_100070688 | |||
| 1127 | Ga0070664_100211452 | |||
| 1128 | Ga0070664_100323041 | |||
| 1129 | Ga0068857_100055452 | |||
| 1130 | Ga0068857_100126896 | |||
| 1131 | Ga0068856_100030945 | |||
| 1132 | Ga0068856_100110976 | |||
| 1133 | Ga0068856_100214645 | |||
| 1134 | Ga0068852_100002004 | |||
| 1135 | Ga0068852_100019888 | |||
| 1136 | Ga0068852_100026230 | |||
| 1137 | Ga0068852_100063804 | |||
| 1138 | Ga0068852_100098919 | |||
| 1139 | Ga0068852_100206481 | |||
| 1140 | Ga0068859_100037861 | |||
| 1141 | Ga0068859_100052151 | |||
| 1142 | Ga0068859_100181967 | |||
| 1143 | Ga0068864_100001568 | |||
| 1144 | Ga0068864_100001586 | |||
| 1145 | Ga0068864_100099792 | |||
| 1146 | Ga0068864_100107264 | |||
| 1147 | Ga0068864_100170649 | |||
| 1148 | Ga0068864_100233300 | |||
| 1149 | Ga0068864_100408943 | |||
| 1150 | Ga0068864_100520148 | |||
| 1151 | Ga0068866_10028879 | |||
| 1152 | Ga0068866_10032952 | |||
| 1153 | Ga0068861_100002195 | |||
| 1154 | Ga0068861_100003200 | |||
| 1155 | Ga0068861_100022248 | |||
| 1156 | Ga0068851_10015256 | |||
| 1157 | Ga0068870_10021558 | |||
| 1158 | Ga0068863_100014146 | |||
| 1159 | Ga0068863_100037402 | |||
| 1160 | Ga0068863_100067500 | |||
| 1161 | Ga0068863_100144847 | |||
| 1162 | Ga0068863_100231961 | |||
| 1163 | Ga0068863_100362334 | |||
| 1164 | Ga0068858_100010259 | |||
| 1165 | Ga0068858_100010997 | |||
| 1166 | Ga0068858_100034019 | |||
| 1167 | Ga0068858_100134534 | |||
| 1168 | Ga0068858_100479892 | |||
| 1169 | Ga0068860_100004773 | |||
| 1170 | Ga0068860_100013190 | |||
| 1171 | Ga0068860_100014652 | |||
| 1172 | Ga0068860_100110562 | |||
| 1173 | Ga0068860_100778495 | |||
| 1174 | Ga0068862_100105764 | |||
| 1175 | Ga0068862_100113282 | |||
| 1176 | Ga0075365_10134964 | |||
| 1177 | Ga0075365_10227929 | |||
| 1178 | Ga0075368_10001721 | |||
| 1179 | Ga0075368_10031566 | |||
| 1180 | Ga0075363_100025485 | |||
| 1181 | Ga0075363_100132991 | |||
| 1182 | Ga0075363_100171506 | |||
| 1183 | Ga0075364_10020354 | |||
| 1184 | Ga0075364_10024222 | |||
| 1185 | Ga0075362_10020417 | |||
| 1186 | Ga0075362_10099771 | |||
| 1187 | Ga0075367_10027013 | |||
| 1188 | Ga0075367_10046742 | |||
| 1189 | Ga0075367_10213926 | |||
| 1190 | Ga0075369_10009477 | |||
| 1191 | Ga0075369_10023185 | |||
| 1192 | Ga0075369_10077233 | |||
| 1193 | Ga0075366_10006187 | |||
| 1194 | Ga0075366_10014161 | |||
| 1195 | Ga0075366_10015488 | |||
| 1196 | Ga0075366_10017365 | |||
| 1197 | Ga0075366_10021478 | |||
| 1198 | Ga0075366_10046110 | |||
| 1199 | Ga0075366_10063417 | |||
| 1200 | Ga0075366_10075447 | |||
| 1201 | Ga0075366_10127889 | |||
| 1202 | Ga0075366_10157302 | |||
| 1203 | Ga0097621_100048794 | |||
| 1204 | Ga0097621_100050894 | |||
| 1205 | Ga0097621_100138090 | |||
| 1206 | Ga0097621_100174511 | |||
| 1207 | Ga0097621_100358307 | |||
| 1208 | Ga0075370_10002155 | |||
| 1209 | Ga0075370_10002284 | |||
| 1210 | Ga0075370_10007713 | |||
| 1211 | Ga0075370_10016859 | |||
| 1212 | Ga0075370_10020704 | |||
| 1213 | Ga0075370_10031684 | |||
| 1214 | Ga0075370_10073610 | |||
| 1215 | Ga0068871_100026952 | |||
| 1216 | Ga0068871_100031602 | |||
| 1217 | Ga0068871_100112507 | |||
| 1218 | Ga0068871_100146267 | |||
| 1219 | Ga0068871_100474505 | |||
| 1220 | Ga0068865_100008752 | |||
| 1221 | Ga0068865_100031334 | |||
| 1222 | Ga0068865_100069568 | |||
| 1223 | Ga0068865_100088425 | |||
| 1224 | Ga0097620_100037861 | |||
| 1225 | Ga0097620_100052149 | |||
| 1226 | Ga0097620_100181975 | |||
| 1227 | Ga0079104_1000008 | |||
| 1228 | Ga0105251_10000590 | |||
| 1229 | Ga0105251_10091828 | |||
| 1230 | Ga0105250_10003787 | |||
| 1231 | Ga0105240_10017111 | |||
| 1232 | Ga0105240_10050744 | |||
| 1233 | Ga0105240_10127118 | |||
