F487568
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 988 | 462 | 948 | 181 |
Family's Representative Sequence
| Representative Sequence | 3300035113|Ga0373936_0113510|Ga0373936_0113510_382_936 |
| Length | 184 |
| Sequence | MTKGYALFDTAIGRCGIAWTSRGIVATCLPEADERRARVRLARRCPGGEEQTPPPAIQLVIDRVVALLRGAPDDLADVVLDMEAVPEFNARIYAIIRTIPPGETITYGEIAKRLGAVDARDVGQAMGQNPFPPIVPCHRVVAAGSKTGGFSARGGVATKLRMLAIEGAQVDGTLPLFEGPARQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 3 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 4 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 5 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 6 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 7 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 8 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 9 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 10 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 11 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 12 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 13 | 2791355199 | |||
| 14 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 15 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 16 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 17 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 18 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 19 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 20 | 2904699407 | |||
| 21 | 2906610324 | |||
| 22 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 23 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 24 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 25 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 26 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 27 | 2922425934 | |||
| 28 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 29 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 30 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 31 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 32 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 33 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 34 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 35 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 36 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 37 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 41 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 67 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 75 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 81 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 83 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 84 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 85 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 86 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 87 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 88 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 89 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 92 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 93 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 94 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 96 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 97 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 98 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 99 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 103 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 104 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 105 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 106 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 107 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 108 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 109 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 110 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 111 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 112 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 113 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 114 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 115 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 143 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 148 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 149 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 150 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 151 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 210 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 211 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 212 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 217 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 218 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 219 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 221 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 222 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 223 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 224 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 225 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 226 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 227 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 228 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 229 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 230 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 231 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 232 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 233 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 234 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 235 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 236 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 237 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 238 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 239 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 240 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 241 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 242 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 243 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 244 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 245 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 246 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 247 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 250 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 251 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 252 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 253 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 254 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 255 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 256 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 257 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 258 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 259 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 261 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 262 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 263 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 264 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 265 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 266 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 267 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 270 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 271 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 272 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 273 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 274 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 275 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 276 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 277 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 278 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 279 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 280 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 281 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 282 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 283 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 284 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 285 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 286 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 287 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 288 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 364 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 365 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 366 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 367 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 368 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 369 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 370 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 372 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 373 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 374 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 375 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 376 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 377 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 378 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 379 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 380 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 381 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 382 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 383 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 384 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 412 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 413 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 414 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 415 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 416 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 417 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 418 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 425 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 428 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 429 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 430 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 431 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 432 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 433 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 434 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 435 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 436 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 437 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 438 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 439 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 440 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 441 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 442 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 443 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 444 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 445 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 446 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 447 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 448 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 449 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 450 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 451 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 452 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 454 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 455 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 456 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 457 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 458 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 459 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 460 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 461 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 462 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.22 |
| Metatranscriptomes | 1.12 |
| Isolates | 3.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.81 |
| Nodule | 3.44 |
| Rhizoplane | 6.28 |
| Rhizosphere | 75.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10014265 | 3300003203 | Bacteria | 3383 |
| 2 | JGI25165J46597_1008272 | 3300003214 | Bacteria | 1644 |
| 3 | JGI25165J46597_1008905 | 3300003214 | Bacteria | 1541 |
| 4 | JGI25153J46596_10001699 | 3300003215 | Bacteria | 13066 |
| 5 | JGI25404J52841_10003242 | 3300003659 | Bacteria | 3191 |
| 6 | JGI25404J52841_10007484 | 3300003659 | Bacteria | 2310 |
| 7 | JGI25404J52841_10014463 | 3300003659 | Bacteria | 1713 |
| 8 | JGI25404J52841_10049818 | 3300003659 | Bacteria | 881 |
| 9 | Ga0070658_11094795 | 3300005327 | Bacteria | 693 |
| 10 | Ga0070683_100008883 | 3300005329 | Bacteria | 8559 |
| 11 | Ga0070683_100054636 | 3300005329 | Bacteria | 3703 |
| 12 | Ga0070683_100067497 | 3300005329 | Bacteria | 3331 |
| 13 | Ga0070677_10193451 | 3300005333 | Bacteria | 977 |
| 14 | Ga0068869_100084996 | 3300005334 | Bacteria | 2369 |
| 15 | Ga0070680_100003569 | 3300005336 | Bacteria | 11609 |
| 16 | Ga0070680_100162622 | 3300005336 | Bacteria | 1876 |
| 17 | Ga0070680_100239691 | 3300005336 | Bacteria | 1533 |
| 18 | Ga0070682_100289771 | 3300005337 | Bacteria | 1197 |
| 19 | Ga0070682_100290793 | 3300005337 | Bacteria | 1195 |
| 20 | Ga0070660_100028691 | 3300005339 | Bacteria | 4165 |
| 21 | Ga0070660_100068615 | 3300005339 | Bacteria | 2764 |
| 22 | Ga0070660_100233401 | 3300005339 | Bacteria | 1497 |
| 23 | Ga0070660_100484862 | 3300005339 | Bacteria | 1027 |
| 24 | Ga0070689_100440846 | 3300005340 | Bacteria | 1107 |
| 25 | Ga0070691_10122660 | 3300005341 | Bacteria | 1310 |
| 26 | Ga0070661_100292591 | 3300005344 | Bacteria | 1266 |
| 27 | Ga0070661_100391975 | 3300005344 | Bacteria | 1097 |
| 28 | Ga0070661_100418671 | 3300005344 | Bacteria | 1062 |
| 29 | Ga0070661_100954356 | 3300005344 | Bacteria | 710 |
| 30 | Ga0070692_10298644 | 3300005345 | Bacteria | 983 |
| 31 | Ga0070668_100047596 | 3300005347 | Bacteria | 3297 |
| 32 | Ga0070675_100585633 | 3300005354 | Bacteria | 1011 |
| 33 | Ga0070671_100053820 | 3300005355 | Bacteria | 3346 |
| 34 | Ga0070671_100423394 | 3300005355 | Bacteria | 1140 |
| 35 | Ga0070674_100100148 | 3300005356 | Bacteria | 2109 |
| 36 | Ga0070674_100192112 | 3300005356 | Bacteria | 1571 |
| 37 | Ga0070674_100224862 | 3300005356 | Bacteria | 1462 |
| 38 | Ga0070673_100160820 | 3300005364 | Bacteria | 1910 |
| 39 | Ga0070673_100226975 | 3300005364 | Bacteria | 1619 |
| 40 | Ga0070688_100630186 | 3300005365 | Bacteria | 824 |
| 41 | Ga0070688_100638242 | 3300005365 | Bacteria | 819 |
| 42 | Ga0070703_10299701 | 3300005406 | Bacteria | 670 |
| 43 | Ga0070709_10001461 | 3300005434 | Bacteria | 12746 |
| 44 | Ga0070709_10113928 | 3300005434 | Bacteria | 1821 |
| 45 | Ga0070714_100003988 | 3300005435 | Bacteria | 11098 |
| 46 | Ga0070714_100614141 | 3300005435 | Bacteria | 1045 |
| 47 | Ga0070714_100620482 | 3300005435 | Bacteria | 1039 |
| 48 | Ga0070714_101262634 | 3300005435 | Bacteria | 721 |
| 49 | Ga0070713_100009716 | 3300005436 | Bacteria | 6909 |
| 50 | Ga0070713_100045353 | 3300005436 | Bacteria | 3602 |
| 51 | Ga0070713_100130018 | 3300005436 | Bacteria | 2219 |
| 52 | Ga0070713_100193726 | 3300005436 | Bacteria | 1833 |
| 53 | Ga0070713_100700968 | 3300005436 | Bacteria | 966 |
| 54 | Ga0070710_10001981 | 3300005437 | Bacteria | 9708 |
| 55 | Ga0070710_10003702 | 3300005437 | Bacteria | 7230 |
| 56 | Ga0070710_10013111 | 3300005437 | Bacteria | 4139 |
| 57 | Ga0070710_10362886 | 3300005437 | Bacteria | 962 |
| 58 | Ga0070701_10162548 | 3300005438 | Bacteria | 1294 |
| 59 | Ga0070711_100010613 | 3300005439 | Bacteria | 5706 |
| 60 | Ga0070711_100054947 | 3300005439 | Bacteria | 2749 |
| 61 | Ga0070711_100071985 | 3300005439 | Bacteria | 2438 |
| 62 | Ga0070708_100183380 | 3300005445 | Bacteria | 1957 |
| 63 | Ga0070663_100016725 | 3300005455 | Bacteria | 4772 |
| 64 | Ga0070663_100059739 | 3300005455 | Bacteria | 2740 |
| 65 | Ga0070663_100124898 | 3300005455 | Bacteria | 1948 |
| 66 | Ga0070663_100188644 | 3300005455 | Bacteria | 1603 |
| 67 | Ga0070678_100046387 | 3300005456 | Bacteria | 3116 |
| 68 | Ga0070678_100090590 | 3300005456 | Bacteria | 2345 |
| 69 | Ga0070678_100506523 | 3300005456 | Bacteria | 1066 |
| 70 | Ga0070662_100076746 | 3300005457 | Bacteria | 2477 |
| 71 | Ga0070662_100968567 | 3300005457 | Bacteria | 728 |
| 72 | Ga0070681_10015034 | 3300005458 | Bacteria | 7699 |
| 73 | Ga0070681_10265153 | 3300005458 | Bacteria | 1629 |
| 74 | Ga0070681_10304690 | 3300005458 | Bacteria | 1503 |
| 75 | Ga0070681_10683269 | 3300005458 | Bacteria | 942 |
| 76 | Ga0070681_10800358 | 3300005458 | Bacteria | 860 |
| 77 | Ga0068867_100298380 | 3300005459 | Bacteria | 1327 |
| 78 | Ga0068867_100655299 | 3300005459 | Bacteria | 922 |
| 79 | Ga0070706_100406781 | 3300005467 | Bacteria | 1267 |
| 80 | Ga0070707_100939000 | 3300005468 | Bacteria | 830 |
| 81 | Ga0070698_100133500 | 3300005471 | Bacteria | 2437 |
| 82 | Ga0070698_100377666 | 3300005471 | Bacteria | 1350 |
| 83 | Ga0070698_101071959 | 3300005471 | Bacteria | 754 |
| 84 | Ga0070699_101123042 | 3300005518 | Bacteria | 721 |
| 85 | Ga0070679_100074282 | 3300005530 | Bacteria | 3390 |
| 86 | Ga0070679_100094119 | 3300005530 | Bacteria | 2983 |
| 87 | Ga0070679_100132475 | 3300005530 | Bacteria | 2474 |
| 88 | Ga0070679_100340493 | 3300005530 | Bacteria | 1448 |
| 89 | Ga0070679_100416144 | 3300005530 | Bacteria | 1290 |
| 90 | Ga0070679_100963696 | 3300005530 | Bacteria | 797 |
| 91 | Ga0070679_101120527 | 3300005530 | Bacteria | 732 |
| 92 | Ga0070684_100016526 | 3300005535 | Bacteria | 6032 |
| 93 | Ga0070684_100048824 | 3300005535 | Bacteria | 3672 |
| 94 | Ga0070684_100376489 | 3300005535 | Bacteria | 1307 |
