F487568

General Info

Members Datasets Scaffolds Average Seq Length
988 462 948 181

Family's Representative Sequence

Representative Sequence 3300035113|Ga0373936_0113510|Ga0373936_0113510_382_936
Length 184
Sequence MTKGYALFDTAIGRCGIAWTSRGIVATCLPEADERRARVRLARRCPGGEEQTPPPAIQLVIDRVVALLRGAPDDLADVVLDMEAVPEFNARIYAIIRTIPPGETITYGEIAKRLGAVDARDVGQAMGQNPFPPIVPCHRVVAAGSKTGGFSARGGVATKLRMLAIEGAQVDGTLPLFEGPARQG

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
3 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
4 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
5 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
6 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
7 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
8 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
9 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
10 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
11 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
12 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
13 2791355199
14 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
15 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
16 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
17 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
18 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
19 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
20 2904699407
21 2906610324
22 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
23 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
24 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
25 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
26 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
27 2922425934
28 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
29 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
30 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
31 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
32 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
33 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
35 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
36 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
40 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
54 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
55 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
58 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
59 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
60 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
61 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
68 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
69 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
70 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
73 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
77 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
88 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
89 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
92 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
93 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
94 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
95 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
96 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
97 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
98 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
99 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
100 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
101 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
102 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
103 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
104 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
105 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
106 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
109 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
110 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
111 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
112 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
113 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
114 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
115 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
116 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
128 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
129 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
130 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
131 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
132 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
133 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
134 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
137 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
143 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
148 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
149 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
150 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
151 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
153 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
155 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
210 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
211 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
212 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
217 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
218 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
219 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
221 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
222 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
223 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
224 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
225 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
226 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
227 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
228 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
229 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
230 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
231 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
232 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
233 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
234 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
235 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
236 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
237 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
238 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
239 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
240 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
241 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
242 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
243 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
244 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
245 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
246 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
247 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
248 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
249 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
250 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
251 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
252 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
253 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
254 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
255 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
256 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
257 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
258 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
259 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
260 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
261 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
262 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
263 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
264 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
265 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
266 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
267 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
268 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
269 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
270 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
271 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
272 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
273 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
274 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
275 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
276 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
277 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
278 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
279 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
280 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
281 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
282 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
283 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
284 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
285 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
286 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
287 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
288 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
289 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
290 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
291 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
292 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
293 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
294 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
295 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
296 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
297 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
298 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
299 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
300 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
301 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
302 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
303 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
304 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
305 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
306 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
307 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
308 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
309 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
310 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
311 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
312 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
313 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
314 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
315 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
316 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
317 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
318 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
319 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
320 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
321 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
322 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
323 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
324 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
325 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
326 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
327 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
328 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
329 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
330 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
331 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
332 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
333 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
334 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
335 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
336 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
337 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
338 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
339 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
340 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
341 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
342 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
343 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
344 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
345 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
346 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
347 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
348 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
349 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
350 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
351 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
352 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
353 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
354 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
355 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
356 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
357 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
358 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
359 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
360 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
361 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
362 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
363 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
364 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
365 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
366 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
367 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
368 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
369 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
370 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
371 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
372 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
373 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
374 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
375 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
376 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
377 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
378 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
379 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
380 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
381 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
382 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
383 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
384 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
385 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
393 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
397 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
398 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
399 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
400 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
401 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
402 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
403 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
404 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
405 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
406 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
407 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