| 1234 | Ga0105240_10345514 | |||
| 1235 | Ga0105240_10360398 | |||
| 1236 | Ga0105245_10049860 | |||
| 1237 | Ga0105245_10131108 | |||
| 1238 | Ga0105243_10001746 | |||
| 1239 | Ga0105243_10105875 | |||
| 1240 | Ga0105243_10192471 | |||
| 1241 | Ga0105243_10272029 | |||
| 1242 | Ga0105242_10486641 | |||
| 1243 | Ga0105248_10072337 | |||
| 1244 | Ga0105248_10109824 | |||
| 1245 | Ga0105248_10164016 | |||
| 1246 | Ga0105248_10168560 | |||
| 1247 | Ga0105248_10269229 | |||
| 1248 | Ga0105248_10524514 | |||
| 1249 | Ga0105237_10090293 | |||
| 1250 | Ga0105237_10101122 | |||
| 1251 | Ga0105237_10122004 | |||
| 1252 | Ga0105237_10202484 | |||
| 1253 | Ga0105237_10451770 | |||
| 1254 | Ga0105238_10027400 | |||
| 1255 | Ga0105238_10037142 | |||
| 1256 | Ga0105249_10006010 | |||
| 1257 | Ga0105249_10012921 | |||
| 1258 | Ga0105249_10300723 | |||
| 1259 | Ga0105249_10479966 | |||
| 1260 | Ga0105239_10099026 | |||
| 1261 | Ga0105239_10510449 | |||
| 1262 | Ga0157369_10039631 | |||
| 1263 | Ga0157369_10070807 | |||
| 1264 | Ga0157374_10233698 | |||
| 1265 | Ga0157374_10266234 | |||
| 1266 | Ga0157374_10337976 | |||
| 1267 | Ga0163162_10042288 | |||
| 1268 | Ga0163162_10046856 | |||
| 1269 | Ga0163162_10050348 | |||
| 1270 | Ga0163162_10178830 | |||
| 1271 | Ga0163162_10445212 | |||
| 1272 | Ga0157372_10140624 | |||
| 1273 | Ga0157375_10012697 | |||
| 1274 | Ga0157375_10034676 | |||
| 1275 | Ga0157375_10221708 | |||
| 1276 | Ga0157375_10346167 | |||
| 1277 | Ga0163163_10033008 | |||
| 1278 | Ga0157380_10040937 | |||
| 1279 | Ga0157380_10400951 | |||
| 1280 | Ga0157377_10000021 | |||
| 1281 | Ga0157377_10015967 | |||
| 1282 | Ga0157379_10053896 | |||
| 1283 | Ga0157379_10060478 | |||
| 1284 | Ga0157379_10142787 | |||
| 1285 | Ga0157379_10250230 | |||
| 1286 | Ga0157376_10070644 | |||
| 1287 | Ga0157376_10179701 | |||
| 1288 | Ga0182007_10000169 | |||
| 1289 | Ga0183361_10001 | |||
| 1290 | Ga0163161_10034999 | |||
| 1291 | Ga0163161_10036801 | |||
| 1292 | Ga0163161_10057946 | |||
| 1293 | Ga0163161_10091381 | |||
| 1294 | Ga0163161_10097146 | |||
| 1295 | Ga0209674_100017 | |||
| 1296 | Ga0209674_100324 | |||
| 1297 | Ga0209672_100001 | |||
| 1298 | Ga0209672_100041 | |||
| 1299 | Ga0209672_103713 | |||
| 1300 | Ga0209147_100022 | |||
| 1301 | Ga0209147_100337 | |||
| 1302 | Ga0209147_100649 | |||
| 1303 | Ga0209563_100596 | |||
| 1304 | Ga0209563_107554 | |||
| 1305 | Ga0207427_101122 | |||
| 1306 | Ga0209258_100033 | |||
| 1307 | Ga0209258_100309 | |||
| 1308 | Ga0207425_1000195 | |||
| 1309 | Ga0209148_1000046 | |||
| 1310 | Ga0209148_1002429 | |||
| 1311 | Ga0209759_1000092 | |||
| 1312 | Ga0209759_1000184 | |||
| 1313 | Ga0209759_1001030 | |||
| 1314 | Ga0209129_1000043 | |||
| 1315 | Ga0209129_1008010 | |||
| 1316 | Ga0209233_1000050 | |||
| 1317 | Ga0209455_1000038 | |||
| 1318 | Ga0209130_1003268 | |||
| 1319 | Ga0209675_1001354 | |||
| 1320 | Ga0209676_1015349 | |||
| 1321 | Ga0209564_1000014 | |||
| 1322 | Ga0209564_1004662 | |||
| 1323 | Ga0209758_1000045 | |||
| 1324 | Ga0209758_1000093 | |||
| 1325 | Ga0209050_1000179 | |||
| 1326 | Ga0207426_1000007 | |||
| 1327 | Ga0209051_1004773 | |||
| 1328 | Ga0209051_1028007 | |||
| 1329 | Ga0209257_1008045 | |||
| 1330 | Ga0209257_1037250 | |||
| 1331 | Ga0207697_10038786 | |||
| 1332 | Ga0207656_10032317 | |||
| 1333 | Ga0207696_1004123 | |||
| 1334 | Ga0207696_1007974 | |||
| 1335 | Ga0207713_1000137 | |||
| 1336 | Ga0207682_10001694 | |||
| 1337 | Ga0207682_10007864 | |||
| 1338 | Ga0207682_10010588 | |||
| 1339 | Ga0207682_10049059 | |||
| 1340 | Ga0207642_10017603 | |||
| 1341 | Ga0207688_10033295 | |||
| 1342 | Ga0207688_10194248 | |||
| 1343 | Ga0207680_10003579 | |||
| 1344 | Ga0207680_10016311 | |||