| 95 | Ga0070684_100481690 | 3300005535 | Bacteria | 1148 |
| 96 | Ga0070684_101056561 | 3300005535 | Bacteria | 763 |
| 97 | Ga0070697_100071083 | 3300005536 | Bacteria | 2854 |
| 98 | Ga0070697_100103553 | 3300005536 | Bacteria | 2366 |
| 99 | Ga0070697_100986080 | 3300005536 | Bacteria | 749 |
| 100 | Ga0068853_100214433 | 3300005539 | Bacteria | 1756 |
| 101 | Ga0068853_100256064 | 3300005539 | Bacteria | 1608 |
| 102 | Ga0068853_100416327 | 3300005539 | Bacteria | 1260 |
| 103 | Ga0068853_100594557 | 3300005539 | Bacteria | 1050 |
| 104 | Ga0068853_100654930 | 3300005539 | Bacteria | 1000 |
| 105 | Ga0068853_101777931 | 3300005539 | Bacteria | 598 |
| 106 | Ga0070672_100297365 | 3300005543 | Bacteria | 1368 |
| 107 | Ga0070672_100600368 | 3300005543 | Bacteria | 959 |
| 108 | Ga0070686_100145822 | 3300005544 | Bacteria | 1653 |
| 109 | Ga0070686_100788786 | 3300005544 | Bacteria | 765 |
| 110 | Ga0070693_100121665 | 3300005547 | Bacteria | 1619 |
| 111 | Ga0070665_100009458 | 3300005548 | Bacteria | 9864 |
| 112 | Ga0070665_100020723 | 3300005548 | Bacteria | 6606 |
| 113 | Ga0070665_100046666 | 3300005548 | Bacteria | 4350 |
| 114 | Ga0070665_100133651 | 3300005548 | Bacteria | 2483 |
| 115 | Ga0070665_100156385 | 3300005548 | Bacteria | 2281 |
| 116 | Ga0070665_100241352 | 3300005548 | Bacteria | 1807 |
| 117 | Ga0070665_100620169 | 3300005548 | Bacteria | 1095 |
| 118 | Ga0070704_101023742 | 3300005549 | Bacteria | 748 |
| 119 | Ga0068855_100029909 | 3300005563 | Bacteria | 6513 |
| 120 | Ga0068855_100065359 | 3300005563 | Bacteria | 4241 |
| 121 | Ga0068855_100130860 | 3300005563 | Bacteria | 2866 |
| 122 | Ga0068855_100136170 | 3300005563 | Bacteria | 2802 |
| 123 | Ga0068855_100504877 | 3300005563 | Bacteria | 1314 |
| 124 | Ga0068855_100633138 | 3300005563 | Bacteria | 1150 |
| 125 | Ga0070664_100231912 | 3300005564 | Bacteria | 1655 |
| 126 | Ga0068857_100005639 | 3300005577 | Bacteria | 10702 |
| 127 | Ga0068857_100641834 | 3300005577 | Bacteria | 1006 |
| 128 | Ga0068854_100005923 | 3300005578 | Bacteria | 7744 |
| 129 | Ga0068854_101185061 | 3300005578 | Bacteria | 684 |
| 130 | Ga0068856_100000476 | 3300005614 | Bacteria | 44310 |
| 131 | Ga0068856_100416911 | 3300005614 | Bacteria | 1363 |
| 132 | Ga0068856_100427182 | 3300005614 | Bacteria | 1345 |
| 133 | Ga0068852_100276425 | 3300005616 | Bacteria | 1618 |
| 134 | Ga0068864_100305057 | 3300005618 | Bacteria | 1491 |
| 135 | Ga0068864_100536784 | 3300005618 | Bacteria | 1129 |
| 136 | Ga0068866_11015432 | 3300005718 | Bacteria | 590 |
| 137 | Ga0068861_100063011 | 3300005719 | Bacteria | 2849 |
| 138 | Ga0068861_100434442 | 3300005719 | Bacteria | 1173 |
| 139 | Ga0068870_10081819 | 3300005840 | Bacteria | 1787 |
| 140 | Ga0068870_10086555 | 3300005840 | Bacteria | 1744 |
| 141 | Ga0068858_100179452 | 3300005842 | Bacteria | 1999 |
| 142 | Ga0068858_100201984 | 3300005842 | Bacteria | 1880 |
| 143 | Ga0068858_100219487 | 3300005842 | Bacteria | 1800 |
| 144 | Ga0068858_100857524 | 3300005842 | Bacteria | 887 |
| 145 | Ga0081455_10008457 | 3300005937 | Bacteria | 10700 |
| 146 | Ga0081455_10011371 | 3300005937 | Bacteria | 8946 |
| 147 | Ga0081455_10071946 | 3300005937 | Bacteria | 2865 |
| 148 | Ga0081455_10116310 | 3300005937 | Bacteria | 2115 |
| 149 | Ga0081540_1005329 | 3300005983 | Bacteria | 9623 |
| 150 | Ga0081540_1007078 | 3300005983 | Bacteria | 8062 |
| 151 | Ga0081540_1007475 | 3300005983 | Bacteria | 7780 |
| 152 | Ga0081540_1010016 | 3300005983 | Bacteria | 6451 |
| 153 | Ga0081540_1016353 | 3300005983 | Bacteria | 4646 |
| 154 | Ga0081540_1018434 | 3300005983 | Bacteria | 4281 |
| 155 | Ga0081540_1027051 | 3300005983 | Bacteria | 3259 |
| 156 | Ga0081540_1048885 | 3300005983 | Bacteria | 2115 |
| 157 | Ga0081540_1053004 | 3300005983 | Bacteria | 1993 |
| 158 | Ga0081540_1053054 | 3300005983 | Bacteria | 1991 |
| 159 | Ga0081540_1069721 | 3300005983 | Bacteria | 1632 |
| 160 | Ga0081539_10000425 | 3300005985 | Bacteria | 89942 |
| 161 | Ga0081539_10037181 | 3300005985 | Bacteria | 2903 |
| 162 | Ga0070717_10001915 | 3300006028 | Bacteria | 14544 |
| 163 | Ga0075365_10037480 | 3300006038 | Bacteria | 3148 |
| 164 | Ga0075365_10058983 | 3300006038 | Bacteria | 2556 |
| 165 | Ga0075365_10096611 | 3300006038 | Bacteria | 2019 |
| 166 | Ga0075365_10367306 | 3300006038 | Bacteria | 1015 |
| 167 | Ga0075365_10399644 | 3300006038 | Bacteria | 970 |
| 168 | Ga0075368_10034050 | 3300006042 | Bacteria | 1984 |
| 169 | Ga0075368_10097895 | 3300006042 | Bacteria | 1203 |
| 170 | Ga0075363_100000795 | 3300006048 | Bacteria | 10907 |
| 171 | Ga0075363_100029297 | 3300006048 | Bacteria | 2840 |
| 172 | Ga0075363_100072106 | 3300006048 | Bacteria | 1878 |
| 173 | Ga0075364_10378811 | 3300006051 | Bacteria | 965 |
| 174 | Ga0070715_10002928 | 3300006163 | Bacteria | 5333 |
| 175 | Ga0070716_100017312 | 3300006173 | Bacteria | 3733 |
| 176 | Ga0070716_100286211 | 3300006173 | Bacteria | 1140 |
| 177 | Ga0070716_100525524 | 3300006173 | Bacteria | 877 |
| 178 | Ga0070716_100820800 | 3300006173 | Bacteria | 722 |
| 179 | Ga0070712_100254170 | 3300006175 | Bacteria | 1406 |
| 180 | Ga0070712_100347031 | 3300006175 | Bacteria | 1214 |
| 181 | Ga0070712_100388111 | 3300006175 | Bacteria | 1151 |
| 182 | Ga0070712_100423449 | 3300006175 | Bacteria | 1104 |
| 183 | Ga0070712_100980028 | 3300006175 | Bacteria | 731 |
| 184 | Ga0075362_10102482 | 3300006177 | Bacteria | 1340 |
| 185 | Ga0075367_10009759 | 3300006178 | Bacteria | 5027 |
| 186 | Ga0075367_10026192 | 3300006178 | Bacteria | 3304 |
| 187 | Ga0075367_10485489 | 3300006178 | Bacteria | 783 |
| 188 | Ga0075369_10023467 | 3300006186 | Bacteria | 2550 |
| 189 | Ga0075369_10467989 | 3300006186 | Bacteria | 598 |
| 190 | Ga0075366_10186109 | 3300006195 | Bacteria | 1262 |
| 191 | Ga0075370_10096836 | 3300006353 | Bacteria | 1706 |
| 192 | Ga0075370_10714073 | 3300006353 | Bacteria | 610 |
| 193 | Ga0068871_100158458 | 3300006358 | Bacteria | 1934 |
| 194 | Ga0075428_100128792 | 3300006844 | Bacteria | 2753 |
| 195 | Ga0075433_10781196 | 3300006852 | Bacteria | 835 |
| 196 | Ga0068865_100100401 | 3300006881 | Bacteria | 2117 |
| 197 | Ga0068865_100220495 | 3300006881 | Bacteria | 1482 |
| 198 | Ga0068865_100245917 | 3300006881 | Bacteria | 1409 |
| 199 | Ga0099825_1022556 | 3300006941 | Bacteria | 4040 |
| 200 | Ga0099822_1024573 | 3300006943 | Bacteria | 5376 |
| 201 | Ga0099794_10013122 | 3300007265 | Bacteria | 3598 |
| 202 | Ga0099795_10144911 | 3300007788 | Bacteria | 969 |
| 203 | Ga0105251_10300235 | 3300009011 | Bacteria | 728 |
| 204 | Ga0105240_10031535 | 3300009093 | Bacteria | 6872 |
| 205 | Ga0105240_10031799 | 3300009093 | Bacteria | 6838 |
| 206 | Ga0105240_10581974 | 3300009093 | Bacteria | 1235 |
| 207 | Ga0105245_10680866 | 3300009098 | Bacteria | 1060 |
| 208 | Ga0105245_10755680 | 3300009098 | Bacteria | 1008 |
| 209 | Ga0105245_10857082 | 3300009098 | Bacteria | 949 |
| 210 | Ga0105247_10277217 | 3300009101 | Bacteria | 1155 |
| 211 | Ga0114129_10043623 | 3300009147 | Bacteria | 6310 |
| 212 | Ga0105241_10112909 | 3300009174 | Bacteria | 2177 |
| 213 | Ga0105241_10578625 | 3300009174 | Bacteria | 1012 |
| 214 | Ga0105242_10139169 | 3300009176 | Bacteria | 2104 |
| 215 | Ga0105248_10329581 | 3300009177 | Bacteria | 1719 |
| 216 | Ga0105237_10641939 | 3300009545 | Bacteria | 1068 |
| 217 | Ga0105238_10007773 | 3300009551 | Bacteria | 10722 |
| 218 | Ga0105238_10042015 | 3300009551 | Bacteria | 4630 |
| 219 | Ga0105238_10334610 | 3300009551 | Bacteria | 1501 |
| 220 | Ga0105238_10757486 | 3300009551 | Bacteria | 985 |
| 221 | Ga0105249_10156611 | 3300009553 | Bacteria | 2197 |
| 222 | Ga0105249_11010209 | 3300009553 | Bacteria | 901 |
| 223 | Ga0105239_10013308 | 3300010375 | Bacteria | 9143 |
| 224 | Ga0105239_10429826 | 3300010375 | Bacteria | 1497 |
| 225 | Ga0105239_10971086 | 3300010375 | Bacteria | 976 |
| 226 | Ga0105246_10316965 | 3300011119 | Bacteria | 1265 |
| 227 | Ga0157373_10614708 | 3300013100 | Bacteria | 792 |
| 228 | Ga0157370_10061297 | 3300013104 | Bacteria | 3570 |
| 229 | Ga0157370_10079869 | 3300013104 | Bacteria | 3080 |
| 230 | Ga0157370_10148369 | 3300013104 | Bacteria | 2183 |
| 231 | Ga0157369_10012327 | 3300013105 | Bacteria | 9710 |
| 232 | Ga0157369_10013199 | 3300013105 | Bacteria | 9350 |
| 233 | Ga0157369_10113235 | 3300013105 | Bacteria | 2882 |
| 234 | Ga0157369_10330348 | 3300013105 | Bacteria | 1584 |
| 235 | Ga0157369_11026646 | 3300013105 | Bacteria | 844 |
| 236 | Ga0157369_11154996 | 3300013105 | Bacteria | 791 |
| 237 | Ga0157374_10513632 | 3300013296 | Bacteria | 1203 |
| 238 | Ga0157374_10747123 | 3300013296 | Bacteria | 993 |
| 239 | Ga0157374_10774577 | 3300013296 | Bacteria | 975 |
| 240 | Ga0157378_11219616 | 3300013297 | Bacteria | 792 |
| 241 | Ga0163162_10230968 | 3300013306 | Bacteria | 1981 |
| 242 | Ga0163162_11868690 | 3300013306 | Bacteria | 687 |
| 243 | Ga0157372_10452965 | 3300013307 | Bacteria | 1495 |
| 244 | Ga0157372_10472819 | 3300013307 | Bacteria | 1461 |
| 245 | Ga0157372_10556992 | 3300013307 | Bacteria | 1336 |
| 246 | Ga0157375_11563882 | 3300013308 | Bacteria | 779 |
| 247 | Ga0163163_10051682 | 3300014325 | Bacteria | 4051 |
| 248 | Ga0163163_10066420 | 3300014325 | Bacteria | 3582 |
| 249 | Ga0163163_11457722 | 3300014325 | Bacteria | 746 |
| 250 | Ga0157380_10227116 | 3300014326 | Bacteria | 1674 |
| 251 | Ga0157376_10443554 | 3300014969 | Bacteria | 1264 |
| 252 | Ga0157376_11040123 | 3300014969 | Bacteria | 843 |
| 253 | Ga0163161_10142698 | 3300017792 | Bacteria | 1814 |
| 254 | Ga0197907_10482238 | 3300020069 | Bacteria | 873 |
| 255 | Ga0197907_11225397 | 3300020069 | Bacteria | 706 |
| 256 | Ga0206356_11267106 | 3300020070 | Bacteria | 767 |
| 257 | Ga0206355_1215798 | 3300020076 | Bacteria | 706 |
| 258 | Ga0206352_10436581 | 3300020078 | Bacteria | 755 |
| 259 | Ga0206352_11357989 | 3300020078 | Bacteria | 661 |
| 260 | Ga0206350_10949899 | 3300020080 | Bacteria | 703 |
| 261 | Ga0206354_10068295 | 3300020081 | Bacteria | 721 |
| 262 | Ga0206353_11967255 | 3300020082 | Bacteria | 1301 |
| 263 | Ga0213873_10004591 | 3300021358 | Bacteria | 2591 |
| 264 | Ga0213873_10009335 | 3300021358 | Bacteria | 2034 |
| 265 | Ga0213876_10002064 | 3300021384 | Bacteria | 11899 |
| 266 | Ga0213876_10031000 | 3300021384 | Bacteria | 2822 |
| 267 | Ga0213875_10090152 | 3300021388 | Bacteria | 1430 |
| 268 | Ga0213871_10000490 | 3300021441 | Bacteria | 5411 |
| 269 | Ga0224712_10242241 | 3300022467 | Bacteria | 831 |
| 270 | Ga0209233_1002779 | 3300025261 | Bacteria | 6291 |
| 271 | Ga0209455_1011932 | 3300025272 | Bacteria | 2109 |
| 272 | Ga0209758_1010528 | 3300025297 | Bacteria | 5516 |
| 273 | Ga0209758_1025853 | 3300025297 | Bacteria | 2562 |
| 274 | Ga0207653_10043757 | 3300025885 | Bacteria | 1475 |
| 275 | Ga0207692_10002972 | 3300025898 | Bacteria | 6568 |
| 276 | Ga0207692_10008204 | 3300025898 | Bacteria | 4317 |
| 277 | Ga0207692_10030002 | 3300025898 | Bacteria | 2589 |
| 278 | Ga0207642_10311043 | 3300025899 | Bacteria | 917 |
| 279 | Ga0207688_10470209 | 3300025901 | Bacteria | 785 |
| 280 | Ga0207680_10274615 | 3300025903 | Bacteria | 1170 |
| 281 | Ga0207647_10076385 | 3300025904 | Bacteria | 2015 |
| 282 | Ga0207647_10348943 | 3300025904 | Bacteria | 838 |
| 283 | Ga0207685_10110293 | 3300025905 | Bacteria | 1192 |
| 284 | Ga0207685_10451964 | 3300025905 | Bacteria | 668 |
| 285 | Ga0207699_10005733 | 3300025906 | Bacteria | 5973 |
| 286 | Ga0207699_10094679 | 3300025906 | Bacteria | 1882 |
| 287 | Ga0207699_10527185 | 3300025906 | Bacteria | 855 |
| 288 | Ga0207699_10794527 | 3300025906 | Bacteria | 695 |
| 289 | Ga0207645_10111875 | 3300025907 | Bacteria | 1768 |
| 290 | Ga0207645_10336235 | 3300025907 | Bacteria | 1009 |
| 291 | Ga0207705_10134297 | 3300025909 | Bacteria | 1844 |
| 292 | Ga0207705_11212792 | 3300025909 | Bacteria | 578 |
| 293 | Ga0207654_10024224 | 3300025911 | Bacteria | 3261 |
| 294 | Ga0207707_10002162 | 3300025912 | Bacteria | 17780 |
| 295 | Ga0207707_10005294 | 3300025912 | Bacteria | 11286 |
| 296 | Ga0207707_10404715 | 3300025912 | Bacteria | 1171 |
| 297 | Ga0207707_10437690 | 3300025912 | Bacteria | 1119 |
| 298 | Ga0207707_10661325 | 3300025912 | Bacteria | 880 |
| 299 | Ga0207695_10027026 | 3300025913 | Bacteria | 6394 |
| 300 | Ga0207695_10054704 | 3300025913 | Bacteria | 4165 |
| 301 | Ga0207695_10085563 | 3300025913 | Bacteria | 3181 |
| 302 | Ga0207695_10240938 | 3300025913 | Bacteria | 1710 |
| 303 | Ga0207671_10012964 | 3300025914 | Bacteria | 6670 |
| 304 | Ga0207671_10703067 | 3300025914 | Bacteria | 804 |
| 305 | Ga0207671_11076284 | 3300025914 | Bacteria | 632 |
| 306 | Ga0207693_10004007 | 3300025915 | Bacteria | 12519 |
| 307 | Ga0207693_10009468 | 3300025915 | Bacteria | 7934 |
| 308 | Ga0207693_10009993 | 3300025915 | Bacteria | 7715 |
| 309 | Ga0207693_10063412 | 3300025915 | Bacteria | 2895 |
| 310 | Ga0207693_10242502 | 3300025915 | Bacteria | 1415 |
| 311 | Ga0207693_10344250 | 3300025915 | Bacteria | 1167 |
| 312 | Ga0207663_10010172 | 3300025916 | Bacteria | 4995 |
| 313 | Ga0207663_10056128 | 3300025916 | Bacteria | 2475 |
| 314 | Ga0207663_10156346 | 3300025916 | Bacteria | 1604 |
| 315 | Ga0207660_10161258 | 3300025917 | Bacteria | 1730 |
| 316 | Ga0207660_10185538 | 3300025917 | Bacteria | 1617 |
| 317 | Ga0207660_10286300 | 3300025917 | Bacteria | 1309 |
| 318 | Ga0207660_10502286 | 3300025917 | Bacteria | 984 |
| 319 | Ga0207657_10008647 | 3300025919 | Bacteria | 10306 |
| 320 | Ga0207657_10228648 | 3300025919 | Bacteria | 1488 |
| 321 | Ga0207657_10445895 | 3300025919 | Bacteria | 1016 |
| 322 | Ga0207649_10176590 | 3300025920 | Bacteria | 1492 |
| 323 | Ga0207649_10467497 | 3300025920 | Bacteria | 954 |
| 324 | Ga0207649_10761871 | 3300025920 | Bacteria | 754 |
| 325 | Ga0207652_10013564 | 3300025921 | Bacteria | 6591 |
| 326 | Ga0207652_10039725 | 3300025921 | Bacteria | 3994 |
| 327 | Ga0207652_10106404 | 3300025921 | Bacteria | 2483 |
| 328 | Ga0207652_10177471 | 3300025921 | Bacteria | 1913 |
| 329 | Ga0207652_10350452 | 3300025921 | Bacteria | 1332 |
| 330 | Ga0207681_10273572 | 3300025923 | Bacteria | 1327 |
| 331 | Ga0207694_10031537 | 3300025924 | Bacteria | 4049 |
| 332 | Ga0207694_10048565 | 3300025924 | Bacteria | 3284 |
| 333 | Ga0207694_10119947 | 3300025924 | Bacteria | 2099 |
| 334 | Ga0207694_10234551 | 3300025924 | Bacteria | 1499 |
| 335 | Ga0207694_10321344 | 3300025924 | Bacteria | 1277 |
| 336 | Ga0207659_10551777 | 3300025926 | Bacteria | 979 |
| 337 | Ga0207659_10675924 | 3300025926 | Bacteria | 883 |
| 338 | Ga0207687_10013836 | 3300025927 | Bacteria | 5270 |
| 339 | Ga0207687_10052637 | 3300025927 | Bacteria | 2842 |
| 340 | Ga0207687_10286140 | 3300025927 | Bacteria | 1323 |
| 341 | Ga0207700_10008050 | 3300025928 | Bacteria | 6500 |
| 342 | Ga0207700_10078205 | 3300025928 | Bacteria | 2572 |
| 343 | Ga0207700_10165094 | 3300025928 | Bacteria | 1842 |
| 344 | Ga0207700_10392223 | 3300025928 | Bacteria | 1215 |
| 345 | Ga0207700_10419375 | 3300025928 | Bacteria | 1175 |
| 346 | Ga0207700_11304046 | 3300025928 | Bacteria | 647 |
| 347 | Ga0207664_10010392 | 3300025929 | Bacteria | 6574 |
| 348 | Ga0207664_11375967 | 3300025929 | Bacteria | 626 |
| 349 | Ga0207690_10378503 | 3300025932 | Bacteria | 1124 |
| 350 | Ga0207706_10317750 | 3300025933 | Bacteria | 1355 |
| 351 | Ga0207686_10124640 | 3300025934 | Bacteria | 1759 |
| 352 | Ga0207709_10022329 | 3300025935 | Bacteria | 3589 |
| 353 | Ga0207709_10085086 | 3300025935 | Bacteria | 2049 |
| 354 | Ga0207709_10291770 | 3300025935 | Bacteria | 1209 |
| 355 | Ga0207709_10338661 | 3300025935 | Bacteria | 1131 |
| 356 | Ga0207670_10407696 | 3300025936 | Bacteria | 1088 |
| 357 | Ga0207669_10117923 | 3300025937 | Bacteria | 1795 |
| 358 | Ga0207669_10491398 | 3300025937 | Bacteria | 980 |
| 359 | Ga0207704_10123604 | 3300025938 | Bacteria | 1777 |
| 360 | Ga0207704_10270825 | 3300025938 | Bacteria | 1286 |
| 361 | Ga0207665_10002028 | 3300025939 | Bacteria | 13631 |
| 362 | Ga0207665_10115974 | 3300025939 | Bacteria | 1887 |
| 363 | Ga0207665_10205865 | 3300025939 | Bacteria | 1435 |
| 364 | Ga0207665_10253265 | 3300025939 | Bacteria | 1302 |
| 365 | Ga0207665_10558601 | 3300025939 | Bacteria | 890 |
| 366 | Ga0207665_10590132 | 3300025939 | Bacteria | 867 |
| 367 | Ga0207691_10482785 | 3300025940 | Bacteria | 1053 |
| 368 | Ga0207711_10310988 | 3300025941 | Bacteria | 1455 |
| 369 | Ga0207711_10611101 | 3300025941 | Bacteria | 1017 |
| 370 | Ga0207689_10081964 | 3300025942 | Bacteria | 2652 |
| 371 | Ga0207689_10593662 | 3300025942 | Bacteria | 931 |
| 372 | Ga0207661_10004540 | 3300025944 | Bacteria | 9726 |
| 373 | Ga0207661_10006444 | 3300025944 | Bacteria | 8298 |
| 374 | Ga0207661_10501990 | 3300025944 | Bacteria | 1108 |
| 375 | Ga0207661_10752271 | 3300025944 | Bacteria | 897 |
| 376 | Ga0207667_10013617 | 3300025949 | Bacteria | 9297 |
| 377 | Ga0207667_10029690 | 3300025949 | Bacteria | 5925 |
| 378 | Ga0207667_10076087 | 3300025949 | Bacteria | 3484 |
| 379 | Ga0207667_10496673 | 3300025949 | Bacteria | 1238 |
| 380 | Ga0207667_10865519 | 3300025949 | Bacteria | 897 |
| 381 | Ga0207712_10042423 | 3300025961 | Bacteria | 3132 |
| 382 | Ga0207712_11173602 | 3300025961 | Bacteria | 685 |
| 383 | Ga0207668_10062725 | 3300025972 | Bacteria | 2618 |
| 384 | Ga0207668_10117798 | 3300025972 | Bacteria | 2005 |
| 385 | Ga0207668_10487738 | 3300025972 | Bacteria | 1058 |
| 386 | Ga0207640_10016570 | 3300025981 | Bacteria | 4290 |
| 387 | Ga0207640_11113810 | 3300025981 | Bacteria | 699 |
| 388 | Ga0207658_10329549 | 3300025986 | Bacteria | 1324 |
| 389 | Ga0207658_11477781 | 3300025986 | Bacteria | 622 |
| 390 | Ga0207677_10067541 | 3300026023 | Bacteria | 2505 |