408 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
411 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
412 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
413 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
414 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
415 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
416 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
417 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
418 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
419 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
420 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
421 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
422 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
423 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
424 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
425 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
426 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
427 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
428 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
429 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
430 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
431 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
432 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
433 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
434 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
435 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
436 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
437 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
438 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
439 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
440 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
441 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
442 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
443 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
444 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
445 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
446 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
447 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
448 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
449 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
450 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
451 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
452 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
453 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
454 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
455 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
456 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
457 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
458 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
459 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
460 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
461 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
462 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.22
Metatranscriptomes 1.12
Isolates 3.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.81
Nodule 3.44
Rhizoplane 6.28
Rhizosphere 75.91
Stem 0
Stem Tuber 0
Unclassified 5.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10014265 3300003203 Bacteria 3383
2 JGI25165J46597_1008272 3300003214 Bacteria 1644
3 JGI25165J46597_1008905 3300003214 Bacteria 1541
4 JGI25153J46596_10001699 3300003215 Bacteria 13066
5 JGI25404J52841_10003242 3300003659 Bacteria 3191
6 JGI25404J52841_10007484 3300003659 Bacteria 2310
7 JGI25404J52841_10014463 3300003659 Bacteria 1713
8 JGI25404J52841_10049818 3300003659 Bacteria 881
9 Ga0070658_11094795 3300005327 Bacteria 693
10 Ga0070683_100008883 3300005329 Bacteria 8559
11 Ga0070683_100054636 3300005329 Bacteria 3703
12 Ga0070683_100067497 3300005329 Bacteria 3331
13 Ga0070677_10193451 3300005333 Bacteria 977
14 Ga0068869_100084996 3300005334 Bacteria 2369
15 Ga0070680_100003569 3300005336 Bacteria 11609
16 Ga0070680_100162622 3300005336 Bacteria 1876
17 Ga0070680_100239691 3300005336 Bacteria 1533
18 Ga0070682_100289771 3300005337 Bacteria 1197
19 Ga0070682_100290793 3300005337 Bacteria 1195
20 Ga0070660_100028691 3300005339 Bacteria 4165
21 Ga0070660_100068615 3300005339 Bacteria 2764
22 Ga0070660_100233401 3300005339 Bacteria 1497
23 Ga0070660_100484862 3300005339 Bacteria 1027
24 Ga0070689_100440846 3300005340 Bacteria 1107
25 Ga0070691_10122660 3300005341 Bacteria 1310
26 Ga0070661_100292591 3300005344 Bacteria 1266
27 Ga0070661_100391975 3300005344 Bacteria 1097
28 Ga0070661_100418671 3300005344 Bacteria 1062
29 Ga0070661_100954356 3300005344 Bacteria 710
30 Ga0070692_10298644 3300005345 Bacteria 983
31 Ga0070668_100047596 3300005347 Bacteria 3297
32 Ga0070675_100585633 3300005354 Bacteria 1011
33 Ga0070671_100053820 3300005355 Bacteria 3346
34 Ga0070671_100423394 3300005355 Bacteria 1140
35 Ga0070674_100100148 3300005356 Bacteria 2109
36 Ga0070674_100192112 3300005356 Bacteria 1571
37 Ga0070674_100224862 3300005356 Bacteria 1462
38 Ga0070673_100160820 3300005364 Bacteria 1910
39 Ga0070673_100226975 3300005364 Bacteria 1619
40 Ga0070688_100630186 3300005365 Bacteria 824
41 Ga0070688_100638242 3300005365 Bacteria 819
42 Ga0070703_10299701 3300005406 Bacteria 670
43 Ga0070709_10001461 3300005434 Bacteria 12746
44 Ga0070709_10113928 3300005434 Bacteria 1821
45 Ga0070714_100003988 3300005435 Bacteria 11098
46 Ga0070714_100614141 3300005435 Bacteria 1045
47 Ga0070714_100620482 3300005435 Bacteria 1039
48 Ga0070714_101262634 3300005435 Bacteria 721
49 Ga0070713_100009716 3300005436 Bacteria 6909
50 Ga0070713_100045353 3300005436 Bacteria 3602
51 Ga0070713_100130018 3300005436 Bacteria 2219
52 Ga0070713_100193726 3300005436 Bacteria 1833
53 Ga0070713_100700968 3300005436 Bacteria 966
54 Ga0070710_10001981 3300005437 Bacteria 9708
55 Ga0070710_10003702 3300005437 Bacteria 7230
56 Ga0070710_10013111 3300005437 Bacteria 4139
57 Ga0070710_10362886 3300005437 Bacteria 962
58 Ga0070701_10162548 3300005438 Bacteria 1294
59 Ga0070711_100010613 3300005439 Bacteria 5706
60 Ga0070711_100054947 3300005439 Bacteria 2749
61 Ga0070711_100071985 3300005439 Bacteria 2438
62 Ga0070708_100183380 3300005445 Bacteria 1957
63 Ga0070663_100016725 3300005455 Bacteria 4772
64 Ga0070663_100059739 3300005455 Bacteria 2740
65 Ga0070663_100124898 3300005455 Bacteria 1948
66 Ga0070663_100188644 3300005455 Bacteria 1603
67 Ga0070678_100046387 3300005456 Bacteria 3116
68 Ga0070678_100090590 3300005456 Bacteria 2345
69 Ga0070678_100506523 3300005456 Bacteria 1066
70 Ga0070662_100076746 3300005457 Bacteria 2477
71 Ga0070662_100968567 3300005457 Bacteria 728
72 Ga0070681_10015034 3300005458 Bacteria 7699
73 Ga0070681_10265153 3300005458 Bacteria 1629
74 Ga0070681_10304690 3300005458 Bacteria 1503
75 Ga0070681_10683269 3300005458 Bacteria 942
76 Ga0070681_10800358 3300005458 Bacteria 860
77 Ga0068867_100298380 3300005459 Bacteria 1327
78 Ga0068867_100655299 3300005459 Bacteria 922
79 Ga0070706_100406781 3300005467 Bacteria 1267
80 Ga0070707_100939000 3300005468 Bacteria 830
81 Ga0070698_100133500 3300005471 Bacteria 2437
82 Ga0070698_100377666 3300005471 Bacteria 1350
83 Ga0070698_101071959 3300005471 Bacteria 754
84 Ga0070699_101123042 3300005518 Bacteria 721
85 Ga0070679_100074282 3300005530 Bacteria 3390
86 Ga0070679_100094119 3300005530 Bacteria 2983
87 Ga0070679_100132475 3300005530 Bacteria 2474
88 Ga0070679_100340493 3300005530 Bacteria 1448
89 Ga0070679_100416144 3300005530 Bacteria 1290
90 Ga0070679_100963696 3300005530 Bacteria 797
91 Ga0070679_101120527 3300005530 Bacteria 732
92 Ga0070684_100016526 3300005535 Bacteria 6032
93 Ga0070684_100048824 3300005535 Bacteria 3672
94 Ga0070684_100376489 3300005535 Bacteria 1307
95 Ga0070684_100481690 3300005535 Bacteria 1148
96 Ga0070684_101056561 3300005535 Bacteria 763
97 Ga0070697_100071083 3300005536 Bacteria 2854
98 Ga0070697_100103553 3300005536 Bacteria 2366
99 Ga0070697_100986080 3300005536 Bacteria 749
100 Ga0068853_100214433 3300005539 Bacteria 1756
101 Ga0068853_100256064 3300005539 Bacteria 1608
102 Ga0068853_100416327 3300005539 Bacteria 1260
103 Ga0068853_100594557 3300005539 Bacteria 1050
104 Ga0068853_100654930 3300005539 Bacteria 1000
105 Ga0068853_101777931 3300005539 Bacteria 598
106 Ga0070672_100297365 3300005543 Bacteria 1368
107 Ga0070672_100600368 3300005543 Bacteria 959
108 Ga0070686_100145822 3300005544 Bacteria 1653
109 Ga0070686_100788786 3300005544 Bacteria 765
110 Ga0070693_100121665 3300005547 Bacteria 1619
111 Ga0070665_100009458 3300005548 Bacteria 9864
112 Ga0070665_100020723 3300005548 Bacteria 6606
113 Ga0070665_100046666 3300005548 Bacteria 4350
114 Ga0070665_100133651 3300005548 Bacteria 2483
115 Ga0070665_100156385 3300005548 Bacteria 2281
116 Ga0070665_100241352 3300005548 Bacteria 1807
117 Ga0070665_100620169 3300005548 Bacteria 1095
118 Ga0070704_101023742 3300005549 Bacteria 748
119 Ga0068855_100029909 3300005563 Bacteria 6513
120 Ga0068855_100065359 3300005563 Bacteria 4241
121 Ga0068855_100130860 3300005563 Bacteria 2866
122 Ga0068855_100136170 3300005563 Bacteria 2802
123 Ga0068855_100504877 3300005563 Bacteria 1314
124 Ga0068855_100633138 3300005563 Bacteria 1150
125 Ga0070664_100231912 3300005564 Bacteria 1655
126 Ga0068857_100005639 3300005577 Bacteria 10702
127 Ga0068857_100641834 3300005577 Bacteria 1006
128 Ga0068854_100005923 3300005578 Bacteria 7744
129 Ga0068854_101185061 3300005578 Bacteria 684
130 Ga0068856_100000476 3300005614 Bacteria 44310
131 Ga0068856_100416911 3300005614 Bacteria 1363
132 Ga0068856_100427182 3300005614 Bacteria 1345
133 Ga0068852_100276425 3300005616 Bacteria 1618
134 Ga0068864_100305057 3300005618 Bacteria 1491
135 Ga0068864_100536784 3300005618 Bacteria 1129
136 Ga0068866_11015432 3300005718 Bacteria 590
137 Ga0068861_100063011 3300005719 Bacteria 2849
138 Ga0068861_100434442 3300005719 Bacteria 1173
139 Ga0068870_10081819 3300005840 Bacteria 1787
140 Ga0068870_10086555 3300005840 Bacteria 1744
141 Ga0068858_100179452 3300005842 Bacteria 1999
142 Ga0068858_100201984 3300005842 Bacteria 1880
143 Ga0068858_100219487 3300005842 Bacteria 1800
144 Ga0068858_100857524 3300005842 Bacteria 887
145 Ga0081455_10008457 3300005937 Bacteria 10700
146 Ga0081455_10011371 3300005937 Bacteria 8946
147 Ga0081455_10071946 3300005937 Bacteria 2865
148 Ga0081455_10116310 3300005937 Bacteria 2115
149 Ga0081540_1005329 3300005983 Bacteria 9623
150 Ga0081540_1007078 3300005983 Bacteria 8062
151 Ga0081540_1007475 3300005983 Bacteria 7780
152 Ga0081540_1010016 3300005983 Bacteria 6451
153 Ga0081540_1016353 3300005983 Bacteria 4646
154 Ga0081540_1018434 3300005983 Bacteria 4281
155 Ga0081540_1027051 3300005983 Bacteria 3259
156 Ga0081540_1048885 3300005983 Bacteria 2115
157 Ga0081540_1053004 3300005983 Bacteria 1993
158 Ga0081540_1053054 3300005983 Bacteria 1991
159 Ga0081540_1069721 3300005983 Bacteria 1632
160 Ga0081539_10000425 3300005985 Bacteria 89942
161 Ga0081539_10037181 3300005985 Bacteria 2903
162 Ga0070717_10001915 3300006028 Bacteria 14544
163 Ga0075365_10037480 3300006038 Bacteria 3148
164 Ga0075365_10058983 3300006038 Bacteria 2556
165 Ga0075365_10096611 3300006038 Bacteria 2019
166 Ga0075365_10367306 3300006038 Bacteria 1015
167 Ga0075365_10399644 3300006038 Bacteria 970
168 Ga0075368_10034050 3300006042 Bacteria 1984
169 Ga0075368_10097895 3300006042 Bacteria 1203
170 Ga0075363_100000795 3300006048 Bacteria 10907
171 Ga0075363_100029297 3300006048 Bacteria 2840
172 Ga0075363_100072106 3300006048 Bacteria 1878
173 Ga0075364_10378811 3300006051 Bacteria 965
174 Ga0070715_10002928 3300006163 Bacteria 5333
175 Ga0070716_100017312 3300006173 Bacteria 3733
176 Ga0070716_100286211 3300006173 Bacteria 1140
177 Ga0070716_100525524 3300006173 Bacteria 877
178 Ga0070716_100820800 3300006173 Bacteria 722
179 Ga0070712_100254170 3300006175 Bacteria 1406
180 Ga0070712_100347031 3300006175 Bacteria 1214
181 Ga0070712_100388111 3300006175 Bacteria 1151
182 Ga0070712_100423449 3300006175 Bacteria 1104
183 Ga0070712_100980028 3300006175 Bacteria 731
184 Ga0075362_10102482 3300006177 Bacteria 1340
185 Ga0075367_10009759 3300006178 Bacteria 5027
186 Ga0075367_10026192 3300006178 Bacteria 3304
187 Ga0075367_10485489 3300006178 Bacteria 783
188 Ga0075369_10023467 3300006186 Bacteria 2550
189 Ga0075369_10467989 3300006186 Bacteria 598
190 Ga0075366_10186109 3300006195 Bacteria 1262
191 Ga0075370_10096836 3300006353 Bacteria 1706
192 Ga0075370_10714073 3300006353 Bacteria 610
193 Ga0068871_100158458 3300006358 Bacteria 1934
194 Ga0075428_100128792 3300006844 Bacteria 2753
195 Ga0075433_10781196 3300006852 Bacteria 835
196 Ga0068865_100100401 3300006881 Bacteria 2117
197 Ga0068865_100220495 3300006881 Bacteria 1482
198 Ga0068865_100245917 3300006881 Bacteria 1409
199 Ga0099825_1022556 3300006941 Bacteria 4040
200 Ga0099822_1024573 3300006943 Bacteria 5376
201 Ga0099794_10013122 3300007265 Bacteria 3598
202 Ga0099795_10144911 3300007788 Bacteria 969
203 Ga0105251_10300235 3300009011 Bacteria 728
204 Ga0105240_10031535 3300009093 Bacteria 6872
205 Ga0105240_10031799 3300009093 Bacteria 6838
206 Ga0105240_10581974 3300009093 Bacteria 1235
207 Ga0105245_10680866 3300009098 Bacteria 1060
208 Ga0105245_10755680 3300009098 Bacteria 1008
209 Ga0105245_10857082 3300009098 Bacteria 949
210 Ga0105247_10277217 3300009101 Bacteria 1155
211 Ga0114129_10043623 3300009147 Bacteria 6310
212 Ga0105241_10112909 3300009174 Bacteria 2177
213 Ga0105241_10578625 3300009174 Bacteria 1012
214 Ga0105242_10139169 3300009176 Bacteria 2104
215 Ga0105248_10329581 3300009177 Bacteria 1719
216 Ga0105237_10641939 3300009545 Bacteria 1068
217 Ga0105238_10007773 3300009551 Bacteria 10722
218 Ga0105238_10042015 3300009551 Bacteria 4630
219 Ga0105238_10334610 3300009551 Bacteria 1501
220 Ga0105238_10757486 3300009551 Bacteria 985
221 Ga0105249_10156611 3300009553 Bacteria 2197
222 Ga0105249_11010209 3300009553 Bacteria 901
223 Ga0105239_10013308 3300010375 Bacteria 9143
224 Ga0105239_10429826 3300010375 Bacteria 1497
225 Ga0105239_10971086 3300010375 Bacteria 976
226 Ga0105246_10316965 3300011119 Bacteria 1265
227 Ga0157373_10614708 3300013100 Bacteria 792
228 Ga0157370_10061297 3300013104 Bacteria 3570
229 Ga0157370_10079869 3300013104 Bacteria 3080
230 Ga0157370_10148369 3300013104 Bacteria 2183
231 Ga0157369_10012327 3300013105 Bacteria 9710
232 Ga0157369_10013199 3300013105 Bacteria 9350
233 Ga0157369_10113235 3300013105 Bacteria 2882
234 Ga0157369_10330348 3300013105 Bacteria 1584
235 Ga0157369_11026646 3300013105 Bacteria 844
236 Ga0157369_11154996 3300013105 Bacteria 791
237 Ga0157374_10513632 3300013296 Bacteria 1203
238 Ga0157374_10747123 3300013296 Bacteria 993
239 Ga0157374_10774577 3300013296 Bacteria 975
240 Ga0157378_11219616 3300013297 Bacteria 792
241 Ga0163162_10230968 3300013306 Bacteria 1981
242 Ga0163162_11868690 3300013306 Bacteria 687
243 Ga0157372_10452965 3300013307 Bacteria 1495
244 Ga0157372_10472819 3300013307 Bacteria 1461
245 Ga0157372_10556992 3300013307 Bacteria 1336
246 Ga0157375_11563882 3300013308 Bacteria 779
247 Ga0163163_10051682 3300014325 Bacteria 4051
248 Ga0163163_10066420 3300014325 Bacteria 3582
249 Ga0163163_11457722 3300014325 Bacteria 746
250 Ga0157380_10227116 3300014326 Bacteria 1674
251 Ga0157376_10443554 3300014969 Bacteria 1264
252 Ga0157376_11040123 3300014969 Bacteria 843
253 Ga0163161_10142698 3300017792 Bacteria 1814
254 Ga0197907_10482238 3300020069 Bacteria 873
255 Ga0197907_11225397 3300020069 Bacteria 706
256 Ga0206356_11267106 3300020070 Bacteria 767
257 Ga0206355_1215798 3300020076 Bacteria 706
258 Ga0206352_10436581 3300020078 Bacteria 755
259 Ga0206352_11357989 3300020078 Bacteria 661