| 1345 | Ga0207680_10271975 | |||
| 1346 | Ga0207647_10006921 | |||
| 1347 | Ga0207647_10012090 | |||
| 1348 | Ga0207647_10019129 | |||
| 1349 | Ga0207645_10009352 | |||
| 1350 | Ga0207645_10036363 | |||
| 1351 | Ga0207645_10080334 | |||
| 1352 | Ga0207643_10075134 | |||
| 1353 | Ga0207705_10043309 | |||
| 1354 | Ga0207684_10008277 | |||
| 1355 | Ga0207695_10014314 | |||
| 1356 | Ga0207695_10017431 | |||
| 1357 | Ga0207695_10045352 | |||
| 1358 | Ga0207671_10006439 | |||
| 1359 | Ga0207671_10032972 | |||
| 1360 | Ga0207671_10287653 | |||
| 1361 | Ga0207662_10045110 | |||
| 1362 | Ga0207657_10000044 | |||
| 1363 | Ga0207649_10022538 | |||
| 1364 | Ga0207646_10063618 | |||
| 1365 | Ga0207681_10001232 | |||
| 1366 | Ga0207681_10009831 | |||
| 1367 | Ga0207681_10125031 | |||
| 1368 | Ga0207694_10004421 | |||
| 1369 | Ga0207650_10001921 | |||
| 1370 | Ga0207650_10013206 | |||
| 1371 | Ga0207650_10136246 | |||
| 1372 | Ga0207650_10159844 | |||
| 1373 | Ga0207650_10347055 | |||
| 1374 | Ga0207659_10001177 | |||
| 1375 | Ga0207659_10006801 | |||
| 1376 | Ga0207659_10011942 | |||
| 1377 | Ga0207659_10021070 | |||
| 1378 | Ga0207659_10024965 | |||
| 1379 | Ga0207659_10049968 | |||
| 1380 | Ga0207659_10149963 | |||
| 1381 | Ga0207687_10057000 | |||
| 1382 | Ga0207687_10092606 | |||
| 1383 | Ga0207644_10002024 | |||
| 1384 | Ga0207644_10002325 | |||
| 1385 | Ga0207644_10030839 | |||
| 1386 | Ga0207644_10039496 | |||
| 1387 | Ga0207644_10085743 | |||
| 1388 | Ga0207690_10000046 | |||
| 1389 | Ga0207690_10111694 | |||
| 1390 | Ga0207706_10023708 | |||
| 1391 | Ga0207706_10083831 | |||
| 1392 | Ga0207706_10318923 | |||
| 1393 | Ga0207686_10001251 | |||
| 1394 | Ga0207709_10000070 | |||
| 1395 | Ga0207709_10000927 | |||
| 1396 | Ga0207709_10027363 | |||
| 1397 | Ga0207709_10111752 | |||
| 1398 | Ga0207669_10006914 | |||
| 1399 | Ga0207669_10054587 | |||
| 1400 | Ga0207669_10087570 | |||
| 1401 | Ga0207704_10002634 | |||
| 1402 | Ga0207704_10006601 | |||
| 1403 | Ga0207704_10105642 | |||
| 1404 | Ga0207704_10138806 | |||
| 1405 | Ga0207691_10016058 | |||
| 1406 | Ga0207691_10022141 | |||
| 1407 | Ga0207691_10031519 | |||
| 1408 | Ga0207691_10067728 | |||
| 1409 | Ga0207691_10123981 | |||
| 1410 | Ga0207691_10261956 | |||
| 1411 | Ga0207691_10433162 | |||
| 1412 | Ga0207711_10014582 | |||
| 1413 | Ga0207711_10018363 | |||
| 1414 | Ga0207711_10036332 | |||
| 1415 | Ga0207689_10007049 | |||
| 1416 | Ga0207689_10025384 | |||
| 1417 | Ga0207689_10078217 | |||
| 1418 | Ga0207689_10081490 | |||
| 1419 | Ga0207661_10259861 | |||
| 1420 | Ga0207679_10177924 | |||
| 1421 | Ga0207679_10243849 | |||
| 1422 | Ga0207667_10014884 | |||
| 1423 | Ga0207651_10001929 | |||
| 1424 | Ga0207651_10006366 | |||
| 1425 | Ga0207651_10094819 | |||
| 1426 | Ga0207651_10134956 | |||
| 1427 | Ga0207712_10005762 | |||
| 1428 | Ga0207712_10098221 | |||
| 1429 | Ga0207712_10433300 | |||
| 1430 | Ga0207668_10087254 | |||
| 1431 | Ga0207668_10541297 | |||
| 1432 | Ga0207658_10000904 | |||
| 1433 | Ga0207658_10015874 | |||
| 1434 | Ga0207658_10023294 | |||
| 1435 | Ga0207658_10050286 | |||
| 1436 | Ga0207677_10004432 | |||
| 1437 | Ga0207677_10200968 | |||
| 1438 | Ga0207677_10284310 | |||
| 1439 | Ga0207703_10001363 | |||
| 1440 | Ga0207703_10002141 | |||
| 1441 | Ga0207703_10006196 | |||
| 1442 | Ga0207703_10348070 | |||
| 1443 | Ga0207639_10052511 | |||
| 1444 | Ga0207639_10087522 | |||
| 1445 | Ga0207639_10236436 | |||
| 1446 | Ga0207639_10393960 | |||
| 1447 | Ga0207678_10000397 | |||
| 1448 | Ga0207678_10085322 | |||
| 1449 | Ga0207678_10124479 | |||
| 1450 | Ga0207708_10016069 | |||
| 1451 | Ga0207708_10023525 | |||
| 1452 | Ga0207708_10260305 | |||
| 1453 | Ga0207702_10035517 | |||