| 391 | Ga0207677_10378830 | 3300026023 | Bacteria | 1194 |
| 392 | Ga0207703_10162751 | 3300026035 | Bacteria | 1956 |
| 393 | Ga0207703_10656164 | 3300026035 | Bacteria | 996 |
| 394 | Ga0207703_10746145 | 3300026035 | Bacteria | 933 |
| 395 | Ga0207639_10031167 | 3300026041 | Bacteria | 3917 |
| 396 | Ga0207639_10126624 | 3300026041 | Bacteria | 2108 |
| 397 | Ga0207639_10271183 | 3300026041 | Bacteria | 1488 |
| 398 | Ga0207639_10333333 | 3300026041 | Bacteria | 1351 |
| 399 | Ga0207639_10391767 | 3300026041 | Bacteria | 1250 |
| 400 | Ga0207678_10010954 | 3300026067 | Bacteria | 7969 |
| 401 | Ga0207678_10045772 | 3300026067 | Bacteria | 3783 |
| 402 | Ga0207678_10053837 | 3300026067 | Bacteria | 3467 |
| 403 | Ga0207678_10066420 | 3300026067 | Bacteria | 3097 |
| 404 | Ga0207678_10693967 | 3300026067 | Bacteria | 896 |
| 405 | Ga0207702_10000514 | 3300026078 | Bacteria | 43618 |
| 406 | Ga0207702_10624719 | 3300026078 | Bacteria | 1058 |
| 407 | Ga0207648_10049340 | 3300026089 | Bacteria | 3683 |
| 408 | Ga0207648_10525823 | 3300026089 | Bacteria | 1084 |
| 409 | Ga0207676_10019625 | 3300026095 | Bacteria | 4934 |
| 410 | Ga0207676_10512021 | 3300026095 | Bacteria | 1141 |
| 411 | Ga0207674_10048184 | 3300026116 | Bacteria | 4362 |
| 412 | Ga0207674_10521377 | 3300026116 | Bacteria | 1148 |
| 413 | Ga0207675_100037613 | 3300026118 | Bacteria | 4513 |
| 414 | Ga0207675_100070222 | 3300026118 | Bacteria | 3273 |
| 415 | Ga0207683_10021505 | 3300026121 | Bacteria | 5525 |
| 416 | Ga0207683_10128052 | 3300026121 | Bacteria | 2283 |
| 417 | Ga0207683_10700350 | 3300026121 | Bacteria | 939 |
| 418 | Ga0207683_11003797 | 3300026121 | Bacteria | 775 |
| 419 | Ga0207698_10057798 | 3300026142 | Bacteria | 3003 |
| 420 | Ga0207698_10469412 | 3300026142 | Bacteria | 1218 |
| 421 | Ga0207698_10703187 | 3300026142 | Bacteria | 1006 |
| 422 | Ga0209589_1000005 | 3300027357 | Bacteria | 530958 |
| 423 | Ga0209489_100005 | 3300027361 | Bacteria | 530958 |
| 424 | Ga0209700_100006 | 3300027363 | Bacteria | 530958 |
| 425 | Ga0209179_1000570 | 3300027512 | Bacteria | 3866 |
| 426 | Ga0209588_1046767 | 3300027671 | Bacteria | 1400 |
| 427 | Ga0268266_10005838 | 3300028379 | Bacteria | 11389 |
| 428 | Ga0268266_10156331 | 3300028379 | Bacteria | 2060 |
| 429 | Ga0268266_10192118 | 3300028379 | Bacteria | 1864 |
| 430 | Ga0268266_11375680 | 3300028379 | Bacteria | 681 |
| 431 | Ga0268266_11655517 | 3300028379 | Bacteria | 615 |
| 432 | Ga0268265_10268494 | 3300028380 | Bacteria | 1520 |
| 433 | Ga0268265_10719307 | 3300028380 | Bacteria | 966 |
| 434 | Ga0265334_10016514 | 3300028573 | Bacteria | 3053 |
| 435 | Ga0307515_10054329 | 3300028794 | Bacteria | 5883 |
| 436 | Ga0307515_10204476 | 3300028794 | Bacteria | 1840 |
| 437 | Ga0307515_10763341 | 3300028794 | Bacteria | 587 |
| 438 | Ga0307512_10301481 | 3300030522 | Bacteria | 746 |
| 439 | Ga0265760_10084633 | 3300031090 | Bacteria | 986 |
| 440 | Ga0265332_10008158 | 3300031238 | Bacteria | 4710 |
| 441 | Ga0265328_10031392 | 3300031239 | Bacteria | 1974 |
| 442 | Ga0265340_10018482 | 3300031247 | Bacteria | 3594 |
| 443 | Ga0265339_10040049 | 3300031249 | Bacteria | 2606 |
| 444 | Ga0265331_10101405 | 3300031250 | Bacteria | 1324 |
| 445 | Ga0265316_10107714 | 3300031344 | Bacteria | 2113 |
| 446 | Ga0265316_10271313 | 3300031344 | Bacteria | 1241 |
| 447 | Ga0307513_10105798 | 3300031456 | Bacteria | 2821 |
| 448 | Ga0307408_100853722 | 3300031548 | Bacteria | 830 |
| 449 | Ga0307508_10045726 | 3300031616 | Bacteria | 3910 |
| 450 | Ga0265314_10015497 | 3300031711 | Bacteria | 6048 |
| 451 | Ga0265314_10061194 | 3300031711 | Bacteria | 2565 |
| 452 | Ga0265314_10113147 | 3300031711 | Bacteria | 1721 |
| 453 | Ga0265314_10124452 | 3300031711 | Bacteria | 1617 |
| 454 | Ga0265342_10010500 | 3300031712 | Bacteria | 6417 |
| 455 | Ga0265342_10036461 | 3300031712 | Bacteria | 3004 |
| 456 | Ga0307516_10072595 | 3300031730 | Bacteria | 3300 |
| 457 | Ga0307516_10075437 | 3300031730 | Bacteria | 3226 |
| 458 | Ga0307516_10427281 | 3300031730 | Bacteria | 982 |
| 459 | Ga0307413_10328219 | 3300031824 | Bacteria | 1172 |
| 460 | Ga0307413_11040531 | 3300031824 | Bacteria | 704 |
| 461 | Ga0307410_10783535 | 3300031852 | Bacteria | 810 |
| 462 | Ga0307406_10443469 | 3300031901 | Bacteria | 1040 |
| 463 | Ga0307406_10528755 | 3300031901 | Bacteria | 961 |
| 464 | Ga0307406_10641596 | 3300031901 | Bacteria | 880 |
| 465 | Ga0307412_10211313 | 3300031911 | Bacteria | 1481 |
| 466 | Ga0307412_10508815 | 3300031911 | Bacteria | 1004 |
| 467 | Ga0307416_100205834 | 3300032002 | Bacteria | 1872 |
| 468 | Ga0307411_10305237 | 3300032005 | Bacteria | 1278 |
| 469 | Ga0307415_100077941 | 3300032126 | Bacteria | 2355 |
| 470 | Ga0307415_100258870 | 3300032126 | Bacteria | 1418 |
| 471 | Ga0307415_100289060 | 3300032126 | Bacteria | 1352 |
| 472 | Ga0307510_10005379 | 3300033180 | Bacteria | 15241 |
| 473 | Ga0307510_10083698 | 3300033180 | Bacteria | 3078 |
| 474 | Ga0307510_10315969 | 3300033180 | Bacteria | 1020 |
| 475 | Ga0315911_1000015 | 3300033442 | Bacteria | 185247 |
| 476 | Ga0373930_0102633 | 3300034816 | Bacteria | 681 |
| 477 | Ga0373938_0059947 | 3300034957 | Bacteria | 888 |
| 478 | Ga0373926_0127308 | 3300035083 | Bacteria | 963 |
| 479 | Ga0373934_0008069 | 3300035086 | Bacteria | 3919 |
| 480 | Ga0373934_0120402 | 3300035086 | Bacteria | 1067 |
| 481 | Ga0373934_0171130 | 3300035086 | Bacteria | 892 |
| 482 | Ga0373944_0176156 | 3300035089 | Bacteria | 765 |
| 483 | Ga0373952_0105271 | 3300035092 | Bacteria | 749 |
| 484 | Ga0373923_0010770 | 3300035111 | Bacteria | 3337 |
| 485 | Ga0373923_0157577 | 3300035111 | Bacteria | 1034 |
| 486 | Ga0373932_0068821 | 3300035112 | Bacteria | 1093 |
| 487 | Ga0373936_0025118 | 3300035113 | Bacteria | 2328 |
| 488 | Ga0373936_0044108 | 3300035113 | Bacteria | 1794 |
| 489 | Ga0373936_0085085 | 3300035113 | Bacteria | 1320 |
| 490 | Ga0373936_0113510 | 3300035113 | Bacteria | 1152 |
| 491 | Ga0373941_0050835 | 3300035115 | Bacteria | 1317 |
| 492 | Ga0373945_0015999 | 3300035116 | Bacteria | 2528 |
| 493 | Ga0373953_0081691 | 3300035117 | Bacteria | 1344 |
| 494 | Ga0373953_0128586 | 3300035117 | Bacteria | 1079 |
| 495 | Ga0373953_0421904 | 3300035117 | Bacteria | 588 |
| 496 | Ga0373954_0003254 | 3300035118 | Bacteria | 6857 |
| 497 | Ga0373954_0013871 | 3300035118 | Bacteria | 3592 |
| 498 | Ga0373954_0050144 | 3300035118 | Bacteria | 1958 |
| 499 | Ga0373956_0244077 | 3300035119 | Bacteria | 854 |
| 500 | Ga0373957_0161379 | 3300035120 | Bacteria | 923 |
| 501 | Ga0373943_0077832 | 3300035170 | Bacteria | 1694 |
| 502 | Ga0373943_0192461 | 3300035170 | Bacteria | 1125 |
| 503 | Ga0373946_0055424 | 3300035171 | Bacteria | 1671 |
| 504 | Ga0373946_0061132 | 3300035171 | Bacteria | 1603 |
| 505 | Ga0373946_0192923 | 3300035171 | Bacteria | 972 |
| 506 | Ga0373946_0193549 | 3300035171 | Bacteria | 971 |
| 507 | Ga0373955_0019007 | 3300035172 | Bacteria | 3427 |
| 508 | Ga0373955_0034453 | 3300035172 | Bacteria | 2674 |
| 509 | Ga0373942_0136365 | 3300035207 | Bacteria | 778 |
| 510 | Ga0373962_0060838 | 3300035242 | Bacteria | 1109 |
| 511 | Ga0373924_0020154 | 3300035410 | Bacteria | 2589 |
| 512 | Ga0373924_0071056 | 3300035410 | Bacteria | 1468 |
| 513 | Ga0373931_0002294 | 3300035691 | Bacteria | 8454 |
| 514 | Ga0373935_0012074 | 3300035692 | Bacteria | 5192 |
| 515 | Ga0373935_0047436 | 3300035692 | Bacteria | 2716 |
| 516 | Ga0373935_0107938 | 3300035692 | Bacteria | 1844 |
| 517 | Ga0373935_0144774 | 3300035692 | Bacteria | 1608 |
| 518 | Ga0373927_0012034 | 3300035695 | Bacteria | 5755 |
| 519 | Ga0373927_0033415 | 3300035695 | Bacteria | 3349 |
| 520 | Ga0373927_0187178 | 3300035695 | Bacteria | 1358 |
| 521 | Ga0373927_0287620 | 3300035695 | Bacteria | 1082 |
| 522 | Ga0373933_0000784 | 3300035724 | Bacteria | 19397 |
| 523 | Ga0373933_0002702 | 3300035724 | Bacteria | 9936 |
| 524 | Ga0373933_0024423 | 3300035724 | Bacteria | 3460 |
| 525 | Ga0373933_0391771 | 3300035724 | Bacteria | 905 |
| 526 | Ga0373933_0625609 | 3300035724 | Bacteria | 707 |
| 527 | Ga0373933_0792884 | 3300035724 | Bacteria | 623 |
| 528 | Ga0373947_0006075 | 3300035725 | Bacteria | 7038 |
| 529 | Ga0373947_0018523 | 3300035725 | Bacteria | 4008 |
| 530 | Ga0373947_0100020 | 3300035725 | Bacteria | 1821 |
| 531 | Ga0373937_0013724 | 3300036401 | Bacteria | 7139 |
| 532 | Ga0373937_0629745 | 3300036401 | Bacteria | 1018 |
| 533 | Ga0373937_0678128 | 3300036401 | Bacteria | 977 |
| 534 | Ga0373937_0915674 | 3300036401 | Bacteria | 825 |
| 535 | Ga0373925_0028352 | 3300037068 | Bacteria | 4102 |
| 536 | Ga0373925_0031318 | 3300037068 | Bacteria | 3908 |
| 537 | Ga0373925_0062447 | 3300037068 | Bacteria | 2801 |
| 538 | Ga0395899_0138645 | 3300037312 | Bacteria | 1732 |
| 539 | Ga0395900_0049784 | 3300037418 | Bacteria | 4317 |
| 540 | Ga0395900_0311332 | 3300037418 | Bacteria | 1558 |
| 541 | Ga0395898_0055824 | 3300037466 | Bacteria | 3852 |
| 542 | Ga0395898_0103771 | 3300037466 | Bacteria | 2727 |
| 543 | Ga0395905_0069858 | 3300037471 | Bacteria | 3290 |
| 544 | Ga0436364_0881658 | 3300037853 | Bacteria | 1656 |
| 545 | Ga0436364_1111914 | 3300037853 | Bacteria | 2129 |
| 546 | Ga0395901_0387541 | 3300038443 | Bacteria | 1437 |
| 547 | Ga0436365_0564143 | 3300039437 | Bacteria | 2450 |
| 548 | Ga0436365_0972944 | 3300039437 | Bacteria | 3362 |
| 549 | Ga0436365_1342005 | 3300039437 | Bacteria | 11459 |
| 550 | Ga0436365_1493072 | 3300039437 | Bacteria | 8985 |
| 551 | Ga0436365_1883175 | 3300039437 | Bacteria | 1493 |
| 552 | Ga0436360_0879024 | 3300039438 | Bacteria | 977 |
| 553 | Ga0436361_0964292 | 3300039447 | Bacteria | 1654 |
| 554 | Ga0436363_0039534 | 3300039450 | Bacteria | 3177 |
| 555 | Ga0436363_0296726 | 3300039450 | Bacteria | 920 |
| 556 | Ga0436363_0557724 | 3300039450 | Bacteria | 1048 |
| 557 | Ga0436362_0009437 | 3300039453 | Bacteria | 1971 |
| 558 | Ga0436362_0953067 | 3300039453 | Bacteria | 5962 |
| 559 | Ga0439465_0020470 | 3300041413 | Bacteria | 2073 |
| 560 | Ga0451833_0686916 | 3300041491 | Bacteria | 606 |
| 561 | Ga0451839_0697962 | 3300041496 | Bacteria | 590 |
| 562 | Ga0439459_0022873 | 3300042438 | Bacteria | 1213 |
| 563 | Ga0466970_0255650 | 3300044765 | Bacteria | 982 |
| 564 | Ga0466957_0059062 | 3300044842 | Bacteria | 2350 |
| 565 | Ga0466957_0392866 | 3300044842 | Bacteria | 948 |
| 566 | Ga0466959_0044336 | 3300045049 | Bacteria | 3278 |
| 567 | Ga0466967_0101592 | 3300045976 | Bacteria | 2629 |
| 568 | Ga0466967_0357537 | 3300045976 | Bacteria | 1414 |
| 569 | Ga0466967_0432291 | 3300045976 | Bacteria | 1284 |
| 570 | Ga0466967_0589444 | 3300045976 | Bacteria | 1096 |
| 571 | Ga0466967_1495507 | 3300045976 | Bacteria | 673 |
| 572 | Ga0495617_020141 | 3300046452 | Bacteria | 2254 |
| 573 | Ga0495592_0057714 | 3300046454 | Bacteria | 2865 |
| 574 | Ga0495592_0420691 | 3300046454 | Bacteria | 843 |
| 575 | Ga0495603_0008752 | 3300046455 | Bacteria | 6120 |
| 576 | Ga0495603_0049995 | 3300046455 | Bacteria | 2487 |
| 577 | Ga0495603_0159059 | 3300046455 | Bacteria | 1310 |
| 578 | Ga0495629_0002984 | 3300046459 | Bacteria | 12864 |
| 579 | Ga0495629_0035847 | 3300046459 | Bacteria | 3504 |
| 580 | Ga0495641_0018784 | 3300046461 | Bacteria | 3558 |
| 581 | Ga0495651_0036567 | 3300046462 | Bacteria | 3823 |
| 582 | Ga0495651_0060367 | 3300046462 | Bacteria | 2904 |
| 583 | Ga0495653_0028021 | 3300046463 | Bacteria | 4508 |
| 584 | Ga0495653_0232128 | 3300046463 | Bacteria | 1234 |
| 585 | Ga0495653_0537577 | 3300046463 | Bacteria | 724 |
| 586 | Ga0495650_0096464 | 3300046471 | Bacteria | 1116 |
| 587 | Ga0495580_0098534 | 3300046472 | Bacteria | 2033 |
| 588 | Ga0495582_0080477 | 3300046473 | Bacteria | 1809 |
| 589 | Ga0495582_0282995 | 3300046473 | Bacteria | 952 |
| 590 | Ga0495639_0003042 | 3300046475 | Bacteria | 7301 |
| 591 | Ga0495639_0007837 | 3300046475 | Bacteria | 4591 |
| 592 | Ga0495639_0042858 | 3300046475 | Bacteria | 2043 |
| 593 | Ga0495639_0103382 | 3300046475 | Bacteria | 1347 |
| 594 | Ga0495662_0034440 | 3300046476 | Bacteria | 2444 |
| 595 | Ga0495662_0103228 | 3300046476 | Bacteria | 1395 |
| 596 | Ga0495662_0114892 | 3300046476 | Bacteria | 1320 |
| 597 | Ga0495664_0129187 | 3300046477 | Bacteria | 1529 |
| 598 | Ga0495664_0156356 | 3300046477 | Bacteria | 1383 |
| 599 | Ga0495594_0020690 | 3300046499 | Bacteria | 3506 |
| 600 | Ga0495594_0096208 | 3300046499 | Bacteria | 1663 |
| 601 | Ga0495594_0398184 | 3300046499 | Bacteria | 783 |
| 602 | Ga0495594_0414886 | 3300046499 | Bacteria | 766 |
| 603 | Ga0495596_0022344 | 3300046500 | Bacteria | 2576 |
| 604 | Ga0495583_0112530 | 3300046506 | Bacteria | 1152 |
| 605 | Ga0495606_0003350 | 3300046507 | Bacteria | 17079 |
| 606 | Ga0495608_0183608 | 3300046511 | Bacteria | 1323 |
| 607 | Ga0495608_0189832 | 3300046511 | Bacteria | 1297 |
| 608 | Ga0495618_0054775 | 3300046514 | Bacteria | 2525 |
| 609 | Ga0495618_0166821 | 3300046514 | Bacteria | 1402 |
| 610 | Ga0495618_0253407 | 3300046514 | Bacteria | 1104 |
| 611 | Ga0495620_0068670 | 3300046515 | Bacteria | 1455 |
| 612 | Ga0495628_0018851 | 3300046516 | Bacteria | 5712 |
| 613 | Ga0495628_0037867 | 3300046516 | Bacteria | 3864 |
| 614 | Ga0495628_0076373 | 3300046516 | Bacteria | 2607 |
| 615 | Ga0495628_0577615 | 3300046516 | Bacteria | 805 |
| 616 | Ga0495630_0059721 | 3300046517 | Bacteria | 2861 |
| 617 | Ga0495630_0098848 | 3300046517 | Bacteria | 2208 |
| 618 | Ga0495630_0430695 | 3300046517 | Bacteria | 1011 |
| 619 | Ga0495630_0762626 | 3300046517 | Bacteria | 739 |
| 620 | Ga0495632_0158599 | 3300046519 | Bacteria | 1043 |
| 621 | Ga0495632_0192772 | 3300046519 | Bacteria | 930 |
| 622 | Ga0495632_0274205 | 3300046519 | Bacteria | 752 |
| 623 | Ga0495644_0043821 | 3300046523 | Bacteria | 1683 |
| 624 | Ga0495648_0005396 | 3300046524 | Bacteria | 10629 |
| 625 | Ga0495666_0090625 | 3300046526 | Bacteria | 1443 |
| 626 | Ga0495642_0041301 | 3300046528 | Bacteria | 1876 |
| 627 | Ga0495652_0141008 | 3300046529 | Bacteria | 1895 |
| 628 | Ga0495652_0273775 | 3300046529 | Bacteria | 1239 |
| 629 | Ga0495652_0314817 | 3300046529 | Bacteria | 1133 |
| 630 | Ga0495665_0048993 | 3300046531 | Bacteria | 2240 |
| 631 | Ga0495665_0072348 | 3300046531 | Bacteria | 1816 |
| 632 | Ga0495665_0260691 | 3300046531 | Bacteria | 891 |
| 633 | Ga0495665_0289521 | 3300046531 | Bacteria | 840 |
| 634 | Ga0495640_0031105 | 3300046533 | Bacteria | 3813 |
| 635 | Ga0495640_0043124 | 3300046533 | Bacteria | 3143 |
| 636 | Ga0495640_0197990 | 3300046533 | Bacteria | 1274 |
| 637 | Ga0495640_0501708 | 3300046533 | Bacteria | 738 |
| 638 | Ga0495586_0084345 | 3300046535 | Bacteria | 1749 |
| 639 | Ga0495587_0070229 | 3300046536 | Bacteria | 2038 |
| 640 | Ga0495609_0127835 | 3300046538 | Bacteria | 1090 |
| 641 | Ga0495609_0128949 | 3300046538 | Bacteria | 1084 |
| 642 | Ga0495645_0024397 | 3300046543 | Bacteria | 4388 |
| 643 | Ga0495645_0187646 | 3300046543 | Bacteria | 1411 |
| 644 | Ga0495622_0015653 | 3300046557 | Bacteria | 3526 |
| 645 | Ga0495622_0035408 | 3300046557 | Bacteria | 2328 |
| 646 | Ga0495667_0035702 | 3300046559 | Bacteria | 3321 |
| 647 | Ga0495667_0122295 | 3300046559 | Bacteria | 1680 |
| 648 | Ga0495667_0146376 | 3300046559 | Bacteria | 1521 |
| 649 | Ga0495667_0785906 | 3300046559 | Bacteria | 587 |
| 650 | Ga0495656_0137787 | 3300046615 | Bacteria | 1167 |
| 651 | Ga0495656_0189032 | 3300046615 | Bacteria | 1016 |
| 652 | Ga0495668_0464903 | 3300046616 | Bacteria | 696 |
| 653 | Ga0495634_0005863 | 3300046642 | Bacteria | 9385 |
| 654 | Ga0495634_0038694 | 3300046642 | Bacteria | 3251 |
| 655 | Ga0495634_0096854 | 3300046642 | Bacteria | 1910 |
| 656 | Ga0495634_0164285 | 3300046642 | Bacteria | 1398 |
| 657 | Ga0495625_0621482 | 3300046660 | Bacteria | 646 |
| 658 | Ga0495635_0004233 | 3300046663 | Bacteria | 9950 |
| 659 | Ga0495635_0058430 | 3300046663 | Bacteria | 2653 |
| 660 | Ga0495659_0008839 | 3300046664 | Bacteria | 3208 |
| 661 | Ga0495659_0104801 | 3300046664 | Bacteria | 1099 |
| 662 | Ga0495659_0250466 | 3300046664 | Bacteria | 738 |
| 663 | Ga0495661_0195600 | 3300046665 | Bacteria | 1062 |
| 664 | Ga0495588_0020627 | 3300046674 | Bacteria | 3242 |
| 665 | Ga0495657_0025879 | 3300046675 | Bacteria | 4162 |
| 666 | Ga0495657_0063786 | 3300046675 | Bacteria | 2429 |
| 667 | Ga0495657_0327290 | 3300046675 | Bacteria | 910 |
| 668 | Ga0495599_0018837 | 3300046678 | Bacteria | 4302 |
| 669 | Ga0495599_0080476 | 3300046678 | Bacteria | 2034 |
| 670 | Ga0495599_0145712 | 3300046678 | Bacteria | 1468 |
| 671 | Ga0495623_0006324 | 3300046679 | Bacteria | 7698 |
| 672 | Ga0495623_0238414 | 3300046679 | Bacteria | 1028 |
| 673 | Ga0495646_0017450 | 3300046680 | Bacteria | 4553 |
| 674 | Ga0495646_0046764 | 3300046680 | Bacteria | 2636 |
| 675 | Ga0495646_0118960 | 3300046680 | Bacteria | 1496 |
| 676 | Ga0495647_0013604 | 3300046681 | Bacteria | 2823 |
| 677 | Ga0495647_0120523 | 3300046681 | Bacteria | 1103 |
| 678 | Ga0495658_0087659 | 3300046683 | Bacteria | 1838 |
| 679 | Ga0495658_0300810 | 3300046683 | Bacteria | 1015 |
| 680 | Ga0495658_0348775 | 3300046683 | Bacteria | 941 |
| 681 | Ga0495669_0006974 | 3300046684 | Bacteria | 4731 |
| 682 | Ga0495669_0049594 | 3300046684 | Bacteria | 1880 |
| 683 | Ga0495669_0118974 | 3300046684 | Bacteria | 1237 |
| 684 | Ga0495613_0106646 | 3300046689 | Bacteria | 2021 |
| 685 | Ga0495613_0213921 | 3300046689 | Bacteria | 1355 |
| 686 | Ga0495613_0880490 | 3300046689 | Bacteria | 580 |
| 687 | Ga0495624_0039316 | 3300046690 | Bacteria | 3033 |
| 688 | Ga0495624_0130355 | 3300046690 | Bacteria | 1542 |
| 689 | Ga0495624_0373061 | 3300046690 | Bacteria | 858 |
| 690 | Ga0495670_0088380 | 3300046691 | Bacteria | 1584 |
| 691 | Ga0495670_0112902 | 3300046691 | Bacteria | 1407 |