260 Ga0206350_10949899 3300020080 Bacteria 703
261 Ga0206354_10068295 3300020081 Bacteria 721
262 Ga0206353_11967255 3300020082 Bacteria 1301
263 Ga0213873_10004591 3300021358 Bacteria 2591
264 Ga0213873_10009335 3300021358 Bacteria 2034
265 Ga0213876_10002064 3300021384 Bacteria 11899
266 Ga0213876_10031000 3300021384 Bacteria 2822
267 Ga0213875_10090152 3300021388 Bacteria 1430
268 Ga0213871_10000490 3300021441 Bacteria 5411
269 Ga0224712_10242241 3300022467 Bacteria 831
270 Ga0209233_1002779 3300025261 Bacteria 6291
271 Ga0209455_1011932 3300025272 Bacteria 2109
272 Ga0209758_1010528 3300025297 Bacteria 5516
273 Ga0209758_1025853 3300025297 Bacteria 2562
274 Ga0207653_10043757 3300025885 Bacteria 1475
275 Ga0207692_10002972 3300025898 Bacteria 6568
276 Ga0207692_10008204 3300025898 Bacteria 4317
277 Ga0207692_10030002 3300025898 Bacteria 2589
278 Ga0207642_10311043 3300025899 Bacteria 917
279 Ga0207688_10470209 3300025901 Bacteria 785
280 Ga0207680_10274615 3300025903 Bacteria 1170
281 Ga0207647_10076385 3300025904 Bacteria 2015
282 Ga0207647_10348943 3300025904 Bacteria 838
283 Ga0207685_10110293 3300025905 Bacteria 1192
284 Ga0207685_10451964 3300025905 Bacteria 668
285 Ga0207699_10005733 3300025906 Bacteria 5973
286 Ga0207699_10094679 3300025906 Bacteria 1882
287 Ga0207699_10527185 3300025906 Bacteria 855
288 Ga0207699_10794527 3300025906 Bacteria 695
289 Ga0207645_10111875 3300025907 Bacteria 1768
290 Ga0207645_10336235 3300025907 Bacteria 1009
291 Ga0207705_10134297 3300025909 Bacteria 1844
292 Ga0207705_11212792 3300025909 Bacteria 578
293 Ga0207654_10024224 3300025911 Bacteria 3261
294 Ga0207707_10002162 3300025912 Bacteria 17780
295 Ga0207707_10005294 3300025912 Bacteria 11286
296 Ga0207707_10404715 3300025912 Bacteria 1171
297 Ga0207707_10437690 3300025912 Bacteria 1119
298 Ga0207707_10661325 3300025912 Bacteria 880
299 Ga0207695_10027026 3300025913 Bacteria 6394
300 Ga0207695_10054704 3300025913 Bacteria 4165
301 Ga0207695_10085563 3300025913 Bacteria 3181
302 Ga0207695_10240938 3300025913 Bacteria 1710
303 Ga0207671_10012964 3300025914 Bacteria 6670
304 Ga0207671_10703067 3300025914 Bacteria 804
305 Ga0207671_11076284 3300025914 Bacteria 632
306 Ga0207693_10004007 3300025915 Bacteria 12519
307 Ga0207693_10009468 3300025915 Bacteria 7934
308 Ga0207693_10009993 3300025915 Bacteria 7715
309 Ga0207693_10063412 3300025915 Bacteria 2895
310 Ga0207693_10242502 3300025915 Bacteria 1415
311 Ga0207693_10344250 3300025915 Bacteria 1167
312 Ga0207663_10010172 3300025916 Bacteria 4995
313 Ga0207663_10056128 3300025916 Bacteria 2475
314 Ga0207663_10156346 3300025916 Bacteria 1604
315 Ga0207660_10161258 3300025917 Bacteria 1730
316 Ga0207660_10185538 3300025917 Bacteria 1617
317 Ga0207660_10286300 3300025917 Bacteria 1309
318 Ga0207660_10502286 3300025917 Bacteria 984
319 Ga0207657_10008647 3300025919 Bacteria 10306
320 Ga0207657_10228648 3300025919 Bacteria 1488
321 Ga0207657_10445895 3300025919 Bacteria 1016
322 Ga0207649_10176590 3300025920 Bacteria 1492
323 Ga0207649_10467497 3300025920 Bacteria 954
324 Ga0207649_10761871 3300025920 Bacteria 754
325 Ga0207652_10013564 3300025921 Bacteria 6591
326 Ga0207652_10039725 3300025921 Bacteria 3994
327 Ga0207652_10106404 3300025921 Bacteria 2483
328 Ga0207652_10177471 3300025921 Bacteria 1913
329 Ga0207652_10350452 3300025921 Bacteria 1332
330 Ga0207681_10273572 3300025923 Bacteria 1327
331 Ga0207694_10031537 3300025924 Bacteria 4049
332 Ga0207694_10048565 3300025924 Bacteria 3284
333 Ga0207694_10119947 3300025924 Bacteria 2099
334 Ga0207694_10234551 3300025924 Bacteria 1499
335 Ga0207694_10321344 3300025924 Bacteria 1277
336 Ga0207659_10551777 3300025926 Bacteria 979
337 Ga0207659_10675924 3300025926 Bacteria 883
338 Ga0207687_10013836 3300025927 Bacteria 5270
339 Ga0207687_10052637 3300025927 Bacteria 2842
340 Ga0207687_10286140 3300025927 Bacteria 1323
341 Ga0207700_10008050 3300025928 Bacteria 6500
342 Ga0207700_10078205 3300025928 Bacteria 2572
343 Ga0207700_10165094 3300025928 Bacteria 1842
344 Ga0207700_10392223 3300025928 Bacteria 1215
345 Ga0207700_10419375 3300025928 Bacteria 1175
346 Ga0207700_11304046 3300025928 Bacteria 647
347 Ga0207664_10010392 3300025929 Bacteria 6574
348 Ga0207664_11375967 3300025929 Bacteria 626
349 Ga0207690_10378503 3300025932 Bacteria 1124
350 Ga0207706_10317750 3300025933 Bacteria 1355
351 Ga0207686_10124640 3300025934 Bacteria 1759
352 Ga0207709_10022329 3300025935 Bacteria 3589
353 Ga0207709_10085086 3300025935 Bacteria 2049
354 Ga0207709_10291770 3300025935 Bacteria 1209
355 Ga0207709_10338661 3300025935 Bacteria 1131
356 Ga0207670_10407696 3300025936 Bacteria 1088
357 Ga0207669_10117923 3300025937 Bacteria 1795
358 Ga0207669_10491398 3300025937 Bacteria 980
359 Ga0207704_10123604 3300025938 Bacteria 1777
360 Ga0207704_10270825 3300025938 Bacteria 1286
361 Ga0207665_10002028 3300025939 Bacteria 13631
362 Ga0207665_10115974 3300025939 Bacteria 1887
363 Ga0207665_10205865 3300025939 Bacteria 1435
364 Ga0207665_10253265 3300025939 Bacteria 1302
365 Ga0207665_10558601 3300025939 Bacteria 890
366 Ga0207665_10590132 3300025939 Bacteria 867
367 Ga0207691_10482785 3300025940 Bacteria 1053
368 Ga0207711_10310988 3300025941 Bacteria 1455
369 Ga0207711_10611101 3300025941 Bacteria 1017
370 Ga0207689_10081964 3300025942 Bacteria 2652
371 Ga0207689_10593662 3300025942 Bacteria 931
372 Ga0207661_10004540 3300025944 Bacteria 9726
373 Ga0207661_10006444 3300025944 Bacteria 8298
374 Ga0207661_10501990 3300025944 Bacteria 1108
375 Ga0207661_10752271 3300025944 Bacteria 897
376 Ga0207667_10013617 3300025949 Bacteria 9297
377 Ga0207667_10029690 3300025949 Bacteria 5925
378 Ga0207667_10076087 3300025949 Bacteria 3484
379 Ga0207667_10496673 3300025949 Bacteria 1238
380 Ga0207667_10865519 3300025949 Bacteria 897
381 Ga0207712_10042423 3300025961 Bacteria 3132
382 Ga0207712_11173602 3300025961 Bacteria 685
383 Ga0207668_10062725 3300025972 Bacteria 2618
384 Ga0207668_10117798 3300025972 Bacteria 2005
385 Ga0207668_10487738 3300025972 Bacteria 1058
386 Ga0207640_10016570 3300025981 Bacteria 4290
387 Ga0207640_11113810 3300025981 Bacteria 699
388 Ga0207658_10329549 3300025986 Bacteria 1324
389 Ga0207658_11477781 3300025986 Bacteria 622
390 Ga0207677_10067541 3300026023 Bacteria 2505
391 Ga0207677_10378830 3300026023 Bacteria 1194
392 Ga0207703_10162751 3300026035 Bacteria 1956
393 Ga0207703_10656164 3300026035 Bacteria 996
394 Ga0207703_10746145 3300026035 Bacteria 933
395 Ga0207639_10031167 3300026041 Bacteria 3917
396 Ga0207639_10126624 3300026041 Bacteria 2108
397 Ga0207639_10271183 3300026041 Bacteria 1488
398 Ga0207639_10333333 3300026041 Bacteria 1351
399 Ga0207639_10391767 3300026041 Bacteria 1250
400 Ga0207678_10010954 3300026067 Bacteria 7969
401 Ga0207678_10045772 3300026067 Bacteria 3783
402 Ga0207678_10053837 3300026067 Bacteria 3467
403 Ga0207678_10066420 3300026067 Bacteria 3097
404 Ga0207678_10693967 3300026067 Bacteria 896
405 Ga0207702_10000514 3300026078 Bacteria 43618
406 Ga0207702_10624719 3300026078 Bacteria 1058
407 Ga0207648_10049340 3300026089 Bacteria 3683
408 Ga0207648_10525823 3300026089 Bacteria 1084
409 Ga0207676_10019625 3300026095 Bacteria 4934
410 Ga0207676_10512021 3300026095 Bacteria 1141
411 Ga0207674_10048184 3300026116 Bacteria 4362
412 Ga0207674_10521377 3300026116 Bacteria 1148
413 Ga0207675_100037613 3300026118 Bacteria 4513
414 Ga0207675_100070222 3300026118 Bacteria 3273
415 Ga0207683_10021505 3300026121 Bacteria 5525
416 Ga0207683_10128052 3300026121 Bacteria 2283
417 Ga0207683_10700350 3300026121 Bacteria 939
418 Ga0207683_11003797 3300026121 Bacteria 775
419 Ga0207698_10057798 3300026142 Bacteria 3003
420 Ga0207698_10469412 3300026142 Bacteria 1218
421 Ga0207698_10703187 3300026142 Bacteria 1006
422 Ga0209589_1000005 3300027357 Bacteria 530958
423 Ga0209489_100005 3300027361 Bacteria 530958
424 Ga0209700_100006 3300027363 Bacteria 530958
425 Ga0209179_1000570 3300027512 Bacteria 3866
426 Ga0209588_1046767 3300027671 Bacteria 1400
427 Ga0268266_10005838 3300028379 Bacteria 11389
428 Ga0268266_10156331 3300028379 Bacteria 2060
429 Ga0268266_10192118 3300028379 Bacteria 1864
430 Ga0268266_11375680 3300028379 Bacteria 681
431 Ga0268266_11655517 3300028379 Bacteria 615
432 Ga0268265_10268494 3300028380 Bacteria 1520
433 Ga0268265_10719307 3300028380 Bacteria 966
434 Ga0265334_10016514 3300028573 Bacteria 3053
435 Ga0307515_10054329 3300028794 Bacteria 5883
436 Ga0307515_10204476 3300028794 Bacteria 1840
437 Ga0307515_10763341 3300028794 Bacteria 587
438 Ga0307512_10301481 3300030522 Bacteria 746
439 Ga0265760_10084633 3300031090 Bacteria 986
440 Ga0265332_10008158 3300031238 Bacteria 4710
441 Ga0265328_10031392 3300031239 Bacteria 1974
442 Ga0265340_10018482 3300031247 Bacteria 3594
443 Ga0265339_10040049 3300031249 Bacteria 2606
444 Ga0265331_10101405 3300031250 Bacteria 1324
445 Ga0265316_10107714 3300031344 Bacteria 2113
446 Ga0265316_10271313 3300031344 Bacteria 1241
447 Ga0307513_10105798 3300031456 Bacteria 2821
448 Ga0307408_100853722 3300031548 Bacteria 830
449 Ga0307508_10045726 3300031616 Bacteria 3910
450 Ga0265314_10015497 3300031711 Bacteria 6048
451 Ga0265314_10061194 3300031711 Bacteria 2565
452 Ga0265314_10113147 3300031711 Bacteria 1721
453 Ga0265314_10124452 3300031711 Bacteria 1617
454 Ga0265342_10010500 3300031712 Bacteria 6417
455 Ga0265342_10036461 3300031712 Bacteria 3004
456 Ga0307516_10072595 3300031730 Bacteria 3300
457 Ga0307516_10075437 3300031730 Bacteria 3226
458 Ga0307516_10427281 3300031730 Bacteria 982
459 Ga0307413_10328219 3300031824 Bacteria 1172
460 Ga0307413_11040531 3300031824 Bacteria 704
461 Ga0307410_10783535 3300031852 Bacteria 810
462 Ga0307406_10443469 3300031901 Bacteria 1040
463 Ga0307406_10528755 3300031901 Bacteria 961
464 Ga0307406_10641596 3300031901 Bacteria 880
465 Ga0307412_10211313 3300031911 Bacteria 1481
466 Ga0307412_10508815 3300031911 Bacteria 1004
467 Ga0307416_100205834 3300032002 Bacteria 1872
468 Ga0307411_10305237 3300032005 Bacteria 1278
469 Ga0307415_100077941 3300032126 Bacteria 2355
470 Ga0307415_100258870 3300032126 Bacteria 1418
471 Ga0307415_100289060 3300032126 Bacteria 1352
472 Ga0307510_10005379 3300033180 Bacteria 15241
473 Ga0307510_10083698 3300033180 Bacteria 3078
474 Ga0307510_10315969 3300033180 Bacteria 1020
475 Ga0315911_1000015 3300033442 Bacteria 185247
476 Ga0373930_0102633 3300034816 Bacteria 681
477 Ga0373938_0059947 3300034957 Bacteria 888
478 Ga0373926_0127308 3300035083 Bacteria 963
479 Ga0373934_0008069 3300035086 Bacteria 3919
480 Ga0373934_0120402 3300035086 Bacteria 1067
481 Ga0373934_0171130 3300035086 Bacteria 892
482 Ga0373944_0176156 3300035089 Bacteria 765
483 Ga0373952_0105271 3300035092 Bacteria 749
484 Ga0373923_0010770 3300035111 Bacteria 3337
485 Ga0373923_0157577 3300035111 Bacteria 1034
486 Ga0373932_0068821 3300035112 Bacteria 1093
487 Ga0373936_0025118 3300035113 Bacteria 2328
488 Ga0373936_0044108 3300035113 Bacteria 1794
489 Ga0373936_0085085 3300035113 Bacteria 1320
490 Ga0373936_0113510 3300035113 Bacteria 1152
491 Ga0373941_0050835 3300035115 Bacteria 1317
492 Ga0373945_0015999 3300035116 Bacteria 2528
493 Ga0373953_0081691 3300035117 Bacteria 1344
494 Ga0373953_0128586 3300035117 Bacteria 1079
495 Ga0373953_0421904 3300035117 Bacteria 588
496 Ga0373954_0003254 3300035118 Bacteria 6857
497 Ga0373954_0013871 3300035118 Bacteria 3592
498 Ga0373954_0050144 3300035118 Bacteria 1958
499 Ga0373956_0244077 3300035119 Bacteria 854
500 Ga0373957_0161379 3300035120 Bacteria 923
501 Ga0373943_0077832 3300035170 Bacteria 1694
502 Ga0373943_0192461 3300035170 Bacteria 1125
503 Ga0373946_0055424 3300035171 Bacteria 1671
504 Ga0373946_0061132 3300035171 Bacteria 1603
505 Ga0373946_0192923 3300035171 Bacteria 972
506 Ga0373946_0193549 3300035171 Bacteria 971
507 Ga0373955_0019007 3300035172 Bacteria 3427
508 Ga0373955_0034453 3300035172 Bacteria 2674
509 Ga0373942_0136365 3300035207 Bacteria 778
510 Ga0373962_0060838 3300035242 Bacteria 1109
511 Ga0373924_0020154 3300035410 Bacteria 2589
512 Ga0373924_0071056 3300035410 Bacteria 1468
513 Ga0373931_0002294 3300035691 Bacteria 8454
514 Ga0373935_0012074 3300035692 Bacteria 5192
515 Ga0373935_0047436 3300035692 Bacteria 2716
516 Ga0373935_0107938 3300035692 Bacteria 1844
517 Ga0373935_0144774 3300035692 Bacteria 1608
518 Ga0373927_0012034 3300035695 Bacteria 5755
519 Ga0373927_0033415 3300035695 Bacteria 3349
520 Ga0373927_0187178 3300035695 Bacteria 1358
521 Ga0373927_0287620 3300035695 Bacteria 1082
522 Ga0373933_0000784 3300035724 Bacteria 19397
523 Ga0373933_0002702 3300035724 Bacteria 9936
524 Ga0373933_0024423 3300035724 Bacteria 3460
525 Ga0373933_0391771 3300035724 Bacteria 905
526 Ga0373933_0625609 3300035724 Bacteria 707
527 Ga0373933_0792884 3300035724 Bacteria 623
528 Ga0373947_0006075 3300035725 Bacteria 7038
529 Ga0373947_0018523 3300035725 Bacteria 4008
530 Ga0373947_0100020 3300035725 Bacteria 1821
531 Ga0373937_0013724 3300036401 Bacteria 7139
532 Ga0373937_0629745 3300036401 Bacteria 1018
533 Ga0373937_0678128 3300036401 Bacteria 977
534 Ga0373937_0915674 3300036401 Bacteria 825
535 Ga0373925_0028352 3300037068 Bacteria 4102
536 Ga0373925_0031318 3300037068 Bacteria 3908
537 Ga0373925_0062447 3300037068 Bacteria 2801
538 Ga0395899_0138645 3300037312 Bacteria 1732
539 Ga0395900_0049784 3300037418 Bacteria 4317
540 Ga0395900_0311332 3300037418 Bacteria 1558
541 Ga0395898_0055824 3300037466 Bacteria 3852
542 Ga0395898_0103771 3300037466 Bacteria 2727
543 Ga0395905_0069858 3300037471 Bacteria 3290
544 Ga0436364_0881658 3300037853 Bacteria 1656
545 Ga0436364_1111914 3300037853 Bacteria 2129
546 Ga0395901_0387541 3300038443 Bacteria 1437
547 Ga0436365_0564143 3300039437 Bacteria 2450
548 Ga0436365_0972944 3300039437 Bacteria 3362
549 Ga0436365_1342005 3300039437 Bacteria 11459
550 Ga0436365_1493072 3300039437 Bacteria 8985
551 Ga0436365_1883175 3300039437 Bacteria 1493
552 Ga0436360_0879024 3300039438 Bacteria 977
553 Ga0436361_0964292 3300039447 Bacteria 1654
554 Ga0436363_0039534 3300039450 Bacteria 3177
555 Ga0436363_0296726 3300039450 Bacteria 920
556 Ga0436363_0557724 3300039450 Bacteria 1048
557 Ga0436362_0009437 3300039453 Bacteria 1971
558 Ga0436362_0953067 3300039453 Bacteria 5962
559 Ga0439465_0020470 3300041413 Bacteria 2073
560 Ga0451833_0686916 3300041491 Bacteria 606
561 Ga0451839_0697962 3300041496 Bacteria 590
562 Ga0439459_0022873 3300042438 Bacteria 1213
563 Ga0466970_0255650 3300044765 Bacteria 982
564 Ga0466957_0059062 3300044842 Bacteria 2350
565 Ga0466957_0392866 3300044842 Bacteria 948
566 Ga0466959_0044336 3300045049 Bacteria 3278
567 Ga0466967_0101592 3300045976 Bacteria 2629
568 Ga0466967_0357537 3300045976 Bacteria 1414
569 Ga0466967_0432291 3300045976 Bacteria 1284
570 Ga0466967_0589444 3300045976 Bacteria 1096
571 Ga0466967_1495507 3300045976 Bacteria 673
572 Ga0495617_020141 3300046452 Bacteria 2254
573 Ga0495592_0057714 3300046454 Bacteria 2865
574 Ga0495592_0420691 3300046454 Bacteria 843
575 Ga0495603_0008752 3300046455 Bacteria 6120
576 Ga0495603_0049995 3300046455 Bacteria 2487
577 Ga0495603_0159059 3300046455 Bacteria 1310
578 Ga0495629_0002984 3300046459 Bacteria 12864
579 Ga0495629_0035847 3300046459 Bacteria 3504
580 Ga0495641_0018784 3300046461 Bacteria 3558
581 Ga0495651_0036567 3300046462 Bacteria 3823
582 Ga0495651_0060367 3300046462 Bacteria 2904
583 Ga0495653_0028021 3300046463 Bacteria 4508
584 Ga0495653_0232128 3300046463 Bacteria 1234
585 Ga0495653_0537577 3300046463 Bacteria 724
586 Ga0495650_0096464 3300046471 Bacteria 1116
587 Ga0495580_0098534 3300046472 Bacteria 2033
588 Ga0495582_0080477 3300046473 Bacteria 1809
589 Ga0495582_0282995 3300046473 Bacteria 952
590 Ga0495639_0003042 3300046475 Bacteria 7301
591 Ga0495639_0007837 3300046475 Bacteria 4591