| 1454 | Ga0207702_10148402 | |||
| 1455 | Ga0207641_10012827 | |||
| 1456 | Ga0207641_10017565 | |||
| 1457 | Ga0207641_10024475 | |||
| 1458 | Ga0207641_10052054 | |||
| 1459 | Ga0207641_10069098 | |||
| 1460 | Ga0207641_10069896 | |||
| 1461 | Ga0207641_10219996 | |||
| 1462 | Ga0207648_10000776 | |||
| 1463 | Ga0207648_10001858 | |||
| 1464 | Ga0207648_10005756 | |||
| 1465 | Ga0207648_10014208 | |||
| 1466 | Ga0207648_10031752 | |||
| 1467 | Ga0207648_10042815 | |||
| 1468 | Ga0207648_10067429 | |||
| 1469 | Ga0207648_10069535 | |||
| 1470 | Ga0207648_10112073 | |||
| 1471 | Ga0207648_10197560 | |||
| 1472 | Ga0207676_10008217 | |||
| 1473 | Ga0207676_10015110 | |||
| 1474 | Ga0207676_10016149 | |||
| 1475 | Ga0207676_10031088 | |||
| 1476 | Ga0207676_10042314 | |||
| 1477 | Ga0207676_10132079 | |||
| 1478 | Ga0207676_10190773 | |||
| 1479 | Ga0207676_10311016 | |||
| 1480 | Ga0207674_10095218 | |||
| 1481 | Ga0207675_100001673 | |||
| 1482 | Ga0207675_100001979 | |||
| 1483 | Ga0207675_100014813 | |||
| 1484 | Ga0207675_100024619 | |||
| 1485 | Ga0207675_100329984 | |||
| 1486 | Ga0207683_10013438 | |||
| 1487 | Ga0207683_10077142 | |||
| 1488 | Ga0207683_10099201 | |||
| 1489 | Ga0207698_10002517 | |||
| 1490 | Ga0207698_10015201 | |||
| 1491 | Ga0207698_10034213 | |||
| 1492 | Ga0207698_10064331 | |||
| 1493 | Ga0207698_10075826 | |||
| 1494 | Ga0207698_10084291 | |||
| 1495 | Ga0207698_10343514 | |||
| 1496 | Ga0209281_1000029 | |||
| 1497 | Ga0209371_1007636 | |||
| 1498 | Ga0209813_10019682 | |||
| 1499 | Ga0268266_10401825 | |||
| 1500 | Ga0268265_10481693 | |||
| 1501 | Ga0268264_10005843 | |||
| 1502 | Ga0268264_10012862 | |||
| 1503 | Ga0268264_10015703 | |||
| 1504 | Ga0268264_10584062 | |||
| 1505 | Ga0307517_10003186 | |||
| 1506 | Ga0307515_10070107 | |||
| 1507 | Ga0307515_10143238 | |||
| 1508 | Ga0307515_10171943 | |||
| 1509 | Ga0265338_10000087 | |||
| 1510 | Ga0265338_10001953 | |||
| 1511 | Ga0268256_1005918 | |||
| 1512 | Ga0307512_10013762 | |||
| 1513 | Ga0307513_10043962 | |||
| 1514 | Ga0307513_10071654 | |||
| 1515 | Ga0307513_10107184 | |||
| 1516 | Ga0307509_10186609 | |||
| 1517 | Ga0307408_100000133 | |||
| 1518 | Ga0307408_100001327 | |||
| 1519 | Ga0307508_10004667 | |||
| 1520 | Ga0307514_10001425 | |||
| 1521 | Ga0307514_10074222 | |||
| 1522 | Ga0307514_10103211 | |||
| 1523 | Ga0307516_10003676 | |||
| 1524 | Ga0307516_10033347 | |||
| 1525 | Ga0307516_10120823 | |||
| 1526 | Ga0307405_10005542 | |||
| 1527 | Ga0307405_10197724 | |||
| 1528 | Ga0307413_10178410 | |||
| 1529 | Ga0307413_10268250 | |||
| 1530 | Ga0307410_10019091 | |||
| 1531 | Ga0307406_10002490 | |||
| 1532 | Ga0307406_10051459 | |||
| 1533 | Ga0307406_10127565 | |||
| 1534 | Ga0307412_10000011 | |||
| 1535 | Ga0307412_10015249 | |||
| 1536 | Ga0307409_100217192 | |||
| 1537 | Ga0307416_100001839 | |||
| 1538 | Ga0307416_100051118 | |||
| 1539 | Ga0307416_100134298 | |||
| 1540 | Ga0307414_10241580 | |||
| 1541 | Ga0307411_10001139 | |||
| 1542 | Ga0307411_10227192 | |||
| 1543 | Ga0307510_10003680 | |||
| 1544 | Ga0373928_0034957 | |||
| 1545 | Ga0373932_0048393 | |||
| 1546 | Ga0373957_0100557 | |||
| 1547 | Ga0373955_0169842 | |||
| 1548 | Ga0373931_0078453 | |||
| 1549 | Ga0373931_0091382 | |||
| 1550 | Ga0373927_0197037 | |||
| 1551 | Ga0373937_0012935 | |||
| 1552 | Ga0373937_0241402 | |||
| 1553 | Ga0373937_0414808 | |||
| 1554 | Ga0373925_0112048 | |||
| 1555 | Ga0395899_0000421 | |||
| 1556 | Ga0395899_0019968 | |||
| 1557 | Ga0395899_0024082 | |||
| 1558 | Ga0395900_0000159 | |||
| 1559 | Ga0395900_0019146 | |||
| 1560 | Ga0395900_0050398 | |||
| 1561 | Ga0395898_0000425 | |||
| 1562 | Ga0395898_0007545 | |||
| 1563 | Ga0395898_0029225 | |||