| 692 | Ga0495589_0212256 | 3300046794 | Bacteria | 911 |
| 693 | Ga0495600_0100555 | 3300046809 | Bacteria | 1885 |
| 694 | Ga0495600_0240484 | 3300046809 | Bacteria | 1154 |
| 695 | Ga0495600_0246640 | 3300046809 | Bacteria | 1137 |
| 696 | Ga0495600_0777507 | 3300046809 | Bacteria | 572 |
| 697 | Ga0495660_0233494 | 3300046810 | Bacteria | 861 |
| 698 | Ga0495581_0022509 | 3300047315 | Bacteria | 3652 |
| 699 | Ga0495581_0039231 | 3300047315 | Bacteria | 2741 |
| 700 | Ga0495581_0056334 | 3300047315 | Bacteria | 2269 |
| 701 | Ga0495581_0133443 | 3300047315 | Bacteria | 1447 |
| 702 | Ga0495604_0093644 | 3300047317 | Bacteria | 2222 |
| 703 | Ga0495604_0098991 | 3300047317 | Bacteria | 2147 |
| 704 | Ga0495604_0103732 | 3300047317 | Bacteria | 2085 |
| 705 | Ga0495604_0282157 | 3300047317 | Bacteria | 1122 |
| 706 | Ga0495604_0417447 | 3300047317 | Bacteria | 881 |
| 707 | Ga0495604_0430065 | 3300047317 | Bacteria | 865 |
| 708 | Ga0495604_0459204 | 3300047317 | Bacteria | 831 |
| 709 | Ga0495636_0050243 | 3300047318 | Bacteria | 1745 |
| 710 | Ga0495674_0066189 | 3300047319 | Bacteria | 3136 |
| 711 | Ga0495674_0087507 | 3300047319 | Bacteria | 2666 |
| 712 | Ga0495674_0119336 | 3300047319 | Bacteria | 2229 |
| 713 | Ga0495674_1008512 | 3300047319 | Bacteria | 638 |
| 714 | Ga0495672_0053768 | 3300047320 | Bacteria | 2357 |
| 715 | Ga0495672_0206616 | 3300047320 | Bacteria | 978 |
| 716 | Ga0495676_0050003 | 3300047321 | Bacteria | 3356 |
| 717 | Ga0495680_0152660 | 3300047322 | Bacteria | 1682 |
| 718 | Ga0495680_0406147 | 3300047322 | Bacteria | 939 |
| 719 | Ga0495675_0037487 | 3300047444 | Bacteria | 3087 |
| 720 | Ga0495675_0039044 | 3300047444 | Bacteria | 3023 |
| 721 | Ga0495675_0377973 | 3300047444 | Bacteria | 829 |
| 722 | Ga0495679_063429 | 3300047446 | Bacteria | 1079 |
| 723 | Ga0495673_0121565 | 3300047469 | Bacteria | 1034 |
| 724 | Ga0495684_0008094 | 3300047471 | Bacteria | 8129 |
| 725 | Ga0495684_0019268 | 3300047471 | Bacteria | 5253 |
| 726 | Ga0495684_0079279 | 3300047471 | Bacteria | 2493 |
| 727 | Ga0495684_0252110 | 3300047471 | Bacteria | 1284 |
| 728 | Ga0495686_0122443 | 3300047472 | Bacteria | 1548 |
| 729 | Ga0495686_0134394 | 3300047472 | Bacteria | 1464 |
| 730 | Ga0495593_0032879 | 3300047673 | Bacteria | 2826 |
| 731 | Ga0495593_0040757 | 3300047673 | Bacteria | 2499 |
| 732 | Ga0495593_0049421 | 3300047673 | Bacteria | 2231 |
| 733 | Ga0495593_0170222 | 3300047673 | Bacteria | 1098 |
| 734 | Ga0495593_0283985 | 3300047673 | Bacteria | 828 |
| 735 | Ga0495602_0061833 | 3300048088 | Bacteria | 3252 |
| 736 | Ga0495602_0197811 | 3300048088 | Bacteria | 1536 |
| 737 | Ga0495602_0288857 | 3300048088 | Bacteria | 1205 |
| 738 | Ga0495614_0183994 | 3300048089 | Bacteria | 941 |
| 739 | Ga0495614_0273504 | 3300048089 | Bacteria | 776 |
| 740 | Ga0495615_0039676 | 3300048090 | Bacteria | 1169 |
| 741 | Ga0495626_0218940 | 3300048091 | Bacteria | 774 |
| 742 | Ga0496100_0241413 | 3300048903 | Bacteria | 1333 |
| 743 | Ga0496101_0077541 | 3300048904 | Bacteria | 2449 |
| 744 | Ga0496101_0181632 | 3300048904 | Bacteria | 1620 |
| 745 | Ga0496101_0210619 | 3300048904 | Bacteria | 1506 |
| 746 | Ga0496101_0642682 | 3300048904 | Bacteria | 838 |
| 747 | Ga0496101_0975022 | 3300048904 | Bacteria | 667 |
| 748 | Ga0496101_1009162 | 3300048904 | Bacteria | 654 |
| 749 | Ga0496102_0084967 | 3300048905 | Bacteria | 2922 |
| 750 | Ga0496102_0094275 | 3300048905 | Bacteria | 2774 |
| 751 | Ga0496102_0129276 | 3300048905 | Bacteria | 2363 |
| 752 | Ga0496102_0201988 | 3300048905 | Bacteria | 1874 |
| 753 | Ga0496102_0481573 | 3300048905 | Bacteria | 1162 |
| 754 | Ga0496102_0520590 | 3300048905 | Bacteria | 1112 |
| 755 | Ga0496103_0107579 | 3300048906 | Bacteria | 1769 |
| 756 | Ga0496104_0007678 | 3300048907 | Bacteria | 9549 |
| 757 | Ga0496104_0140577 | 3300048907 | Bacteria | 2319 |
| 758 | Ga0496104_0580447 | 3300048907 | Bacteria | 1031 |
| 759 | Ga0496104_0622867 | 3300048907 | Bacteria | 989 |
| 760 | Ga0496104_0687146 | 3300048907 | Bacteria | 931 |
| 761 | Ga0496105_0097372 | 3300048908 | Bacteria | 2430 |
| 762 | Ga0496105_0274728 | 3300048908 | Bacteria | 1360 |
| 763 | Ga0496105_0439275 | 3300048908 | Bacteria | 1031 |
| 764 | Ga0496105_0471756 | 3300048908 | Bacteria | 988 |
| 765 | Ga0496106_0008768 | 3300048909 | Bacteria | 7473 |
| 766 | Ga0496106_0057561 | 3300048909 | Bacteria | 2940 |
| 767 | Ga0496106_0073480 | 3300048909 | Bacteria | 2616 |
| 768 | Ga0496106_0090660 | 3300048909 | Bacteria | 2359 |
| 769 | Ga0496107_0032726 | 3300048910 | Bacteria | 3717 |
| 770 | Ga0496107_0222751 | 3300048910 | Bacteria | 1403 |
| 771 | Ga0496107_0476306 | 3300048910 | Bacteria | 926 |
| 772 | Ga0496108_0204509 | 3300048911 | Bacteria | 1713 |
| 773 | Ga0496108_0223181 | 3300048911 | Bacteria | 1637 |
| 774 | Ga0496109_0000469 | 3300048912 | Bacteria | 34339 |
| 775 | Ga0496109_0944410 | 3300048912 | Bacteria | 800 |
| 776 | Ga0496110_0011658 | 3300048913 | Bacteria | 7207 |
| 777 | Ga0496110_0065763 | 3300048913 | Bacteria | 3206 |
| 778 | Ga0496110_0284284 | 3300048913 | Bacteria | 1506 |
| 779 | Ga0496110_0674586 | 3300048913 | Bacteria | 934 |
| 780 | Ga0496110_0739849 | 3300048913 | Bacteria | 886 |
| 781 | Ga0496111_0035057 | 3300048914 | Bacteria | 3585 |
| 782 | Ga0496111_0084785 | 3300048914 | Bacteria | 2316 |
| 783 | Ga0496111_0155210 | 3300048914 | Bacteria | 1698 |
| 784 | Ga0496111_0873852 | 3300048914 | Bacteria | 648 |
| 785 | Ga0496111_0979587 | 3300048914 | Bacteria | 606 |
| 786 | Ga0496112_0000096 | 3300048915 | Bacteria | 57298 |
| 787 | Ga0496112_0017876 | 3300048915 | Bacteria | 6673 |
| 788 | Ga0496112_0111037 | 3300048915 | Bacteria | 2712 |
| 789 | Ga0496112_0119746 | 3300048915 | Bacteria | 2602 |
| 790 | Ga0496112_0119972 | 3300048915 | Bacteria | 2600 |
| 791 | Ga0496112_0287859 | 3300048915 | Bacteria | 1589 |
| 792 | Ga0496113_0119862 | 3300048916 | Bacteria | 2056 |
| 793 | Ga0496113_0171286 | 3300048916 | Bacteria | 1719 |
| 794 | Ga0496113_0244651 | 3300048916 | Bacteria | 1431 |
| 795 | Ga0496114_0005276 | 3300048917 | Bacteria | 10097 |
| 796 | Ga0496114_0326765 | 3300048917 | Bacteria | 1356 |
| 797 | Ga0496114_0363577 | 3300048917 | Bacteria | 1280 |
| 798 | Ga0496115_0019167 | 3300048918 | Bacteria | 5263 |
| 799 | Ga0496115_0019415 | 3300048918 | Bacteria | 5230 |
| 800 | Ga0496115_0044802 | 3300048918 | Bacteria | 3531 |
| 801 | Ga0496115_0130697 | 3300048918 | Bacteria | 2069 |
| 802 | Ga0496115_0583505 | 3300048918 | Bacteria | 890 |
| 803 | Ga0496118_0136657 | 3300048921 | Bacteria | 1563 |
| 804 | Ga0496118_0264262 | 3300048921 | Bacteria | 969 |
| 805 | Ga0496119_0070230 | 3300048922 | Bacteria | 2055 |
| 806 | Ga0496119_0123615 | 3300048922 | Bacteria | 1419 |
| 807 | Ga0496119_0231188 | 3300048922 | Bacteria | 941 |
| 808 | Ga0496121_0002453 | 3300048924 | Bacteria | 28353 |
| 809 | Ga0496121_0084289 | 3300048924 | Bacteria | 2506 |
| 810 | Ga0496121_0169347 | 3300048924 | Bacteria | 1589 |
| 811 | Ga0496121_0448430 | 3300048924 | Bacteria | 832 |
| 812 | Ga0496121_0568859 | 3300048924 | Bacteria | 706 |
| 813 | Ga0496124_0160713 | 3300048927 | Bacteria | 1751 |
| 814 | Ga0496125_0226979 | 3300048928 | Bacteria | 1198 |
| 815 | Ga0496126_0056340 | 3300048929 | Bacteria | 3553 |
| 816 | Ga0496126_0067172 | 3300048929 | Bacteria | 3204 |
| 817 | Ga0496126_0111934 | 3300048929 | Bacteria | 2377 |
| 818 | Ga0496126_0390298 | 3300048929 | Bacteria | 1131 |
| 819 | Ga0496126_0509483 | 3300048929 | Bacteria | 960 |
| 820 | Ga0495682_0150622 | 3300049460 | Bacteria | 830 |
| 821 | Ga0501032_0000196 | 3300049569 | Bacteria | 50261 |
| 822 | Ga0501032_0096066 | 3300049569 | Bacteria | 1964 |
| 823 | Ga0501033_0003209 | 3300049570 | Bacteria | 13536 |
| 824 | Ga0501033_0018168 | 3300049570 | Bacteria | 5313 |
| 825 | Ga0501034_0001151 | 3300049571 | Bacteria | 36663 |
| 826 | Ga0501034_0504125 | 3300049571 | Bacteria | 1124 |
| 827 | Ga0501036_0000323 | 3300049572 | Bacteria | 33256 |
| 828 | Ga0501036_0083448 | 3300049572 | Bacteria | 2701 |
| 829 | Ga0501036_0607310 | 3300049572 | Bacteria | 907 |
| 830 | Ga0501037_0001377 | 3300049573 | Bacteria | 17808 |
| 831 | Ga0501037_0001630 | 3300049573 | Bacteria | 16306 |
| 832 | Ga0501038_0001622 | 3300049574 | Bacteria | 20925 |
| 833 | Ga0501039_0001302 | 3300049575 | Bacteria | 18240 |
| 834 | Ga0501039_0258956 | 3300049575 | Bacteria | 1367 |
| 835 | Ga0501039_0578651 | 3300049575 | Bacteria | 881 |
| 836 | Ga0501042_0046374 | 3300049578 | Bacteria | 3098 |
| 837 | Ga0501042_0137635 | 3300049578 | Bacteria | 1760 |
| 838 | Ga0501043_0000409 | 3300049579 | Bacteria | 38657 |
| 839 | Ga0501043_0017728 | 3300049579 | Bacteria | 5582 |
| 840 | Ga0501046_0000181 | 3300049580 | Bacteria | 64035 |
| 841 | Ga0501046_0060008 | 3300049580 | Bacteria | 2977 |
| 842 | Ga0501047_0002426 | 3300049581 | Bacteria | 17808 |
| 843 | Ga0501047_0062965 | 3300049581 | Bacteria | 3578 |
| 844 | Ga0501047_0352826 | 3300049581 | Bacteria | 1307 |
| 845 | Ga0501048_0003595 | 3300049582 | Bacteria | 11806 |
| 846 | Ga0501067_0000145 | 3300049583 | Bacteria | 39277 |
| 847 | Ga0501067_0023101 | 3300049583 | Bacteria | 3445 |
| 848 | Ga0501067_0050454 | 3300049583 | Bacteria | 2306 |
| 849 | Ga0501068_0002577 | 3300049584 | Bacteria | 9611 |
| 850 | Ga0501069_0116733 | 3300049585 | Bacteria | 1522 |
| 851 | Ga0501070_0003510 | 3300049586 | Bacteria | 13565 |
| 852 | Ga0501070_0605189 | 3300049586 | Bacteria | 873 |
| 853 | Ga0501071_0274480 | 3300049587 | Bacteria | 1275 |
| 854 | Ga0501072_0017020 | 3300049588 | Bacteria | 5585 |
| 855 | Ga0501073_0000027 | 3300049589 | Bacteria | 121860 |
| 856 | Ga0501073_0039562 | 3300049589 | Bacteria | 3340 |
| 857 | Ga0501074_0001347 | 3300049590 | Bacteria | 16291 |
| 858 | Ga0501074_0146411 | 3300049590 | Bacteria | 1689 |
| 859 | Ga0501079_0048138 | 3300049741 | Bacteria | 3290 |
| 860 | Ga0501079_0751275 | 3300049741 | Bacteria | 768 |
| 861 | Ga0501080_0002621 | 3300049742 | Bacteria | 15752 |
| 862 | Ga0501080_0052129 | 3300049742 | Bacteria | 3808 |
| 863 | Ga0501083_0002123 | 3300049744 | Bacteria | 13604 |
| 864 | Ga0501035_0001852 | 3300049822 | Bacteria | 21281 |
| 865 | Ga0501035_0005411 | 3300049822 | Bacteria | 12069 |
| 866 | Ga0501044_0003498 | 3300049823 | Bacteria | 17680 |
| 867 | Ga0501044_0035674 | 3300049823 | Bacteria | 5207 |
| 868 | Ga0501044_0453947 | 3300049823 | Bacteria | 1188 |
| 869 | Ga0501045_1042880 | 3300049824 | Bacteria | 599 |
| 870 | nmdc:mga03683_147542_c1 | 3300050489 | Bacteria | 1060 |
| 871 | nmdc:mga03683_266469_c1 | 3300050489 | Bacteria | 798 |
| 872 | nmdc:mga03n38_415174_c1 | 3300050490 | Bacteria | 743 |
| 873 | nmdc:mga03n38_98_c1 | 3300050490 | Bacteria | 19203 |
| 874 | nmdc:mga00v17_134015_c1 | 3300050491 | Bacteria | 1585 |
| 875 | nmdc:mga00v17_360989_c1 | 3300050491 | Bacteria | 944 |
| 876 | nmdc:mga00v17_825617_c1 | 3300050491 | Bacteria | 590 |
| 877 | nmdc:mga0yw44_134681_c1 | 3300050492 | Bacteria | 1602 |
| 878 | nmdc:mga0yw44_375205_c1 | 3300050492 | Bacteria | 960 |
| 879 | nmdc:mga0yw44_459536_c1 | 3300050492 | Bacteria | 863 |
| 880 | nmdc:mga0yw44_6672_c1 | 3300050492 | Bacteria | 5602 |
| 881 | nmdc:mga0k408_135893_c1 | 3300050493 | Bacteria | 1461 |
| 882 | nmdc:mga0k408_219045_c1 | 3300050493 | Bacteria | 1136 |
| 883 | nmdc:mga0k408_67583_c1 | 3300050493 | Bacteria | 2083 |
| 884 | nmdc:mga06z11_114027_c1 | 3300050494 | Bacteria | 1500 |
| 885 | nmdc:mga06z11_32996_c1 | 3300050494 | Bacteria | 2529 |
| 886 | nmdc:mga06z11_342728_c1 | 3300050494 | Bacteria | 894 |
| 887 | nmdc:mga06z11_37963_c1 | 3300050494 | Bacteria | 2389 |
| 888 | nmdc:mga06z11_656518_c1 | 3300050494 | Bacteria | 639 |
| 889 | nmdc:mga07m45_144674_c1 | 3300050496 | Bacteria | 1378 |
| 890 | nmdc:mga07m45_9952_c2 | 3300050496 | Bacteria | 4350 |
| 891 | nmdc:mga08y16_1190555_c1 | 3300050511 | Bacteria | 733 |
| 892 | nmdc:mga0n895_1673395_c1 | 3300050512 | Bacteria | 599 |
| 893 | nmdc:mga0n895_179818_c1 | 3300050512 | Bacteria | 2146 |
| 894 | nmdc:mga0rr50_287390_c1 | 3300050513 | Bacteria | 1373 |
| 895 | nmdc:mga08x19_815980_c1 | 3300050514 | Bacteria | 662 |
| 896 | Ga0495601_0018892 | 3300053077 | Bacteria | 4199 |
| 897 | Ga0495601_0023042 | 3300053077 | Bacteria | 3826 |
| 898 | Ga0495601_0045290 | 3300053077 | Bacteria | 2766 |
| 899 | Ga0495612_0050427 | 3300053078 | Bacteria | 1709 |
| 900 | Ga0495612_0141603 | 3300053078 | Bacteria | 1043 |
| 901 | Ga0495612_0266615 | 3300053078 | Bacteria | 764 |
| 902 | Ga0500635_0003192 | 3300053080 | Bacteria | 4104 |
| 903 | Ga0500635_0008969 | 3300053080 | Bacteria | 2760 |
| 904 | Ga0495595_0051790 | 3300053084 | Bacteria | 1903 |
| 905 | Ga0495619_0008712 | 3300053085 | Bacteria | 6416 |
| 906 | Ga0495619_0052867 | 3300053085 | Bacteria | 2685 |
| 907 | Ga0495619_0620895 | 3300053085 | Bacteria | 739 |
| 908 | Ga0495619_0639291 | 3300053085 | Bacteria | 726 |
| 909 | Ga0500578_0459676 | 3300053086 | Bacteria | 723 |
| 910 | Ga0500566_0000207 | 3300053094 | Bacteria | 31105 |
| 911 | Ga0500641_0001497 | 3300053096 | Bacteria | 8343 |
| 912 | Ga0500641_0170350 | 3300053096 | Bacteria | 937 |
| 913 | Ga0500654_137610 | 3300053099 | Bacteria | 902 |
| 914 | Ga0500554_000856 | 3300053102 | Bacteria | 5978 |
| 915 | Ga0500554_001256 | 3300053102 | Bacteria | 4908 |
| 916 | Ga0500556_0017680 | 3300053104 | Bacteria | 2238 |
| 917 | Ga0500572_000676 | 3300053111 | Bacteria | 11214 |
| 918 | Ga0500595_000299 | 3300053119 | Bacteria | 32634 |
| 919 | Ga0500595_003982 | 3300053119 | Bacteria | 6751 |
| 920 | Ga0500595_004108 | 3300053119 | Bacteria | 6601 |
| 921 | Ga0500595_015612 | 3300053119 | Bacteria | 2847 |
| 922 | Ga0500608_051325 | 3300053122 | Bacteria | 1981 |
| 923 | Ga0500614_005280 | 3300053123 | Bacteria | 2713 |
| 924 | Ga0500642_0009622 | 3300053130 | Bacteria | 3365 |
| 925 | Ga0500559_0107274 | 3300053136 | Bacteria | 1292 |
| 926 | Ga0500568_0008381 | 3300053139 | Bacteria | 4985 |
| 927 | Ga0500603_000313 | 3300053150 | Bacteria | 12755 |
| 928 | Ga0500603_016677 | 3300053150 | Bacteria | 1746 |
| 929 | Ga0500619_187121 | 3300053154 | Bacteria | 698 |
| 930 | Ga0500627_0208447 | 3300053158 | Bacteria | 875 |
| 931 | Ga0500630_001066 | 3300053159 | Bacteria | 12827 |
| 932 | Ga0500633_0209680 | 3300053160 | Bacteria | 729 |
| 933 | Ga0500638_002777 | 3300053162 | Bacteria | 6250 |
| 934 | Ga0500638_003145 | 3300053162 | Bacteria | 6024 |
| 935 | Ga0500639_000072 | 3300053163 | Bacteria | 46512 |
| 936 | Ga0500639_104704 | 3300053163 | Bacteria | 1386 |
| 937 | Ga0500636_0039800 | 3300053177 | Bacteria | 2781 |
| 938 | Ga0500637_0000065 | 3300053178 | Bacteria | 37771 |
| 939 | Ga0500637_0002631 | 3300053178 | Bacteria | 8033 |
| 940 | Ga0500637_0059800 | 3300053178 | Bacteria | 2182 |
| 941 | Ga0500637_0199894 | 3300053178 | Bacteria | 1139 |
| 942 | Ga0500570_033718 | 3300053724 | Bacteria | 2745 |
| 943 | Ga0500609_025955 | 3300053731 | Bacteria | 803 |
| 944 | Ga0500596_036886 | 3300053735 | Bacteria | 771 |
| 945 | Ga0501084_0003235 | 3300054114 | Bacteria | 13188 |
| 946 | Ga0501084_0661451 | 3300054114 | Bacteria | 882 |
| 947 | Ga0500661_001927 | 3300055283 | Bacteria | 3916 |
| 948 | Ga0501082_0005376 | 3300060353 | Bacteria | 11113 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035113 | Ga0373936_0113510 | Ga0373936_0113510_382_936 | 176 |
| 2 | 3300035118 | Ga0373954_0013871 | Ga0373954_0013871_1251_1805 | 176 |
| 3 | 3300035692 | Ga0373935_0144774 | Ga0373935_0144774_659_1213 | 176 |
| 4 | 3300035724 | Ga0373933_0625609 | Ga0373933_0625609_90_644 | 176 |
| 5 | 3300035725 | Ga0373947_0100020 | Ga0373947_0100020_354_908 | 176 |
| 6 | 3300036401 | Ga0373937_0629745 | Ga0373937_0629745_265_819 | 176 |
| 7 | 3300037068 | Ga0373925_0031318 | Ga0373925_0031318_3235_3789 | 176 |
| 8 | 3300046473 | Ga0495582_0282995 | Ga0495582_0282995_227_781 | 176 |
| 9 | 3300046511 | Ga0495608_0183608 | Ga0495608_0183608_434_988 | 176 |
| 10 | 3300046517 | Ga0495630_0430695 | Ga0495630_0430695_375_929 | 176 |
| 11 | 3300046529 | Ga0495652_0314817 | Ga0495652_0314817_200_754 | 176 |
| 12 | 3300046642 | Ga0495634_0164285 | Ga0495634_0164285_286_840 | 176 |
| 13 | 3300046683 | Ga0495658_0348775 | Ga0495658_0348775_42_596 | 176 |
| 14 | 3300047317 | Ga0495604_0430065 | Ga0495604_0430065_189_743 | 176 |
| 15 | 3300047673 | Ga0495593_0283985 | Ga0495593_0283985_119_673 | 176 |
| 16 | 3300048088 | Ga0495602_0197811 | Ga0495602_0197811_621_1175 | 176 |
| 17 | 3300050513 | nmdc:mga0rr50_287390_c1 | nmdc:mga0rr50_287390_c1_305_862 | 176 |
| 18 | 3300053085 | Ga0495619_0620895 | Ga0495619_0620895_88_642 | 176 |
| 19 | iso_pu_bacteria | 2508501128 | 2509146428 | 176 |
| 20 | iso_pu_bacteria | 2513237096 | 2513656190 | 176 |
| 21 | iso_pu_bacteria | 2513237101 | 2513694665 | 176 |
| 22 | iso_pu_bacteria | 2513237137 | 2513860707 | 176 |
| 23 | iso_pu_bacteria | 2513237145 | 2513917630 | 176 |
| 24 | iso_pu_bacteria | 2517572143 | 2517887710 | 176 |
| 25 | iso_pu_bacteria | 2524023228 | 2524535376 | 176 |
| 26 | iso_pu_bacteria | 2667528175 | 2671120778 | 176 |
| 27 | iso_pu_bacteria | 2721755755 | 2723842483 | 176 |
| 28 | iso_pu_bacteria | 2728368998 | 2728748279 | 176 |
| 29 | iso_pu_bacteria | 2791355197 | 2793072902 | 176 |
| 30 | iso_pu_bacteria | 2791355199 | 2793078665 | 176 |
| 31 | iso_pu_bacteria | 2874604998 | 2874606830 | 176 |
| 32 | iso_pu_bacteria | 2876808645 | 2876818017 | 176 |
| 33 | iso_pu_bacteria | 2879110137 | 2879112257 | 176 |
| 34 | iso_pu_bacteria | 2885374607 | 2885382551 | 176 |
| 35 | iso_pu_bacteria | 2889033259 | 2889034245 | 176 |
| 36 | iso_pu_bacteria | 2903748898 | 2903753645 | 176 |
| 37 | iso_pu_bacteria | 2904699407 | 2904709570 | 176 |
| 38 | iso_pu_bacteria | 2906610324 | 2906612720 | 176 |
| 39 | iso_pu_bacteria | 2906635258 | 2906640552 | 176 |