592 Ga0495639_0042858 3300046475 Bacteria 2043
593 Ga0495639_0103382 3300046475 Bacteria 1347
594 Ga0495662_0034440 3300046476 Bacteria 2444
595 Ga0495662_0103228 3300046476 Bacteria 1395
596 Ga0495662_0114892 3300046476 Bacteria 1320
597 Ga0495664_0129187 3300046477 Bacteria 1529
598 Ga0495664_0156356 3300046477 Bacteria 1383
599 Ga0495594_0020690 3300046499 Bacteria 3506
600 Ga0495594_0096208 3300046499 Bacteria 1663
601 Ga0495594_0398184 3300046499 Bacteria 783
602 Ga0495594_0414886 3300046499 Bacteria 766
603 Ga0495596_0022344 3300046500 Bacteria 2576
604 Ga0495583_0112530 3300046506 Bacteria 1152
605 Ga0495606_0003350 3300046507 Bacteria 17079
606 Ga0495608_0183608 3300046511 Bacteria 1323
607 Ga0495608_0189832 3300046511 Bacteria 1297
608 Ga0495618_0054775 3300046514 Bacteria 2525
609 Ga0495618_0166821 3300046514 Bacteria 1402
610 Ga0495618_0253407 3300046514 Bacteria 1104
611 Ga0495620_0068670 3300046515 Bacteria 1455
612 Ga0495628_0018851 3300046516 Bacteria 5712
613 Ga0495628_0037867 3300046516 Bacteria 3864
614 Ga0495628_0076373 3300046516 Bacteria 2607
615 Ga0495628_0577615 3300046516 Bacteria 805
616 Ga0495630_0059721 3300046517 Bacteria 2861
617 Ga0495630_0098848 3300046517 Bacteria 2208
618 Ga0495630_0430695 3300046517 Bacteria 1011
619 Ga0495630_0762626 3300046517 Bacteria 739
620 Ga0495632_0158599 3300046519 Bacteria 1043
621 Ga0495632_0192772 3300046519 Bacteria 930
622 Ga0495632_0274205 3300046519 Bacteria 752
623 Ga0495644_0043821 3300046523 Bacteria 1683
624 Ga0495648_0005396 3300046524 Bacteria 10629
625 Ga0495666_0090625 3300046526 Bacteria 1443
626 Ga0495642_0041301 3300046528 Bacteria 1876
627 Ga0495652_0141008 3300046529 Bacteria 1895
628 Ga0495652_0273775 3300046529 Bacteria 1239
629 Ga0495652_0314817 3300046529 Bacteria 1133
630 Ga0495665_0048993 3300046531 Bacteria 2240
631 Ga0495665_0072348 3300046531 Bacteria 1816
632 Ga0495665_0260691 3300046531 Bacteria 891
633 Ga0495665_0289521 3300046531 Bacteria 840
634 Ga0495640_0031105 3300046533 Bacteria 3813
635 Ga0495640_0043124 3300046533 Bacteria 3143
636 Ga0495640_0197990 3300046533 Bacteria 1274
637 Ga0495640_0501708 3300046533 Bacteria 738
638 Ga0495586_0084345 3300046535 Bacteria 1749
639 Ga0495587_0070229 3300046536 Bacteria 2038
640 Ga0495609_0127835 3300046538 Bacteria 1090
641 Ga0495609_0128949 3300046538 Bacteria 1084
642 Ga0495645_0024397 3300046543 Bacteria 4388
643 Ga0495645_0187646 3300046543 Bacteria 1411
644 Ga0495622_0015653 3300046557 Bacteria 3526
645 Ga0495622_0035408 3300046557 Bacteria 2328
646 Ga0495667_0035702 3300046559 Bacteria 3321
647 Ga0495667_0122295 3300046559 Bacteria 1680
648 Ga0495667_0146376 3300046559 Bacteria 1521
649 Ga0495667_0785906 3300046559 Bacteria 587
650 Ga0495656_0137787 3300046615 Bacteria 1167
651 Ga0495656_0189032 3300046615 Bacteria 1016
652 Ga0495668_0464903 3300046616 Bacteria 696
653 Ga0495634_0005863 3300046642 Bacteria 9385
654 Ga0495634_0038694 3300046642 Bacteria 3251
655 Ga0495634_0096854 3300046642 Bacteria 1910
656 Ga0495634_0164285 3300046642 Bacteria 1398
657 Ga0495625_0621482 3300046660 Bacteria 646
658 Ga0495635_0004233 3300046663 Bacteria 9950
659 Ga0495635_0058430 3300046663 Bacteria 2653
660 Ga0495659_0008839 3300046664 Bacteria 3208
661 Ga0495659_0104801 3300046664 Bacteria 1099
662 Ga0495659_0250466 3300046664 Bacteria 738
663 Ga0495661_0195600 3300046665 Bacteria 1062
664 Ga0495588_0020627 3300046674 Bacteria 3242
665 Ga0495657_0025879 3300046675 Bacteria 4162
666 Ga0495657_0063786 3300046675 Bacteria 2429
667 Ga0495657_0327290 3300046675 Bacteria 910
668 Ga0495599_0018837 3300046678 Bacteria 4302
669 Ga0495599_0080476 3300046678 Bacteria 2034
670 Ga0495599_0145712 3300046678 Bacteria 1468
671 Ga0495623_0006324 3300046679 Bacteria 7698
672 Ga0495623_0238414 3300046679 Bacteria 1028
673 Ga0495646_0017450 3300046680 Bacteria 4553
674 Ga0495646_0046764 3300046680 Bacteria 2636
675 Ga0495646_0118960 3300046680 Bacteria 1496
676 Ga0495647_0013604 3300046681 Bacteria 2823
677 Ga0495647_0120523 3300046681 Bacteria 1103
678 Ga0495658_0087659 3300046683 Bacteria 1838
679 Ga0495658_0300810 3300046683 Bacteria 1015
680 Ga0495658_0348775 3300046683 Bacteria 941
681 Ga0495669_0006974 3300046684 Bacteria 4731
682 Ga0495669_0049594 3300046684 Bacteria 1880
683 Ga0495669_0118974 3300046684 Bacteria 1237
684 Ga0495613_0106646 3300046689 Bacteria 2021
685 Ga0495613_0213921 3300046689 Bacteria 1355
686 Ga0495613_0880490 3300046689 Bacteria 580
687 Ga0495624_0039316 3300046690 Bacteria 3033
688 Ga0495624_0130355 3300046690 Bacteria 1542
689 Ga0495624_0373061 3300046690 Bacteria 858
690 Ga0495670_0088380 3300046691 Bacteria 1584
691 Ga0495670_0112902 3300046691 Bacteria 1407
692 Ga0495589_0212256 3300046794 Bacteria 911
693 Ga0495600_0100555 3300046809 Bacteria 1885
694 Ga0495600_0240484 3300046809 Bacteria 1154
695 Ga0495600_0246640 3300046809 Bacteria 1137
696 Ga0495600_0777507 3300046809 Bacteria 572
697 Ga0495660_0233494 3300046810 Bacteria 861
698 Ga0495581_0022509 3300047315 Bacteria 3652
699 Ga0495581_0039231 3300047315 Bacteria 2741
700 Ga0495581_0056334 3300047315 Bacteria 2269
701 Ga0495581_0133443 3300047315 Bacteria 1447
702 Ga0495604_0093644 3300047317 Bacteria 2222
703 Ga0495604_0098991 3300047317 Bacteria 2147
704 Ga0495604_0103732 3300047317 Bacteria 2085
705 Ga0495604_0282157 3300047317 Bacteria 1122
706 Ga0495604_0417447 3300047317 Bacteria 881
707 Ga0495604_0430065 3300047317 Bacteria 865
708 Ga0495604_0459204 3300047317 Bacteria 831
709 Ga0495636_0050243 3300047318 Bacteria 1745
710 Ga0495674_0066189 3300047319 Bacteria 3136
711 Ga0495674_0087507 3300047319 Bacteria 2666
712 Ga0495674_0119336 3300047319 Bacteria 2229
713 Ga0495674_1008512 3300047319 Bacteria 638
714 Ga0495672_0053768 3300047320 Bacteria 2357
715 Ga0495672_0206616 3300047320 Bacteria 978
716 Ga0495676_0050003 3300047321 Bacteria 3356
717 Ga0495680_0152660 3300047322 Bacteria 1682
718 Ga0495680_0406147 3300047322 Bacteria 939
719 Ga0495675_0037487 3300047444 Bacteria 3087
720 Ga0495675_0039044 3300047444 Bacteria 3023
721 Ga0495675_0377973 3300047444 Bacteria 829
722 Ga0495679_063429 3300047446 Bacteria 1079
723 Ga0495673_0121565 3300047469 Bacteria 1034
724 Ga0495684_0008094 3300047471 Bacteria 8129
725 Ga0495684_0019268 3300047471 Bacteria 5253
726 Ga0495684_0079279 3300047471 Bacteria 2493
727 Ga0495684_0252110 3300047471 Bacteria 1284
728 Ga0495686_0122443 3300047472 Bacteria 1548
729 Ga0495686_0134394 3300047472 Bacteria 1464
730 Ga0495593_0032879 3300047673 Bacteria 2826
731 Ga0495593_0040757 3300047673 Bacteria 2499
732 Ga0495593_0049421 3300047673 Bacteria 2231
733 Ga0495593_0170222 3300047673 Bacteria 1098
734 Ga0495593_0283985 3300047673 Bacteria 828
735 Ga0495602_0061833 3300048088 Bacteria 3252
736 Ga0495602_0197811 3300048088 Bacteria 1536
737 Ga0495602_0288857 3300048088 Bacteria 1205
738 Ga0495614_0183994 3300048089 Bacteria 941
739 Ga0495614_0273504 3300048089 Bacteria 776
740 Ga0495615_0039676 3300048090 Bacteria 1169
741 Ga0495626_0218940 3300048091 Bacteria 774
742 Ga0496100_0241413 3300048903 Bacteria 1333
743 Ga0496101_0077541 3300048904 Bacteria 2449
744 Ga0496101_0181632 3300048904 Bacteria 1620
745 Ga0496101_0210619 3300048904 Bacteria 1506
746 Ga0496101_0642682 3300048904 Bacteria 838
747 Ga0496101_0975022 3300048904 Bacteria 667
748 Ga0496101_1009162 3300048904 Bacteria 654
749 Ga0496102_0084967 3300048905 Bacteria 2922
750 Ga0496102_0094275 3300048905 Bacteria 2774
751 Ga0496102_0129276 3300048905 Bacteria 2363
752 Ga0496102_0201988 3300048905 Bacteria 1874
753 Ga0496102_0481573 3300048905 Bacteria 1162
754 Ga0496102_0520590 3300048905 Bacteria 1112
755 Ga0496103_0107579 3300048906 Bacteria 1769
756 Ga0496104_0007678 3300048907 Bacteria 9549
757 Ga0496104_0140577 3300048907 Bacteria 2319
758 Ga0496104_0580447 3300048907 Bacteria 1031
759 Ga0496104_0622867 3300048907 Bacteria 989
760 Ga0496104_0687146 3300048907 Bacteria 931
761 Ga0496105_0097372 3300048908 Bacteria 2430
762 Ga0496105_0274728 3300048908 Bacteria 1360
763 Ga0496105_0439275 3300048908 Bacteria 1031
764 Ga0496105_0471756 3300048908 Bacteria 988
765 Ga0496106_0008768 3300048909 Bacteria 7473
766 Ga0496106_0057561 3300048909 Bacteria 2940
767 Ga0496106_0073480 3300048909 Bacteria 2616
768 Ga0496106_0090660 3300048909 Bacteria 2359
769 Ga0496107_0032726 3300048910 Bacteria 3717
770 Ga0496107_0222751 3300048910 Bacteria 1403
771 Ga0496107_0476306 3300048910 Bacteria 926
772 Ga0496108_0204509 3300048911 Bacteria 1713
773 Ga0496108_0223181 3300048911 Bacteria 1637
774 Ga0496109_0000469 3300048912 Bacteria 34339
775 Ga0496109_0944410 3300048912 Bacteria 800
776 Ga0496110_0011658 3300048913 Bacteria 7207
777 Ga0496110_0065763 3300048913 Bacteria 3206
778 Ga0496110_0284284 3300048913 Bacteria 1506
779 Ga0496110_0674586 3300048913 Bacteria 934
780 Ga0496110_0739849 3300048913 Bacteria 886
781 Ga0496111_0035057 3300048914 Bacteria 3585
782 Ga0496111_0084785 3300048914 Bacteria 2316
783 Ga0496111_0155210 3300048914 Bacteria 1698
784 Ga0496111_0873852 3300048914 Bacteria 648
785 Ga0496111_0979587 3300048914 Bacteria 606
786 Ga0496112_0000096 3300048915 Bacteria 57298
787 Ga0496112_0017876 3300048915 Bacteria 6673
788 Ga0496112_0111037 3300048915 Bacteria 2712
789 Ga0496112_0119746 3300048915 Bacteria 2602
790 Ga0496112_0119972 3300048915 Bacteria 2600
791 Ga0496112_0287859 3300048915 Bacteria 1589
792 Ga0496113_0119862 3300048916 Bacteria 2056
793 Ga0496113_0171286 3300048916 Bacteria 1719
794 Ga0496113_0244651 3300048916 Bacteria 1431
795 Ga0496114_0005276 3300048917 Bacteria 10097
796 Ga0496114_0326765 3300048917 Bacteria 1356
797 Ga0496114_0363577 3300048917 Bacteria 1280
798 Ga0496115_0019167 3300048918 Bacteria 5263
799 Ga0496115_0019415 3300048918 Bacteria 5230
800 Ga0496115_0044802 3300048918 Bacteria 3531
801 Ga0496115_0130697 3300048918 Bacteria 2069
802 Ga0496115_0583505 3300048918 Bacteria 890
803 Ga0496118_0136657 3300048921 Bacteria 1563
804 Ga0496118_0264262 3300048921 Bacteria 969
805 Ga0496119_0070230 3300048922 Bacteria 2055
806 Ga0496119_0123615 3300048922 Bacteria 1419
807 Ga0496119_0231188 3300048922 Bacteria 941
808 Ga0496121_0002453 3300048924 Bacteria 28353
809 Ga0496121_0084289 3300048924 Bacteria 2506
810 Ga0496121_0169347 3300048924 Bacteria 1589
811 Ga0496121_0448430 3300048924 Bacteria 832
812 Ga0496121_0568859 3300048924 Bacteria 706
813 Ga0496124_0160713 3300048927 Bacteria 1751
814 Ga0496125_0226979 3300048928 Bacteria 1198
815 Ga0496126_0056340 3300048929 Bacteria 3553
816 Ga0496126_0067172 3300048929 Bacteria 3204
817 Ga0496126_0111934 3300048929 Bacteria 2377
818 Ga0496126_0390298 3300048929 Bacteria 1131
819 Ga0496126_0509483 3300048929 Bacteria 960
820 Ga0495682_0150622 3300049460 Bacteria 830
821 Ga0501032_0000196 3300049569 Bacteria 50261
822 Ga0501032_0096066 3300049569 Bacteria 1964
823 Ga0501033_0003209 3300049570 Bacteria 13536
824 Ga0501033_0018168 3300049570 Bacteria 5313
825 Ga0501034_0001151 3300049571 Bacteria 36663
826 Ga0501034_0504125 3300049571 Bacteria 1124
827 Ga0501036_0000323 3300049572 Bacteria 33256
828 Ga0501036_0083448 3300049572 Bacteria 2701
829 Ga0501036_0607310 3300049572 Bacteria 907
830 Ga0501037_0001377 3300049573 Bacteria 17808
831 Ga0501037_0001630 3300049573 Bacteria 16306
832 Ga0501038_0001622 3300049574 Bacteria 20925
833 Ga0501039_0001302 3300049575 Bacteria 18240
834 Ga0501039_0258956 3300049575 Bacteria 1367
835 Ga0501039_0578651 3300049575 Bacteria 881
836 Ga0501042_0046374 3300049578 Bacteria 3098
837 Ga0501042_0137635 3300049578 Bacteria 1760
838 Ga0501043_0000409 3300049579 Bacteria 38657
839 Ga0501043_0017728 3300049579 Bacteria 5582
840 Ga0501046_0000181 3300049580 Bacteria 64035
841 Ga0501046_0060008 3300049580 Bacteria 2977
842 Ga0501047_0002426 3300049581 Bacteria 17808
843 Ga0501047_0062965 3300049581 Bacteria 3578
844 Ga0501047_0352826 3300049581 Bacteria 1307
845 Ga0501048_0003595 3300049582 Bacteria 11806
846 Ga0501067_0000145 3300049583 Bacteria 39277
847 Ga0501067_0023101 3300049583 Bacteria 3445
848 Ga0501067_0050454 3300049583 Bacteria 2306
849 Ga0501068_0002577 3300049584 Bacteria 9611
850 Ga0501069_0116733 3300049585 Bacteria 1522
851 Ga0501070_0003510 3300049586 Bacteria 13565
852 Ga0501070_0605189 3300049586 Bacteria 873
853 Ga0501071_0274480 3300049587 Bacteria 1275
854 Ga0501072_0017020 3300049588 Bacteria 5585
855 Ga0501073_0000027 3300049589 Bacteria 121860
856 Ga0501073_0039562 3300049589 Bacteria 3340
857 Ga0501074_0001347 3300049590 Bacteria 16291
858 Ga0501074_0146411 3300049590 Bacteria 1689
859 Ga0501079_0048138 3300049741 Bacteria 3290
860 Ga0501079_0751275 3300049741 Bacteria 768
861 Ga0501080_0002621 3300049742 Bacteria 15752
862 Ga0501080_0052129 3300049742 Bacteria 3808
863 Ga0501083_0002123 3300049744 Bacteria 13604
864 Ga0501035_0001852 3300049822 Bacteria 21281
865 Ga0501035_0005411 3300049822 Bacteria 12069
866 Ga0501044_0003498 3300049823 Bacteria 17680
867 Ga0501044_0035674 3300049823 Bacteria 5207
868 Ga0501044_0453947 3300049823 Bacteria 1188
869 Ga0501045_1042880 3300049824 Bacteria 599
870 nmdc:mga03683_147542_c1 3300050489 Bacteria 1060
871 nmdc:mga03683_266469_c1 3300050489 Bacteria 798
872 nmdc:mga03n38_415174_c1 3300050490 Bacteria 743
873 nmdc:mga03n38_98_c1 3300050490 Bacteria 19203
874 nmdc:mga00v17_134015_c1 3300050491 Bacteria 1585
875 nmdc:mga00v17_360989_c1 3300050491 Bacteria 944
876 nmdc:mga00v17_825617_c1 3300050491 Bacteria 590
877 nmdc:mga0yw44_134681_c1 3300050492 Bacteria 1602
878 nmdc:mga0yw44_375205_c1 3300050492 Bacteria 960
879 nmdc:mga0yw44_459536_c1 3300050492 Bacteria 863
880 nmdc:mga0yw44_6672_c1 3300050492 Bacteria 5602
881 nmdc:mga0k408_135893_c1 3300050493 Bacteria 1461
882 nmdc:mga0k408_219045_c1 3300050493 Bacteria 1136
883 nmdc:mga0k408_67583_c1 3300050493 Bacteria 2083
884 nmdc:mga06z11_114027_c1 3300050494 Bacteria 1500
885 nmdc:mga06z11_32996_c1 3300050494 Bacteria 2529
886 nmdc:mga06z11_342728_c1 3300050494 Bacteria 894
887 nmdc:mga06z11_37963_c1 3300050494 Bacteria 2389
888 nmdc:mga06z11_656518_c1 3300050494 Bacteria 639
889 nmdc:mga07m45_144674_c1 3300050496 Bacteria 1378
890 nmdc:mga07m45_9952_c2 3300050496 Bacteria 4350
891 nmdc:mga08y16_1190555_c1 3300050511 Bacteria 733
892 nmdc:mga0n895_1673395_c1 3300050512 Bacteria 599
893 nmdc:mga0n895_179818_c1 3300050512 Bacteria 2146
894 nmdc:mga0rr50_287390_c1 3300050513 Bacteria 1373
895 nmdc:mga08x19_815980_c1 3300050514 Bacteria 662
896 Ga0495601_0018892 3300053077 Bacteria 4199
897 Ga0495601_0023042 3300053077 Bacteria 3826
898 Ga0495601_0045290 3300053077 Bacteria 2766
899 Ga0495612_0050427 3300053078 Bacteria 1709
900 Ga0495612_0141603 3300053078 Bacteria 1043
901 Ga0495612_0266615 3300053078 Bacteria 764
902 Ga0500635_0003192 3300053080 Bacteria 4104
903 Ga0500635_0008969 3300053080 Bacteria 2760
904 Ga0495595_0051790 3300053084 Bacteria 1903
905 Ga0495619_0008712 3300053085 Bacteria 6416
906 Ga0495619_0052867 3300053085 Bacteria 2685
907 Ga0495619_0620895 3300053085 Bacteria 739
908 Ga0495619_0639291 3300053085 Bacteria 726
909 Ga0500578_0459676 3300053086 Bacteria 723
910 Ga0500566_0000207 3300053094 Bacteria 31105
911 Ga0500641_0001497 3300053096 Bacteria 8343
912 Ga0500641_0170350 3300053096 Bacteria 937
913 Ga0500654_137610 3300053099 Bacteria 902
914 Ga0500554_000856 3300053102 Bacteria 5978
915 Ga0500554_001256 3300053102 Bacteria 4908
916 Ga0500556_0017680 3300053104 Bacteria 2238
917 Ga0500572_000676 3300053111 Bacteria 11214
918 Ga0500595_000299 3300053119 Bacteria 32634
919 Ga0500595_003982 3300053119 Bacteria 6751
920 Ga0500595_004108 3300053119 Bacteria 6601
921 Ga0500595_015612 3300053119 Bacteria 2847
922 Ga0500608_051325 3300053122 Bacteria 1981
923 Ga0500614_005280 3300053123 Bacteria 2713
924 Ga0500642_0009622 3300053130 Bacteria 3365