| 1564 | Ga0395905_0000079 | |||
| 1565 | Ga0395905_0000235 | |||
| 1566 | Ga0395905_0044852 | |||
| 1567 | Ga0395905_0102595 | |||
| 1568 | Ga0395905_0162640 | |||
| 1569 | Ga0395901_0000109 | |||
| 1570 | Ga0395901_0072550 | |||
| 1571 | Ga0436360_0682679 | |||
| 1572 | Ga0436361_0621765 | |||
| 1573 | Ga0436363_0993833 | |||
| 1574 | Ga0451798_0026603 | |||
| 1575 | Ga0451849_0292172 | |||
| 1576 | Ga0466964_0053842 | |||
| 1577 | Ga0453684_0016340 | |||
| 1578 | Ga0466971_0025669 | |||
| 1579 | Ga0466970_0128725 | |||
| 1580 | Ga0466957_0040153 | |||
| 1581 | Ga0466957_0131084 | |||
| 1582 | Ga0466960_0245797 | |||
| 1583 | Ga0466959_0031417 | |||
| 1584 | Ga0451576_0288014 | |||
| 1585 | Ga0466958_0123287 | |||
| 1586 | Ga0466958_0191280 | |||
| 1587 | Ga0495592_0000418 | |||
| 1588 | Ga0495592_0007034 | |||
| 1589 | Ga0495592_0103513 | |||
| 1590 | Ga0495603_0037029 | |||
| 1591 | Ga0495590_0021156 | |||
| 1592 | Ga0495591_003062 | |||
| 1593 | Ga0495629_0000350 | |||
| 1594 | Ga0495629_0001209 | |||
| 1595 | Ga0495629_0038290 | |||
| 1596 | Ga0495629_0157943 | |||
| 1597 | Ga0495638_0013760 | |||
| 1598 | Ga0495641_0009348 | |||
| 1599 | Ga0495651_0076444 | |||
| 1600 | Ga0495651_0084160 | |||
| 1601 | Ga0495651_0114900 | |||
| 1602 | Ga0495653_0003248 | |||
| 1603 | Ga0495653_0046903 | |||
| 1604 | Ga0495653_0110072 | |||
| 1605 | Ga0495650_0026543 | |||
| 1606 | Ga0495650_0027151 | |||
| 1607 | Ga0495650_0035337 | |||
| 1608 | Ga0495650_0076264 | |||
| 1609 | Ga0495580_0000001 | |||
| 1610 | Ga0495580_0002480 | |||
| 1611 | Ga0495580_0063709 | |||
| 1612 | Ga0495580_0334664 | |||
| 1613 | Ga0495582_0004973 | |||
| 1614 | Ga0495582_0014067 | |||
| 1615 | Ga0495582_0035867 | |||
| 1616 | Ga0495582_0229203 | |||
| 1617 | Ga0495605_0001893 | |||
| 1618 | Ga0495662_0026903 | |||
| 1619 | Ga0495664_0020285 | |||
| 1620 | Ga0495664_0023953 | |||
| 1621 | Ga0495664_0153708 | |||
| 1622 | Ga0495584_0079282 | |||
| 1623 | Ga0495596_0005022 | |||
| 1624 | Ga0495583_0020828 | |||
| 1625 | Ga0495583_0057200 | |||
| 1626 | Ga0495606_0015750 | |||
| 1627 | Ga0495606_0024992 | |||
| 1628 | Ga0495606_0050987 | |||
| 1629 | Ga0495608_0004602 | |||
| 1630 | Ga0495608_0005829 | |||
| 1631 | Ga0495610_0005342 | |||
| 1632 | Ga0495610_0030325 | |||
| 1633 | Ga0495618_0000415 | |||
| 1634 | Ga0495618_0014000 | |||
| 1635 | Ga0495620_0032334 | |||
| 1636 | Ga0495620_0036672 | |||
| 1637 | Ga0495620_0040499 | |||
| 1638 | Ga0495628_0019378 | |||
| 1639 | Ga0495628_0137787 | |||
| 1640 | Ga0495628_0139498 | |||
| 1641 | Ga0495628_0187322 | |||
| 1642 | Ga0495630_0018394 | |||
| 1643 | Ga0495630_0089207 | |||
| 1644 | Ga0495630_0120123 | |||
| 1645 | Ga0495630_0274257 | |||
| 1646 | Ga0495631_0125023 | |||
| 1647 | Ga0495632_0005034 | |||
| 1648 | Ga0495643_0039315 | |||
| 1649 | Ga0495648_0008606 | |||
| 1650 | Ga0495648_0021032 | |||
| 1651 | Ga0495648_0034993 | |||
| 1652 | Ga0495648_0170953 | |||
| 1653 | Ga0495666_0063871 | |||
| 1654 | Ga0495652_0027306 | |||
| 1655 | Ga0495652_0041987 | |||
| 1656 | Ga0495665_0003698 | |||
| 1657 | Ga0495665_0016798 | |||
| 1658 | Ga0495665_0028597 | |||
| 1659 | Ga0495665_0048732 | |||
| 1660 | Ga0495640_0001146 | |||
| 1661 | Ga0495640_0012264 | |||
| 1662 | Ga0495640_0055085 | |||
| 1663 | Ga0495586_0020369 | |||
| 1664 | Ga0495587_0003091 | |||
| 1665 | Ga0495598_0075374 | |||
| 1666 | Ga0495609_0095884 | |||
| 1667 | Ga0495621_0023505 | |||
| 1668 | Ga0495597_0014933 | |||
| 1669 | Ga0495597_0042423 | |||
| 1670 | Ga0495597_0129708 | |||
| 1671 | Ga0495645_0031906 | |||
| 1672 | Ga0495645_0052270 | |||
| 1673 | Ga0495645_0140066 | |||
| 1674 | Ga0495622_0000323 | |||
| 1675 | Ga0495634_0012967 | |||
| 1676 | Ga0495634_0124082 | |||