| 40 | iso_pu_bacteria | 2906660503 | 2906663224 | 176 |
| 41 | iso_pu_bacteria | 2908739725 | 2908745916 | 176 |
| 42 | iso_pu_bacteria | 2922361189 | 2922367631 | 176 |
| 43 | iso_pu_bacteria | 2922386360 | 2922391606 | 176 |
| 44 | iso_pu_bacteria | 2922425934 | 2922433200 | 176 |
| 45 | iso_pu_bacteria | 2935630451 | 2935630603 | 176 |
| 46 | iso_pu_bacteria | 2941507105 | 2941507255 | 176 |
| 47 | iso_pu_bacteria | 2941515067 | 2941515682 | 176 |
| 48 | iso_pu_bacteria | 2941523033 | 2941523610 | 176 |
| 49 | iso_pu_bacteria | 3005474847 | 3005482797 | 176 |
| 50 | iso_pu_bacteria | 8006933436 | 8006935101 | 176 |
| 51 | iso_pu_bacteria | 8006964411 | 8006965372 | 176 |
| 52 | iso_pu_bacteria | 8006973647 | 8006975069 | 176 |
| 53 | iso_pu_bacteria | 8006984368 | 8006986084 | 176 |
| 54 | iso_pu_bacteria | 8019555841 | 8019563603 | 176 |
| 55 | iso_pu_bacteria | 8019565922 | 8019573672 | 176 |
| 56 | iso_pu_bacteria | 8056673599 | 8056678963 | 176 |
| 57 | 3300005434 | Ga0070709_10001461 | Ga0070709_1000146111 | 177 |
| 58 | 3300005435 | Ga0070714_100003988 | Ga0070714_1000039889 | 177 |
| 59 | 3300005436 | Ga0070713_100193726 | Ga0070713_1001937262 | 177 |
| 60 | 3300005437 | Ga0070710_10001981 | Ga0070710_1000198113 | 177 |
| 61 | 3300006175 | Ga0070712_100423449 | Ga0070712_1004234491 | 177 |
| 62 | 3300021358 | Ga0213873_10009335 | Ga0213873_100093351 | 177 |
| 63 | 3300021384 | Ga0213876_10002064 | Ga0213876_100020645 | 177 |
| 64 | 3300025898 | Ga0207692_10002972 | Ga0207692_100029726 | 177 |
| 65 | 3300025915 | Ga0207693_10009468 | Ga0207693_100094685 | 177 |
| 66 | 3300025928 | Ga0207700_10165094 | Ga0207700_101650942 | 177 |
| 67 | 3300025929 | Ga0207664_10010392 | Ga0207664_100103925 | 177 |
| 68 | 3300039437 | Ga0436365_1342005 | Ga0436365_1342005_5047_5589 | 177 |
| 69 | 3300039453 | Ga0436362_0009437 | Ga0436362_0009437_1265_1807 | 177 |
| 70 | 3300048924 | Ga0496121_0448430 | Ga0496121_0448430_18_560 | 177 |
| 71 | 3300048915 | Ga0496112_0000096 | Ga0496112_0000096_12670_13209 | 178 |
| 72 | iso_pu_bacteria | 2513237098 | 2513679750 | 178 |
| 73 | 3300003203 | JGI25406J46586_10014265 | JGI25406J46586_100142654 | 179 |
| 74 | 3300003214 | JGI25165J46597_1008272 | JGI25165J46597_10082722 | 179 |
| 75 | 3300003214 | JGI25165J46597_1008905 | JGI25165J46597_10089052 | 179 |
| 76 | 3300003215 | JGI25153J46596_10001699 | JGI25153J46596_1000169912 | 179 |
| 77 | 3300003659 | JGI25404J52841_10003242 | JGI25404J52841_100032423 | 179 |
| 78 | 3300003659 | JGI25404J52841_10007484 | JGI25404J52841_100074841 | 179 |
| 79 | 3300003659 | JGI25404J52841_10014463 | JGI25404J52841_100144632 | 179 |
| 80 | 3300003659 | JGI25404J52841_10049818 | JGI25404J52841_100498181 | 179 |
| 81 | 3300005327 | Ga0070658_11094795 | Ga0070658_110947951 | 179 |
| 82 | 3300005329 | Ga0070683_100008883 | Ga0070683_10000888311 | 179 |
| 83 | 3300005329 | Ga0070683_100054636 | Ga0070683_1000546363 | 179 |
| 84 | 3300005329 | Ga0070683_100067497 | Ga0070683_1000674973 | 179 |
| 85 | 3300005333 | Ga0070677_10193451 | Ga0070677_101934512 | 179 |
| 86 | 3300005334 | Ga0068869_100084996 | Ga0068869_1000849961 | 179 |
| 87 | 3300005336 | Ga0070680_100003569 | Ga0070680_1000035698 | 179 |
| 88 | 3300005336 | Ga0070680_100162622 | Ga0070680_1001626222 | 179 |
| 89 | 3300005336 | Ga0070680_100239691 | Ga0070680_1002396912 | 179 |
| 90 | 3300005337 | Ga0070682_100289771 | Ga0070682_1002897712 | 179 |
| 91 | 3300005337 | Ga0070682_100290793 | Ga0070682_1002907932 | 179 |
| 92 | 3300005339 | Ga0070660_100028691 | Ga0070660_1000286911 | 179 |
| 93 | 3300005339 | Ga0070660_100068615 | Ga0070660_1000686153 | 179 |
| 94 | 3300005339 | Ga0070660_100233401 | Ga0070660_1002334011 | 179 |
| 95 | 3300005339 | Ga0070660_100484862 | Ga0070660_1004848621 | 179 |
| 96 | 3300005340 | Ga0070689_100440846 | Ga0070689_1004408462 | 179 |
| 97 | 3300005341 | Ga0070691_10122660 | Ga0070691_101226602 | 179 |
| 98 | 3300005344 | Ga0070661_100292591 | Ga0070661_1002925912 | 179 |
| 99 | 3300005344 | Ga0070661_100391975 | Ga0070661_1003919751 | 179 |
| 100 | 3300005344 | Ga0070661_100418671 | Ga0070661_1004186712 | 179 |
| 101 | 3300005344 | Ga0070661_100954356 | Ga0070661_1009543561 | 179 |
| 102 | 3300005345 | Ga0070692_10298644 | Ga0070692_102986441 | 179 |
| 103 | 3300005347 | Ga0070668_100047596 | Ga0070668_1000475963 | 179 |
| 104 | 3300005354 | Ga0070675_100585633 | Ga0070675_1005856331 | 179 |
| 105 | 3300005355 | Ga0070671_100053820 | Ga0070671_1000538203 | 179 |
| 106 | 3300005355 | Ga0070671_100423394 | Ga0070671_1004233941 | 179 |
| 107 | 3300005356 | Ga0070674_100100148 | Ga0070674_1001001482 | 179 |
| 108 | 3300005356 | Ga0070674_100192112 | Ga0070674_1001921122 | 179 |
| 109 | 3300005356 | Ga0070674_100224862 | Ga0070674_1002248621 | 179 |
| 110 | 3300005364 | Ga0070673_100160820 | Ga0070673_1001608201 | 179 |
| 111 | 3300005364 | Ga0070673_100226975 | Ga0070673_1002269752 | 179 |
| 112 | 3300005365 | Ga0070688_100630186 | Ga0070688_1006301862 | 179 |
| 113 | 3300005365 | Ga0070688_100638242 | Ga0070688_1006382422 | 179 |
| 114 | 3300005406 | Ga0070703_10299701 | Ga0070703_102997011 | 179 |
| 115 | 3300005434 | Ga0070709_10113928 | Ga0070709_101139282 | 179 |
| 116 | 3300005435 | Ga0070714_100614141 | Ga0070714_1006141411 | 179 |
| 117 | 3300005435 | Ga0070714_100620482 | Ga0070714_1006204821 | 179 |
| 118 | 3300005435 | Ga0070714_101262634 | Ga0070714_1012626341 | 179 |
| 119 | 3300005436 | Ga0070713_100009716 | Ga0070713_1000097162 | 179 |
| 120 | 3300005436 | Ga0070713_100045353 | Ga0070713_1000453532 | 179 |
| 121 | 3300005436 | Ga0070713_100130018 | Ga0070713_1001300183 | 179 |
| 122 | 3300005436 | Ga0070713_100700968 | Ga0070713_1007009681 | 179 |
| 123 | 3300005437 | Ga0070710_10003702 | Ga0070710_100037027 | 179 |
| 124 | 3300005437 | Ga0070710_10013111 | Ga0070710_100131112 | 179 |
| 125 | 3300005437 | Ga0070710_10362886 | Ga0070710_103628861 | 179 |
| 126 | 3300005438 | Ga0070701_10162548 | Ga0070701_101625481 | 179 |
| 127 | 3300005439 | Ga0070711_100010613 | Ga0070711_1000106132 | 179 |
| 128 | 3300005439 | Ga0070711_100054947 | Ga0070711_1000549473 | 179 |
| 129 | 3300005439 | Ga0070711_100071985 | Ga0070711_1000719852 | 179 |
| 130 | 3300005445 | Ga0070708_100183380 | Ga0070708_1001833802 | 179 |
| 131 | 3300005455 | Ga0070663_100016725 | Ga0070663_1000167252 | 179 |
| 132 | 3300005455 | Ga0070663_100059739 | Ga0070663_1000597393 | 179 |
| 133 | 3300005455 | Ga0070663_100124898 | Ga0070663_1001248982 | 179 |
| 134 | 3300005455 | Ga0070663_100188644 | Ga0070663_1001886441 | 179 |
| 135 | 3300005456 | Ga0070678_100046387 | Ga0070678_1000463873 | 179 |
| 136 | 3300005456 | Ga0070678_100090590 | Ga0070678_1000905902 | 179 |
| 137 | 3300005456 | Ga0070678_100506523 | Ga0070678_1005065231 | 179 |
| 138 | 3300005457 | Ga0070662_100076746 | Ga0070662_1000767463 | 179 |
| 139 | 3300005457 | Ga0070662_100968567 | Ga0070662_1009685671 | 179 |
| 140 | 3300005458 | Ga0070681_10015034 | Ga0070681_100150346 | 179 |
| 141 | 3300005458 | Ga0070681_10265153 | Ga0070681_102651531 | 179 |
| 142 | 3300005458 | Ga0070681_10304690 | Ga0070681_103046901 | 179 |
| 143 | 3300005458 | Ga0070681_10683269 | Ga0070681_106832691 | 179 |
| 144 | 3300005458 | Ga0070681_10800358 | Ga0070681_108003581 | 179 |
| 145 | 3300005459 | Ga0068867_100298380 | Ga0068867_1002983802 | 179 |
| 146 | 3300005459 | Ga0068867_100655299 | Ga0068867_1006552991 | 179 |
| 147 | 3300005467 | Ga0070706_100406781 | Ga0070706_1004067811 | 179 |
| 148 | 3300005468 | Ga0070707_100939000 | Ga0070707_1009390001 | 179 |
| 149 | 3300005471 | Ga0070698_100133500 | Ga0070698_1001335002 | 179 |
| 150 | 3300005471 | Ga0070698_100377666 | Ga0070698_1003776662 | 179 |
| 151 | 3300005471 | Ga0070698_101071959 | Ga0070698_1010719591 | 179 |
| 152 | 3300005518 | Ga0070699_101123042 | Ga0070699_1011230421 | 179 |
| 153 | 3300005530 | Ga0070679_100074282 | Ga0070679_1000742822 | 179 |
| 154 | 3300005530 | Ga0070679_100094119 | Ga0070679_1000941191 | 179 |
| 155 | 3300005530 | Ga0070679_100132475 | Ga0070679_1001324752 | 179 |
| 156 | 3300005530 | Ga0070679_100340493 | Ga0070679_1003404931 | 179 |
| 157 | 3300005530 | Ga0070679_100416144 | Ga0070679_1004161442 | 179 |
| 158 | 3300005530 | Ga0070679_100963696 | Ga0070679_1009636961 | 179 |
| 159 | 3300005530 | Ga0070679_101120527 | Ga0070679_1011205271 | 179 |
| 160 | 3300005535 | Ga0070684_100016526 | Ga0070684_1000165267 | 179 |
| 161 | 3300005535 | Ga0070684_100048824 | Ga0070684_1000488243 | 179 |
| 162 | 3300005535 | Ga0070684_100376489 | Ga0070684_1003764892 | 179 |
| 163 | 3300005535 | Ga0070684_100481690 | Ga0070684_1004816902 | 179 |
| 164 | 3300005535 | Ga0070684_101056561 | Ga0070684_1010565611 | 179 |
| 165 | 3300005536 | Ga0070697_100071083 | Ga0070697_1000710832 | 179 |
| 166 | 3300005536 | Ga0070697_100103553 | Ga0070697_1001035531 | 179 |
| 167 | 3300005536 | Ga0070697_100986080 | Ga0070697_1009860801 | 179 |
| 168 | 3300005539 | Ga0068853_100214433 | Ga0068853_1002144332 | 179 |
| 169 | 3300005539 | Ga0068853_100256064 | Ga0068853_1002560641 | 179 |
| 170 | 3300005539 | Ga0068853_100416327 | Ga0068853_1004163273 | 179 |
| 171 | 3300005539 | Ga0068853_100594557 | Ga0068853_1005945571 | 179 |
| 172 | 3300005539 | Ga0068853_100654930 | Ga0068853_1006549301 | 179 |
| 173 | 3300005539 | Ga0068853_101777931 | Ga0068853_1017779311 | 179 |
| 174 | 3300005543 | Ga0070672_100297365 | Ga0070672_1002973652 | 179 |
| 175 | 3300005543 | Ga0070672_100600368 | Ga0070672_1006003682 | 179 |
| 176 | 3300005544 | Ga0070686_100145822 | Ga0070686_1001458222 | 179 |
| 177 | 3300005544 | Ga0070686_100788786 | Ga0070686_1007887861 | 179 |
| 178 | 3300005547 | Ga0070693_100121665 | Ga0070693_1001216652 | 179 |
| 179 | 3300005548 | Ga0070665_100009458 | Ga0070665_1000094582 | 179 |
| 180 | 3300005548 | Ga0070665_100020723 | Ga0070665_1000207233 | 179 |
| 181 | 3300005548 | Ga0070665_100046666 | Ga0070665_1000466664 | 179 |
| 182 | 3300005548 | Ga0070665_100133651 | Ga0070665_1001336512 | 179 |
| 183 | 3300005548 | Ga0070665_100156385 | Ga0070665_1001563852 | 179 |
| 184 | 3300005548 | Ga0070665_100241352 | Ga0070665_1002413522 | 179 |
| 185 | 3300005548 | Ga0070665_100620169 | Ga0070665_1006201691 | 179 |
| 186 | 3300005549 | Ga0070704_101023742 | Ga0070704_1010237421 | 179 |
| 187 | 3300005563 | Ga0068855_100029909 | Ga0068855_1000299096 | 179 |
| 188 | 3300005563 | Ga0068855_100065359 | Ga0068855_1000653593 | 179 |
| 189 | 3300005563 | Ga0068855_100130860 | Ga0068855_1001308602 | 179 |
| 190 | 3300005563 | Ga0068855_100136170 | Ga0068855_1001361701 | 179 |
| 191 | 3300005563 | Ga0068855_100504877 | Ga0068855_1005048772 | 179 |
| 192 | 3300005563 | Ga0068855_100633138 | Ga0068855_1006331381 | 179 |
| 193 | 3300005564 | Ga0070664_100231912 | Ga0070664_1002319122 | 179 |
| 194 | 3300005577 | Ga0068857_100005639 | Ga0068857_1000056399 | 179 |
| 195 | 3300005577 | Ga0068857_100641834 | Ga0068857_1006418342 | 179 |
| 196 | 3300005578 | Ga0068854_100005923 | Ga0068854_1000059238 | 179 |
| 197 | 3300005578 | Ga0068854_101185061 | Ga0068854_1011850611 | 179 |
| 198 | 3300005614 | Ga0068856_100000476 | Ga0068856_10000047641 | 179 |
| 199 | 3300005614 | Ga0068856_100416911 | Ga0068856_1004169112 | 179 |
| 200 | 3300005614 | Ga0068856_100427182 | Ga0068856_1004271822 | 179 |
| 201 | 3300005616 | Ga0068852_100276425 | Ga0068852_1002764252 | 179 |
| 202 | 3300005618 | Ga0068864_100305057 | Ga0068864_1003050572 | 179 |
| 203 | 3300005618 | Ga0068864_100536784 | Ga0068864_1005367842 | 179 |
| 204 | 3300005718 | Ga0068866_11015432 | Ga0068866_110154321 | 179 |
| 205 | 3300005719 | Ga0068861_100063011 | Ga0068861_1000630112 | 179 |
| 206 | 3300005719 | Ga0068861_100434442 | Ga0068861_1004344422 | 179 |
| 207 | 3300005840 | Ga0068870_10081819 | Ga0068870_100818192 | 179 |
| 208 | 3300005840 | Ga0068870_10086555 | Ga0068870_100865552 | 179 |
| 209 | 3300005842 | Ga0068858_100179452 | Ga0068858_1001794523 | 179 |
| 210 | 3300005842 | Ga0068858_100201984 | Ga0068858_1002019842 | 179 |
| 211 | 3300005842 | Ga0068858_100219487 | Ga0068858_1002194872 | 179 |
| 212 | 3300005842 | Ga0068858_100857524 | Ga0068858_1008575242 | 179 |
| 213 | 3300005937 | Ga0081455_10008457 | Ga0081455_1000845710 | 179 |
| 214 | 3300005937 | Ga0081455_10011371 | Ga0081455_100113717 | 179 |
| 215 | 3300005937 | Ga0081455_10071946 | Ga0081455_100719463 | 179 |
| 216 | 3300005937 | Ga0081455_10116310 | Ga0081455_101163102 | 179 |
| 217 | 3300005983 | Ga0081540_1005329 | Ga0081540_10053296 | 179 |
| 218 | 3300005983 | Ga0081540_1007078 | Ga0081540_10070786 | 179 |
| 219 | 3300005983 | Ga0081540_1007475 | Ga0081540_10074755 | 179 |
| 220 | 3300005983 | Ga0081540_1010016 | Ga0081540_10100168 | 179 |
| 221 | 3300005983 | Ga0081540_1016353 | Ga0081540_10163533 | 179 |
| 222 | 3300005983 | Ga0081540_1018434 | Ga0081540_10184341 | 179 |
| 223 | 3300005983 | Ga0081540_1027051 | Ga0081540_10270514 | 179 |
| 224 | 3300005983 | Ga0081540_1048885 | Ga0081540_10488853 | 179 |
| 225 | 3300005983 | Ga0081540_1053004 | Ga0081540_10530042 | 179 |
| 226 | 3300005983 | Ga0081540_1053054 | Ga0081540_10530543 | 179 |
| 227 | 3300005983 | Ga0081540_1069721 | Ga0081540_10697212 | 179 |
| 228 | 3300005985 | Ga0081539_10000425 | Ga0081539_100004252 | 179 |
| 229 | 3300005985 | Ga0081539_10037181 | Ga0081539_100371812 | 179 |
| 230 | 3300006028 | Ga0070717_10001915 | Ga0070717_100019156 | 179 |
| 231 | 3300006038 | Ga0075365_10037480 | Ga0075365_100374803 | 179 |
| 232 | 3300006038 | Ga0075365_10058983 | Ga0075365_100589833 | 179 |
| 233 | 3300006038 | Ga0075365_10096611 | Ga0075365_100966111 | 179 |
| 234 | 3300006038 | Ga0075365_10367306 | Ga0075365_103673062 | 179 |
| 235 | 3300006038 | Ga0075365_10399644 | Ga0075365_103996441 | 179 |
| 236 | 3300006042 | Ga0075368_10034050 | Ga0075368_100340502 | 179 |
| 237 | 3300006042 | Ga0075368_10097895 | Ga0075368_100978952 | 179 |
| 238 | 3300006048 | Ga0075363_100000795 | Ga0075363_1000007954 | 179 |
| 239 | 3300006048 | Ga0075363_100029297 | Ga0075363_1000292973 | 179 |
| 240 | 3300006048 | Ga0075363_100072106 | Ga0075363_1000721062 | 179 |
| 241 | 3300006051 | Ga0075364_10378811 | Ga0075364_103788111 | 179 |
| 242 | 3300006163 | Ga0070715_10002928 | Ga0070715_100029284 | 179 |
| 243 | 3300006173 | Ga0070716_100017312 | Ga0070716_1000173122 | 179 |
| 244 | 3300006173 | Ga0070716_100286211 | Ga0070716_1002862112 | 179 |
| 245 | 3300006173 | Ga0070716_100525524 | Ga0070716_1005255241 | 179 |
| 246 | 3300006173 | Ga0070716_100820800 | Ga0070716_1008208001 | 179 |
| 247 | 3300006175 | Ga0070712_100254170 | Ga0070712_1002541702 | 179 |
| 248 | 3300006175 | Ga0070712_100347031 | Ga0070712_1003470311 | 179 |
| 249 | 3300006175 | Ga0070712_100388111 | Ga0070712_1003881112 | 179 |
| 250 | 3300006175 | Ga0070712_100980028 | Ga0070712_1009800281 | 179 |
| 251 | 3300006177 | Ga0075362_10102482 | Ga0075362_101024822 | 179 |
| 252 | 3300006178 | Ga0075367_10009759 | Ga0075367_100097595 | 179 |
| 253 | 3300006178 | Ga0075367_10026192 | Ga0075367_100261924 | 179 |
| 254 | 3300006178 | Ga0075367_10485489 | Ga0075367_104854892 | 179 |
| 255 | 3300006186 | Ga0075369_10023467 | Ga0075369_100234673 | 179 |
| 256 | 3300006186 | Ga0075369_10467989 | Ga0075369_104679891 | 179 |
| 257 | 3300006195 | Ga0075366_10186109 | Ga0075366_101861092 | 179 |
| 258 | 3300006353 | Ga0075370_10096836 | Ga0075370_100968362 | 179 |
| 259 | 3300006353 | Ga0075370_10714073 | Ga0075370_107140731 | 179 |
| 260 | 3300006358 | Ga0068871_100158458 | Ga0068871_1001584582 | 179 |
| 261 | 3300006844 | Ga0075428_100128792 | Ga0075428_1001287923 | 179 |
| 262 | 3300006852 | Ga0075433_10781196 | Ga0075433_107811962 | 179 |
| 263 | 3300006881 | Ga0068865_100100401 | Ga0068865_1001004013 | 179 |
| 264 | 3300006881 | Ga0068865_100220495 | Ga0068865_1002204951 | 179 |
| 265 | 3300006881 | Ga0068865_100245917 | Ga0068865_1002459172 | 179 |
| 266 | 3300006941 | Ga0099825_1022556 | Ga0099825_10225565 | 179 |
| 267 | 3300006943 | Ga0099822_1024573 | Ga0099822_10245735 | 179 |
| 268 | 3300007265 | Ga0099794_10013122 | Ga0099794_100131223 | 179 |
| 269 | 3300007788 | Ga0099795_10144911 | Ga0099795_101449111 | 179 |
| 270 | 3300009011 | Ga0105251_10300235 | Ga0105251_103002351 | 179 |
| 271 | 3300009093 | Ga0105240_10031535 | Ga0105240_100315353 | 179 |
| 272 | 3300009093 | Ga0105240_10031799 | Ga0105240_100317992 | 179 |
| 273 | 3300009093 | Ga0105240_10581974 | Ga0105240_105819741 | 179 |
| 274 | 3300009098 | Ga0105245_10680866 | Ga0105245_106808661 | 179 |
| 275 | 3300009098 | Ga0105245_10755680 | Ga0105245_107556801 | 179 |
| 276 | 3300009098 | Ga0105245_10857082 | Ga0105245_108570822 | 179 |
| 277 | 3300009101 | Ga0105247_10277217 | Ga0105247_102772172 | 179 |
| 278 | 3300009147 | Ga0114129_10043623 | Ga0114129_100436234 | 179 |
| 279 | 3300009174 | Ga0105241_10112909 | Ga0105241_101129093 | 179 |
| 280 | 3300009174 | Ga0105241_10578625 | Ga0105241_105786251 | 179 |
| 281 | 3300009176 | Ga0105242_10139169 | Ga0105242_101391691 | 179 |
| 282 | 3300009177 | Ga0105248_10329581 | Ga0105248_103295812 | 179 |
| 283 | 3300009545 | Ga0105237_10641939 | Ga0105237_106419392 | 179 |
| 284 | 3300009551 | Ga0105238_10007773 | Ga0105238_1000777310 | 179 |
| 285 | 3300009551 | Ga0105238_10042015 | Ga0105238_100420154 | 179 |
| 286 | 3300009551 | Ga0105238_10334610 | Ga0105238_103346103 | 179 |
| 287 | 3300009551 | Ga0105238_10757486 | Ga0105238_107574862 | 179 |
| 288 | 3300009553 | Ga0105249_10156611 | Ga0105249_101566112 | 179 |
| 289 | 3300009553 | Ga0105249_11010209 | Ga0105249_110102091 | 179 |
| 290 | 3300010375 | Ga0105239_10013308 | Ga0105239_1001330810 | 179 |
| 291 | 3300010375 | Ga0105239_10429826 | Ga0105239_104298262 | 179 |
| 292 | 3300010375 | Ga0105239_10971086 | Ga0105239_109710861 | 179 |