925 Ga0500559_0107274 3300053136 Bacteria 1292
926 Ga0500568_0008381 3300053139 Bacteria 4985
927 Ga0500603_000313 3300053150 Bacteria 12755
928 Ga0500603_016677 3300053150 Bacteria 1746
929 Ga0500619_187121 3300053154 Bacteria 698
930 Ga0500627_0208447 3300053158 Bacteria 875
931 Ga0500630_001066 3300053159 Bacteria 12827
932 Ga0500633_0209680 3300053160 Bacteria 729
933 Ga0500638_002777 3300053162 Bacteria 6250
934 Ga0500638_003145 3300053162 Bacteria 6024
935 Ga0500639_000072 3300053163 Bacteria 46512
936 Ga0500639_104704 3300053163 Bacteria 1386
937 Ga0500636_0039800 3300053177 Bacteria 2781
938 Ga0500637_0000065 3300053178 Bacteria 37771
939 Ga0500637_0002631 3300053178 Bacteria 8033
940 Ga0500637_0059800 3300053178 Bacteria 2182
941 Ga0500637_0199894 3300053178 Bacteria 1139
942 Ga0500570_033718 3300053724 Bacteria 2745
943 Ga0500609_025955 3300053731 Bacteria 803
944 Ga0500596_036886 3300053735 Bacteria 771
945 Ga0501084_0003235 3300054114 Bacteria 13188
946 Ga0501084_0661451 3300054114 Bacteria 882
947 Ga0500661_001927 3300055283 Bacteria 3916
948 Ga0501082_0005376 3300060353 Bacteria 11113

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035113 Ga0373936_0113510 Ga0373936_0113510_382_936 176
2 3300035118 Ga0373954_0013871 Ga0373954_0013871_1251_1805 176
3 3300035692 Ga0373935_0144774 Ga0373935_0144774_659_1213 176
4 3300035724 Ga0373933_0625609 Ga0373933_0625609_90_644 176
5 3300035725 Ga0373947_0100020 Ga0373947_0100020_354_908 176
6 3300036401 Ga0373937_0629745 Ga0373937_0629745_265_819 176
7 3300037068 Ga0373925_0031318 Ga0373925_0031318_3235_3789 176
8 3300046473 Ga0495582_0282995 Ga0495582_0282995_227_781 176
9 3300046511 Ga0495608_0183608 Ga0495608_0183608_434_988 176
10 3300046517 Ga0495630_0430695 Ga0495630_0430695_375_929 176
11 3300046529 Ga0495652_0314817 Ga0495652_0314817_200_754 176
12 3300046642 Ga0495634_0164285 Ga0495634_0164285_286_840 176
13 3300046683 Ga0495658_0348775 Ga0495658_0348775_42_596 176
14 3300047317 Ga0495604_0430065 Ga0495604_0430065_189_743 176
15 3300047673 Ga0495593_0283985 Ga0495593_0283985_119_673 176
16 3300048088 Ga0495602_0197811 Ga0495602_0197811_621_1175 176
17 3300050513 nmdc:mga0rr50_287390_c1 nmdc:mga0rr50_287390_c1_305_862 176
18 3300053085 Ga0495619_0620895 Ga0495619_0620895_88_642 176
19 iso_pu_bacteria 2508501128 2509146428 176
20 iso_pu_bacteria 2513237096 2513656190 176
21 iso_pu_bacteria 2513237101 2513694665 176
22 iso_pu_bacteria 2513237137 2513860707 176
23 iso_pu_bacteria 2513237145 2513917630 176
24 iso_pu_bacteria 2517572143 2517887710 176
25 iso_pu_bacteria 2524023228 2524535376 176
26 iso_pu_bacteria 2667528175 2671120778 176
27 iso_pu_bacteria 2721755755 2723842483 176
28 iso_pu_bacteria 2728368998 2728748279 176
29 iso_pu_bacteria 2791355197 2793072902 176
30 iso_pu_bacteria 2791355199 2793078665 176
31 iso_pu_bacteria 2874604998 2874606830 176
32 iso_pu_bacteria 2876808645 2876818017 176
33 iso_pu_bacteria 2879110137 2879112257 176
34 iso_pu_bacteria 2885374607 2885382551 176
35 iso_pu_bacteria 2889033259 2889034245 176
36 iso_pu_bacteria 2903748898 2903753645 176
37 iso_pu_bacteria 2904699407 2904709570 176
38 iso_pu_bacteria 2906610324 2906612720 176
39 iso_pu_bacteria 2906635258 2906640552 176
40 iso_pu_bacteria 2906660503 2906663224 176
41 iso_pu_bacteria 2908739725 2908745916 176
42 iso_pu_bacteria 2922361189 2922367631 176
43 iso_pu_bacteria 2922386360 2922391606 176
44 iso_pu_bacteria 2922425934 2922433200 176
45 iso_pu_bacteria 2935630451 2935630603 176
46 iso_pu_bacteria 2941507105 2941507255 176
47 iso_pu_bacteria 2941515067 2941515682 176
48 iso_pu_bacteria 2941523033 2941523610 176
49 iso_pu_bacteria 3005474847 3005482797 176
50 iso_pu_bacteria 8006933436 8006935101 176
51 iso_pu_bacteria 8006964411 8006965372 176
52 iso_pu_bacteria 8006973647 8006975069 176
53 iso_pu_bacteria 8006984368 8006986084 176
54 iso_pu_bacteria 8019555841 8019563603 176
55 iso_pu_bacteria 8019565922 8019573672 176
56 iso_pu_bacteria 8056673599 8056678963 176
57 3300005434 Ga0070709_10001461 Ga0070709_1000146111 177
58 3300005435 Ga0070714_100003988 Ga0070714_1000039889 177
59 3300005436 Ga0070713_100193726 Ga0070713_1001937262 177
60 3300005437 Ga0070710_10001981 Ga0070710_1000198113 177
61 3300006175 Ga0070712_100423449 Ga0070712_1004234491 177
62 3300021358 Ga0213873_10009335 Ga0213873_100093351 177
63 3300021384 Ga0213876_10002064 Ga0213876_100020645 177
64 3300025898 Ga0207692_10002972 Ga0207692_100029726 177
65 3300025915 Ga0207693_10009468 Ga0207693_100094685 177
66 3300025928 Ga0207700_10165094 Ga0207700_101650942 177
67 3300025929 Ga0207664_10010392 Ga0207664_100103925 177
68 3300039437 Ga0436365_1342005 Ga0436365_1342005_5047_5589 177
69 3300039453 Ga0436362_0009437 Ga0436362_0009437_1265_1807 177
70 3300048924 Ga0496121_0448430 Ga0496121_0448430_18_560 177
71 3300048915 Ga0496112_0000096 Ga0496112_0000096_12670_13209 178
72 iso_pu_bacteria 2513237098 2513679750 178
73 3300003203 JGI25406J46586_10014265 JGI25406J46586_100142654 179
74 3300003214 JGI25165J46597_1008272 JGI25165J46597_10082722 179
75 3300003214 JGI25165J46597_1008905 JGI25165J46597_10089052 179
76 3300003215 JGI25153J46596_10001699 JGI25153J46596_1000169912 179
77 3300003659 JGI25404J52841_10003242 JGI25404J52841_100032423 179
78 3300003659 JGI25404J52841_10007484 JGI25404J52841_100074841 179
79 3300003659 JGI25404J52841_10014463 JGI25404J52841_100144632 179
80 3300003659 JGI25404J52841_10049818 JGI25404J52841_100498181 179
81 3300005327 Ga0070658_11094795 Ga0070658_110947951 179
82 3300005329 Ga0070683_100008883 Ga0070683_10000888311 179
83 3300005329 Ga0070683_100054636 Ga0070683_1000546363 179
84 3300005329 Ga0070683_100067497 Ga0070683_1000674973 179
85 3300005333 Ga0070677_10193451 Ga0070677_101934512 179
86 3300005334 Ga0068869_100084996 Ga0068869_1000849961 179
87 3300005336 Ga0070680_100003569 Ga0070680_1000035698 179
88 3300005336 Ga0070680_100162622 Ga0070680_1001626222 179
89 3300005336 Ga0070680_100239691 Ga0070680_1002396912 179
90 3300005337 Ga0070682_100289771 Ga0070682_1002897712 179
91 3300005337 Ga0070682_100290793 Ga0070682_1002907932 179
92 3300005339 Ga0070660_100028691 Ga0070660_1000286911 179
93 3300005339 Ga0070660_100068615 Ga0070660_1000686153 179
94 3300005339 Ga0070660_100233401 Ga0070660_1002334011 179
95 3300005339 Ga0070660_100484862 Ga0070660_1004848621 179
96 3300005340 Ga0070689_100440846 Ga0070689_1004408462 179
97 3300005341 Ga0070691_10122660 Ga0070691_101226602 179
98 3300005344 Ga0070661_100292591 Ga0070661_1002925912 179
99 3300005344 Ga0070661_100391975 Ga0070661_1003919751 179
100 3300005344 Ga0070661_100418671 Ga0070661_1004186712 179
101 3300005344 Ga0070661_100954356 Ga0070661_1009543561 179
102 3300005345 Ga0070692_10298644 Ga0070692_102986441 179
103 3300005347 Ga0070668_100047596 Ga0070668_1000475963 179
104 3300005354 Ga0070675_100585633 Ga0070675_1005856331 179
105 3300005355 Ga0070671_100053820 Ga0070671_1000538203 179
106 3300005355 Ga0070671_100423394 Ga0070671_1004233941 179
107 3300005356 Ga0070674_100100148 Ga0070674_1001001482 179
108 3300005356 Ga0070674_100192112 Ga0070674_1001921122 179
109 3300005356 Ga0070674_100224862 Ga0070674_1002248621 179
110 3300005364 Ga0070673_100160820 Ga0070673_1001608201 179
111 3300005364 Ga0070673_100226975 Ga0070673_1002269752 179
112 3300005365 Ga0070688_100630186 Ga0070688_1006301862 179
113 3300005365 Ga0070688_100638242 Ga0070688_1006382422 179
114 3300005406 Ga0070703_10299701 Ga0070703_102997011 179
115 3300005434 Ga0070709_10113928 Ga0070709_101139282 179
116 3300005435 Ga0070714_100614141 Ga0070714_1006141411 179
117 3300005435 Ga0070714_100620482 Ga0070714_1006204821 179
118 3300005435 Ga0070714_101262634 Ga0070714_1012626341 179
119 3300005436 Ga0070713_100009716 Ga0070713_1000097162 179
120 3300005436 Ga0070713_100045353 Ga0070713_1000453532 179
121 3300005436 Ga0070713_100130018 Ga0070713_1001300183 179
122 3300005436 Ga0070713_100700968 Ga0070713_1007009681 179
123 3300005437 Ga0070710_10003702 Ga0070710_100037027 179
124 3300005437 Ga0070710_10013111 Ga0070710_100131112 179
125 3300005437 Ga0070710_10362886 Ga0070710_103628861 179
126 3300005438 Ga0070701_10162548 Ga0070701_101625481 179
127 3300005439 Ga0070711_100010613 Ga0070711_1000106132 179
128 3300005439 Ga0070711_100054947 Ga0070711_1000549473 179
129 3300005439 Ga0070711_100071985 Ga0070711_1000719852 179
130 3300005445 Ga0070708_100183380 Ga0070708_1001833802 179
131 3300005455 Ga0070663_100016725 Ga0070663_1000167252 179
132 3300005455 Ga0070663_100059739 Ga0070663_1000597393 179
133 3300005455 Ga0070663_100124898 Ga0070663_1001248982 179
134 3300005455 Ga0070663_100188644 Ga0070663_1001886441 179
135 3300005456 Ga0070678_100046387 Ga0070678_1000463873 179
136 3300005456 Ga0070678_100090590 Ga0070678_1000905902 179
137 3300005456 Ga0070678_100506523 Ga0070678_1005065231 179
138 3300005457 Ga0070662_100076746 Ga0070662_1000767463 179
139 3300005457 Ga0070662_100968567 Ga0070662_1009685671 179
140 3300005458 Ga0070681_10015034 Ga0070681_100150346 179
141 3300005458 Ga0070681_10265153 Ga0070681_102651531 179
142 3300005458 Ga0070681_10304690 Ga0070681_103046901 179
143 3300005458 Ga0070681_10683269 Ga0070681_106832691 179
144 3300005458 Ga0070681_10800358 Ga0070681_108003581 179
145 3300005459 Ga0068867_100298380 Ga0068867_1002983802 179
146 3300005459 Ga0068867_100655299 Ga0068867_1006552991 179
147 3300005467 Ga0070706_100406781 Ga0070706_1004067811 179
148 3300005468 Ga0070707_100939000 Ga0070707_1009390001 179
149 3300005471 Ga0070698_100133500 Ga0070698_1001335002 179
150 3300005471 Ga0070698_100377666 Ga0070698_1003776662 179
151 3300005471 Ga0070698_101071959 Ga0070698_1010719591 179
152 3300005518 Ga0070699_101123042 Ga0070699_1011230421 179
153 3300005530 Ga0070679_100074282 Ga0070679_1000742822 179
154 3300005530 Ga0070679_100094119 Ga0070679_1000941191 179
155 3300005530 Ga0070679_100132475 Ga0070679_1001324752 179
156 3300005530 Ga0070679_100340493 Ga0070679_1003404931 179
157 3300005530 Ga0070679_100416144 Ga0070679_1004161442 179
158 3300005530 Ga0070679_100963696 Ga0070679_1009636961 179
159 3300005530 Ga0070679_101120527 Ga0070679_1011205271 179
160 3300005535 Ga0070684_100016526 Ga0070684_1000165267 179
161 3300005535 Ga0070684_100048824 Ga0070684_1000488243 179
162 3300005535 Ga0070684_100376489 Ga0070684_1003764892 179
163 3300005535 Ga0070684_100481690 Ga0070684_1004816902 179
164 3300005535 Ga0070684_101056561 Ga0070684_1010565611 179
165 3300005536 Ga0070697_100071083 Ga0070697_1000710832 179
166 3300005536 Ga0070697_100103553 Ga0070697_1001035531 179
167 3300005536 Ga0070697_100986080 Ga0070697_1009860801 179
168 3300005539 Ga0068853_100214433 Ga0068853_1002144332 179
169 3300005539 Ga0068853_100256064 Ga0068853_1002560641 179
170 3300005539 Ga0068853_100416327 Ga0068853_1004163273 179
171 3300005539 Ga0068853_100594557 Ga0068853_1005945571 179
172 3300005539 Ga0068853_100654930 Ga0068853_1006549301 179
173 3300005539 Ga0068853_101777931 Ga0068853_1017779311 179
174 3300005543 Ga0070672_100297365 Ga0070672_1002973652 179
175 3300005543 Ga0070672_100600368 Ga0070672_1006003682 179
176 3300005544 Ga0070686_100145822 Ga0070686_1001458222 179
177 3300005544 Ga0070686_100788786 Ga0070686_1007887861 179
178 3300005547 Ga0070693_100121665 Ga0070693_1001216652 179
179 3300005548 Ga0070665_100009458 Ga0070665_1000094582 179
180 3300005548 Ga0070665_100020723 Ga0070665_1000207233 179
181 3300005548 Ga0070665_100046666 Ga0070665_1000466664 179
182 3300005548 Ga0070665_100133651 Ga0070665_1001336512 179
183 3300005548 Ga0070665_100156385 Ga0070665_1001563852 179
184 3300005548 Ga0070665_100241352 Ga0070665_1002413522 179
185 3300005548 Ga0070665_100620169 Ga0070665_1006201691 179
186 3300005549 Ga0070704_101023742 Ga0070704_1010237421 179
187 3300005563 Ga0068855_100029909 Ga0068855_1000299096 179
188 3300005563 Ga0068855_100065359 Ga0068855_1000653593 179
189 3300005563 Ga0068855_100130860 Ga0068855_1001308602 179
190 3300005563 Ga0068855_100136170 Ga0068855_1001361701 179
191 3300005563 Ga0068855_100504877 Ga0068855_1005048772 179
192 3300005563 Ga0068855_100633138 Ga0068855_1006331381 179
193 3300005564 Ga0070664_100231912 Ga0070664_1002319122 179
194 3300005577 Ga0068857_100005639 Ga0068857_1000056399 179
195 3300005577 Ga0068857_100641834 Ga0068857_1006418342 179
196 3300005578 Ga0068854_100005923 Ga0068854_1000059238 179
197 3300005578 Ga0068854_101185061 Ga0068854_1011850611 179
198 3300005614 Ga0068856_100000476 Ga0068856_10000047641 179
199 3300005614 Ga0068856_100416911 Ga0068856_1004169112 179
200 3300005614 Ga0068856_100427182 Ga0068856_1004271822 179
201 3300005616 Ga0068852_100276425 Ga0068852_1002764252 179
202 3300005618 Ga0068864_100305057 Ga0068864_1003050572 179
203 3300005618 Ga0068864_100536784 Ga0068864_1005367842 179
204 3300005718 Ga0068866_11015432 Ga0068866_110154321 179
205 3300005719 Ga0068861_100063011 Ga0068861_1000630112 179
206 3300005719 Ga0068861_100434442 Ga0068861_1004344422 179
207 3300005840 Ga0068870_10081819 Ga0068870_100818192 179
208 3300005840 Ga0068870_10086555 Ga0068870_100865552 179
209 3300005842 Ga0068858_100179452 Ga0068858_1001794523 179
210 3300005842 Ga0068858_100201984 Ga0068858_1002019842 179
211 3300005842 Ga0068858_100219487 Ga0068858_1002194872 179
212 3300005842 Ga0068858_100857524 Ga0068858_1008575242 179
213 3300005937 Ga0081455_10008457 Ga0081455_1000845710 179
214 3300005937 Ga0081455_10011371 Ga0081455_100113717 179
215 3300005937 Ga0081455_10071946 Ga0081455_100719463 179
216 3300005937 Ga0081455_10116310 Ga0081455_101163102 179
217 3300005983 Ga0081540_1005329 Ga0081540_10053296 179
218 3300005983 Ga0081540_1007078 Ga0081540_10070786 179
219 3300005983 Ga0081540_1007475 Ga0081540_10074755 179
220 3300005983 Ga0081540_1010016 Ga0081540_10100168 179
221 3300005983 Ga0081540_1016353 Ga0081540_10163533 179
222 3300005983 Ga0081540_1018434 Ga0081540_10184341 179
223 3300005983 Ga0081540_1027051 Ga0081540_10270514 179
224 3300005983 Ga0081540_1048885 Ga0081540_10488853 179
225 3300005983 Ga0081540_1053004 Ga0081540_10530042 179
226 3300005983 Ga0081540_1053054 Ga0081540_10530543 179
227 3300005983 Ga0081540_1069721 Ga0081540_10697212 179
228 3300005985 Ga0081539_10000425 Ga0081539_100004252 179
229 3300005985 Ga0081539_10037181 Ga0081539_100371812 179
230 3300006028 Ga0070717_10001915 Ga0070717_100019156 179
231 3300006038 Ga0075365_10037480 Ga0075365_100374803 179
232 3300006038 Ga0075365_10058983 Ga0075365_100589833 179
233 3300006038 Ga0075365_10096611 Ga0075365_100966111 179
234 3300006038 Ga0075365_10367306 Ga0075365_103673062 179
235 3300006038 Ga0075365_10399644 Ga0075365_103996441 179
236 3300006042 Ga0075368_10034050 Ga0075368_100340502 179
237 3300006042 Ga0075368_10097895 Ga0075368_100978952 179
238 3300006048 Ga0075363_100000795 Ga0075363_1000007954 179
239 3300006048 Ga0075363_100029297 Ga0075363_1000292973 179
240 3300006048 Ga0075363_100072106 Ga0075363_1000721062 179
241 3300006051 Ga0075364_10378811 Ga0075364_103788111 179
242 3300006163 Ga0070715_10002928 Ga0070715_100029284 179
243 3300006173 Ga0070716_100017312 Ga0070716_1000173122 179
244 3300006173 Ga0070716_100286211 Ga0070716_1002862112 179
245 3300006173 Ga0070716_100525524 Ga0070716_1005255241 179
246 3300006173 Ga0070716_100820800 Ga0070716_1008208001 179
247 3300006175 Ga0070712_100254170 Ga0070712_1002541702 179
248 3300006175 Ga0070712_100347031 Ga0070712_1003470311 179
249 3300006175 Ga0070712_100388111 Ga0070712_1003881112 179
250 3300006175 Ga0070712_100980028 Ga0070712_1009800281 179
251 3300006177 Ga0075362_10102482 Ga0075362_101024822 179
252 3300006178 Ga0075367_10009759 Ga0075367_100097595 179
253 3300006178 Ga0075367_10026192 Ga0075367_100261924 179
254 3300006178 Ga0075367_10485489 Ga0075367_104854892 179