| 1677 | Ga0495634_0185989 | |||
| 1678 | Ga0495611_0059503 | |||
| 1679 | Ga0495625_0031755 | |||
| 1680 | Ga0495625_0072125 | |||
| 1681 | Ga0495635_0000381 | |||
| 1682 | Ga0495635_0014539 | |||
| 1683 | Ga0495635_0049797 | |||
| 1684 | Ga0495635_0202067 | |||
| 1685 | Ga0495661_0005116 | |||
| 1686 | Ga0495588_0070491 | |||
| 1687 | Ga0495588_0213223 | |||
| 1688 | Ga0495657_0033057 | |||
| 1689 | Ga0495599_0018350 | |||
| 1690 | Ga0495599_0058678 | |||
| 1691 | Ga0495623_0036924 | |||
| 1692 | Ga0495623_0051850 | |||
| 1693 | Ga0495623_0073104 | |||
| 1694 | Ga0495623_0126886 | |||
| 1695 | Ga0495646_0003092 | |||
| 1696 | Ga0495646_0004800 | |||
| 1697 | Ga0495646_0007653 | |||
| 1698 | Ga0495647_0055566 | |||
| 1699 | Ga0495658_0005455 | |||
| 1700 | Ga0495613_0002613 | |||
| 1701 | Ga0495613_0010209 | |||
| 1702 | Ga0495613_0076364 | |||
| 1703 | Ga0495624_0001552 | |||
| 1704 | Ga0495624_0022060 | |||
| 1705 | Ga0495624_0032776 | |||
| 1706 | Ga0495624_0037196 | |||
| 1707 | Ga0495624_0223455 | |||
| 1708 | Ga0495671_0035075 | |||
| 1709 | Ga0495671_0101963 | |||
| 1710 | Ga0495671_0144278 | |||
| 1711 | Ga0495649_0006372 | |||
| 1712 | Ga0495649_0020638 | |||
| 1713 | Ga0495649_0137747 | |||
| 1714 | Ga0495649_0237482 | |||
| 1715 | Ga0495589_0003386 | |||
| 1716 | Ga0495589_0017621 | |||
| 1717 | Ga0495589_0066001 | |||
| 1718 | Ga0495600_0007815 | |||
| 1719 | Ga0495600_0012622 | |||
| 1720 | Ga0495660_0032774 | |||
| 1721 | Ga0495660_0086243 | |||
| 1722 | Ga0495581_0022908 | |||
| 1723 | Ga0495581_0025220 | |||
| 1724 | Ga0495604_0001718 | |||
| 1725 | Ga0495604_0048198 | |||
| 1726 | Ga0495604_0101071 | |||
| 1727 | Ga0495604_0251980 | |||
| 1728 | Ga0495674_0024129 | |||
| 1729 | Ga0495674_0028979 | |||
| 1730 | Ga0495674_0030646 | |||
| 1731 | Ga0495674_0265431 | |||
| 1732 | Ga0495672_0001486 | |||
| 1733 | Ga0495672_0107830 | |||
| 1734 | Ga0495676_0024342 | |||
| 1735 | Ga0495676_0094485 | |||
| 1736 | Ga0495676_0178137 | |||
| 1737 | Ga0495676_0209718 | |||
| 1738 | Ga0495680_0048068 | |||
| 1739 | Ga0495680_0054890 | |||
| 1740 | Ga0495680_0060598 | |||
| 1741 | Ga0495680_0078177 | |||
| 1742 | Ga0495683_0001965 | |||
| 1743 | Ga0495683_0019876 | |||
| 1744 | Ga0495683_0032511 | |||
| 1745 | Ga0495683_0049973 | |||
| 1746 | Ga0495687_000292 | |||
| 1747 | Ga0495687_004028 | |||
| 1748 | Ga0495687_053989 | |||
| 1749 | Ga0495687_055158 | |||
| 1750 | Ga0495675_0000784 | |||
| 1751 | Ga0495675_0006186 | |||
| 1752 | Ga0495675_0009654 | |||
| 1753 | Ga0495675_0134339 | |||
| 1754 | Ga0495679_000342 | |||
| 1755 | Ga0495679_001336 | |||
| 1756 | Ga0495679_006514 | |||
| 1757 | Ga0495673_0008672 | |||
| 1758 | Ga0495673_0017547 | |||
| 1759 | Ga0495684_0064932 | |||
| 1760 | Ga0495684_0148529 | |||
| 1761 | Ga0495686_0001715 | |||
| 1762 | Ga0495686_0009644 | |||
| 1763 | Ga0495593_0008485 | |||
| 1764 | Ga0495593_0042701 | |||
| 1765 | Ga0495602_0004174 | |||
| 1766 | Ga0495602_0110178 | |||
| 1767 | Ga0495602_0134587 | |||
| 1768 | Ga0495614_0002311 | |||
| 1769 | Ga0495614_0010363 | |||
| 1770 | Ga0495614_0015494 | |||
| 1771 | Ga0495626_0008575 | |||
| 1772 | Ga0495626_0072060 | |||
| 1773 | Ga0496100_0112035 | |||
| 1774 | Ga0496101_0001250 | |||
| 1775 | Ga0496101_0090419 | |||
| 1776 | Ga0496101_0364172 | |||
| 1777 | Ga0496102_0002193 | |||
| 1778 | Ga0496102_0190228 | |||
| 1779 | Ga0496103_0002317 | |||
| 1780 | Ga0496103_0009680 | |||
| 1781 | Ga0496103_0275839 | |||
| 1782 | Ga0496104_0007665 | |||
| 1783 | Ga0496105_0077564 | |||
| 1784 | Ga0496105_0416377 | |||
| 1785 | Ga0496106_0000051 | |||
| 1786 | Ga0496106_0048008 | |||
| 1787 | Ga0496107_0061373 | |||
| 1788 | Ga0496108_0036075 | |||
| 1789 | Ga0496108_0117169 | |||