| 293 | 3300011119 | Ga0105246_10316965 | Ga0105246_103169652 | 179 |
| 294 | 3300013100 | Ga0157373_10614708 | Ga0157373_106147081 | 179 |
| 295 | 3300013104 | Ga0157370_10061297 | Ga0157370_100612974 | 179 |
| 296 | 3300013104 | Ga0157370_10079869 | Ga0157370_100798693 | 179 |
| 297 | 3300013104 | Ga0157370_10148369 | Ga0157370_101483693 | 179 |
| 298 | 3300013105 | Ga0157369_10012327 | Ga0157369_1001232712 | 179 |
| 299 | 3300013105 | Ga0157369_10013199 | Ga0157369_1001319910 | 179 |
| 300 | 3300013105 | Ga0157369_10113235 | Ga0157369_101132354 | 179 |
| 301 | 3300013105 | Ga0157369_10330348 | Ga0157369_103303481 | 179 |
| 302 | 3300013105 | Ga0157369_11026646 | Ga0157369_110266461 | 179 |
| 303 | 3300013105 | Ga0157369_11154996 | Ga0157369_111549961 | 179 |
| 304 | 3300013296 | Ga0157374_10513632 | Ga0157374_105136322 | 179 |
| 305 | 3300013296 | Ga0157374_10747123 | Ga0157374_107471232 | 179 |
| 306 | 3300013296 | Ga0157374_10774577 | Ga0157374_107745772 | 179 |
| 307 | 3300013297 | Ga0157378_11219616 | Ga0157378_112196161 | 179 |
| 308 | 3300013306 | Ga0163162_10230968 | Ga0163162_102309682 | 179 |
| 309 | 3300013306 | Ga0163162_11868690 | Ga0163162_118686901 | 179 |
| 310 | 3300013307 | Ga0157372_10452965 | Ga0157372_104529652 | 179 |
| 311 | 3300013307 | Ga0157372_10472819 | Ga0157372_104728192 | 179 |
| 312 | 3300013307 | Ga0157372_10556992 | Ga0157372_105569922 | 179 |
| 313 | 3300013308 | Ga0157375_11563882 | Ga0157375_115638821 | 179 |
| 314 | 3300014325 | Ga0163163_10051682 | Ga0163163_100516821 | 179 |
| 315 | 3300014325 | Ga0163163_10066420 | Ga0163163_100664202 | 179 |
| 316 | 3300014325 | Ga0163163_11457722 | Ga0163163_114577221 | 179 |
| 317 | 3300014326 | Ga0157380_10227116 | Ga0157380_102271162 | 179 |
| 318 | 3300014969 | Ga0157376_10443554 | Ga0157376_104435542 | 179 |
| 319 | 3300014969 | Ga0157376_11040123 | Ga0157376_110401231 | 179 |
| 320 | 3300017792 | Ga0163161_10142698 | Ga0163161_101426983 | 179 |
| 321 | 3300020069 | Ga0197907_10482238 | Ga0197907_104822382 | 179 |
| 322 | 3300020069 | Ga0197907_11225397 | Ga0197907_112253971 | 179 |
| 323 | 3300020070 | Ga0206356_11267106 | Ga0206356_112671061 | 179 |
| 324 | 3300020076 | Ga0206355_1215798 | Ga0206355_12157981 | 179 |
| 325 | 3300020078 | Ga0206352_10436581 | Ga0206352_104365812 | 179 |
| 326 | 3300020078 | Ga0206352_11357989 | Ga0206352_113579891 | 179 |
| 327 | 3300020080 | Ga0206350_10949899 | Ga0206350_109498991 | 179 |
| 328 | 3300020081 | Ga0206354_10068295 | Ga0206354_100682951 | 179 |
| 329 | 3300020082 | Ga0206353_11967255 | Ga0206353_119672552 | 179 |
| 330 | 3300021358 | Ga0213873_10004591 | Ga0213873_100045912 | 179 |
| 331 | 3300021384 | Ga0213876_10031000 | Ga0213876_100310004 | 179 |
| 332 | 3300021388 | Ga0213875_10090152 | Ga0213875_100901521 | 179 |
| 333 | 3300021441 | Ga0213871_10000490 | Ga0213871_100004904 | 179 |
| 334 | 3300022467 | Ga0224712_10242241 | Ga0224712_102422411 | 179 |
| 335 | 3300025261 | Ga0209233_1002779 | Ga0209233_10027792 | 179 |
| 336 | 3300025272 | Ga0209455_1011932 | Ga0209455_10119323 | 179 |
| 337 | 3300025297 | Ga0209758_1010528 | Ga0209758_10105285 | 179 |
| 338 | 3300025297 | Ga0209758_1025853 | Ga0209758_10258533 | 179 |
| 339 | 3300025885 | Ga0207653_10043757 | Ga0207653_100437571 | 179 |
| 340 | 3300025898 | Ga0207692_10008204 | Ga0207692_100082044 | 179 |
| 341 | 3300025898 | Ga0207692_10030002 | Ga0207692_100300022 | 179 |
| 342 | 3300025899 | Ga0207642_10311043 | Ga0207642_103110432 | 179 |
| 343 | 3300025901 | Ga0207688_10470209 | Ga0207688_104702091 | 179 |
| 344 | 3300025903 | Ga0207680_10274615 | Ga0207680_102746152 | 179 |
| 345 | 3300025904 | Ga0207647_10076385 | Ga0207647_100763852 | 179 |
| 346 | 3300025904 | Ga0207647_10348943 | Ga0207647_103489431 | 179 |
| 347 | 3300025905 | Ga0207685_10110293 | Ga0207685_101102932 | 179 |
| 348 | 3300025905 | Ga0207685_10451964 | Ga0207685_104519641 | 179 |
| 349 | 3300025906 | Ga0207699_10005733 | Ga0207699_100057336 | 179 |
| 350 | 3300025906 | Ga0207699_10094679 | Ga0207699_100946791 | 179 |
| 351 | 3300025906 | Ga0207699_10527185 | Ga0207699_105271851 | 179 |
| 352 | 3300025906 | Ga0207699_10794527 | Ga0207699_107945271 | 179 |
| 353 | 3300025907 | Ga0207645_10111875 | Ga0207645_101118751 | 179 |
| 354 | 3300025907 | Ga0207645_10336235 | Ga0207645_103362351 | 179 |
| 355 | 3300025909 | Ga0207705_10134297 | Ga0207705_101342972 | 179 |
| 356 | 3300025909 | Ga0207705_11212792 | Ga0207705_112127921 | 179 |
| 357 | 3300025911 | Ga0207654_10024224 | Ga0207654_100242244 | 179 |
| 358 | 3300025912 | Ga0207707_10002162 | Ga0207707_1000216214 | 179 |
| 359 | 3300025912 | Ga0207707_10005294 | Ga0207707_100052946 | 179 |
| 360 | 3300025912 | Ga0207707_10404715 | Ga0207707_104047152 | 179 |
| 361 | 3300025912 | Ga0207707_10437690 | Ga0207707_104376901 | 179 |
| 362 | 3300025912 | Ga0207707_10661325 | Ga0207707_106613251 | 179 |
| 363 | 3300025913 | Ga0207695_10027026 | Ga0207695_100270262 | 179 |
| 364 | 3300025913 | Ga0207695_10054704 | Ga0207695_100547041 | 179 |
| 365 | 3300025913 | Ga0207695_10085563 | Ga0207695_100855634 | 179 |
| 366 | 3300025913 | Ga0207695_10240938 | Ga0207695_102409382 | 179 |
| 367 | 3300025914 | Ga0207671_10012964 | Ga0207671_100129648 | 179 |
| 368 | 3300025914 | Ga0207671_10703067 | Ga0207671_107030671 | 179 |
| 369 | 3300025914 | Ga0207671_11076284 | Ga0207671_110762841 | 179 |
| 370 | 3300025915 | Ga0207693_10004007 | Ga0207693_100040076 | 179 |
| 371 | 3300025915 | Ga0207693_10009993 | Ga0207693_100099938 | 179 |
| 372 | 3300025915 | Ga0207693_10063412 | Ga0207693_100634123 | 179 |
| 373 | 3300025915 | Ga0207693_10242502 | Ga0207693_102425022 | 179 |
| 374 | 3300025915 | Ga0207693_10344250 | Ga0207693_103442502 | 179 |
| 375 | 3300025916 | Ga0207663_10010172 | Ga0207663_100101723 | 179 |
| 376 | 3300025916 | Ga0207663_10056128 | Ga0207663_100561282 | 179 |
| 377 | 3300025916 | Ga0207663_10156346 | Ga0207663_101563462 | 179 |
| 378 | 3300025917 | Ga0207660_10161258 | Ga0207660_101612582 | 179 |
| 379 | 3300025917 | Ga0207660_10185538 | Ga0207660_101855381 | 179 |
| 380 | 3300025917 | Ga0207660_10286300 | Ga0207660_102863002 | 179 |
| 381 | 3300025917 | Ga0207660_10502286 | Ga0207660_105022862 | 179 |
| 382 | 3300025919 | Ga0207657_10008647 | Ga0207657_100086472 | 179 |
| 383 | 3300025919 | Ga0207657_10228648 | Ga0207657_102286482 | 179 |
| 384 | 3300025919 | Ga0207657_10445895 | Ga0207657_104458951 | 179 |
| 385 | 3300025920 | Ga0207649_10176590 | Ga0207649_101765902 | 179 |
| 386 | 3300025920 | Ga0207649_10467497 | Ga0207649_104674972 | 179 |
| 387 | 3300025920 | Ga0207649_10761871 | Ga0207649_107618711 | 179 |
| 388 | 3300025921 | Ga0207652_10013564 | Ga0207652_100135648 | 179 |
| 389 | 3300025921 | Ga0207652_10039725 | Ga0207652_100397254 | 179 |
| 390 | 3300025921 | Ga0207652_10106404 | Ga0207652_101064042 | 179 |
| 391 | 3300025921 | Ga0207652_10177471 | Ga0207652_101774713 | 179 |
| 392 | 3300025921 | Ga0207652_10350452 | Ga0207652_103504522 | 179 |
| 393 | 3300025923 | Ga0207681_10273572 | Ga0207681_102735721 | 179 |
| 394 | 3300025924 | Ga0207694_10031537 | Ga0207694_100315375 | 179 |
| 395 | 3300025924 | Ga0207694_10048565 | Ga0207694_100485651 | 179 |
| 396 | 3300025924 | Ga0207694_10119947 | Ga0207694_101199473 | 179 |
| 397 | 3300025924 | Ga0207694_10234551 | Ga0207694_102345512 | 179 |
| 398 | 3300025924 | Ga0207694_10321344 | Ga0207694_103213442 | 179 |
| 399 | 3300025926 | Ga0207659_10551777 | Ga0207659_105517772 | 179 |
| 400 | 3300025926 | Ga0207659_10675924 | Ga0207659_106759241 | 179 |
| 401 | 3300025927 | Ga0207687_10013836 | Ga0207687_100138363 | 179 |
| 402 | 3300025927 | Ga0207687_10052637 | Ga0207687_100526374 | 179 |
| 403 | 3300025927 | Ga0207687_10286140 | Ga0207687_102861402 | 179 |
| 404 | 3300025928 | Ga0207700_10008050 | Ga0207700_100080506 | 179 |
| 405 | 3300025928 | Ga0207700_10078205 | Ga0207700_100782053 | 179 |
| 406 | 3300025928 | Ga0207700_10392223 | Ga0207700_103922232 | 179 |
| 407 | 3300025928 | Ga0207700_10419375 | Ga0207700_104193753 | 179 |
| 408 | 3300025928 | Ga0207700_11304046 | Ga0207700_113040461 | 179 |
| 409 | 3300025929 | Ga0207664_11375967 | Ga0207664_113759671 | 179 |
| 410 | 3300025932 | Ga0207690_10378503 | Ga0207690_103785032 | 179 |
| 411 | 3300025933 | Ga0207706_10317750 | Ga0207706_103177501 | 179 |
| 412 | 3300025934 | Ga0207686_10124640 | Ga0207686_101246401 | 179 |
| 413 | 3300025935 | Ga0207709_10022329 | Ga0207709_100223295 | 179 |
| 414 | 3300025935 | Ga0207709_10085086 | Ga0207709_100850862 | 179 |
| 415 | 3300025935 | Ga0207709_10291770 | Ga0207709_102917701 | 179 |
| 416 | 3300025935 | Ga0207709_10338661 | Ga0207709_103386612 | 179 |
| 417 | 3300025936 | Ga0207670_10407696 | Ga0207670_104076962 | 179 |
| 418 | 3300025937 | Ga0207669_10117923 | Ga0207669_101179232 | 179 |
| 419 | 3300025937 | Ga0207669_10491398 | Ga0207669_104913982 | 179 |
| 420 | 3300025938 | Ga0207704_10123604 | Ga0207704_101236043 | 179 |
| 421 | 3300025938 | Ga0207704_10270825 | Ga0207704_102708252 | 179 |
| 422 | 3300025939 | Ga0207665_10002028 | Ga0207665_100020282 | 179 |
| 423 | 3300025939 | Ga0207665_10115974 | Ga0207665_101159742 | 179 |
| 424 | 3300025939 | Ga0207665_10205865 | Ga0207665_102058652 | 179 |
| 425 | 3300025939 | Ga0207665_10253265 | Ga0207665_102532652 | 179 |
| 426 | 3300025939 | Ga0207665_10558601 | Ga0207665_105586011 | 179 |
| 427 | 3300025939 | Ga0207665_10590132 | Ga0207665_105901321 | 179 |
| 428 | 3300025940 | Ga0207691_10482785 | Ga0207691_104827852 | 179 |
| 429 | 3300025941 | Ga0207711_10310988 | Ga0207711_103109881 | 179 |
| 430 | 3300025941 | Ga0207711_10611101 | Ga0207711_106111012 | 179 |
| 431 | 3300025942 | Ga0207689_10081964 | Ga0207689_100819643 | 179 |
| 432 | 3300025942 | Ga0207689_10593662 | Ga0207689_105936621 | 179 |
| 433 | 3300025944 | Ga0207661_10004540 | Ga0207661_100045402 | 179 |
| 434 | 3300025944 | Ga0207661_10006444 | Ga0207661_100064443 | 179 |
| 435 | 3300025944 | Ga0207661_10501990 | Ga0207661_105019902 | 179 |
| 436 | 3300025944 | Ga0207661_10752271 | Ga0207661_107522712 | 179 |
| 437 | 3300025949 | Ga0207667_10013617 | Ga0207667_1001361711 | 179 |
| 438 | 3300025949 | Ga0207667_10029690 | Ga0207667_100296903 | 179 |
| 439 | 3300025949 | Ga0207667_10076087 | Ga0207667_100760872 | 179 |
| 440 | 3300025949 | Ga0207667_10496673 | Ga0207667_104966731 | 179 |
| 441 | 3300025949 | Ga0207667_10865519 | Ga0207667_108655191 | 179 |
| 442 | 3300025961 | Ga0207712_10042423 | Ga0207712_100424232 | 179 |
| 443 | 3300025961 | Ga0207712_11173602 | Ga0207712_111736021 | 179 |
| 444 | 3300025972 | Ga0207668_10062725 | Ga0207668_100627253 | 179 |
| 445 | 3300025972 | Ga0207668_10117798 | Ga0207668_101177983 | 179 |
| 446 | 3300025972 | Ga0207668_10487738 | Ga0207668_104877382 | 179 |
| 447 | 3300025981 | Ga0207640_10016570 | Ga0207640_100165702 | 179 |
| 448 | 3300025981 | Ga0207640_11113810 | Ga0207640_111138101 | 179 |
| 449 | 3300025986 | Ga0207658_10329549 | Ga0207658_103295492 | 179 |
| 450 | 3300025986 | Ga0207658_11477781 | Ga0207658_114777811 | 179 |
| 451 | 3300026023 | Ga0207677_10067541 | Ga0207677_100675412 | 179 |
| 452 | 3300026023 | Ga0207677_10378830 | Ga0207677_103788302 | 179 |
| 453 | 3300026035 | Ga0207703_10162751 | Ga0207703_101627511 | 179 |
| 454 | 3300026035 | Ga0207703_10656164 | Ga0207703_106561642 | 179 |
| 455 | 3300026035 | Ga0207703_10746145 | Ga0207703_107461451 | 179 |
| 456 | 3300026041 | Ga0207639_10031167 | Ga0207639_100311671 | 179 |
| 457 | 3300026041 | Ga0207639_10126624 | Ga0207639_101266241 | 179 |
| 458 | 3300026041 | Ga0207639_10271183 | Ga0207639_102711832 | 179 |
| 459 | 3300026041 | Ga0207639_10333333 | Ga0207639_103333333 | 179 |
| 460 | 3300026041 | Ga0207639_10391767 | Ga0207639_103917671 | 179 |
| 461 | 3300026067 | Ga0207678_10010954 | Ga0207678_100109549 | 179 |
| 462 | 3300026067 | Ga0207678_10045772 | Ga0207678_100457723 | 179 |
| 463 | 3300026067 | Ga0207678_10053837 | Ga0207678_100538373 | 179 |
| 464 | 3300026067 | Ga0207678_10066420 | Ga0207678_100664203 | 179 |
| 465 | 3300026067 | Ga0207678_10693967 | Ga0207678_106939672 | 179 |
| 466 | 3300026078 | Ga0207702_10000514 | Ga0207702_1000051410 | 179 |
| 467 | 3300026078 | Ga0207702_10624719 | Ga0207702_106247191 | 179 |
| 468 | 3300026089 | Ga0207648_10049340 | Ga0207648_100493402 | 179 |
| 469 | 3300026089 | Ga0207648_10525823 | Ga0207648_105258231 | 179 |
| 470 | 3300026095 | Ga0207676_10019625 | Ga0207676_100196251 | 179 |
| 471 | 3300026095 | Ga0207676_10512021 | Ga0207676_105120212 | 179 |
| 472 | 3300026116 | Ga0207674_10048184 | Ga0207674_100481842 | 179 |
| 473 | 3300026116 | Ga0207674_10521377 | Ga0207674_105213771 | 179 |
| 474 | 3300026118 | Ga0207675_100037613 | Ga0207675_1000376135 | 179 |
| 475 | 3300026118 | Ga0207675_100070222 | Ga0207675_1000702221 | 179 |
| 476 | 3300026121 | Ga0207683_10021505 | Ga0207683_100215052 | 179 |
| 477 | 3300026121 | Ga0207683_10128052 | Ga0207683_101280523 | 179 |
| 478 | 3300026121 | Ga0207683_10700350 | Ga0207683_107003502 | 179 |
| 479 | 3300026121 | Ga0207683_11003797 | Ga0207683_110037971 | 179 |
| 480 | 3300026142 | Ga0207698_10057798 | Ga0207698_100577982 | 179 |
| 481 | 3300026142 | Ga0207698_10469412 | Ga0207698_104694121 | 179 |
| 482 | 3300026142 | Ga0207698_10703187 | Ga0207698_107031872 | 179 |
| 483 | 3300027357 | Ga0209589_1000005 | Ga0209589_100000512 | 179 |
| 484 | 3300027361 | Ga0209489_100005 | Ga0209489_10000512 | 179 |
| 485 | 3300027363 | Ga0209700_100006 | Ga0209700_10000612 | 179 |
| 486 | 3300027512 | Ga0209179_1000570 | Ga0209179_10005701 | 179 |
| 487 | 3300027671 | Ga0209588_1046767 | Ga0209588_10467672 | 179 |
| 488 | 3300028379 | Ga0268266_10005838 | Ga0268266_100058384 | 179 |
| 489 | 3300028379 | Ga0268266_10156331 | Ga0268266_101563312 | 179 |
| 490 | 3300028379 | Ga0268266_10192118 | Ga0268266_101921183 | 179 |
| 491 | 3300028379 | Ga0268266_11375680 | Ga0268266_113756801 | 179 |
| 492 | 3300028379 | Ga0268266_11655517 | Ga0268266_116555171 | 179 |
| 493 | 3300028380 | Ga0268265_10268494 | Ga0268265_102684942 | 179 |
| 494 | 3300028380 | Ga0268265_10719307 | Ga0268265_107193071 | 179 |
| 495 | 3300028573 | Ga0265334_10016514 | Ga0265334_100165142 | 179 |
| 496 | 3300028794 | Ga0307515_10054329 | Ga0307515_100543294 | 179 |
| 497 | 3300028794 | Ga0307515_10204476 | Ga0307515_102044762 | 179 |
| 498 | 3300028794 | Ga0307515_10763341 | Ga0307515_107633411 | 179 |
| 499 | 3300030522 | Ga0307512_10301481 | Ga0307512_103014811 | 179 |
| 500 | 3300031090 | Ga0265760_10084633 | Ga0265760_100846331 | 179 |
| 501 | 3300031238 | Ga0265332_10008158 | Ga0265332_100081584 | 179 |
| 502 | 3300031239 | Ga0265328_10031392 | Ga0265328_100313923 | 179 |
| 503 | 3300031247 | Ga0265340_10018482 | Ga0265340_100184824 | 179 |
| 504 | 3300031249 | Ga0265339_10040049 | Ga0265339_100400492 | 179 |
| 505 | 3300031250 | Ga0265331_10101405 | Ga0265331_101014052 | 179 |
| 506 | 3300031344 | Ga0265316_10107714 | Ga0265316_101077143 | 179 |
| 507 | 3300031344 | Ga0265316_10271313 | Ga0265316_102713132 | 179 |
| 508 | 3300031456 | Ga0307513_10105798 | Ga0307513_101057983 | 179 |
| 509 | 3300031548 | Ga0307408_100853722 | Ga0307408_1008537221 | 179 |
| 510 | 3300031616 | Ga0307508_10045726 | Ga0307508_100457262 | 179 |
| 511 | 3300031711 | Ga0265314_10015497 | Ga0265314_100154973 | 179 |
| 512 | 3300031711 | Ga0265314_10061194 | Ga0265314_100611943 | 179 |
| 513 | 3300031711 | Ga0265314_10113147 | Ga0265314_101131471 | 179 |
| 514 | 3300031711 | Ga0265314_10124452 | Ga0265314_101244522 | 179 |
| 515 | 3300031712 | Ga0265342_10010500 | Ga0265342_100105008 | 179 |
| 516 | 3300031712 | Ga0265342_10036461 | Ga0265342_100364614 | 179 |
| 517 | 3300031730 | Ga0307516_10072595 | Ga0307516_100725953 | 179 |
| 518 | 3300031730 | Ga0307516_10075437 | Ga0307516_100754374 | 179 |
| 519 | 3300031730 | Ga0307516_10427281 | Ga0307516_104272811 | 179 |
| 520 | 3300031824 | Ga0307413_10328219 | Ga0307413_103282192 | 179 |
| 521 | 3300031824 | Ga0307413_11040531 | Ga0307413_110405311 | 179 |
| 522 | 3300031852 | Ga0307410_10783535 | Ga0307410_107835351 | 179 |
| 523 | 3300031901 | Ga0307406_10443469 | Ga0307406_104434691 | 179 |
| 524 | 3300031901 | Ga0307406_10528755 | Ga0307406_105287552 | 179 |
| 525 | 3300031901 | Ga0307406_10641596 | Ga0307406_106415962 | 179 |
| 526 | 3300031911 | Ga0307412_10211313 | Ga0307412_102113132 | 179 |
| 527 | 3300031911 | Ga0307412_10508815 | Ga0307412_105088152 | 179 |
| 528 | 3300032002 | Ga0307416_100205834 | Ga0307416_1002058342 | 179 |
| 529 | 3300032005 | Ga0307411_10305237 | Ga0307411_103052371 | 179 |
| 530 | 3300032126 | Ga0307415_100077941 | Ga0307415_1000779412 | 179 |
| 531 | 3300032126 | Ga0307415_100258870 | Ga0307415_1002588702 | 179 |
| 532 | 3300032126 | Ga0307415_100289060 | Ga0307415_1002890601 | 179 |
| 533 | 3300033180 | Ga0307510_10005379 | Ga0307510_1000537914 | 179 |
| 534 | 3300033180 | Ga0307510_10083698 | Ga0307510_100836982 | 179 |
| 535 | 3300033180 | Ga0307510_10315969 | Ga0307510_103159692 | 179 |
| 536 | 3300033442 | Ga0315911_1000015 | Ga0315911_100001523 | 179 |
| 537 | 3300034816 | Ga0373930_0102633 | Ga0373930_0102633_46_588 | 179 |
| 538 | 3300034957 | Ga0373938_0059947 | Ga0373938_0059947_271_813 | 179 |
| 539 | 3300035083 | Ga0373926_0127308 | Ga0373926_0127308_62_604 | 179 |
| 540 | 3300035086 | Ga0373934_0008069 | Ga0373934_0008069_558_1100 | 179 |
| 541 | 3300035086 | Ga0373934_0120402 | Ga0373934_0120402_306_848 | 179 |
| 542 | 3300035086 | Ga0373934_0171130 | Ga0373934_0171130_313_855 | 179 |
| 543 | 3300035089 | Ga0373944_0176156 | Ga0373944_0176156_57_599 | 179 |
| 544 | 3300035092 | Ga0373952_0105271 | Ga0373952_0105271_173_715 | 179 |
| 545 | 3300035111 | Ga0373923_0010770 | Ga0373923_0010770_1501_2043 | 179 |
| 546 | 3300035111 | Ga0373923_0157577 | Ga0373923_0157577_41_583 | 179 |