255 3300006186 Ga0075369_10023467 Ga0075369_100234673 179
256 3300006186 Ga0075369_10467989 Ga0075369_104679891 179
257 3300006195 Ga0075366_10186109 Ga0075366_101861092 179
258 3300006353 Ga0075370_10096836 Ga0075370_100968362 179
259 3300006353 Ga0075370_10714073 Ga0075370_107140731 179
260 3300006358 Ga0068871_100158458 Ga0068871_1001584582 179
261 3300006844 Ga0075428_100128792 Ga0075428_1001287923 179
262 3300006852 Ga0075433_10781196 Ga0075433_107811962 179
263 3300006881 Ga0068865_100100401 Ga0068865_1001004013 179
264 3300006881 Ga0068865_100220495 Ga0068865_1002204951 179
265 3300006881 Ga0068865_100245917 Ga0068865_1002459172 179
266 3300006941 Ga0099825_1022556 Ga0099825_10225565 179
267 3300006943 Ga0099822_1024573 Ga0099822_10245735 179
268 3300007265 Ga0099794_10013122 Ga0099794_100131223 179
269 3300007788 Ga0099795_10144911 Ga0099795_101449111 179
270 3300009011 Ga0105251_10300235 Ga0105251_103002351 179
271 3300009093 Ga0105240_10031535 Ga0105240_100315353 179
272 3300009093 Ga0105240_10031799 Ga0105240_100317992 179
273 3300009093 Ga0105240_10581974 Ga0105240_105819741 179
274 3300009098 Ga0105245_10680866 Ga0105245_106808661 179
275 3300009098 Ga0105245_10755680 Ga0105245_107556801 179
276 3300009098 Ga0105245_10857082 Ga0105245_108570822 179
277 3300009101 Ga0105247_10277217 Ga0105247_102772172 179
278 3300009147 Ga0114129_10043623 Ga0114129_100436234 179
279 3300009174 Ga0105241_10112909 Ga0105241_101129093 179
280 3300009174 Ga0105241_10578625 Ga0105241_105786251 179
281 3300009176 Ga0105242_10139169 Ga0105242_101391691 179
282 3300009177 Ga0105248_10329581 Ga0105248_103295812 179
283 3300009545 Ga0105237_10641939 Ga0105237_106419392 179
284 3300009551 Ga0105238_10007773 Ga0105238_1000777310 179
285 3300009551 Ga0105238_10042015 Ga0105238_100420154 179
286 3300009551 Ga0105238_10334610 Ga0105238_103346103 179
287 3300009551 Ga0105238_10757486 Ga0105238_107574862 179
288 3300009553 Ga0105249_10156611 Ga0105249_101566112 179
289 3300009553 Ga0105249_11010209 Ga0105249_110102091 179
290 3300010375 Ga0105239_10013308 Ga0105239_1001330810 179
291 3300010375 Ga0105239_10429826 Ga0105239_104298262 179
292 3300010375 Ga0105239_10971086 Ga0105239_109710861 179
293 3300011119 Ga0105246_10316965 Ga0105246_103169652 179
294 3300013100 Ga0157373_10614708 Ga0157373_106147081 179
295 3300013104 Ga0157370_10061297 Ga0157370_100612974 179
296 3300013104 Ga0157370_10079869 Ga0157370_100798693 179
297 3300013104 Ga0157370_10148369 Ga0157370_101483693 179
298 3300013105 Ga0157369_10012327 Ga0157369_1001232712 179
299 3300013105 Ga0157369_10013199 Ga0157369_1001319910 179
300 3300013105 Ga0157369_10113235 Ga0157369_101132354 179
301 3300013105 Ga0157369_10330348 Ga0157369_103303481 179
302 3300013105 Ga0157369_11026646 Ga0157369_110266461 179
303 3300013105 Ga0157369_11154996 Ga0157369_111549961 179
304 3300013296 Ga0157374_10513632 Ga0157374_105136322 179
305 3300013296 Ga0157374_10747123 Ga0157374_107471232 179
306 3300013296 Ga0157374_10774577 Ga0157374_107745772 179
307 3300013297 Ga0157378_11219616 Ga0157378_112196161 179
308 3300013306 Ga0163162_10230968 Ga0163162_102309682 179
309 3300013306 Ga0163162_11868690 Ga0163162_118686901 179
310 3300013307 Ga0157372_10452965 Ga0157372_104529652 179
311 3300013307 Ga0157372_10472819 Ga0157372_104728192 179
312 3300013307 Ga0157372_10556992 Ga0157372_105569922 179
313 3300013308 Ga0157375_11563882 Ga0157375_115638821 179
314 3300014325 Ga0163163_10051682 Ga0163163_100516821 179
315 3300014325 Ga0163163_10066420 Ga0163163_100664202 179
316 3300014325 Ga0163163_11457722 Ga0163163_114577221 179
317 3300014326 Ga0157380_10227116 Ga0157380_102271162 179
318 3300014969 Ga0157376_10443554 Ga0157376_104435542 179
319 3300014969 Ga0157376_11040123 Ga0157376_110401231 179
320 3300017792 Ga0163161_10142698 Ga0163161_101426983 179
321 3300020069 Ga0197907_10482238 Ga0197907_104822382 179
322 3300020069 Ga0197907_11225397 Ga0197907_112253971 179
323 3300020070 Ga0206356_11267106 Ga0206356_112671061 179
324 3300020076 Ga0206355_1215798 Ga0206355_12157981 179
325 3300020078 Ga0206352_10436581 Ga0206352_104365812 179
326 3300020078 Ga0206352_11357989 Ga0206352_113579891 179
327 3300020080 Ga0206350_10949899 Ga0206350_109498991 179
328 3300020081 Ga0206354_10068295 Ga0206354_100682951 179
329 3300020082 Ga0206353_11967255 Ga0206353_119672552 179
330 3300021358 Ga0213873_10004591 Ga0213873_100045912 179
331 3300021384 Ga0213876_10031000 Ga0213876_100310004 179
332 3300021388 Ga0213875_10090152 Ga0213875_100901521 179
333 3300021441 Ga0213871_10000490 Ga0213871_100004904 179
334 3300022467 Ga0224712_10242241 Ga0224712_102422411 179
335 3300025261 Ga0209233_1002779 Ga0209233_10027792 179
336 3300025272 Ga0209455_1011932 Ga0209455_10119323 179
337 3300025297 Ga0209758_1010528 Ga0209758_10105285 179
338 3300025297 Ga0209758_1025853 Ga0209758_10258533 179
339 3300025885 Ga0207653_10043757 Ga0207653_100437571 179
340 3300025898 Ga0207692_10008204 Ga0207692_100082044 179
341 3300025898 Ga0207692_10030002 Ga0207692_100300022 179
342 3300025899 Ga0207642_10311043 Ga0207642_103110432 179
343 3300025901 Ga0207688_10470209 Ga0207688_104702091 179
344 3300025903 Ga0207680_10274615 Ga0207680_102746152 179
345 3300025904 Ga0207647_10076385 Ga0207647_100763852 179
346 3300025904 Ga0207647_10348943 Ga0207647_103489431 179
347 3300025905 Ga0207685_10110293 Ga0207685_101102932 179
348 3300025905 Ga0207685_10451964 Ga0207685_104519641 179
349 3300025906 Ga0207699_10005733 Ga0207699_100057336 179
350 3300025906 Ga0207699_10094679 Ga0207699_100946791 179
351 3300025906 Ga0207699_10527185 Ga0207699_105271851 179
352 3300025906 Ga0207699_10794527 Ga0207699_107945271 179
353 3300025907 Ga0207645_10111875 Ga0207645_101118751 179
354 3300025907 Ga0207645_10336235 Ga0207645_103362351 179
355 3300025909 Ga0207705_10134297 Ga0207705_101342972 179
356 3300025909 Ga0207705_11212792 Ga0207705_112127921 179
357 3300025911 Ga0207654_10024224 Ga0207654_100242244 179
358 3300025912 Ga0207707_10002162 Ga0207707_1000216214 179
359 3300025912 Ga0207707_10005294 Ga0207707_100052946 179
360 3300025912 Ga0207707_10404715 Ga0207707_104047152 179
361 3300025912 Ga0207707_10437690 Ga0207707_104376901 179
362 3300025912 Ga0207707_10661325 Ga0207707_106613251 179
363 3300025913 Ga0207695_10027026 Ga0207695_100270262 179
364 3300025913 Ga0207695_10054704 Ga0207695_100547041 179
365 3300025913 Ga0207695_10085563 Ga0207695_100855634 179
366 3300025913 Ga0207695_10240938 Ga0207695_102409382 179
367 3300025914 Ga0207671_10012964 Ga0207671_100129648 179
368 3300025914 Ga0207671_10703067 Ga0207671_107030671 179
369 3300025914 Ga0207671_11076284 Ga0207671_110762841 179
370 3300025915 Ga0207693_10004007 Ga0207693_100040076 179
371 3300025915 Ga0207693_10009993 Ga0207693_100099938 179
372 3300025915 Ga0207693_10063412 Ga0207693_100634123 179
373 3300025915 Ga0207693_10242502 Ga0207693_102425022 179
374 3300025915 Ga0207693_10344250 Ga0207693_103442502 179
375 3300025916 Ga0207663_10010172 Ga0207663_100101723 179
376 3300025916 Ga0207663_10056128 Ga0207663_100561282 179
377 3300025916 Ga0207663_10156346 Ga0207663_101563462 179
378 3300025917 Ga0207660_10161258 Ga0207660_101612582 179
379 3300025917 Ga0207660_10185538 Ga0207660_101855381 179
380 3300025917 Ga0207660_10286300 Ga0207660_102863002 179
381 3300025917 Ga0207660_10502286 Ga0207660_105022862 179
382 3300025919 Ga0207657_10008647 Ga0207657_100086472 179
383 3300025919 Ga0207657_10228648 Ga0207657_102286482 179
384 3300025919 Ga0207657_10445895 Ga0207657_104458951 179
385 3300025920 Ga0207649_10176590 Ga0207649_101765902 179
386 3300025920 Ga0207649_10467497 Ga0207649_104674972 179
387 3300025920 Ga0207649_10761871 Ga0207649_107618711 179
388 3300025921 Ga0207652_10013564 Ga0207652_100135648 179
389 3300025921 Ga0207652_10039725 Ga0207652_100397254 179
390 3300025921 Ga0207652_10106404 Ga0207652_101064042 179
391 3300025921 Ga0207652_10177471 Ga0207652_101774713 179
392 3300025921 Ga0207652_10350452 Ga0207652_103504522 179
393 3300025923 Ga0207681_10273572 Ga0207681_102735721 179
394 3300025924 Ga0207694_10031537 Ga0207694_100315375 179
395 3300025924 Ga0207694_10048565 Ga0207694_100485651 179
396 3300025924 Ga0207694_10119947 Ga0207694_101199473 179
397 3300025924 Ga0207694_10234551 Ga0207694_102345512 179
398 3300025924 Ga0207694_10321344 Ga0207694_103213442 179
399 3300025926 Ga0207659_10551777 Ga0207659_105517772 179
400 3300025926 Ga0207659_10675924 Ga0207659_106759241 179
401 3300025927 Ga0207687_10013836 Ga0207687_100138363 179
402 3300025927 Ga0207687_10052637 Ga0207687_100526374 179
403 3300025927 Ga0207687_10286140 Ga0207687_102861402 179
404 3300025928 Ga0207700_10008050 Ga0207700_100080506 179
405 3300025928 Ga0207700_10078205 Ga0207700_100782053 179
406 3300025928 Ga0207700_10392223 Ga0207700_103922232 179
407 3300025928 Ga0207700_10419375 Ga0207700_104193753 179
408 3300025928 Ga0207700_11304046 Ga0207700_113040461 179
409 3300025929 Ga0207664_11375967 Ga0207664_113759671 179
410 3300025932 Ga0207690_10378503 Ga0207690_103785032 179
411 3300025933 Ga0207706_10317750 Ga0207706_103177501 179
412 3300025934 Ga0207686_10124640 Ga0207686_101246401 179
413 3300025935 Ga0207709_10022329 Ga0207709_100223295 179
414 3300025935 Ga0207709_10085086 Ga0207709_100850862 179
415 3300025935 Ga0207709_10291770 Ga0207709_102917701 179
416 3300025935 Ga0207709_10338661 Ga0207709_103386612 179
417 3300025936 Ga0207670_10407696 Ga0207670_104076962 179
418 3300025937 Ga0207669_10117923 Ga0207669_101179232 179
419 3300025937 Ga0207669_10491398 Ga0207669_104913982 179
420 3300025938 Ga0207704_10123604 Ga0207704_101236043 179
421 3300025938 Ga0207704_10270825 Ga0207704_102708252 179
422 3300025939 Ga0207665_10002028 Ga0207665_100020282 179
423 3300025939 Ga0207665_10115974 Ga0207665_101159742 179
424 3300025939 Ga0207665_10205865 Ga0207665_102058652 179
425 3300025939 Ga0207665_10253265 Ga0207665_102532652 179
426 3300025939 Ga0207665_10558601 Ga0207665_105586011 179
427 3300025939 Ga0207665_10590132 Ga0207665_105901321 179
428 3300025940 Ga0207691_10482785 Ga0207691_104827852 179
429 3300025941 Ga0207711_10310988 Ga0207711_103109881 179
430 3300025941 Ga0207711_10611101 Ga0207711_106111012 179
431 3300025942 Ga0207689_10081964 Ga0207689_100819643 179
432 3300025942 Ga0207689_10593662 Ga0207689_105936621 179
433 3300025944 Ga0207661_10004540 Ga0207661_100045402 179
434 3300025944 Ga0207661_10006444 Ga0207661_100064443 179
435 3300025944 Ga0207661_10501990 Ga0207661_105019902 179
436 3300025944 Ga0207661_10752271 Ga0207661_107522712 179
437 3300025949 Ga0207667_10013617 Ga0207667_1001361711 179
438 3300025949 Ga0207667_10029690 Ga0207667_100296903 179
439 3300025949 Ga0207667_10076087 Ga0207667_100760872 179
440 3300025949 Ga0207667_10496673 Ga0207667_104966731 179
441 3300025949 Ga0207667_10865519 Ga0207667_108655191 179
442 3300025961 Ga0207712_10042423 Ga0207712_100424232 179
443 3300025961 Ga0207712_11173602 Ga0207712_111736021 179
444 3300025972 Ga0207668_10062725 Ga0207668_100627253 179
445 3300025972 Ga0207668_10117798 Ga0207668_101177983 179
446 3300025972 Ga0207668_10487738 Ga0207668_104877382 179
447 3300025981 Ga0207640_10016570 Ga0207640_100165702 179
448 3300025981 Ga0207640_11113810 Ga0207640_111138101 179
449 3300025986 Ga0207658_10329549 Ga0207658_103295492 179
450 3300025986 Ga0207658_11477781 Ga0207658_114777811 179
451 3300026023 Ga0207677_10067541 Ga0207677_100675412 179
452 3300026023 Ga0207677_10378830 Ga0207677_103788302 179
453 3300026035 Ga0207703_10162751 Ga0207703_101627511 179
454 3300026035 Ga0207703_10656164 Ga0207703_106561642 179
455 3300026035 Ga0207703_10746145 Ga0207703_107461451 179
456 3300026041 Ga0207639_10031167 Ga0207639_100311671 179
457 3300026041 Ga0207639_10126624 Ga0207639_101266241 179
458 3300026041 Ga0207639_10271183 Ga0207639_102711832 179
459 3300026041 Ga0207639_10333333 Ga0207639_103333333 179
460 3300026041 Ga0207639_10391767 Ga0207639_103917671 179
461 3300026067 Ga0207678_10010954 Ga0207678_100109549 179
462 3300026067 Ga0207678_10045772 Ga0207678_100457723 179
463 3300026067 Ga0207678_10053837 Ga0207678_100538373 179
464 3300026067 Ga0207678_10066420 Ga0207678_100664203 179
465 3300026067 Ga0207678_10693967 Ga0207678_106939672 179
466 3300026078 Ga0207702_10000514 Ga0207702_1000051410 179
467 3300026078 Ga0207702_10624719 Ga0207702_106247191 179
468 3300026089 Ga0207648_10049340 Ga0207648_100493402 179
469 3300026089 Ga0207648_10525823 Ga0207648_105258231 179
470 3300026095 Ga0207676_10019625 Ga0207676_100196251 179
471 3300026095 Ga0207676_10512021 Ga0207676_105120212 179
472 3300026116 Ga0207674_10048184 Ga0207674_100481842 179
473 3300026116 Ga0207674_10521377 Ga0207674_105213771 179
474 3300026118 Ga0207675_100037613 Ga0207675_1000376135 179
475 3300026118 Ga0207675_100070222 Ga0207675_1000702221 179
476 3300026121 Ga0207683_10021505 Ga0207683_100215052 179
477 3300026121 Ga0207683_10128052 Ga0207683_101280523 179
478 3300026121 Ga0207683_10700350 Ga0207683_107003502 179
479 3300026121 Ga0207683_11003797 Ga0207683_110037971 179
480 3300026142 Ga0207698_10057798 Ga0207698_100577982 179
481 3300026142 Ga0207698_10469412 Ga0207698_104694121 179
482 3300026142 Ga0207698_10703187 Ga0207698_107031872 179
483 3300027357 Ga0209589_1000005 Ga0209589_100000512 179
484 3300027361 Ga0209489_100005 Ga0209489_10000512 179
485 3300027363 Ga0209700_100006 Ga0209700_10000612 179
486 3300027512 Ga0209179_1000570 Ga0209179_10005701 179
487 3300027671 Ga0209588_1046767 Ga0209588_10467672 179
488 3300028379 Ga0268266_10005838 Ga0268266_100058384 179
489 3300028379 Ga0268266_10156331 Ga0268266_101563312 179
490 3300028379 Ga0268266_10192118 Ga0268266_101921183 179
491 3300028379 Ga0268266_11375680 Ga0268266_113756801 179
492 3300028379 Ga0268266_11655517 Ga0268266_116555171 179
493 3300028380 Ga0268265_10268494 Ga0268265_102684942 179
494 3300028380 Ga0268265_10719307 Ga0268265_107193071 179
495 3300028573 Ga0265334_10016514 Ga0265334_100165142 179
496 3300028794 Ga0307515_10054329 Ga0307515_100543294 179
497 3300028794 Ga0307515_10204476 Ga0307515_102044762 179
498 3300028794 Ga0307515_10763341 Ga0307515_107633411 179
499 3300030522 Ga0307512_10301481 Ga0307512_103014811 179
500 3300031090 Ga0265760_10084633 Ga0265760_100846331 179
501 3300031238 Ga0265332_10008158 Ga0265332_100081584 179
502 3300031239 Ga0265328_10031392 Ga0265328_100313923 179
503 3300031247 Ga0265340_10018482 Ga0265340_100184824 179
504 3300031249 Ga0265339_10040049 Ga0265339_100400492 179
505 3300031250 Ga0265331_10101405 Ga0265331_101014052 179
506 3300031344 Ga0265316_10107714 Ga0265316_101077143 179
507 3300031344 Ga0265316_10271313 Ga0265316_102713132 179
508 3300031456 Ga0307513_10105798 Ga0307513_101057983 179
509 3300031548 Ga0307408_100853722 Ga0307408_1008537221 179
510 3300031616 Ga0307508_10045726 Ga0307508_100457262 179
511 3300031711 Ga0265314_10015497 Ga0265314_100154973 179
512 3300031711 Ga0265314_10061194 Ga0265314_100611943 179
513 3300031711 Ga0265314_10113147 Ga0265314_101131471 179
514 3300031711 Ga0265314_10124452 Ga0265314_101244522 179
515 3300031712 Ga0265342_10010500 Ga0265342_100105008 179
516 3300031712 Ga0265342_10036461 Ga0265342_100364614 179
517 3300031730 Ga0307516_10072595 Ga0307516_100725953 179
518 3300031730 Ga0307516_10075437 Ga0307516_100754374 179
519 3300031730 Ga0307516_10427281 Ga0307516_104272811 179
520 3300031824 Ga0307413_10328219 Ga0307413_103282192 179
521 3300031824 Ga0307413_11040531 Ga0307413_110405311 179
522 3300031852 Ga0307410_10783535 Ga0307410_107835351 179
523 3300031901 Ga0307406_10443469 Ga0307406_104434691 179
524 3300031901 Ga0307406_10528755 Ga0307406_105287552 179
525 3300031901 Ga0307406_10641596 Ga0307406_106415962 179
526 3300031911 Ga0307412_10211313 Ga0307412_102113132 179