| 1790 | Ga0496109_0284672 | |||
| 1791 | Ga0496110_0169121 | |||
| 1792 | Ga0496110_0679806 | |||
| 1793 | Ga0496112_0085244 | |||
| 1794 | Ga0496113_0038065 | |||
| 1795 | Ga0496113_0099632 | |||
| 1796 | Ga0496114_0152801 | |||
| 1797 | Ga0496116_0088893 | |||
| 1798 | Ga0496116_0124794 | |||
| 1799 | Ga0496116_0172593 | |||
| 1800 | Ga0496117_0001476 | |||
| 1801 | Ga0496117_0002745 | |||
| 1802 | Ga0496117_0074720 | |||
| 1803 | Ga0496117_0105394 | |||
| 1804 | Ga0496117_0131554 | |||
| 1805 | Ga0496118_0001841 | |||
| 1806 | Ga0496118_0002994 | |||
| 1807 | Ga0496118_0003375 | |||
| 1808 | Ga0496118_0012483 | |||
| 1809 | Ga0496118_0014012 | |||
| 1810 | Ga0496118_0020217 | |||
| 1811 | Ga0496118_0112447 | |||
| 1812 | Ga0496119_0042024 | |||
| 1813 | Ga0496121_0000639 | |||
| 1814 | Ga0496121_0003125 | |||
| 1815 | Ga0496121_0004422 | |||
| 1816 | Ga0496121_0009350 | |||
| 1817 | Ga0496121_0032381 | |||
| 1818 | Ga0496126_0001778 | |||
| 1819 | Ga0496126_0002490 | |||
| 1820 | Ga0496126_0006608 | |||
| 1821 | Ga0496126_0010712 | |||
| 1822 | Ga0496126_0219721 | |||
| 1823 | Ga0495682_0007651 | |||
| 1824 | Ga0495682_0017449 | |||
| 1825 | Ga0495682_0071906 | |||
| 1826 | Ga0501206_002502 | |||
| 1827 | Ga0501223_020910 | |||
| 1828 | Ga0501252_006389 | |||
| 1829 | Ga0501253_037805 | |||
| 1830 | Ga0501257_053152 | |||
| 1831 | Ga0501265_001018 | |||
| 1832 | nmdc:mga03683_14596_c1 | |||
| 1833 | nmdc:mga03683_2386_c1 | |||
| 1834 | nmdc:mga03n38_80742_c1 | |||
| 1835 | nmdc:mga00v17_37965_c1 | |||
| 1836 | nmdc:mga0yw44_144797_c1 | |||
| 1837 | nmdc:mga0yw44_287378_c1 | |||
| 1838 | nmdc:mga0k408_10932_c1 | |||
| 1839 | nmdc:mga0k408_17492_c1 | |||
| 1840 | nmdc:mga0k408_19702_c1 | |||
| 1841 | nmdc:mga0k408_2227_c1 | |||
| 1842 | nmdc:mga0k408_23154_c1 | |||
| 1843 | nmdc:mga0k408_252_c1 | |||
| 1844 | nmdc:mga0k408_2779_c1 | |||
| 1845 | nmdc:mga0k408_4961_c1 | |||
| 1846 | nmdc:mga0k408_6822_c1 | |||
| 1847 | nmdc:mga0k408_83681_c1 | |||
| 1848 | nmdc:mga0k408_9425_c1 | |||
| 1849 | nmdc:mga06z11_181485_c1 | |||
| 1850 | nmdc:mga06z11_192219_c1 | |||
| 1851 | nmdc:mga06z11_263623_c1 | |||
| 1852 | nmdc:mga04h51_23445_c1 | |||
| 1853 | nmdc:mga07m45_134813_c1 | |||
| 1854 | nmdc:mga07m45_143861_c1 | |||
| 1855 | nmdc:mga07m45_1560_c1 | |||
| 1856 | nmdc:mga07m45_37873_c1 | |||
| 1857 | nmdc:mga07m45_4097_c1 | |||
| 1858 | nmdc:mga07m45_55769_c1 | |||
| 1859 | nmdc:mga07m45_8094_c1 | |||
| 1860 | nmdc:mga05p37_602287_c1 | |||
| 1861 | nmdc:mga0n895_179513_c1 | |||
| 1862 | nmdc:mga0sz30_45608_c1 | |||
| 1863 | nmdc:mga0sz30_55362_c1 | |||
| 1864 | Ga0495601_0091512 | |||
| 1865 | Ga0495595_0078578 | |||
| 1866 | Ga0500578_0000039 | |||
| 1867 | Ga0500578_0015477 | |||
| 1868 | Ga0500644_0001167 | |||
| 1869 | Ga0500644_0012107 | |||
| 1870 | Ga0500594_0000907 | |||
| 1871 | Ga0500628_008513 | |||
| 1872 | Ga0500652_000804 | |||
| 1873 | Ga0500559_0000176 | |||
| 1874 | Ga0500568_0016616 | |||
| 1875 | Ga0500568_0026693 | |||
| 1876 | Ga0500590_002860 | |||
| 1877 | Ga0500604_0022550 | |||
| 1878 | Ga0500620_014684 | |||
| 1879 | Ga0500622_0000770 | |||
| 1880 | Ga0500622_0001562 | |||
| 1881 | Ga0500645_006427 | |||
| 1882 | Ga0587072_011357 | |||
| 1883 | Ga0466962_0003292 | |||
| 1884 | Ga0466962_0030813 | |||
| 1885 | 2501073708 | |||
| 1886 | 2501078223 | |||
| 1887 | 2501409988 | |||
| 1888 | 2509131831 | |||
| 1889 | 2510252947 | |||
| 1890 | 2511089938 | |||
| 1891 | 2511095314 | |||
| 1892 | 2511104986 | |||
| 1893 | 2512346823 | |||
| 1894 | 2513554431 | |||
| 1895 | 2513561211 | |||
| 1896 | 2513959421 | |||
| 1897 | 2514046762 | |||
| 1898 | 2515681903 | |||
| 1899 | 2516018373 | |||
| 1900 | 2519460148 | |||
| 1901 | 2527079518 | |||
| 1902 | 2548500867 | |||
| 1903 | 2563055375 | |||
| 1904 | 2585290354 | |||
| 1905 | 2587725722 | |||
| 1906 | 2587736646 | |||
| 1907 | 2588290652 | |||
| 1908 | 2599744424 | |||
| 1909 | 2600206461 | |||
| 1910 | 2643972666 | |||
| 1911 | 2644057832 | |||
| 1912 | 2644072869 | |||
| 1913 | 2644143487 | |||
| 1914 | 2644276076 | |||
| 1915 | 2644292118 | |||
| 1916 | 2644303437 | |||
| 1917 | 2644646587 | |||
| 1918 | 2676744699 | |||
| 1919 | 2713478982 | |||
| 1920 | 2719638749 | |||
| 1921 | 2738822289 | |||
| 1922 | 2738836575 | |||
| 1923 | 2738875975 | |||
| 1924 | 2739187927 | |||
| 1925 | 2739222573 | |||
| 1926 | 2739242089 | |||
| 1927 | 2753565538 | |||
| 1928 | 2792832607 | |||
| 1929 | 2808968619 | |||
| 1930 | 2809003450 | |||
| 1931 | 2809010727 | |||
| 1932 | 2816470293 | |||
| 1933 | 2817262415 | |||
| 1934 | 2817280134 | |||
| 1935 | 2817455278 | |||
| 1936 | 2819624087 | |||
| 1937 | 2842328947 | |||
| 1938 | 2842353634 | |||
| 1939 | 2842720514 | |||
| 1940 | 2856293047 | |||
| 1941 | 2857361783 | |||
| 1942 | 2883093280 | |||
| 1943 | 2885276289 | |||
| 1944 | 2900578307 | |||
| 1945 | 2900636657 | |||
| 1946 | 2902688860 | |||
| 1947 | 2904488272 | |||
| 1948 | 2904570820 | |||
| 1949 | 2904617997 | |||
| 1950 | 2919530965 | |||
| 1951 | 2921648851 | |||
| 1952 | 2928060924 | |||
| 1953 | 2928112810 | |||
| 1954 | 2928141741 | |||
| 1955 | 2928161738 | |||
| 1956 | 2928170761 | |||
| 1957 | 2928508342 | |||
| 1958 | 2945934997 | |||
| 1959 | 2974321625 | |||
| 1960 | 2981993097 | |||
| 1961 | 2990704445 | |||
| 1962 | 2990714792 | |||
| 1963 | 642424833 | |||
| 1964 | 642419984 | |||
| 1965 | 642591819 | |||
| 1966 | 642619893 | |||
| 1967 | 8003958887 | |||
| 1968 | 8020809836 | |||
| 1969 | 8020948995 | |||
| 1970 | 8039098897 | |||
| 1971 | 8040171013 | |||
| 1972 | 8040175562 | |||
| 1973 | 8055267925 | |||
| 1974 | 8055304346 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6an9-assembly2.cif.gz_A | crystal structure of ppk2 class iii in complex with adp from cytophaga hutchinsonii atcc 33406 | 0.9375 | 7 | 265 |
| 6au0-assembly1.cif.gz_A | crystal structure of ppk2 (class iii) in complex with bisphosphonate inhibitor (2-((3,5-dichlorophenyl)amino)ethane-1,1-diyl)diphosphonic acid | 0.9369 | 7 | 265 |
| 7bmm-assembly2.cif.gz_C | crystal structure of polyphosphate kinase 2 from deinococcus radiodurans in apo form | 0.9364 | 5 | 269 |
| 7bmm-assembly2.cif.gz_C | crystal structure of polyphosphate kinase 2 from deinococcus radiodurans in apo form | 0.9296 | 5 | 269 |
| 5o6m-assembly1.cif.gz_A | structure of polyphosphate kinase from meiothermus ruber n121d bound to atp | 0.9219 | 9 | 258 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5ldbC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9513 | 8 | 260 | 3.40.50.300 |
| 6aqeA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9459 | 6 | 269 | 3.40.50.300 |
| 6aqeA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.939 | 6 | 269 | 3.40.50.300 |
| 6angA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9389 | 7 | 265 | 3.40.50.300 |
| 3czpB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9291 | 29 | 251 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0HG63-F1-model_v4 | Polyphosphate kinase 2 family protein | 0.9845 | 145 | 262 |
GO:0016301
|
| AF-A0A7W9H9L7-F1-model_v4 | Polyphosphate kinase 2 (PPK2 family) | 0.9813 | 146 | 260 |
GO:0016301
|
| AF-Q09C39-F1-model_v4 | PvdS | 0.9771 | 62 | 253 |
GO:0006797
GO:0008976 |
| AF-A0A2V7MJT5-F1-model_v4 | Polyphosphate kinase 2 | 0.9763 | 146 | 269 |
GO:0016301
|
| AF-A0A7W1IA79-F1-model_v4 | Polyphosphate kinase 2 family protein | 0.9757 | 60 | 260 |
GO:0006797
GO:0016301 GO:0016776 |