| 547 | 3300035112 | Ga0373932_0068821 | Ga0373932_0068821_74_616 | 179 |
| 548 | 3300035113 | Ga0373936_0025118 | Ga0373936_0025118_72_614 | 179 |
| 549 | 3300035113 | Ga0373936_0044108 | Ga0373936_0044108_668_1210 | 179 |
| 550 | 3300035113 | Ga0373936_0085085 | Ga0373936_0085085_520_1062 | 179 |
| 551 | 3300035115 | Ga0373941_0050835 | Ga0373941_0050835_579_1121 | 179 |
| 552 | 3300035116 | Ga0373945_0015999 | Ga0373945_0015999_947_1489 | 179 |
| 553 | 3300035117 | Ga0373953_0081691 | Ga0373953_0081691_148_690 | 179 |
| 554 | 3300035117 | Ga0373953_0128586 | Ga0373953_0128586_355_897 | 179 |
| 555 | 3300035117 | Ga0373953_0421904 | Ga0373953_0421904_11_553 | 179 |
| 556 | 3300035118 | Ga0373954_0003254 | Ga0373954_0003254_1213_1755 | 179 |
| 557 | 3300035118 | Ga0373954_0050144 | Ga0373954_0050144_331_873 | 179 |
| 558 | 3300035119 | Ga0373956_0244077 | Ga0373956_0244077_157_699 | 179 |
| 559 | 3300035120 | Ga0373957_0161379 | Ga0373957_0161379_294_836 | 179 |
| 560 | 3300035170 | Ga0373943_0077832 | Ga0373943_0077832_333_875 | 179 |
| 561 | 3300035170 | Ga0373943_0192461 | Ga0373943_0192461_108_650 | 179 |
| 562 | 3300035171 | Ga0373946_0055424 | Ga0373946_0055424_720_1262 | 179 |
| 563 | 3300035171 | Ga0373946_0061132 | Ga0373946_0061132_689_1231 | 179 |
| 564 | 3300035171 | Ga0373946_0192923 | Ga0373946_0192923_203_745 | 179 |
| 565 | 3300035171 | Ga0373946_0193549 | Ga0373946_0193549_188_757 | 179 |
| 566 | 3300035172 | Ga0373955_0019007 | Ga0373955_0019007_482_1024 | 179 |
| 567 | 3300035172 | Ga0373955_0034453 | Ga0373955_0034453_2082_2624 | 179 |
| 568 | 3300035207 | Ga0373942_0136365 | Ga0373942_0136365_36_578 | 179 |
| 569 | 3300035242 | Ga0373962_0060838 | Ga0373962_0060838_361_903 | 179 |
| 570 | 3300035410 | Ga0373924_0020154 | Ga0373924_0020154_944_1486 | 179 |
| 571 | 3300035410 | Ga0373924_0071056 | Ga0373924_0071056_649_1191 | 179 |
| 572 | 3300035691 | Ga0373931_0002294 | Ga0373931_0002294_2348_2890 | 179 |
| 573 | 3300035692 | Ga0373935_0012074 | Ga0373935_0012074_4099_4641 | 179 |
| 574 | 3300035692 | Ga0373935_0047436 | Ga0373935_0047436_1088_1630 | 179 |
| 575 | 3300035692 | Ga0373935_0107938 | Ga0373935_0107938_196_738 | 179 |
| 576 | 3300035695 | Ga0373927_0012034 | Ga0373927_0012034_3543_4097 | 179 |
| 577 | 3300035695 | Ga0373927_0033415 | Ga0373927_0033415_1877_2419 | 179 |
| 578 | 3300035695 | Ga0373927_0187178 | Ga0373927_0187178_713_1273 | 179 |
| 579 | 3300035695 | Ga0373927_0287620 | Ga0373927_0287620_84_626 | 179 |
| 580 | 3300035724 | Ga0373933_0000784 | Ga0373933_0000784_6768_7310 | 179 |
| 581 | 3300035724 | Ga0373933_0002702 | Ga0373933_0002702_490_1032 | 179 |
| 582 | 3300035724 | Ga0373933_0024423 | Ga0373933_0024423_1919_2461 | 179 |
| 583 | 3300035724 | Ga0373933_0391771 | Ga0373933_0391771_333_875 | 179 |
| 584 | 3300035724 | Ga0373933_0792884 | Ga0373933_0792884_27_569 | 179 |
| 585 | 3300035725 | Ga0373947_0006075 | Ga0373947_0006075_3703_4245 | 179 |
| 586 | 3300035725 | Ga0373947_0018523 | Ga0373947_0018523_2701_3243 | 179 |
| 587 | 3300036401 | Ga0373937_0013724 | Ga0373937_0013724_3215_3757 | 179 |
| 588 | 3300036401 | Ga0373937_0678128 | Ga0373937_0678128_366_908 | 179 |
| 589 | 3300036401 | Ga0373937_0915674 | Ga0373937_0915674_151_693 | 179 |
| 590 | 3300037068 | Ga0373925_0028352 | Ga0373925_0028352_3499_4068 | 179 |
| 591 | 3300037068 | Ga0373925_0062447 | Ga0373925_0062447_1686_2228 | 179 |
| 592 | 3300037312 | Ga0395899_0138645 | Ga0395899_0138645_74_616 | 179 |
| 593 | 3300037418 | Ga0395900_0049784 | Ga0395900_0049784_1975_2517 | 179 |
| 594 | 3300037418 | Ga0395900_0311332 | Ga0395900_0311332_804_1346 | 179 |
| 595 | 3300037466 | Ga0395898_0055824 | Ga0395898_0055824_531_1124 | 179 |
| 596 | 3300037466 | Ga0395898_0103771 | Ga0395898_0103771_1816_2358 | 179 |
| 597 | 3300037471 | Ga0395905_0069858 | Ga0395905_0069858_159_701 | 179 |
| 598 | 3300037853 | Ga0436364_0881658 | Ga0436364_0881658_475_1044 | 179 |
| 599 | 3300037853 | Ga0436364_1111914 | Ga0436364_1111914_834_1379 | 179 |
| 600 | 3300038443 | Ga0395901_0387541 | Ga0395901_0387541_186_779 | 179 |
| 601 | 3300039437 | Ga0436365_0564143 | Ga0436365_0564143_43_606 | 179 |
| 602 | 3300039437 | Ga0436365_0972944 | Ga0436365_0972944_116_661 | 179 |
| 603 | 3300039437 | Ga0436365_1493072 | Ga0436365_1493072_3523_4065 | 179 |
| 604 | 3300039437 | Ga0436365_1883175 | Ga0436365_1883175_759_1301 | 179 |
| 605 | 3300039438 | Ga0436360_0879024 | Ga0436360_0879024_278_820 | 179 |
| 606 | 3300039447 | Ga0436361_0964292 | Ga0436361_0964292_1003_1557 | 179 |
| 607 | 3300039450 | Ga0436363_0039534 | Ga0436363_0039534_172_714 | 179 |
| 608 | 3300039450 | Ga0436363_0296726 | Ga0436363_0296726_215_757 | 179 |
| 609 | 3300039450 | Ga0436363_0557724 | Ga0436363_0557724_378_920 | 179 |
| 610 | 3300039453 | Ga0436362_0953067 | Ga0436362_0953067_2892_3446 | 179 |
| 611 | 3300041413 | Ga0439465_0020470 | Ga0439465_0020470_366_920 | 179 |
| 612 | 3300041491 | Ga0451833_0686916 | Ga0451833_0686916_21_563 | 179 |
| 613 | 3300041496 | Ga0451839_0697962 | Ga0451839_0697962_34_576 | 179 |
| 614 | 3300042438 | Ga0439459_0022873 | Ga0439459_0022873_565_1119 | 179 |
| 615 | 3300044765 | Ga0466970_0255650 | Ga0466970_0255650_216_758 | 179 |
| 616 | 3300044842 | Ga0466957_0059062 | Ga0466957_0059062_1631_2173 | 179 |
| 617 | 3300044842 | Ga0466957_0392866 | Ga0466957_0392866_293_835 | 179 |
| 618 | 3300045049 | Ga0466959_0044336 | Ga0466959_0044336_348_890 | 179 |
| 619 | 3300045976 | Ga0466967_0101592 | Ga0466967_0101592_663_1205 | 179 |
| 620 | 3300045976 | Ga0466967_0357537 | Ga0466967_0357537_389_931 | 179 |
| 621 | 3300045976 | Ga0466967_0432291 | Ga0466967_0432291_551_1123 | 179 |
| 622 | 3300045976 | Ga0466967_0589444 | Ga0466967_0589444_437_979 | 179 |
| 623 | 3300045976 | Ga0466967_1495507 | Ga0466967_1495507_13_555 | 179 |
| 624 | 3300046452 | Ga0495617_020141 | Ga0495617_020141_972_1514 | 179 |
| 625 | 3300046454 | Ga0495592_0057714 | Ga0495592_0057714_1138_1680 | 179 |
| 626 | 3300046454 | Ga0495592_0420691 | Ga0495592_0420691_187_729 | 179 |
| 627 | 3300046455 | Ga0495603_0008752 | Ga0495603_0008752_3766_4308 | 179 |
| 628 | 3300046455 | Ga0495603_0049995 | Ga0495603_0049995_1033_1575 | 179 |
| 629 | 3300046455 | Ga0495603_0159059 | Ga0495603_0159059_77_619 | 179 |
| 630 | 3300046459 | Ga0495629_0002984 | Ga0495629_0002984_2269_2811 | 179 |
| 631 | 3300046459 | Ga0495629_0035847 | Ga0495629_0035847_90_632 | 179 |
| 632 | 3300046461 | Ga0495641_0018784 | Ga0495641_0018784_2128_2670 | 179 |
| 633 | 3300046462 | Ga0495651_0036567 | Ga0495651_0036567_1164_1706 | 179 |
| 634 | 3300046462 | Ga0495651_0060367 | Ga0495651_0060367_2340_2882 | 179 |
| 635 | 3300046463 | Ga0495653_0028021 | Ga0495653_0028021_3257_3799 | 179 |
| 636 | 3300046463 | Ga0495653_0232128 | Ga0495653_0232128_250_792 | 179 |
| 637 | 3300046463 | Ga0495653_0537577 | Ga0495653_0537577_36_578 | 179 |
| 638 | 3300046471 | Ga0495650_0096464 | Ga0495650_0096464_120_674 | 179 |
| 639 | 3300046472 | Ga0495580_0098534 | Ga0495580_0098534_105_647 | 179 |
| 640 | 3300046473 | Ga0495582_0080477 | Ga0495582_0080477_667_1209 | 179 |
| 641 | 3300046475 | Ga0495639_0003042 | Ga0495639_0003042_4028_4570 | 179 |
| 642 | 3300046475 | Ga0495639_0007837 | Ga0495639_0007837_3031_3573 | 179 |
| 643 | 3300046475 | Ga0495639_0042858 | Ga0495639_0042858_80_622 | 179 |
| 644 | 3300046475 | Ga0495639_0103382 | Ga0495639_0103382_212_766 | 179 |
| 645 | 3300046476 | Ga0495662_0034440 | Ga0495662_0034440_1813_2355 | 179 |
| 646 | 3300046476 | Ga0495662_0103228 | Ga0495662_0103228_35_577 | 179 |
| 647 | 3300046476 | Ga0495662_0114892 | Ga0495662_0114892_758_1300 | 179 |
| 648 | 3300046477 | Ga0495664_0129187 | Ga0495664_0129187_628_1170 | 179 |
| 649 | 3300046477 | Ga0495664_0156356 | Ga0495664_0156356_250_792 | 179 |
| 650 | 3300046499 | Ga0495594_0020690 | Ga0495594_0020690_916_1458 | 179 |
| 651 | 3300046499 | Ga0495594_0096208 | Ga0495594_0096208_1085_1627 | 179 |
| 652 | 3300046499 | Ga0495594_0398184 | Ga0495594_0398184_100_669 | 179 |
| 653 | 3300046499 | Ga0495594_0414886 | Ga0495594_0414886_22_576 | 179 |
| 654 | 3300046500 | Ga0495596_0022344 | Ga0495596_0022344_285_827 | 179 |
| 655 | 3300046506 | Ga0495583_0112530 | Ga0495583_0112530_585_1127 | 179 |
| 656 | 3300046507 | Ga0495606_0003350 | Ga0495606_0003350_10021_10563 | 179 |
| 657 | 3300046511 | Ga0495608_0189832 | Ga0495608_0189832_570_1112 | 179 |
| 658 | 3300046514 | Ga0495618_0054775 | Ga0495618_0054775_1676_2218 | 179 |
| 659 | 3300046514 | Ga0495618_0166821 | Ga0495618_0166821_42_584 | 179 |
| 660 | 3300046514 | Ga0495618_0253407 | Ga0495618_0253407_144_686 | 179 |
| 661 | 3300046515 | Ga0495620_0068670 | Ga0495620_0068670_33_587 | 179 |
| 662 | 3300046516 | Ga0495628_0018851 | Ga0495628_0018851_377_919 | 179 |
| 663 | 3300046516 | Ga0495628_0037867 | Ga0495628_0037867_770_1312 | 179 |
| 664 | 3300046516 | Ga0495628_0076373 | Ga0495628_0076373_387_929 | 179 |
| 665 | 3300046516 | Ga0495628_0577615 | Ga0495628_0577615_176_718 | 179 |
| 666 | 3300046517 | Ga0495630_0059721 | Ga0495630_0059721_1015_1557 | 179 |
| 667 | 3300046517 | Ga0495630_0098848 | Ga0495630_0098848_1012_1554 | 179 |
| 668 | 3300046517 | Ga0495630_0762626 | Ga0495630_0762626_117_659 | 179 |
| 669 | 3300046519 | Ga0495632_0158599 | Ga0495632_0158599_368_910 | 179 |
| 670 | 3300046519 | Ga0495632_0192772 | Ga0495632_0192772_228_782 | 179 |
| 671 | 3300046519 | Ga0495632_0274205 | Ga0495632_0274205_87_641 | 179 |
| 672 | 3300046523 | Ga0495644_0043821 | Ga0495644_0043821_662_1216 | 179 |
| 673 | 3300046524 | Ga0495648_0005396 | Ga0495648_0005396_7639_8181 | 179 |
| 674 | 3300046526 | Ga0495666_0090625 | Ga0495666_0090625_170_739 | 179 |
| 675 | 3300046528 | Ga0495642_0041301 | Ga0495642_0041301_717_1259 | 179 |
| 676 | 3300046529 | Ga0495652_0141008 | Ga0495652_0141008_1027_1569 | 179 |
| 677 | 3300046529 | Ga0495652_0273775 | Ga0495652_0273775_154_696 | 179 |
| 678 | 3300046531 | Ga0495665_0048993 | Ga0495665_0048993_1165_1707 | 179 |
| 679 | 3300046531 | Ga0495665_0072348 | Ga0495665_0072348_818_1360 | 179 |
| 680 | 3300046531 | Ga0495665_0260691 | Ga0495665_0260691_217_759 | 179 |
| 681 | 3300046531 | Ga0495665_0289521 | Ga0495665_0289521_54_596 | 179 |
| 682 | 3300046533 | Ga0495640_0031105 | Ga0495640_0031105_426_968 | 179 |
| 683 | 3300046533 | Ga0495640_0043124 | Ga0495640_0043124_2166_2708 | 179 |
| 684 | 3300046533 | Ga0495640_0197990 | Ga0495640_0197990_527_1069 | 179 |
| 685 | 3300046533 | Ga0495640_0501708 | Ga0495640_0501708_43_585 | 179 |
| 686 | 3300046535 | Ga0495586_0084345 | Ga0495586_0084345_980_1522 | 179 |
| 687 | 3300046536 | Ga0495587_0070229 | Ga0495587_0070229_332_874 | 179 |
| 688 | 3300046538 | Ga0495609_0127835 | Ga0495609_0127835_527_1069 | 179 |
| 689 | 3300046538 | Ga0495609_0128949 | Ga0495609_0128949_234_776 | 179 |
| 690 | 3300046543 | Ga0495645_0024397 | Ga0495645_0024397_1599_2141 | 179 |
| 691 | 3300046543 | Ga0495645_0187646 | Ga0495645_0187646_759_1319 | 179 |
| 692 | 3300046557 | Ga0495622_0015653 | Ga0495622_0015653_1094_1636 | 179 |
| 693 | 3300046557 | Ga0495622_0035408 | Ga0495622_0035408_1679_2221 | 179 |
| 694 | 3300046559 | Ga0495667_0035702 | Ga0495667_0035702_1887_2429 | 179 |
| 695 | 3300046559 | Ga0495667_0122295 | Ga0495667_0122295_419_961 | 179 |
| 696 | 3300046559 | Ga0495667_0146376 | Ga0495667_0146376_890_1432 | 179 |
| 697 | 3300046559 | Ga0495667_0785906 | Ga0495667_0785906_11_553 | 179 |
| 698 | 3300046615 | Ga0495656_0137787 | Ga0495656_0137787_66_620 | 179 |
| 699 | 3300046615 | Ga0495656_0189032 | Ga0495656_0189032_277_819 | 179 |
| 700 | 3300046616 | Ga0495668_0464903 | Ga0495668_0464903_108_650 | 179 |
| 701 | 3300046642 | Ga0495634_0005863 | Ga0495634_0005863_3212_3754 | 179 |
| 702 | 3300046642 | Ga0495634_0038694 | Ga0495634_0038694_1185_1727 | 179 |
| 703 | 3300046642 | Ga0495634_0096854 | Ga0495634_0096854_262_804 | 179 |
| 704 | 3300046660 | Ga0495625_0621482 | Ga0495625_0621482_11_565 | 179 |
| 705 | 3300046663 | Ga0495635_0004233 | Ga0495635_0004233_9242_9784 | 179 |
| 706 | 3300046663 | Ga0495635_0058430 | Ga0495635_0058430_346_888 | 179 |
| 707 | 3300046664 | Ga0495659_0008839 | Ga0495659_0008839_1142_1696 | 179 |
| 708 | 3300046664 | Ga0495659_0104801 | Ga0495659_0104801_150_704 | 179 |
| 709 | 3300046664 | Ga0495659_0250466 | Ga0495659_0250466_117_671 | 179 |
| 710 | 3300046665 | Ga0495661_0195600 | Ga0495661_0195600_140_694 | 179 |
| 711 | 3300046674 | Ga0495588_0020627 | Ga0495588_0020627_1166_1720 | 179 |
| 712 | 3300046675 | Ga0495657_0025879 | Ga0495657_0025879_2234_2776 | 179 |
| 713 | 3300046675 | Ga0495657_0063786 | Ga0495657_0063786_310_852 | 179 |
| 714 | 3300046675 | Ga0495657_0327290 | Ga0495657_0327290_317_859 | 179 |
| 715 | 3300046678 | Ga0495599_0018837 | Ga0495599_0018837_2208_2750 | 179 |
| 716 | 3300046678 | Ga0495599_0080476 | Ga0495599_0080476_1446_1988 | 179 |
| 717 | 3300046678 | Ga0495599_0145712 | Ga0495599_0145712_728_1288 | 179 |
| 718 | 3300046679 | Ga0495623_0006324 | Ga0495623_0006324_2541_3083 | 179 |
| 719 | 3300046679 | Ga0495623_0238414 | Ga0495623_0238414_121_663 | 179 |
| 720 | 3300046680 | Ga0495646_0017450 | Ga0495646_0017450_2233_2775 | 179 |
| 721 | 3300046680 | Ga0495646_0046764 | Ga0495646_0046764_2029_2571 | 179 |
| 722 | 3300046680 | Ga0495646_0118960 | Ga0495646_0118960_37_579 | 179 |
| 723 | 3300046681 | Ga0495647_0013604 | Ga0495647_0013604_260_802 | 179 |
| 724 | 3300046681 | Ga0495647_0120523 | Ga0495647_0120523_393_935 | 179 |
| 725 | 3300046683 | Ga0495658_0087659 | Ga0495658_0087659_787_1329 | 179 |
| 726 | 3300046683 | Ga0495658_0300810 | Ga0495658_0300810_410_952 | 179 |
| 727 | 3300046684 | Ga0495669_0006974 | Ga0495669_0006974_2597_3151 | 179 |
| 728 | 3300046684 | Ga0495669_0049594 | Ga0495669_0049594_188_730 | 179 |
| 729 | 3300046684 | Ga0495669_0118974 | Ga0495669_0118974_587_1141 | 179 |
| 730 | 3300046689 | Ga0495613_0106646 | Ga0495613_0106646_827_1369 | 179 |
| 731 | 3300046689 | Ga0495613_0213921 | Ga0495613_0213921_552_1106 | 179 |
| 732 | 3300046689 | Ga0495613_0880490 | Ga0495613_0880490_27_569 | 179 |
| 733 | 3300046690 | Ga0495624_0039316 | Ga0495624_0039316_323_865 | 179 |
| 734 | 3300046690 | Ga0495624_0130355 | Ga0495624_0130355_51_593 | 179 |
| 735 | 3300046690 | Ga0495624_0373061 | Ga0495624_0373061_245_787 | 179 |
| 736 | 3300046691 | Ga0495670_0088380 | Ga0495670_0088380_920_1474 | 179 |
| 737 | 3300046691 | Ga0495670_0112902 | Ga0495670_0112902_350_904 | 179 |
| 738 | 3300046794 | Ga0495589_0212256 | Ga0495589_0212256_140_694 | 179 |
| 739 | 3300046809 | Ga0495600_0100555 | Ga0495600_0100555_440_982 | 179 |
| 740 | 3300046809 | Ga0495600_0240484 | Ga0495600_0240484_407_949 | 179 |
| 741 | 3300046809 | Ga0495600_0246640 | Ga0495600_0246640_285_839 | 179 |
| 742 | 3300046809 | Ga0495600_0777507 | Ga0495600_0777507_11_553 | 179 |
| 743 | 3300046810 | Ga0495660_0233494 | Ga0495660_0233494_27_581 | 179 |
| 744 | 3300047315 | Ga0495581_0022509 | Ga0495581_0022509_1736_2278 | 179 |
| 745 | 3300047315 | Ga0495581_0039231 | Ga0495581_0039231_841_1383 | 179 |
| 746 | 3300047315 | Ga0495581_0056334 | Ga0495581_0056334_509_1063 | 179 |
| 747 | 3300047315 | Ga0495581_0133443 | Ga0495581_0133443_839_1381 | 179 |
| 748 | 3300047317 | Ga0495604_0093644 | Ga0495604_0093644_1589_2131 | 179 |
| 749 | 3300047317 | Ga0495604_0098991 | Ga0495604_0098991_1514_2056 | 179 |
| 750 | 3300047317 | Ga0495604_0103732 | Ga0495604_0103732_945_1487 | 179 |
| 751 | 3300047317 | Ga0495604_0282157 | Ga0495604_0282157_147_701 | 179 |
| 752 | 3300047317 | Ga0495604_0417447 | Ga0495604_0417447_243_785 | 179 |
| 753 | 3300047317 | Ga0495604_0459204 | Ga0495604_0459204_58_720 | 179 |
| 754 | 3300047318 | Ga0495636_0050243 | Ga0495636_0050243_625_1179 | 179 |
| 755 | 3300047319 | Ga0495674_0066189 | Ga0495674_0066189_260_802 | 179 |
| 756 | 3300047319 | Ga0495674_0087507 | Ga0495674_0087507_895_1437 | 179 |
| 757 | 3300047319 | Ga0495674_0119336 | Ga0495674_0119336_1180_1722 | 179 |
| 758 | 3300047319 | Ga0495674_1008512 | Ga0495674_1008512_50_592 | 179 |
| 759 | 3300047320 | Ga0495672_0053768 | Ga0495672_0053768_1170_1712 | 179 |
| 760 | 3300047320 | Ga0495672_0206616 | Ga0495672_0206616_85_627 | 179 |
| 761 | 3300047321 | Ga0495676_0050003 | Ga0495676_0050003_89_631 | 179 |
| 762 | 3300047322 | Ga0495680_0152660 | Ga0495680_0152660_786_1328 | 179 |
| 763 | 3300047322 | Ga0495680_0406147 | Ga0495680_0406147_23_565 | 179 |
| 764 | 3300047444 | Ga0495675_0037487 | Ga0495675_0037487_1259_1801 | 179 |
| 765 | 3300047444 | Ga0495675_0039044 | Ga0495675_0039044_1060_1602 | 179 |
| 766 | 3300047444 | Ga0495675_0377973 | Ga0495675_0377973_107_649 | 179 |
| 767 | 3300047446 | Ga0495679_063429 | Ga0495679_063429_368_922 | 179 |
| 768 | 3300047469 | Ga0495673_0121565 | Ga0495673_0121565_159_701 | 179 |
| 769 | 3300047471 | Ga0495684_0008094 | Ga0495684_0008094_4869_5411 | 179 |
| 770 | 3300047471 | Ga0495684_0019268 | Ga0495684_0019268_2761_3303 | 179 |
| 771 | 3300047471 | Ga0495684_0079279 | Ga0495684_0079279_1081_1623 | 179 |
| 772 | 3300047471 | Ga0495684_0252110 | Ga0495684_0252110_103_645 | 179 |
| 773 | 3300047472 | Ga0495686_0122443 | Ga0495686_0122443_722_1264 | 179 |
| 774 | 3300047472 | Ga0495686_0134394 | Ga0495686_0134394_541_1083 | 179 |
| 775 | 3300047673 | Ga0495593_0032879 | Ga0495593_0032879_926_1468 | 179 |
| 776 | 3300047673 | Ga0495593_0040757 | Ga0495593_0040757_1066_1608 | 179 |
| 777 | 3300047673 | Ga0495593_0049421 | Ga0495593_0049421_1143_1685 | 179 |
| 778 | 3300047673 | Ga0495593_0170222 | Ga0495593_0170222_433_975 | 179 |
| 779 | 3300048088 | Ga0495602_0061833 | Ga0495602_0061833_1589_2131 | 179 |
| 780 | 3300048088 | Ga0495602_0288857 | Ga0495602_0288857_626_1168 | 179 |
| 781 | 3300048089 | Ga0495614_0183994 | Ga0495614_0183994_257_799 | 179 |