527 3300031911 Ga0307412_10508815 Ga0307412_105088152 179
528 3300032002 Ga0307416_100205834 Ga0307416_1002058342 179
529 3300032005 Ga0307411_10305237 Ga0307411_103052371 179
530 3300032126 Ga0307415_100077941 Ga0307415_1000779412 179
531 3300032126 Ga0307415_100258870 Ga0307415_1002588702 179
532 3300032126 Ga0307415_100289060 Ga0307415_1002890601 179
533 3300033180 Ga0307510_10005379 Ga0307510_1000537914 179
534 3300033180 Ga0307510_10083698 Ga0307510_100836982 179
535 3300033180 Ga0307510_10315969 Ga0307510_103159692 179
536 3300033442 Ga0315911_1000015 Ga0315911_100001523 179
537 3300034816 Ga0373930_0102633 Ga0373930_0102633_46_588 179
538 3300034957 Ga0373938_0059947 Ga0373938_0059947_271_813 179
539 3300035083 Ga0373926_0127308 Ga0373926_0127308_62_604 179
540 3300035086 Ga0373934_0008069 Ga0373934_0008069_558_1100 179
541 3300035086 Ga0373934_0120402 Ga0373934_0120402_306_848 179
542 3300035086 Ga0373934_0171130 Ga0373934_0171130_313_855 179
543 3300035089 Ga0373944_0176156 Ga0373944_0176156_57_599 179
544 3300035092 Ga0373952_0105271 Ga0373952_0105271_173_715 179
545 3300035111 Ga0373923_0010770 Ga0373923_0010770_1501_2043 179
546 3300035111 Ga0373923_0157577 Ga0373923_0157577_41_583 179
547 3300035112 Ga0373932_0068821 Ga0373932_0068821_74_616 179
548 3300035113 Ga0373936_0025118 Ga0373936_0025118_72_614 179
549 3300035113 Ga0373936_0044108 Ga0373936_0044108_668_1210 179
550 3300035113 Ga0373936_0085085 Ga0373936_0085085_520_1062 179
551 3300035115 Ga0373941_0050835 Ga0373941_0050835_579_1121 179
552 3300035116 Ga0373945_0015999 Ga0373945_0015999_947_1489 179
553 3300035117 Ga0373953_0081691 Ga0373953_0081691_148_690 179
554 3300035117 Ga0373953_0128586 Ga0373953_0128586_355_897 179
555 3300035117 Ga0373953_0421904 Ga0373953_0421904_11_553 179
556 3300035118 Ga0373954_0003254 Ga0373954_0003254_1213_1755 179
557 3300035118 Ga0373954_0050144 Ga0373954_0050144_331_873 179
558 3300035119 Ga0373956_0244077 Ga0373956_0244077_157_699 179
559 3300035120 Ga0373957_0161379 Ga0373957_0161379_294_836 179
560 3300035170 Ga0373943_0077832 Ga0373943_0077832_333_875 179
561 3300035170 Ga0373943_0192461 Ga0373943_0192461_108_650 179
562 3300035171 Ga0373946_0055424 Ga0373946_0055424_720_1262 179
563 3300035171 Ga0373946_0061132 Ga0373946_0061132_689_1231 179
564 3300035171 Ga0373946_0192923 Ga0373946_0192923_203_745 179
565 3300035171 Ga0373946_0193549 Ga0373946_0193549_188_757 179
566 3300035172 Ga0373955_0019007 Ga0373955_0019007_482_1024 179
567 3300035172 Ga0373955_0034453 Ga0373955_0034453_2082_2624 179
568 3300035207 Ga0373942_0136365 Ga0373942_0136365_36_578 179
569 3300035242 Ga0373962_0060838 Ga0373962_0060838_361_903 179
570 3300035410 Ga0373924_0020154 Ga0373924_0020154_944_1486 179
571 3300035410 Ga0373924_0071056 Ga0373924_0071056_649_1191 179
572 3300035691 Ga0373931_0002294 Ga0373931_0002294_2348_2890 179
573 3300035692 Ga0373935_0012074 Ga0373935_0012074_4099_4641 179
574 3300035692 Ga0373935_0047436 Ga0373935_0047436_1088_1630 179
575 3300035692 Ga0373935_0107938 Ga0373935_0107938_196_738 179
576 3300035695 Ga0373927_0012034 Ga0373927_0012034_3543_4097 179
577 3300035695 Ga0373927_0033415 Ga0373927_0033415_1877_2419 179
578 3300035695 Ga0373927_0187178 Ga0373927_0187178_713_1273 179
579 3300035695 Ga0373927_0287620 Ga0373927_0287620_84_626 179
580 3300035724 Ga0373933_0000784 Ga0373933_0000784_6768_7310 179
581 3300035724 Ga0373933_0002702 Ga0373933_0002702_490_1032 179
582 3300035724 Ga0373933_0024423 Ga0373933_0024423_1919_2461 179
583 3300035724 Ga0373933_0391771 Ga0373933_0391771_333_875 179
584 3300035724 Ga0373933_0792884 Ga0373933_0792884_27_569 179
585 3300035725 Ga0373947_0006075 Ga0373947_0006075_3703_4245 179
586 3300035725 Ga0373947_0018523 Ga0373947_0018523_2701_3243 179
587 3300036401 Ga0373937_0013724 Ga0373937_0013724_3215_3757 179
588 3300036401 Ga0373937_0678128 Ga0373937_0678128_366_908 179
589 3300036401 Ga0373937_0915674 Ga0373937_0915674_151_693 179
590 3300037068 Ga0373925_0028352 Ga0373925_0028352_3499_4068 179
591 3300037068 Ga0373925_0062447 Ga0373925_0062447_1686_2228 179
592 3300037312 Ga0395899_0138645 Ga0395899_0138645_74_616 179
593 3300037418 Ga0395900_0049784 Ga0395900_0049784_1975_2517 179
594 3300037418 Ga0395900_0311332 Ga0395900_0311332_804_1346 179
595 3300037466 Ga0395898_0055824 Ga0395898_0055824_531_1124 179
596 3300037466 Ga0395898_0103771 Ga0395898_0103771_1816_2358 179
597 3300037471 Ga0395905_0069858 Ga0395905_0069858_159_701 179
598 3300037853 Ga0436364_0881658 Ga0436364_0881658_475_1044 179
599 3300037853 Ga0436364_1111914 Ga0436364_1111914_834_1379 179
600 3300038443 Ga0395901_0387541 Ga0395901_0387541_186_779 179
601 3300039437 Ga0436365_0564143 Ga0436365_0564143_43_606 179
602 3300039437 Ga0436365_0972944 Ga0436365_0972944_116_661 179
603 3300039437 Ga0436365_1493072 Ga0436365_1493072_3523_4065 179
604 3300039437 Ga0436365_1883175 Ga0436365_1883175_759_1301 179
605 3300039438 Ga0436360_0879024 Ga0436360_0879024_278_820 179
606 3300039447 Ga0436361_0964292 Ga0436361_0964292_1003_1557 179
607 3300039450 Ga0436363_0039534 Ga0436363_0039534_172_714 179
608 3300039450 Ga0436363_0296726 Ga0436363_0296726_215_757 179
609 3300039450 Ga0436363_0557724 Ga0436363_0557724_378_920 179
610 3300039453 Ga0436362_0953067 Ga0436362_0953067_2892_3446 179
611 3300041413 Ga0439465_0020470 Ga0439465_0020470_366_920 179
612 3300041491 Ga0451833_0686916 Ga0451833_0686916_21_563 179
613 3300041496 Ga0451839_0697962 Ga0451839_0697962_34_576 179
614 3300042438 Ga0439459_0022873 Ga0439459_0022873_565_1119 179
615 3300044765 Ga0466970_0255650 Ga0466970_0255650_216_758 179
616 3300044842 Ga0466957_0059062 Ga0466957_0059062_1631_2173 179
617 3300044842 Ga0466957_0392866 Ga0466957_0392866_293_835 179
618 3300045049 Ga0466959_0044336 Ga0466959_0044336_348_890 179
619 3300045976 Ga0466967_0101592 Ga0466967_0101592_663_1205 179
620 3300045976 Ga0466967_0357537 Ga0466967_0357537_389_931 179
621 3300045976 Ga0466967_0432291 Ga0466967_0432291_551_1123 179
622 3300045976 Ga0466967_0589444 Ga0466967_0589444_437_979 179
623 3300045976 Ga0466967_1495507 Ga0466967_1495507_13_555 179
624 3300046452 Ga0495617_020141 Ga0495617_020141_972_1514 179
625 3300046454 Ga0495592_0057714 Ga0495592_0057714_1138_1680 179
626 3300046454 Ga0495592_0420691 Ga0495592_0420691_187_729 179
627 3300046455 Ga0495603_0008752 Ga0495603_0008752_3766_4308 179
628 3300046455 Ga0495603_0049995 Ga0495603_0049995_1033_1575 179
629 3300046455 Ga0495603_0159059 Ga0495603_0159059_77_619 179
630 3300046459 Ga0495629_0002984 Ga0495629_0002984_2269_2811 179
631 3300046459 Ga0495629_0035847 Ga0495629_0035847_90_632 179
632 3300046461 Ga0495641_0018784 Ga0495641_0018784_2128_2670 179
633 3300046462 Ga0495651_0036567 Ga0495651_0036567_1164_1706 179
634 3300046462 Ga0495651_0060367 Ga0495651_0060367_2340_2882 179
635 3300046463 Ga0495653_0028021 Ga0495653_0028021_3257_3799 179
636 3300046463 Ga0495653_0232128 Ga0495653_0232128_250_792 179
637 3300046463 Ga0495653_0537577 Ga0495653_0537577_36_578 179
638 3300046471 Ga0495650_0096464 Ga0495650_0096464_120_674 179
639 3300046472 Ga0495580_0098534 Ga0495580_0098534_105_647 179
640 3300046473 Ga0495582_0080477 Ga0495582_0080477_667_1209 179
641 3300046475 Ga0495639_0003042 Ga0495639_0003042_4028_4570 179
642 3300046475 Ga0495639_0007837 Ga0495639_0007837_3031_3573 179
643 3300046475 Ga0495639_0042858 Ga0495639_0042858_80_622 179
644 3300046475 Ga0495639_0103382 Ga0495639_0103382_212_766 179
645 3300046476 Ga0495662_0034440 Ga0495662_0034440_1813_2355 179
646 3300046476 Ga0495662_0103228 Ga0495662_0103228_35_577 179
647 3300046476 Ga0495662_0114892 Ga0495662_0114892_758_1300 179
648 3300046477 Ga0495664_0129187 Ga0495664_0129187_628_1170 179
649 3300046477 Ga0495664_0156356 Ga0495664_0156356_250_792 179
650 3300046499 Ga0495594_0020690 Ga0495594_0020690_916_1458 179
651 3300046499 Ga0495594_0096208 Ga0495594_0096208_1085_1627 179
652 3300046499 Ga0495594_0398184 Ga0495594_0398184_100_669 179
653 3300046499 Ga0495594_0414886 Ga0495594_0414886_22_576 179
654 3300046500 Ga0495596_0022344 Ga0495596_0022344_285_827 179
655 3300046506 Ga0495583_0112530 Ga0495583_0112530_585_1127 179
656 3300046507 Ga0495606_0003350 Ga0495606_0003350_10021_10563 179
657 3300046511 Ga0495608_0189832 Ga0495608_0189832_570_1112 179
658 3300046514 Ga0495618_0054775 Ga0495618_0054775_1676_2218 179
659 3300046514 Ga0495618_0166821 Ga0495618_0166821_42_584 179
660 3300046514 Ga0495618_0253407 Ga0495618_0253407_144_686 179
661 3300046515 Ga0495620_0068670 Ga0495620_0068670_33_587 179
662 3300046516 Ga0495628_0018851 Ga0495628_0018851_377_919 179
663 3300046516 Ga0495628_0037867 Ga0495628_0037867_770_1312 179
664 3300046516 Ga0495628_0076373 Ga0495628_0076373_387_929 179
665 3300046516 Ga0495628_0577615 Ga0495628_0577615_176_718 179
666 3300046517 Ga0495630_0059721 Ga0495630_0059721_1015_1557 179
667 3300046517 Ga0495630_0098848 Ga0495630_0098848_1012_1554 179
668 3300046517 Ga0495630_0762626 Ga0495630_0762626_117_659 179
669 3300046519 Ga0495632_0158599 Ga0495632_0158599_368_910 179
670 3300046519 Ga0495632_0192772 Ga0495632_0192772_228_782 179
671 3300046519 Ga0495632_0274205 Ga0495632_0274205_87_641 179
672 3300046523 Ga0495644_0043821 Ga0495644_0043821_662_1216 179
673 3300046524 Ga0495648_0005396 Ga0495648_0005396_7639_8181 179
674 3300046526 Ga0495666_0090625 Ga0495666_0090625_170_739 179
675 3300046528 Ga0495642_0041301 Ga0495642_0041301_717_1259 179
676 3300046529 Ga0495652_0141008 Ga0495652_0141008_1027_1569 179
677 3300046529 Ga0495652_0273775 Ga0495652_0273775_154_696 179
678 3300046531 Ga0495665_0048993 Ga0495665_0048993_1165_1707 179
679 3300046531 Ga0495665_0072348 Ga0495665_0072348_818_1360 179
680 3300046531 Ga0495665_0260691 Ga0495665_0260691_217_759 179
681 3300046531 Ga0495665_0289521 Ga0495665_0289521_54_596 179
682 3300046533 Ga0495640_0031105 Ga0495640_0031105_426_968 179
683 3300046533 Ga0495640_0043124 Ga0495640_0043124_2166_2708 179
684 3300046533 Ga0495640_0197990 Ga0495640_0197990_527_1069 179
685 3300046533 Ga0495640_0501708 Ga0495640_0501708_43_585 179
686 3300046535 Ga0495586_0084345 Ga0495586_0084345_980_1522 179
687 3300046536 Ga0495587_0070229 Ga0495587_0070229_332_874 179
688 3300046538 Ga0495609_0127835 Ga0495609_0127835_527_1069 179
689 3300046538 Ga0495609_0128949 Ga0495609_0128949_234_776 179
690 3300046543 Ga0495645_0024397 Ga0495645_0024397_1599_2141 179
691 3300046543 Ga0495645_0187646 Ga0495645_0187646_759_1319 179
692 3300046557 Ga0495622_0015653 Ga0495622_0015653_1094_1636 179
693 3300046557 Ga0495622_0035408 Ga0495622_0035408_1679_2221 179
694 3300046559 Ga0495667_0035702 Ga0495667_0035702_1887_2429 179
695 3300046559 Ga0495667_0122295 Ga0495667_0122295_419_961 179
696 3300046559 Ga0495667_0146376 Ga0495667_0146376_890_1432 179
697 3300046559 Ga0495667_0785906 Ga0495667_0785906_11_553 179
698 3300046615 Ga0495656_0137787 Ga0495656_0137787_66_620 179
699 3300046615 Ga0495656_0189032 Ga0495656_0189032_277_819 179
700 3300046616 Ga0495668_0464903 Ga0495668_0464903_108_650 179
701 3300046642 Ga0495634_0005863 Ga0495634_0005863_3212_3754 179
702 3300046642 Ga0495634_0038694 Ga0495634_0038694_1185_1727 179
703 3300046642 Ga0495634_0096854 Ga0495634_0096854_262_804 179
704 3300046660 Ga0495625_0621482 Ga0495625_0621482_11_565 179
705 3300046663 Ga0495635_0004233 Ga0495635_0004233_9242_9784 179
706 3300046663 Ga0495635_0058430 Ga0495635_0058430_346_888 179
707 3300046664 Ga0495659_0008839 Ga0495659_0008839_1142_1696 179
708 3300046664 Ga0495659_0104801 Ga0495659_0104801_150_704 179
709 3300046664 Ga0495659_0250466 Ga0495659_0250466_117_671 179
710 3300046665 Ga0495661_0195600 Ga0495661_0195600_140_694 179
711 3300046674 Ga0495588_0020627 Ga0495588_0020627_1166_1720 179
712 3300046675 Ga0495657_0025879 Ga0495657_0025879_2234_2776 179
713 3300046675 Ga0495657_0063786 Ga0495657_0063786_310_852 179
714 3300046675 Ga0495657_0327290 Ga0495657_0327290_317_859 179
715 3300046678 Ga0495599_0018837 Ga0495599_0018837_2208_2750 179
716 3300046678 Ga0495599_0080476 Ga0495599_0080476_1446_1988 179
717 3300046678 Ga0495599_0145712 Ga0495599_0145712_728_1288 179
718 3300046679 Ga0495623_0006324 Ga0495623_0006324_2541_3083 179
719 3300046679 Ga0495623_0238414 Ga0495623_0238414_121_663 179
720 3300046680 Ga0495646_0017450 Ga0495646_0017450_2233_2775 179
721 3300046680 Ga0495646_0046764 Ga0495646_0046764_2029_2571 179
722 3300046680 Ga0495646_0118960 Ga0495646_0118960_37_579 179
723 3300046681 Ga0495647_0013604 Ga0495647_0013604_260_802 179
724 3300046681 Ga0495647_0120523 Ga0495647_0120523_393_935 179
725 3300046683 Ga0495658_0087659 Ga0495658_0087659_787_1329 179
726 3300046683 Ga0495658_0300810 Ga0495658_0300810_410_952 179
727 3300046684 Ga0495669_0006974 Ga0495669_0006974_2597_3151 179
728 3300046684 Ga0495669_0049594 Ga0495669_0049594_188_730 179
729 3300046684 Ga0495669_0118974 Ga0495669_0118974_587_1141 179
730 3300046689 Ga0495613_0106646 Ga0495613_0106646_827_1369 179
731 3300046689 Ga0495613_0213921 Ga0495613_0213921_552_1106 179
732 3300046689 Ga0495613_0880490 Ga0495613_0880490_27_569 179
733 3300046690 Ga0495624_0039316 Ga0495624_0039316_323_865 179
734 3300046690 Ga0495624_0130355 Ga0495624_0130355_51_593 179
735 3300046690 Ga0495624_0373061 Ga0495624_0373061_245_787 179
736 3300046691 Ga0495670_0088380 Ga0495670_0088380_920_1474 179
737 3300046691 Ga0495670_0112902 Ga0495670_0112902_350_904 179
738 3300046794 Ga0495589_0212256 Ga0495589_0212256_140_694 179
739 3300046809 Ga0495600_0100555 Ga0495600_0100555_440_982 179
740 3300046809 Ga0495600_0240484 Ga0495600_0240484_407_949 179
741 3300046809 Ga0495600_0246640 Ga0495600_0246640_285_839 179
742 3300046809 Ga0495600_0777507 Ga0495600_0777507_11_553 179
743 3300046810 Ga0495660_0233494 Ga0495660_0233494_27_581 179
744 3300047315 Ga0495581_0022509 Ga0495581_0022509_1736_2278 179
745 3300047315 Ga0495581_0039231 Ga0495581_0039231_841_1383 179
746 3300047315 Ga0495581_0056334 Ga0495581_0056334_509_1063 179
747 3300047315 Ga0495581_0133443 Ga0495581_0133443_839_1381 179
748 3300047317 Ga0495604_0093644 Ga0495604_0093644_1589_2131 179
749 3300047317 Ga0495604_0098991 Ga0495604_0098991_1514_2056 179
750 3300047317 Ga0495604_0103732 Ga0495604_0103732_945_1487 179
751 3300047317 Ga0495604_0282157 Ga0495604_0282157_147_701 179
752 3300047317 Ga0495604_0417447 Ga0495604_0417447_243_785 179
753 3300047317 Ga0495604_0459204 Ga0495604_0459204_58_720 179
754 3300047318 Ga0495636_0050243 Ga0495636_0050243_625_1179 179
755 3300047319 Ga0495674_0066189 Ga0495674_0066189_260_802 179
756 3300047319 Ga0495674_0087507 Ga0495674_0087507_895_1437 179
757 3300047319 Ga0495674_0119336 Ga0495674_0119336_1180_1722 179
758 3300047319 Ga0495674_1008512 Ga0495674_1008512_50_592 179
759 3300047320 Ga0495672_0053768 Ga0495672_0053768_1170_1712 179
760 3300047320 Ga0495672_0206616 Ga0495672_0206616_85_627 179
761 3300047321 Ga0495676_0050003 Ga0495676_0050003_89_631 179
762 3300047322 Ga0495680_0152660 Ga0495680_0152660_786_1328 179
763 3300047322 Ga0495680_0406147 Ga0495680_0406147_23_565 179
764 3300047444 Ga0495675_0037487 Ga0495675_0037487_1259_1801 179
765 3300047444 Ga0495675_0039044 Ga0495675_0039044_1060_1602 179
766 3300047444 Ga0495675_0377973 Ga0495675_0377973_107_649 179
767 3300047446 Ga0495679_063429 Ga0495679_063429_368_922 179
768 3300047469 Ga0495673_0121565 Ga0495673_0121565_159_701 179
769 3300047471 Ga0495684_0008094 Ga0495684_0008094_4869_5411 179
770 3300047471 Ga0495684_0019268 Ga0495684_0019268_2761_3303 179
771 3300047471 Ga0495684_0079279 Ga0495684_0079279_1081_1623 179
772 3300047471 Ga0495684_0252110 Ga0495684_0252110_103_645 179
773 3300047472 Ga0495686_0122443 Ga0495686_0122443_722_1264 179
774 3300047472 Ga0495686_0134394 Ga0495686_0134394_541_1083 179
775 3300047673 Ga0495593_0032879 Ga0495593_0032879_926_1468 179
776 3300047673 Ga0495593_0040757 Ga0495593_0040757_1066_1608 179
777 3300047673 Ga0495593_0049421 Ga0495593_0049421_1143_1685 179
778 3300047673 Ga0495593_0170222 Ga0495593_0170222_433_975 179
779 3300048088 Ga0495602_0061833 Ga0495602_0061833_1589_2131 179
780 3300048088 Ga0495602_0288857 Ga0495602_0288857_626_1168 179
781 3300048089 Ga0495614_0183994 Ga0495614_0183994_257_799 179
782 3300048089 Ga0495614_0273504 Ga0495614_0273504_178_720 179
783 3300048090 Ga0495615_0039676 Ga0495615_0039676_588_1142 179
784 3300048091 Ga0495626_0218940 Ga0495626_0218940_30_572 179
785 3300048903 Ga0496100_0241413 Ga0496100_0241413_691_1233 179
786 3300048904 Ga0496101_0077541 Ga0496101_0077541_276_818 179
787 3300048904 Ga0496101_0181632 Ga0496101_0181632_1001_1549 179
788 3300048904 Ga0496101_0210619 Ga0496101_0210619_100_654 179
789 3300048904 Ga0496101_0642682 Ga0496101_0642682_192_734 179
790 3300048904 Ga0496101_0975022 Ga0496101_0975022_111_653 179
791 3300048904 Ga0496101_1009162 Ga0496101_1009162_46_588 179
792 3300048905 Ga0496102_0084967 Ga0496102_0084967_594_1148 179
793 3300048905 Ga0496102_0094275 Ga0496102_0094275_844_1392 179
794 3300048905 Ga0496102_0129276 Ga0496102_0129276_249_791 179
795 3300048905 Ga0496102_0201988 Ga0496102_0201988_244_786 179
796 3300048905 Ga0496102_0481573 Ga0496102_0481573_578_1120 179
797 3300048905 Ga0496102_0520590 Ga0496102_0520590_435_1004 179
798 3300048906 Ga0496103_0107579 Ga0496103_0107579_533_1087 179
799 3300048907 Ga0496104_0007678 Ga0496104_0007678_4035_4583 179
800 3300048907 Ga0496104_0140577 Ga0496104_0140577_825_1379 179
801 3300048907 Ga0496104_0580447 Ga0496104_0580447_240_782 179
802 3300048907 Ga0496104_0622867 Ga0496104_0622867_63_617 179
803 3300048907 Ga0496104_0687146 Ga0496104_0687146_312_866 179
804 3300048908 Ga0496105_0097372 Ga0496105_0097372_1156_1704 179
805 3300048908 Ga0496105_0274728 Ga0496105_0274728_79_633 179
806 3300048908 Ga0496105_0439275 Ga0496105_0439275_449_991 179
807 3300048908 Ga0496105_0471756 Ga0496105_0471756_413_955 179
808 3300048909 Ga0496106_0008768 Ga0496106_0008768_2432_2980 179
809 3300048909 Ga0496106_0057561 Ga0496106_0057561_280_834 179
810 3300048909 Ga0496106_0073480 Ga0496106_0073480_531_1073 179
811 3300048909 Ga0496106_0090660 Ga0496106_0090660_249_791 179
812 3300048910 Ga0496107_0032726 Ga0496107_0032726_147_689 179
813 3300048910 Ga0496107_0222751 Ga0496107_0222751_428_976 179
814 3300048910 Ga0496107_0476306 Ga0496107_0476306_351_893 179
815 3300048911 Ga0496108_0204509 Ga0496108_0204509_378_926 179
816 3300048911 Ga0496108_0223181 Ga0496108_0223181_496_1038 179
817 3300048912 Ga0496109_0000469 Ga0496109_0000469_33305_33847 179
818 3300048912 Ga0496109_0944410 Ga0496109_0944410_234_788 179
819 3300048913 Ga0496110_0011658 Ga0496110_0011658_4198_4746 179
820 3300048913 Ga0496110_0065763 Ga0496110_0065763_2242_2784 179
821 3300048913 Ga0496110_0284284 Ga0496110_0284284_933_1475 179
822 3300048913 Ga0496110_0674586 Ga0496110_0674586_28_570 179
823 3300048913 Ga0496110_0739849 Ga0496110_0739849_83_637 179
824 3300048914 Ga0496111_0035057 Ga0496111_0035057_2792_3334 179
825 3300048914 Ga0496111_0084785 Ga0496111_0084785_715_1263 179
826 3300048914 Ga0496111_0155210 Ga0496111_0155210_362_904 179
827 3300048914 Ga0496111_0873852 Ga0496111_0873852_92_637 179
828 3300048914 Ga0496111_0979587 Ga0496111_0979587_12_554 179
829 3300048915 Ga0496112_0017876 Ga0496112_0017876_780_1322 179
830 3300048915 Ga0496112_0111037 Ga0496112_0111037_351_896 179
831 3300048915 Ga0496112_0119746 Ga0496112_0119746_597_1145 179
832 3300048915 Ga0496112_0119972 Ga0496112_0119972_992_1546 179
833 3300048915 Ga0496112_0287859 Ga0496112_0287859_682_1224 179
834 3300048916 Ga0496113_0119862 Ga0496113_0119862_999_1547 179
835 3300048916 Ga0496113_0171286 Ga0496113_0171286_122_664 179
836 3300048916 Ga0496113_0244651 Ga0496113_0244651_426_968 179
837 3300048917 Ga0496114_0005276 Ga0496114_0005276_4656_5198 179
838 3300048917 Ga0496114_0326765 Ga0496114_0326765_70_612 179
839 3300048917 Ga0496114_0363577 Ga0496114_0363577_138_692 179
840 3300048918 Ga0496115_0019167 Ga0496115_0019167_4015_4557 179
841 3300048918 Ga0496115_0019415 Ga0496115_0019415_50_598 179
842 3300048918 Ga0496115_0044802 Ga0496115_0044802_402_944 179
843 3300048918 Ga0496115_0130697 Ga0496115_0130697_532_1074 179
844 3300048918 Ga0496115_0583505 Ga0496115_0583505_314_856 179
845 3300048921 Ga0496118_0136657 Ga0496118_0136657_753_1292 179
846 3300048921 Ga0496118_0264262 Ga0496118_0264262_25_570 179
847 3300048922 Ga0496119_0070230 Ga0496119_0070230_1236_1775 179
848 3300048922 Ga0496119_0123615 Ga0496119_0123615_428_970 179
849 3300048922 Ga0496119_0231188 Ga0496119_0231188_104_691 179
850 3300048924 Ga0496121_0002453 Ga0496121_0002453_18868_19410 179
851 3300048924 Ga0496121_0084289 Ga0496121_0084289_1674_2228 179
852 3300048924 Ga0496121_0169347 Ga0496121_0169347_771_1358 179
853 3300048924 Ga0496121_0568859 Ga0496121_0568859_135_677 179
854 3300048927 Ga0496124_0160713 Ga0496124_0160713_28_582 179
855 3300048928 Ga0496125_0226979 Ga0496125_0226979_101_655 179
856 3300048929 Ga0496126_0056340 Ga0496126_0056340_2514_3056 179
857 3300048929 Ga0496126_0067172 Ga0496126_0067172_454_996 179
858 3300048929 Ga0496126_0111934 Ga0496126_0111934_1455_2009 179
859 3300048929 Ga0496126_0390298 Ga0496126_0390298_568_1110 179
860 3300048929 Ga0496126_0509483 Ga0496126_0509483_340_882 179
861 3300049460 Ga0495682_0150622 Ga0495682_0150622_22_576 179
862 3300049569 Ga0501032_0000196 Ga0501032_0000196_9900_10460 179
863 3300049569 Ga0501032_0096066 Ga0501032_0096066_782_1336 179
864 3300049570 Ga0501033_0003209 Ga0501033_0003209_9851_10411 179
865 3300049570 Ga0501033_0018168 Ga0501033_0018168_1639_2193 179
866 3300049571 Ga0501034_0001151 Ga0501034_0001151_9900_10460 179
867 3300049571 Ga0501034_0504125 Ga0501034_0504125_255_809 179
868 3300049572 Ga0501036_0000323 Ga0501036_0000323_30786_31346 179
869 3300049572 Ga0501036_0083448 Ga0501036_0083448_1409_1963 179
870 3300049572 Ga0501036_0607310 Ga0501036_0607310_52_606 179
871 3300049573 Ga0501037_0001377 Ga0501037_0001377_7349_7909 179
872 3300049573 Ga0501037_0001630 Ga0501037_0001630_3076_3630 179
873 3300049574 Ga0501038_0001622 Ga0501038_0001622_9738_10298 179
874 3300049575 Ga0501039_0001302 Ga0501039_0001302_10149_10709 179
875 3300049575 Ga0501039_0258956 Ga0501039_0258956_623_1177 179
876 3300049575 Ga0501039_0578651 Ga0501039_0578651_167_721 179
877 3300049578 Ga0501042_0046374 Ga0501042_0046374_335_895 179
878 3300049578 Ga0501042_0137635 Ga0501042_0137635_474_1028 179
879 3300049579 Ga0501043_0000409 Ga0501043_0000409_28198_28758 179
880 3300049579 Ga0501043_0017728 Ga0501043_0017728_2882_3436 179
881 3300049580 Ga0501046_0000181 Ga0501046_0000181_9900_10460 179
882 3300049580 Ga0501046_0060008 Ga0501046_0060008_1238_1792 179
883 3300049581 Ga0501047_0002426 Ga0501047_0002426_9900_10460 179
884 3300049581 Ga0501047_0062965 Ga0501047_0062965_622_1164 179
885 3300049581 Ga0501047_0352826 Ga0501047_0352826_640_1200 179
886 3300049582 Ga0501048_0003595 Ga0501048_0003595_1358_1918 179
887 3300049583 Ga0501067_0000145 Ga0501067_0000145_9843_10403 179
888 3300049583 Ga0501067_0023101 Ga0501067_0023101_691_1233 179
889 3300049583 Ga0501067_0050454 Ga0501067_0050454_903_1460 179
890 3300049584 Ga0501068_0002577 Ga0501068_0002577_7529_8089 179
891 3300049585 Ga0501069_0116733 Ga0501069_0116733_552_1112 179
892 3300049586 Ga0501070_0003510 Ga0501070_0003510_1616_2176 179
893 3300049586 Ga0501070_0605189 Ga0501070_0605189_80_634 179
894 3300049587 Ga0501071_0274480 Ga0501071_0274480_255_815 179
895 3300049588 Ga0501072_0017020 Ga0501072_0017020_1920_2480 179
896 3300049589 Ga0501073_0000027 Ga0501073_0000027_10943_11503 179
897 3300049589 Ga0501073_0039562 Ga0501073_0039562_1914_2456 179
898 3300049590 Ga0501074_0001347 Ga0501074_0001347_9395_9955 179
899 3300049590 Ga0501074_0146411 Ga0501074_0146411_63_605 179
900 3300049741 Ga0501079_0048138 Ga0501079_0048138_275_835 179
901 3300049741 Ga0501079_0751275 Ga0501079_0751275_151_705 179
902 3300049742 Ga0501080_0002621 Ga0501080_0002621_9900_10460 179
903 3300049742 Ga0501080_0052129 Ga0501080_0052129_2184_2726 179
904 3300049744 Ga0501083_0002123 Ga0501083_0002123_7130_7690 179
905 3300049822 Ga0501035_0001852 Ga0501035_0001852_9900_10460 179
906 3300049822 Ga0501035_0005411 Ga0501035_0005411_3204_3758 179
907 3300049823 Ga0501044_0003498 Ga0501044_0003498_7221_7781 179
908 3300049823 Ga0501044_0035674 Ga0501044_0035674_592_1134 179
909 3300049823 Ga0501044_0453947 Ga0501044_0453947_582_1142 179
910 3300049824 Ga0501045_1042880 Ga0501045_1042880_10_552 179
911 3300050489 nmdc:mga03683_147542_c1 nmdc:mga03683_147542_c1_148_702 179
912 3300050489 nmdc:mga03683_266469_c1 nmdc:mga03683_266469_c1_166_720 179
913 3300050490 nmdc:mga03n38_415174_c1 nmdc:mga03n38_415174_c1_40_582 179
914 3300050490 nmdc:mga03n38_98_c1 nmdc:mga03n38_98_c1_12982_13536 179
915 3300050491 nmdc:mga00v17_134015_c1 nmdc:mga00v17_134015_c1_53_607 179
916 3300050491 nmdc:mga00v17_360989_c1 nmdc:mga00v17_360989_c1_347_889 179
917 3300050491 nmdc:mga00v17_825617_c1 nmdc:mga00v17_825617_c1_19_573 179
918 3300050492 nmdc:mga0yw44_134681_c1 nmdc:mga0yw44_134681_c1_639_1193 179
919 3300050492 nmdc:mga0yw44_375205_c1 nmdc:mga0yw44_375205_c1_358_912 179
920 3300050492 nmdc:mga0yw44_459536_c1 nmdc:mga0yw44_459536_c1_108_662 179
921 3300050492 nmdc:mga0yw44_6672_c1 nmdc:mga0yw44_6672_c1_3873_4427 179
922 3300050493 nmdc:mga0k408_135893_c1 nmdc:mga0k408_135893_c1_759_1313 179
923 3300050493 nmdc:mga0k408_219045_c1 nmdc:mga0k408_219045_c1_522_1076 179
924 3300050493 nmdc:mga0k408_67583_c1 nmdc:mga0k408_67583_c1_245_799 179
925 3300050494 nmdc:mga06z11_114027_c1 nmdc:mga06z11_114027_c1_388_942 179
926 3300050494 nmdc:mga06z11_32996_c1 nmdc:mga06z11_32996_c1_1307_1861 179
927 3300050494 nmdc:mga06z11_342728_c1 nmdc:mga06z11_342728_c1_130_684 179
928 3300050494 nmdc:mga06z11_37963_c1 nmdc:mga06z11_37963_c1_800_1354 179
929 3300050494 nmdc:mga06z11_656518_c1 nmdc:mga06z11_656518_c1_45_599 179
930 3300050496 nmdc:mga07m45_144674_c1 nmdc:mga07m45_144674_c1_563_1117 179
931 3300050496 nmdc:mga07m45_9952_c2 nmdc:mga07m45_9952_c2_2863_3417 179
932 3300050511 nmdc:mga08y16_1190555_c1 nmdc:mga08y16_1190555_c1_11_565 179
933 3300050512 nmdc:mga0n895_1673395_c1 nmdc:mga0n895_1673395_c1_24_566 179
934 3300050512 nmdc:mga0n895_179818_c1 nmdc:mga0n895_179818_c1_455_1009 179
935 3300050514 nmdc:mga08x19_815980_c1 nmdc:mga08x19_815980_c1_19_573 179
936 3300053077 Ga0495601_0018892 Ga0495601_0018892_361_903 179
937 3300053077 Ga0495601_0023042 Ga0495601_0023042_2059_2601 179
938 3300053077 Ga0495601_0045290 Ga0495601_0045290_1197_1739 179
939 3300053078 Ga0495612_0050427 Ga0495612_0050427_493_1035 179
940 3300053078 Ga0495612_0141603 Ga0495612_0141603_25_585 179
941 3300053078 Ga0495612_0266615 Ga0495612_0266615_122_676 179
942 3300053080 Ga0500635_0003192 Ga0500635_0003192_2638_3207 179
943 3300053080 Ga0500635_0008969 Ga0500635_0008969_119_661 179
944 3300053084 Ga0495595_0051790 Ga0495595_0051790_1212_1754 179
945 3300053085 Ga0495619_0008712 Ga0495619_0008712_1111_1653 179
946 3300053085 Ga0495619_0052867 Ga0495619_0052867_2132_2674 179
947 3300053085 Ga0495619_0639291 Ga0495619_0639291_83_625 179
948 3300053086 Ga0500578_0459676 Ga0500578_0459676_147_686 179
949 3300053094 Ga0500566_0000207 Ga0500566_0000207_20080_20622 179
950 3300053096 Ga0500641_0001497 Ga0500641_0001497_6272_6814 179
951 3300053096 Ga0500641_0170350 Ga0500641_0170350_26_583 179
952 3300053099 Ga0500654_137610 Ga0500654_137610_339_881 179
953 3300053102 Ga0500554_000856 Ga0500554_000856_4539_5108 179
954 3300053102 Ga0500554_001256 Ga0500554_001256_1723_2265 179
955 3300053104 Ga0500556_0017680 Ga0500556_0017680_1398_1940 179
956 3300053111 Ga0500572_000676 Ga0500572_000676_10625_11167 179
957 3300053119 Ga0500595_000299 Ga0500595_000299_30724_31266 179
958 3300053119 Ga0500595_003982 Ga0500595_003982_1828_2367 179
959 3300053119 Ga0500595_004108 Ga0500595_004108_3055_3609 179
960 3300053119 Ga0500595_015612 Ga0500595_015612_786_1328 179
961 3300053122 Ga0500608_051325 Ga0500608_051325_1329_1871 179
962 3300053123 Ga0500614_005280 Ga0500614_005280_1156_1698 179
963 3300053130 Ga0500642_0009622 Ga0500642_0009622_703_1242 179
964 3300053136 Ga0500559_0107274 Ga0500559_0107274_449_991 179
965 3300053139 Ga0500568_0008381 Ga0500568_0008381_2451_2993 179
966 3300053150 Ga0500603_000313 Ga0500603_000313_11228_11797 179
967 3300053150 Ga0500603_016677 Ga0500603_016677_1157_1699 179
968 3300053154 Ga0500619_187121 Ga0500619_187121_15_557 179
969 3300053158 Ga0500627_0208447 Ga0500627_0208447_10_549 179
970 3300053159 Ga0500630_001066 Ga0500630_001066_12159_12701 179
971 3300053160 Ga0500633_0209680 Ga0500633_0209680_147_701 179
972 3300053162 Ga0500638_002777 Ga0500638_002777_731_1273 179
973 3300053162 Ga0500638_003145 Ga0500638_003145_2681_3223 179
974 3300053163 Ga0500639_000072 Ga0500639_000072_31088_31630 179
975 3300053163 Ga0500639_104704 Ga0500639_104704_331_873 179
976 3300053177 Ga0500636_0039800 Ga0500636_0039800_1891_2433 179
977 3300053178 Ga0500637_0000065 Ga0500637_0000065_30983_31525 179
978 3300053178 Ga0500637_0002631 Ga0500637_0002631_787_1356 179
979 3300053178 Ga0500637_0059800 Ga0500637_0059800_424_966 179
980 3300053178 Ga0500637_0199894 Ga0500637_0199894_467_1021 179
981 3300053724 Ga0500570_033718 Ga0500570_033718_346_885 179
982 3300053731 Ga0500609_025955 Ga0500609_025955_27_566 179
983 3300053735 Ga0500596_036886 Ga0500596_036886_116_658 179
984 3300054114 Ga0501084_0003235 Ga0501084_0003235_10278_10838 179
985 3300054114 Ga0501084_0661451 Ga0501084_0661451_191_745 179
986 3300055283 Ga0500661_001927 Ga0500661_001927_1332_1874 179
987 3300060353 Ga0501082_0005376 Ga0501082_0005376_655_1215 179
988 iso_pu_bacteria 8056681323 8056685530 179

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01035

DNA_binding_1

6-O-methylguanine DNA methyltransferase, DNA binding domain

87

168

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sfe-assembly1.cif.gz_A ada o6-methylguanine-dna methyltransferase from escherichia coli 0.8754 1 170
1sfe-assembly1.cif.gz_A ada o6-methylguanine-dna methyltransferase from escherichia coli 0.8706 1 170
4zyd-assembly2.cif.gz_A-3 crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase in complex with modified dna 0.8589 4 171
7dqt-assembly1.cif.gz_A crystal structure of o6-methylguanine methyltransferase y91f variant 0.853 3 171
7e1p-assembly1.cif.gz_A crystal structure of sulfurisphaera tokodaii o6-methylguanine methyltransferase c120s variant in complex with o6-methyldeoxyguanosine 0.8517 3 171
ID Description Score Start End Superfamily
af_Q4DAC5_49_134_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.945 86 170 1.10.10.10
5llqB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9231 85 170 1.10.10.10
5llqB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9125 85 170 1.10.10.10
af_Q4DAC5_49_134_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9034 86 170 1.10.10.10
1t39B01 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Methylated DNA-protein cysteine methyltransferase domain 0.8983 5 28 3.30.160.70
ID Description Score Start End GO Terms
AF-A0A431RJJ5-F1-model_v4 deleted 0.9872 2 133
AF-A0A431RJJ5-F1-model_v4 deleted 0.9655 2 133
AF-A0A2R7NXB5-F1-model_v4 Cysteine methyltransferase 0.9618 2 150 GO:0003908
GO:0006281
GO:0032259
AF-K2CBI1-F1-model_v4 Uncharacterized protein 0.9558 2 121 GO:0003908
GO:0006281
AF-A0A355UNV3-F1-model_v4 Cysteine methyltransferase 0.9542 2 168 GO:0003908
GO:0006281
GO:0032259

Feature Viewer

pLDDT pTM Quality
90.93 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map