| 782 | 3300048089 | Ga0495614_0273504 | Ga0495614_0273504_178_720 | 179 |
| 783 | 3300048090 | Ga0495615_0039676 | Ga0495615_0039676_588_1142 | 179 |
| 784 | 3300048091 | Ga0495626_0218940 | Ga0495626_0218940_30_572 | 179 |
| 785 | 3300048903 | Ga0496100_0241413 | Ga0496100_0241413_691_1233 | 179 |
| 786 | 3300048904 | Ga0496101_0077541 | Ga0496101_0077541_276_818 | 179 |
| 787 | 3300048904 | Ga0496101_0181632 | Ga0496101_0181632_1001_1549 | 179 |
| 788 | 3300048904 | Ga0496101_0210619 | Ga0496101_0210619_100_654 | 179 |
| 789 | 3300048904 | Ga0496101_0642682 | Ga0496101_0642682_192_734 | 179 |
| 790 | 3300048904 | Ga0496101_0975022 | Ga0496101_0975022_111_653 | 179 |
| 791 | 3300048904 | Ga0496101_1009162 | Ga0496101_1009162_46_588 | 179 |
| 792 | 3300048905 | Ga0496102_0084967 | Ga0496102_0084967_594_1148 | 179 |
| 793 | 3300048905 | Ga0496102_0094275 | Ga0496102_0094275_844_1392 | 179 |
| 794 | 3300048905 | Ga0496102_0129276 | Ga0496102_0129276_249_791 | 179 |
| 795 | 3300048905 | Ga0496102_0201988 | Ga0496102_0201988_244_786 | 179 |
| 796 | 3300048905 | Ga0496102_0481573 | Ga0496102_0481573_578_1120 | 179 |
| 797 | 3300048905 | Ga0496102_0520590 | Ga0496102_0520590_435_1004 | 179 |
| 798 | 3300048906 | Ga0496103_0107579 | Ga0496103_0107579_533_1087 | 179 |
| 799 | 3300048907 | Ga0496104_0007678 | Ga0496104_0007678_4035_4583 | 179 |
| 800 | 3300048907 | Ga0496104_0140577 | Ga0496104_0140577_825_1379 | 179 |
| 801 | 3300048907 | Ga0496104_0580447 | Ga0496104_0580447_240_782 | 179 |
| 802 | 3300048907 | Ga0496104_0622867 | Ga0496104_0622867_63_617 | 179 |
| 803 | 3300048907 | Ga0496104_0687146 | Ga0496104_0687146_312_866 | 179 |
| 804 | 3300048908 | Ga0496105_0097372 | Ga0496105_0097372_1156_1704 | 179 |
| 805 | 3300048908 | Ga0496105_0274728 | Ga0496105_0274728_79_633 | 179 |
| 806 | 3300048908 | Ga0496105_0439275 | Ga0496105_0439275_449_991 | 179 |
| 807 | 3300048908 | Ga0496105_0471756 | Ga0496105_0471756_413_955 | 179 |
| 808 | 3300048909 | Ga0496106_0008768 | Ga0496106_0008768_2432_2980 | 179 |
| 809 | 3300048909 | Ga0496106_0057561 | Ga0496106_0057561_280_834 | 179 |
| 810 | 3300048909 | Ga0496106_0073480 | Ga0496106_0073480_531_1073 | 179 |
| 811 | 3300048909 | Ga0496106_0090660 | Ga0496106_0090660_249_791 | 179 |
| 812 | 3300048910 | Ga0496107_0032726 | Ga0496107_0032726_147_689 | 179 |
| 813 | 3300048910 | Ga0496107_0222751 | Ga0496107_0222751_428_976 | 179 |
| 814 | 3300048910 | Ga0496107_0476306 | Ga0496107_0476306_351_893 | 179 |
| 815 | 3300048911 | Ga0496108_0204509 | Ga0496108_0204509_378_926 | 179 |
| 816 | 3300048911 | Ga0496108_0223181 | Ga0496108_0223181_496_1038 | 179 |
| 817 | 3300048912 | Ga0496109_0000469 | Ga0496109_0000469_33305_33847 | 179 |
| 818 | 3300048912 | Ga0496109_0944410 | Ga0496109_0944410_234_788 | 179 |
| 819 | 3300048913 | Ga0496110_0011658 | Ga0496110_0011658_4198_4746 | 179 |
| 820 | 3300048913 | Ga0496110_0065763 | Ga0496110_0065763_2242_2784 | 179 |
| 821 | 3300048913 | Ga0496110_0284284 | Ga0496110_0284284_933_1475 | 179 |
| 822 | 3300048913 | Ga0496110_0674586 | Ga0496110_0674586_28_570 | 179 |
| 823 | 3300048913 | Ga0496110_0739849 | Ga0496110_0739849_83_637 | 179 |
| 824 | 3300048914 | Ga0496111_0035057 | Ga0496111_0035057_2792_3334 | 179 |
| 825 | 3300048914 | Ga0496111_0084785 | Ga0496111_0084785_715_1263 | 179 |
| 826 | 3300048914 | Ga0496111_0155210 | Ga0496111_0155210_362_904 | 179 |
| 827 | 3300048914 | Ga0496111_0873852 | Ga0496111_0873852_92_637 | 179 |
| 828 | 3300048914 | Ga0496111_0979587 | Ga0496111_0979587_12_554 | 179 |
| 829 | 3300048915 | Ga0496112_0017876 | Ga0496112_0017876_780_1322 | 179 |
| 830 | 3300048915 | Ga0496112_0111037 | Ga0496112_0111037_351_896 | 179 |
| 831 | 3300048915 | Ga0496112_0119746 | Ga0496112_0119746_597_1145 | 179 |
| 832 | 3300048915 | Ga0496112_0119972 | Ga0496112_0119972_992_1546 | 179 |
| 833 | 3300048915 | Ga0496112_0287859 | Ga0496112_0287859_682_1224 | 179 |
| 834 | 3300048916 | Ga0496113_0119862 | Ga0496113_0119862_999_1547 | 179 |
| 835 | 3300048916 | Ga0496113_0171286 | Ga0496113_0171286_122_664 | 179 |
| 836 | 3300048916 | Ga0496113_0244651 | Ga0496113_0244651_426_968 | 179 |
| 837 | 3300048917 | Ga0496114_0005276 | Ga0496114_0005276_4656_5198 | 179 |
| 838 | 3300048917 | Ga0496114_0326765 | Ga0496114_0326765_70_612 | 179 |
| 839 | 3300048917 | Ga0496114_0363577 | Ga0496114_0363577_138_692 | 179 |
| 840 | 3300048918 | Ga0496115_0019167 | Ga0496115_0019167_4015_4557 | 179 |
| 841 | 3300048918 | Ga0496115_0019415 | Ga0496115_0019415_50_598 | 179 |
| 842 | 3300048918 | Ga0496115_0044802 | Ga0496115_0044802_402_944 | 179 |
| 843 | 3300048918 | Ga0496115_0130697 | Ga0496115_0130697_532_1074 | 179 |
| 844 | 3300048918 | Ga0496115_0583505 | Ga0496115_0583505_314_856 | 179 |
| 845 | 3300048921 | Ga0496118_0136657 | Ga0496118_0136657_753_1292 | 179 |
| 846 | 3300048921 | Ga0496118_0264262 | Ga0496118_0264262_25_570 | 179 |
| 847 | 3300048922 | Ga0496119_0070230 | Ga0496119_0070230_1236_1775 | 179 |
| 848 | 3300048922 | Ga0496119_0123615 | Ga0496119_0123615_428_970 | 179 |
| 849 | 3300048922 | Ga0496119_0231188 | Ga0496119_0231188_104_691 | 179 |
| 850 | 3300048924 | Ga0496121_0002453 | Ga0496121_0002453_18868_19410 | 179 |
| 851 | 3300048924 | Ga0496121_0084289 | Ga0496121_0084289_1674_2228 | 179 |
| 852 | 3300048924 | Ga0496121_0169347 | Ga0496121_0169347_771_1358 | 179 |
| 853 | 3300048924 | Ga0496121_0568859 | Ga0496121_0568859_135_677 | 179 |
| 854 | 3300048927 | Ga0496124_0160713 | Ga0496124_0160713_28_582 | 179 |
| 855 | 3300048928 | Ga0496125_0226979 | Ga0496125_0226979_101_655 | 179 |
| 856 | 3300048929 | Ga0496126_0056340 | Ga0496126_0056340_2514_3056 | 179 |
| 857 | 3300048929 | Ga0496126_0067172 | Ga0496126_0067172_454_996 | 179 |
| 858 | 3300048929 | Ga0496126_0111934 | Ga0496126_0111934_1455_2009 | 179 |
| 859 | 3300048929 | Ga0496126_0390298 | Ga0496126_0390298_568_1110 | 179 |
| 860 | 3300048929 | Ga0496126_0509483 | Ga0496126_0509483_340_882 | 179 |
| 861 | 3300049460 | Ga0495682_0150622 | Ga0495682_0150622_22_576 | 179 |
| 862 | 3300049569 | Ga0501032_0000196 | Ga0501032_0000196_9900_10460 | 179 |
| 863 | 3300049569 | Ga0501032_0096066 | Ga0501032_0096066_782_1336 | 179 |
| 864 | 3300049570 | Ga0501033_0003209 | Ga0501033_0003209_9851_10411 | 179 |
| 865 | 3300049570 | Ga0501033_0018168 | Ga0501033_0018168_1639_2193 | 179 |
| 866 | 3300049571 | Ga0501034_0001151 | Ga0501034_0001151_9900_10460 | 179 |
| 867 | 3300049571 | Ga0501034_0504125 | Ga0501034_0504125_255_809 | 179 |
| 868 | 3300049572 | Ga0501036_0000323 | Ga0501036_0000323_30786_31346 | 179 |
| 869 | 3300049572 | Ga0501036_0083448 | Ga0501036_0083448_1409_1963 | 179 |
| 870 | 3300049572 | Ga0501036_0607310 | Ga0501036_0607310_52_606 | 179 |
| 871 | 3300049573 | Ga0501037_0001377 | Ga0501037_0001377_7349_7909 | 179 |
| 872 | 3300049573 | Ga0501037_0001630 | Ga0501037_0001630_3076_3630 | 179 |
| 873 | 3300049574 | Ga0501038_0001622 | Ga0501038_0001622_9738_10298 | 179 |
| 874 | 3300049575 | Ga0501039_0001302 | Ga0501039_0001302_10149_10709 | 179 |
| 875 | 3300049575 | Ga0501039_0258956 | Ga0501039_0258956_623_1177 | 179 |
| 876 | 3300049575 | Ga0501039_0578651 | Ga0501039_0578651_167_721 | 179 |
| 877 | 3300049578 | Ga0501042_0046374 | Ga0501042_0046374_335_895 | 179 |
| 878 | 3300049578 | Ga0501042_0137635 | Ga0501042_0137635_474_1028 | 179 |
| 879 | 3300049579 | Ga0501043_0000409 | Ga0501043_0000409_28198_28758 | 179 |
| 880 | 3300049579 | Ga0501043_0017728 | Ga0501043_0017728_2882_3436 | 179 |
| 881 | 3300049580 | Ga0501046_0000181 | Ga0501046_0000181_9900_10460 | 179 |
| 882 | 3300049580 | Ga0501046_0060008 | Ga0501046_0060008_1238_1792 | 179 |
| 883 | 3300049581 | Ga0501047_0002426 | Ga0501047_0002426_9900_10460 | 179 |
| 884 | 3300049581 | Ga0501047_0062965 | Ga0501047_0062965_622_1164 | 179 |
| 885 | 3300049581 | Ga0501047_0352826 | Ga0501047_0352826_640_1200 | 179 |
| 886 | 3300049582 | Ga0501048_0003595 | Ga0501048_0003595_1358_1918 | 179 |
| 887 | 3300049583 | Ga0501067_0000145 | Ga0501067_0000145_9843_10403 | 179 |
| 888 | 3300049583 | Ga0501067_0023101 | Ga0501067_0023101_691_1233 | 179 |
| 889 | 3300049583 | Ga0501067_0050454 | Ga0501067_0050454_903_1460 | 179 |
| 890 | 3300049584 | Ga0501068_0002577 | Ga0501068_0002577_7529_8089 | 179 |
| 891 | 3300049585 | Ga0501069_0116733 | Ga0501069_0116733_552_1112 | 179 |
| 892 | 3300049586 | Ga0501070_0003510 | Ga0501070_0003510_1616_2176 | 179 |
| 893 | 3300049586 | Ga0501070_0605189 | Ga0501070_0605189_80_634 | 179 |
| 894 | 3300049587 | Ga0501071_0274480 | Ga0501071_0274480_255_815 | 179 |
| 895 | 3300049588 | Ga0501072_0017020 | Ga0501072_0017020_1920_2480 | 179 |
| 896 | 3300049589 | Ga0501073_0000027 | Ga0501073_0000027_10943_11503 | 179 |
| 897 | 3300049589 | Ga0501073_0039562 | Ga0501073_0039562_1914_2456 | 179 |
| 898 | 3300049590 | Ga0501074_0001347 | Ga0501074_0001347_9395_9955 | 179 |
| 899 | 3300049590 | Ga0501074_0146411 | Ga0501074_0146411_63_605 | 179 |
| 900 | 3300049741 | Ga0501079_0048138 | Ga0501079_0048138_275_835 | 179 |
| 901 | 3300049741 | Ga0501079_0751275 | Ga0501079_0751275_151_705 | 179 |
| 902 | 3300049742 | Ga0501080_0002621 | Ga0501080_0002621_9900_10460 | 179 |
| 903 | 3300049742 | Ga0501080_0052129 | Ga0501080_0052129_2184_2726 | 179 |
| 904 | 3300049744 | Ga0501083_0002123 | Ga0501083_0002123_7130_7690 | 179 |
| 905 | 3300049822 | Ga0501035_0001852 | Ga0501035_0001852_9900_10460 | 179 |
| 906 | 3300049822 | Ga0501035_0005411 | Ga0501035_0005411_3204_3758 | 179 |
| 907 | 3300049823 | Ga0501044_0003498 | Ga0501044_0003498_7221_7781 | 179 |
| 908 | 3300049823 | Ga0501044_0035674 | Ga0501044_0035674_592_1134 | 179 |
| 909 | 3300049823 | Ga0501044_0453947 | Ga0501044_0453947_582_1142 | 179 |
| 910 | 3300049824 | Ga0501045_1042880 | Ga0501045_1042880_10_552 | 179 |
| 911 | 3300050489 | nmdc:mga03683_147542_c1 | nmdc:mga03683_147542_c1_148_702 | 179 |
| 912 | 3300050489 | nmdc:mga03683_266469_c1 | nmdc:mga03683_266469_c1_166_720 | 179 |
| 913 | 3300050490 | nmdc:mga03n38_415174_c1 | nmdc:mga03n38_415174_c1_40_582 | 179 |
| 914 | 3300050490 | nmdc:mga03n38_98_c1 | nmdc:mga03n38_98_c1_12982_13536 | 179 |
| 915 | 3300050491 | nmdc:mga00v17_134015_c1 | nmdc:mga00v17_134015_c1_53_607 | 179 |
| 916 | 3300050491 | nmdc:mga00v17_360989_c1 | nmdc:mga00v17_360989_c1_347_889 | 179 |
| 917 | 3300050491 | nmdc:mga00v17_825617_c1 | nmdc:mga00v17_825617_c1_19_573 | 179 |
| 918 | 3300050492 | nmdc:mga0yw44_134681_c1 | nmdc:mga0yw44_134681_c1_639_1193 | 179 |
| 919 | 3300050492 | nmdc:mga0yw44_375205_c1 | nmdc:mga0yw44_375205_c1_358_912 | 179 |
| 920 | 3300050492 | nmdc:mga0yw44_459536_c1 | nmdc:mga0yw44_459536_c1_108_662 | 179 |
| 921 | 3300050492 | nmdc:mga0yw44_6672_c1 | nmdc:mga0yw44_6672_c1_3873_4427 | 179 |
| 922 | 3300050493 | nmdc:mga0k408_135893_c1 | nmdc:mga0k408_135893_c1_759_1313 | 179 |
| 923 | 3300050493 | nmdc:mga0k408_219045_c1 | nmdc:mga0k408_219045_c1_522_1076 | 179 |
| 924 | 3300050493 | nmdc:mga0k408_67583_c1 | nmdc:mga0k408_67583_c1_245_799 | 179 |
| 925 | 3300050494 | nmdc:mga06z11_114027_c1 | nmdc:mga06z11_114027_c1_388_942 | 179 |
| 926 | 3300050494 | nmdc:mga06z11_32996_c1 | nmdc:mga06z11_32996_c1_1307_1861 | 179 |
| 927 | 3300050494 | nmdc:mga06z11_342728_c1 | nmdc:mga06z11_342728_c1_130_684 | 179 |
| 928 | 3300050494 | nmdc:mga06z11_37963_c1 | nmdc:mga06z11_37963_c1_800_1354 | 179 |
| 929 | 3300050494 | nmdc:mga06z11_656518_c1 | nmdc:mga06z11_656518_c1_45_599 | 179 |
| 930 | 3300050496 | nmdc:mga07m45_144674_c1 | nmdc:mga07m45_144674_c1_563_1117 | 179 |
| 931 | 3300050496 | nmdc:mga07m45_9952_c2 | nmdc:mga07m45_9952_c2_2863_3417 | 179 |
| 932 | 3300050511 | nmdc:mga08y16_1190555_c1 | nmdc:mga08y16_1190555_c1_11_565 | 179 |
| 933 | 3300050512 | nmdc:mga0n895_1673395_c1 | nmdc:mga0n895_1673395_c1_24_566 | 179 |
| 934 | 3300050512 | nmdc:mga0n895_179818_c1 | nmdc:mga0n895_179818_c1_455_1009 | 179 |
| 935 | 3300050514 | nmdc:mga08x19_815980_c1 | nmdc:mga08x19_815980_c1_19_573 | 179 |
| 936 | 3300053077 | Ga0495601_0018892 | Ga0495601_0018892_361_903 | 179 |
| 937 | 3300053077 | Ga0495601_0023042 | Ga0495601_0023042_2059_2601 | 179 |
| 938 | 3300053077 | Ga0495601_0045290 | Ga0495601_0045290_1197_1739 | 179 |
| 939 | 3300053078 | Ga0495612_0050427 | Ga0495612_0050427_493_1035 | 179 |
| 940 | 3300053078 | Ga0495612_0141603 | Ga0495612_0141603_25_585 | 179 |
| 941 | 3300053078 | Ga0495612_0266615 | Ga0495612_0266615_122_676 | 179 |
| 942 | 3300053080 | Ga0500635_0003192 | Ga0500635_0003192_2638_3207 | 179 |
| 943 | 3300053080 | Ga0500635_0008969 | Ga0500635_0008969_119_661 | 179 |
| 944 | 3300053084 | Ga0495595_0051790 | Ga0495595_0051790_1212_1754 | 179 |
| 945 | 3300053085 | Ga0495619_0008712 | Ga0495619_0008712_1111_1653 | 179 |
| 946 | 3300053085 | Ga0495619_0052867 | Ga0495619_0052867_2132_2674 | 179 |
| 947 | 3300053085 | Ga0495619_0639291 | Ga0495619_0639291_83_625 | 179 |
| 948 | 3300053086 | Ga0500578_0459676 | Ga0500578_0459676_147_686 | 179 |
| 949 | 3300053094 | Ga0500566_0000207 | Ga0500566_0000207_20080_20622 | 179 |
| 950 | 3300053096 | Ga0500641_0001497 | Ga0500641_0001497_6272_6814 | 179 |
| 951 | 3300053096 | Ga0500641_0170350 | Ga0500641_0170350_26_583 | 179 |
| 952 | 3300053099 | Ga0500654_137610 | Ga0500654_137610_339_881 | 179 |
| 953 | 3300053102 | Ga0500554_000856 | Ga0500554_000856_4539_5108 | 179 |
| 954 | 3300053102 | Ga0500554_001256 | Ga0500554_001256_1723_2265 | 179 |
| 955 | 3300053104 | Ga0500556_0017680 | Ga0500556_0017680_1398_1940 | 179 |
| 956 | 3300053111 | Ga0500572_000676 | Ga0500572_000676_10625_11167 | 179 |
| 957 | 3300053119 | Ga0500595_000299 | Ga0500595_000299_30724_31266 | 179 |
| 958 | 3300053119 | Ga0500595_003982 | Ga0500595_003982_1828_2367 | 179 |
| 959 | 3300053119 | Ga0500595_004108 | Ga0500595_004108_3055_3609 | 179 |
| 960 | 3300053119 | Ga0500595_015612 | Ga0500595_015612_786_1328 | 179 |
| 961 | 3300053122 | Ga0500608_051325 | Ga0500608_051325_1329_1871 | 179 |
| 962 | 3300053123 | Ga0500614_005280 | Ga0500614_005280_1156_1698 | 179 |
| 963 | 3300053130 | Ga0500642_0009622 | Ga0500642_0009622_703_1242 | 179 |
| 964 | 3300053136 | Ga0500559_0107274 | Ga0500559_0107274_449_991 | 179 |
| 965 | 3300053139 | Ga0500568_0008381 | Ga0500568_0008381_2451_2993 | 179 |
| 966 | 3300053150 | Ga0500603_000313 | Ga0500603_000313_11228_11797 | 179 |
| 967 | 3300053150 | Ga0500603_016677 | Ga0500603_016677_1157_1699 | 179 |
| 968 | 3300053154 | Ga0500619_187121 | Ga0500619_187121_15_557 | 179 |
| 969 | 3300053158 | Ga0500627_0208447 | Ga0500627_0208447_10_549 | 179 |
| 970 | 3300053159 | Ga0500630_001066 | Ga0500630_001066_12159_12701 | 179 |
| 971 | 3300053160 | Ga0500633_0209680 | Ga0500633_0209680_147_701 | 179 |
| 972 | 3300053162 | Ga0500638_002777 | Ga0500638_002777_731_1273 | 179 |
| 973 | 3300053162 | Ga0500638_003145 | Ga0500638_003145_2681_3223 | 179 |
| 974 | 3300053163 | Ga0500639_000072 | Ga0500639_000072_31088_31630 | 179 |
| 975 | 3300053163 | Ga0500639_104704 | Ga0500639_104704_331_873 | 179 |
| 976 | 3300053177 | Ga0500636_0039800 | Ga0500636_0039800_1891_2433 | 179 |
| 977 | 3300053178 | Ga0500637_0000065 | Ga0500637_0000065_30983_31525 | 179 |
| 978 | 3300053178 | Ga0500637_0002631 | Ga0500637_0002631_787_1356 | 179 |
| 979 | 3300053178 | Ga0500637_0059800 | Ga0500637_0059800_424_966 | 179 |
| 980 | 3300053178 | Ga0500637_0199894 | Ga0500637_0199894_467_1021 | 179 |
| 981 | 3300053724 | Ga0500570_033718 | Ga0500570_033718_346_885 | 179 |
| 982 | 3300053731 | Ga0500609_025955 | Ga0500609_025955_27_566 | 179 |
| 983 | 3300053735 | Ga0500596_036886 | Ga0500596_036886_116_658 | 179 |
| 984 | 3300054114 | Ga0501084_0003235 | Ga0501084_0003235_10278_10838 | 179 |
| 985 | 3300054114 | Ga0501084_0661451 | Ga0501084_0661451_191_745 | 179 |
| 986 | 3300055283 | Ga0500661_001927 | Ga0500661_001927_1332_1874 | 179 |
| 987 | 3300060353 | Ga0501082_0005376 | Ga0501082_0005376_655_1215 | 179 |
| 988 | iso_pu_bacteria | 8056681323 | 8056685530 | 179 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1sfe-assembly1.cif.gz_A | ada o6-methylguanine-dna methyltransferase from escherichia coli | 0.8754 | 1 | 170 |
| 1sfe-assembly1.cif.gz_A | ada o6-methylguanine-dna methyltransferase from escherichia coli | 0.8706 | 1 | 170 |
| 4zyd-assembly2.cif.gz_A-3 | crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase in complex with modified dna | 0.8589 | 4 | 171 |
| 7dqt-assembly1.cif.gz_A | crystal structure of o6-methylguanine methyltransferase y91f variant | 0.853 | 3 | 171 |
| 7e1p-assembly1.cif.gz_A | crystal structure of sulfurisphaera tokodaii o6-methylguanine methyltransferase c120s variant in complex with o6-methyldeoxyguanosine | 0.8517 | 3 | 171 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4DAC5_49_134_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.945 | 86 | 170 | 1.10.10.10 |
| 5llqB02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9231 | 85 | 170 | 1.10.10.10 |
| 5llqB02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9125 | 85 | 170 | 1.10.10.10 |
| af_Q4DAC5_49_134_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9034 | 86 | 170 | 1.10.10.10 |
| 1t39B01 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Methylated DNA-protein cysteine methyltransferase domain | 0.8983 | 5 | 28 | 3.30.160.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A431RJJ5-F1-model_v4 | deleted | 0.9872 | 2 | 133 |
|
| AF-A0A431RJJ5-F1-model_v4 | deleted | 0.9655 | 2 | 133 |
|
| AF-A0A2R7NXB5-F1-model_v4 | Cysteine methyltransferase | 0.9618 | 2 | 150 |
GO:0003908
GO:0006281 GO:0032259 |
| AF-K2CBI1-F1-model_v4 | Uncharacterized protein | 0.9558 | 2 | 121 |
GO:0003908
GO:0006281 |
| AF-A0A355UNV3-F1-model_v4 | Cysteine methyltransferase | 0.9542 | 2 | 168 |
GO:0003908
GO:0006281 GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar