F487569

General Info

Members Datasets Scaffolds Average Seq Length
988 557 1976 322

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0178657|Ga0395900_0178657_100_1206
Length 368
Sequence MPKEYRPRTSQGRRVPILFGHDKRDRAAADFASRGPQQTRTQGRIVVKAFKYFAAALVVLLTPALAAAQKFPERNIRLIVPFPAGGPNDIIARVVSQKMSEILKQTIIVDNRGGQGGVIGTDLVAKAKPDGYTIAVTSAGALAISPSMEKVAYDTLKDLQPVTLVAKVPEMLVVAENVPAKNMKELVALAKKEPGKLNFASSGPGSLPHLAGELFKLTAHIDAVHVPYRGAAPAVNDLLGGQVQMVFLDLPVLLPHVKAGKLRPIAVGAEKRVATLPDVPTTAEVGYPTLLTENWYGMVAPAGTPKDIVATLNKAAVEAMKDPAVVSKLSSLGAILVGNSPDEFRTFIASEKAKWAKVIKDAGVPTQK

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
77 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
109 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
111 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
160 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
161 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
162 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
163 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
169 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
170 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
171 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
172 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
173 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
174 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
175 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
176 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
177 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
178 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
181 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
182 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
183 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
184 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
185 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
186 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
187 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
188 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
191 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
192 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
193 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
194 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
195 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
203 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
213 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
214 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
215 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
216 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
217 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
218 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
219 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
220 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
221 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
222 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
223 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
224 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
225 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
226 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
227 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
228 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
229 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
230 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
231 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
232 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
233 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
234 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
235 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
236 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
237 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
238 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
239 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
240 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
241 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
242 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
243 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
244 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
245 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
246 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
247 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
248 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
249 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
250 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
251 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
252 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
253 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
254 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
255 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
256 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
257 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
258 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
259 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
260 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
261 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
262 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
263 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
264 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
265 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
266 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
267 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
268 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
269 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
270 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
271 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
272 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
273 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
274 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
275 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
276 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
277 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
278 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
279 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
280 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
281 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
282 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
283 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
284 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
285 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
286 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
287 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
288 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
289 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
290 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
291 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
292 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
293 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
294 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
295 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
296 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
297 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
298 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
299 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
300 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
301 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
302 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
303 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
304 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
305 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
306 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
307 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
308 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
309 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
310 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
311 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
312 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
313 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
314 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
315 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
316 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
317 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
318 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
319 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
320 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
321 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
322 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
323 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
324 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
325 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
326 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
327 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
338 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
339 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
340 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
341 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
342 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
343 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
344 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
345 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
346 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
347 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
348 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
349 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
350 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
353 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
354 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
355 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
356 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
357 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
358 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
359 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
360 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
361 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
362 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
363 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
364 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
365 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
366 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
367 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
368 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
369 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
370 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
371 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
372 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
373 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
374 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
375 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
376 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
377 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
378 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
379 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
380 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
381 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
382 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
383 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
384 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
385 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
386 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
387 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
388 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
389 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
390 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
391 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
392 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
393 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
394 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
395 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
396 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
397 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
398 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
399 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
400 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
401 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
402 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
403 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
404 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
405 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
406 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
407 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
408 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
409 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
410 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
411 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
412 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
413 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
414 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
415 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
416 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
417 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
418 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
419 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
420 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
421 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
422 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
423 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
424 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
425 2791355199
426 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
427 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
428 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
429 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
430 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
431 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
432 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
433 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
434 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
435 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
436 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
437 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
438 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
439 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
440 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
441 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
442 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
443 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
444 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
445 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
446 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
447 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
448 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
449 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
450 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
451 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
452 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
453 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
454 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
455 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
456 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
457 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
458 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
459 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
460 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
461 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
462 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
463 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
464 2922368715
465 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
466 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
467 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
468 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
469 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
470 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
471 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
472 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
473 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
474 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
475 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
476 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
477 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
478 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
479 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
480 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
481 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
482 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
483 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
484 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
485 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
486 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
487 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
488 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
489 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
490 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
491 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
492 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
493 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
494 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
495 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
496 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
497 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
498 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
499 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
500 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
501 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
502 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
503 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
504 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
505 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
506 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
507 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
508 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
509 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
510 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
511 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
512 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
513 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
514 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
515 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
516 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
517 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
518 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
519 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
520 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
521 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
522 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
523 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
524 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
525 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
526 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
527 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
528 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
529 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
530 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
531 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
532 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
533 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
534 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
535 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
536 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
537 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
538 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
539 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
540 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
541 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
542 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
543 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
544 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
545 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
546 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
547 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
548 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
549 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
550 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
551 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
552 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
553 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
554 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
555 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
556 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
557 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.89
Metatranscriptomes 0
Isolates 15.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.84
Nodule 13.06
Rhizoplane 4.66
Rhizosphere 65.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0178657 3300037418 Bacteria 2158
2 JGI25406J46586_10000359 3300003203 Bacteria 20746
3 JGI25406J46586_10006073 3300003203 Bacteria 5580
4 JGI25153J46596_10004803 3300003215 Bacteria 7199
5 JGI25153J46596_10005279 3300003215 Bacteria 6793
6 JGI25153J46596_10005848 3300003215 Bacteria 6374
7 JGI25153J46596_10007756 3300003215 Bacteria 5222
8 rootH2_10062151 3300003320 Bacteria 1641
9 JGI25160J50197_1008171 3300003354 Bacteria 4013
10 JGI25160J50197_1031104 3300003354 Bacteria 1380
11 JGI25404J52841_10030037 3300003659 Bacteria 1165
12 Ga0055543_1011624 3300004625 Bacteria 1795
13 Ga0065165_1000919 3300005262 Bacteria 37849
14 Ga0065165_1002792 3300005262 Bacteria 13765
15 Ga0065165_1005273 3300005262 Bacteria 7373
16 Ga0070658_10045234 3300005327 Bacteria 3559
17 Ga0070658_10093766 3300005327 Bacteria 2476
18 Ga0070658_10293588 3300005327 Bacteria 1385
19 Ga0070676_10044708 3300005328 Bacteria 2578
20 Ga0070676_10136276 3300005328 Bacteria 1558
21 Ga0070683_100149805 3300005329 Bacteria 2212
22 Ga0070690_100059558 3300005330 Bacteria 2455
23 Ga0070690_100078710 3300005330 Bacteria 2154
24 Ga0070680_100077218 3300005336 Bacteria 2743
25 Ga0070680_100131705 3300005336 Bacteria 2093
26 Ga0070682_100190506 3300005337 Bacteria 1440
27 Ga0068868_100030792 3300005338 Bacteria 4115
28 Ga0070660_100151829 3300005339 Bacteria 1863
29 Ga0070660_100220170 3300005339 Bacteria 1542
30 Ga0070689_100219789 3300005340 Bacteria 1558
31 Ga0070687_100055331 3300005343 Bacteria 2072
32 Ga0070661_100271496 3300005344 Bacteria 1313
33 Ga0070668_100076521 3300005347 Bacteria 2614
34 Ga0070668_100133095 3300005347 Bacteria 1997
35 Ga0070668_100217989 3300005347 Bacteria 1572
36 Ga0070675_100118178 3300005354 Bacteria 2251
37 Ga0070671_100055275 3300005355 Bacteria 3302
38 Ga0070674_100386901 3300005356 Bacteria 1139
39 Ga0070673_100069800 3300005364 Bacteria 2817
40 Ga0070709_10007358 3300005434 Bacteria 6032
41 Ga0070709_10024332 3300005434 Bacteria 3563
42 Ga0070709_10078062 3300005434 Bacteria 2154
43 Ga0070709_10141936 3300005434 Bacteria 1651
44 Ga0070714_100024637 3300005435 Bacteria 4957
45 Ga0070713_100007733 3300005436 Bacteria 7568
46 Ga0070713_100039241 3300005436 Bacteria 3842
47 Ga0070710_10002417 3300005437 Bacteria 8854
48 Ga0070710_10038634 3300005437 Bacteria 2623
49 Ga0070711_100006676 3300005439 Bacteria 6977
50 Ga0070663_100069526 3300005455 Bacteria 2558
51 Ga0070663_100300982 3300005455 Bacteria 1284
52 Ga0070662_100351488 3300005457 Bacteria 1208
53 Ga0070681_10050857 3300005458 Bacteria 4134
54 Ga0070681_10074250 3300005458 Bacteria 3362
55 Ga0070681_10223614 3300005458 Bacteria 1797
56 Ga0068853_100042910 3300005539 Bacteria 3869
57 Ga0068853_100449012 3300005539 Bacteria 1212
58 Ga0070686_100008070 3300005544 Bacteria 5881
59 Ga0070696_100048131 3300005546 Bacteria 2959
60 Ga0070696_100107754 3300005546 Bacteria 2004
61 Ga0070665_100015092 3300005548 Bacteria 7756
62 Ga0070665_100099359 3300005548 Bacteria 2914
63 Ga0070665_100405452 3300005548 Bacteria 1371
64 Ga0068855_100001526 3300005563 Bacteria 29026
65 Ga0068855_100037526 3300005563 Bacteria 5761
66 Ga0068855_100076692 3300005563 Bacteria 3878
67 Ga0068857_100266693 3300005577 Bacteria 1573
68 Ga0068856_100365997 3300005614 Bacteria 1460
69 Ga0068856_100392745 3300005614 Bacteria 1407
70 Ga0068852_100141999 3300005616 Bacteria 2223
71 Ga0068852_100216491 3300005616 Bacteria 1820
72 Ga0068859_100092180 3300005617 Bacteria 3081
73 Ga0068866_10080273 3300005718 Bacteria 1750
74 Ga0068851_10141729 3300005834 Bacteria 1308
75 Ga0068863_100036014 3300005841 Bacteria 4713
76 Ga0068863_100116459 3300005841 Bacteria 2546
77 Ga0068863_100151155 3300005841 Bacteria 2221
78 Ga0068863_100445265 3300005841 Bacteria 1271
79 Ga0068863_100455047 3300005841 Bacteria 1256
80 Ga0068858_100029243 3300005842 Bacteria 5116
81 Ga0068858_100091077 3300005842 Bacteria 2838
82 Ga0068860_100000441 3300005843 Bacteria 52446
83 Ga0068862_100662443 3300005844 Bacteria 1008
84 Ga0081455_10001479 3300005937 Bacteria 29079
85 Ga0081455_10003833 3300005937 Bacteria 17148
86 Ga0081455_10053122 3300005937 Bacteria 3464
87 Ga0081455_10085161 3300005937 Bacteria 2578
88 Ga0081538_10025304 3300005981 Bacteria 4190
89 Ga0081538_10120242 3300005981 Bacteria 1264
90 Ga0081540_1004960 3300005983 Bacteria 10007
91 Ga0081540_1006444 3300005983 Bacteria 8542
92 Ga0081540_1021674 3300005983 Bacteria 3816
93 Ga0081540_1025036 3300005983 Bacteria 3447
94 Ga0081540_1026089 3300005983 Bacteria 3345
95 Ga0081540_1026760 3300005983 Bacteria 3284
96 Ga0081540_1026892 3300005983 Bacteria 3273
97 Ga0081539_10001114 3300005985 Bacteria 48756
98 Ga0081539_10001128 3300005985 Bacteria 48441
99 Ga0070717_10051443 3300006028 Bacteria 3390
100 Ga0070717_10057816 3300006028 Bacteria 3206
101 Ga0075365_10016412 3300006038 Bacteria 4505
102 Ga0075365_10078393 3300006038 Bacteria 2234
103 Ga0075365_10224578 3300006038 Bacteria 1318
104 Ga0075365_10240526 3300006038 Bacteria 1271
105 Ga0075368_10002709 3300006042 Bacteria 5837
106 Ga0075368_10032382 3300006042 Bacteria 2030
107 Ga0075363_100012045 3300006048 Bacteria 4157
108 Ga0075363_100016422 3300006048 Bacteria 3656
109 Ga0075364_10034512 3300006051 Bacteria 3264
110 Ga0075364_10062765 3300006051 Bacteria 2438
111 Ga0075364_10184785 3300006051 Bacteria 1411
112 Ga0075432_10017317 3300006058 Bacteria 2458
113 Ga0070715_10005346 3300006163 Bacteria 4276
114 Ga0070715_10022360 3300006163 Bacteria 2465
115 Ga0070716_100001217 3300006173 Bacteria 11316
116 Ga0070712_100102915 3300006175 Bacteria 2116
117 Ga0070712_100177090 3300006175 Bacteria 1659
118 Ga0070712_100449722 3300006175 Bacteria 1072
119 Ga0075362_10004628 3300006177 Bacteria 4960
120 Ga0075367_10024485 3300006178 Bacteria 3405
121 Ga0075367_10041204 3300006178 Bacteria 2699
122 Ga0075369_10080344 3300006186 Bacteria 1445
123 Ga0075369_10102720 3300006186 Bacteria 1283
124 Ga0075366_10019905 3300006195 Bacteria 3888
125 Ga0075366_10023974 3300006195 Bacteria 3557
126 Ga0075366_10073632 3300006195 Bacteria 2036
127 Ga0075366_10134994 3300006195 Bacteria 1490
128 Ga0097621_100010589 3300006237 Bacteria 6755
129 Ga0075370_10029799 3300006353 Bacteria 3041
130 Ga0075370_10032951 3300006353 Bacteria 2899
131 Ga0068871_100036409 3300006358 Bacteria 3918
132 Ga0075428_100000476 3300006844 Bacteria 40332
133 Ga0075428_100001723 3300006844 Bacteria 23380
134 Ga0075428_100274360 3300006844 Bacteria 1814
135 Ga0075430_100000201 3300006846 Bacteria 40551
136 Ga0075430_100000244 3300006846 Bacteria 37691
137 Ga0075430_100136323 3300006846 Bacteria 2045
138 Ga0075431_100000260 3300006847 Bacteria 40551
139 Ga0075433_10000007 3300006852 Bacteria 75995
140 Ga0075433_10127889 3300006852 Bacteria 2256
141 Ga0075433_10196700 3300006852 Bacteria 1793
142 Ga0075434_100000091 3300006871 Bacteria 49489
143 Ga0075434_100034266 3300006871 Bacteria 5014
144 Ga0075434_100110129 3300006871 Bacteria 2765
145 Ga0075434_100210094 3300006871 Bacteria 1966
146 Ga0075434_100276410 3300006871 Bacteria 1699
147 Ga0075429_100001265 3300006880 Bacteria 20558
148 Ga0075429_100063046 3300006880 Bacteria 3229
149 Ga0068865_100115705 3300006881 Bacteria 1985
150 Ga0068865_100121134 3300006881 Bacteria 1945
151 Ga0097620_100092182 3300006931 Bacteria 3081
152 Ga0099825_1020668 3300006941 Bacteria 4628
153 Ga0099824_1018360 3300006942 Bacteria 5770
154 Ga0075435_100003301 3300007076 Bacteria 10940
155 Ga0075435_100011769 3300007076 Bacteria 6454
156 Ga0075435_100312517 3300007076 Bacteria 1345
157 Ga0099795_10017367 3300007788 Bacteria 2293
158 Ga0105251_10119249 3300009011 Bacteria 1199
159 Ga0105240_10014700 3300009093 Bacteria 10677
160 Ga0111539_10001412 3300009094 Bacteria 31985
161 Ga0111539_10071975 3300009094 Bacteria 4078
162 Ga0111539_10569547 3300009094 Bacteria 1319
163 Ga0105245_10145957 3300009098 Bacteria 2232
164 Ga0105245_10221927 3300009098 Bacteria 1824
165 Ga0105245_10249822 3300009098 Bacteria 1723
166 Ga0114129_10002772 3300009147 Bacteria 24406
167 Ga0114129_10007261 3300009147 Bacteria 15774
168 Ga0114129_10071187 3300009147 Bacteria 4849
169 Ga0105243_10125749 3300009148 Bacteria 2168
170 Ga0105242_10004266 3300009176 Bacteria 11145
171 Ga0105242_10353114 3300009176 Bacteria 1358
172 Ga0105248_10047962 3300009177 Bacteria 4790
173 Ga0105248_10145936 3300009177 Bacteria 2670
174 Ga0105237_10023192 3300009545 Bacteria 6362
175 Ga0105238_10064515 3300009551 Bacteria 3662
176 Ga0105249_10083546 3300009553 Bacteria 2973
177 Ga0105239_10141596 3300010375 Bacteria 2680
178 Ga0105239_10166820 3300010375 Bacteria 2463
179 Ga0105239_10219240 3300010375 Bacteria 2133
180 Ga0105239_10253395 3300010375 Bacteria 1977
181 Ga0105239_10275570 3300010375 Bacteria 1893
182 Ga0105246_10034641 3300011119 Bacteria 3367
183 Ga0105246_10076063 3300011119 Bacteria 2378
184 Ga0105246_10126198 3300011119 Bacteria 1904
185 Ga0157371_10163070 3300013102 Bacteria 1592
186 Ga0157370_10232451 3300013104 Bacteria 1706
187 Ga0163162_10278586 3300013306 Bacteria 1804
188 Ga0163162_10311618 3300013306 Bacteria 1706
189 Ga0157375_10053365 3300013308 Bacteria 3977
190 Ga0163163_10006941 3300014325 Bacteria 9948
191 Ga0163163_10313152 3300014325 Bacteria 1623
192 Ga0157380_10347142 3300014326 Bacteria 1387
193 Ga0157379_10012889 3300014968 Bacteria 7313
194 Ga0157376_10288393 3300014969 Bacteria 1549
195 Ga0213876_10097083 3300021384 Bacteria 1561
196 Ga0209563_101090 3300025230 Bacteria 7793
197 Ga0209677_102351 3300025253 Bacteria 7241
198 Ga0209148_1000316 3300025254 Bacteria 68104
199 Ga0209233_1004623 3300025261 Bacteria 4654
200 Ga0209673_1025297 3300025273 Bacteria 1976
201 Ga0209564_1037958 3300025295 Bacteria 1348
202 Ga0209758_1000106 3300025297 Bacteria 218450
203 Ga0209758_1001405 3300025297 Bacteria 28529
204 Ga0209758_1002396 3300025297 Bacteria 19259
205 Ga0209758_1005929 3300025297 Bacteria 9080
206 Ga0209758_1006430 3300025297 Bacteria 8450
207 Ga0209758_1011834 3300025297 Bacteria 4981
208 Ga0209758_1024111 3300025297 Bacteria 2722
209 Ga0209758_1045760 3300025297 Bacteria 1585
210 Ga0209256_1002946 3300025299 Bacteria 12776
211 Ga0207426_1000374 3300025302 Bacteria 78498
212 Ga0207426_1001007 3300025302 Bacteria 27365
213 Ga0207426_1003263 3300025302 Bacteria 9067
214 Ga0207426_1008613 3300025302 Bacteria 4097
215 Ga0207426_1055401 3300025302 Bacteria 1161
216 Ga0209257_1001741 3300025304 Bacteria 24170
217 Ga0207692_10015365 3300025898 Bacteria 3366
218 Ga0207710_10007424 3300025900 Bacteria 4643
219 Ga0207688_10048222 3300025901 Bacteria 2380
220 Ga0207688_10079889 3300025901 Bacteria 1866
221 Ga0207680_10063441 3300025903 Bacteria 2261
222 Ga0207647_10152140 3300025904 Bacteria 1352
223 Ga0207699_10001489 3300025906 Bacteria 11129
224 Ga0207645_10021194 3300025907 Bacteria 4241
225 Ga0207645_10133652 3300025907 Bacteria 1615
226 Ga0207707_10122357 3300025912 Bacteria 2275
227 Ga0207707_10204665 3300025912 Bacteria 1720
228 Ga0207695_10000478 3300025913 Bacteria 86076
229 Ga0207671_10003084 3300025914 Bacteria 17008
230 Ga0207693_10005512 3300025915 Bacteria 10533
231 Ga0207693_10008449 3300025915 Bacteria 8426
232 Ga0207693_10027452 3300025915 Bacteria 4501
233 Ga0207693_10107351 3300025915 Bacteria 2190
234 Ga0207663_10000425 3300025916 Bacteria 18308
235 Ga0207660_10190158 3300025917 Bacteria 1598
236 Ga0207657_10130332 3300025919 Bacteria 2061
237 Ga0207649_10051415 3300025920 Bacteria 2552
238 Ga0207652_10166552 3300025921 Bacteria 1976
239 Ga0207681_10276192 3300025923 Bacteria 1321
240 Ga0207694_10114799 3300025924 Bacteria 2145
241 Ga0207650_10263109 3300025925 Bacteria 1400
242 Ga0207687_10029064 3300025927 Bacteria 3717
243 Ga0207687_10118046 3300025927 Bacteria 1979
244 Ga0207700_10005022 3300025928 Bacteria 7870
245 Ga0207700_10200398 3300025928 Bacteria 1682
246 Ga0207700_10321855 3300025928 Bacteria 1340
247 Ga0207664_10070747 3300025929 Bacteria 2808
248 Ga0207664_10146369 3300025929 Bacteria 2003
249 Ga0207644_10041059 3300025931 Bacteria 3271
250 Ga0207644_10048873 3300025931 Bacteria 3026
251 Ga0207690_10061018 3300025932 Bacteria 2562
252 Ga0207706_10057132 3300025933 Bacteria 3439
253 Ga0207686_10026307 3300025934 Bacteria 3393
254 Ga0207709_10018115 3300025935 Bacteria 3940
255 Ga0207670_10156546 3300025936 Bacteria 1697
256 Ga0207704_10163037 3300025938 Bacteria 1589
257 Ga0207665_10003367 3300025939 Bacteria 10702
258 Ga0207665_10021180 3300025939 Bacteria 4273
259 Ga0207691_10154586 3300025940 Bacteria 2015
260 Ga0207711_10009422 3300025941 Bacteria 8151
261 Ga0207711_10087313 3300025941 Bacteria 2736
262 Ga0207689_10058438 3300025942 Bacteria 3172
263 Ga0207661_10091550 3300025944 Bacteria 2534
264 Ga0207661_10302400 3300025944 Bacteria 1434
265 Ga0207667_10017077 3300025949 Bacteria 8183
266 Ga0207668_10036615 3300025972 Bacteria 3276
267 Ga0207640_10148610 3300025981 Bacteria 1718
268 Ga0207658_10164790 3300025986 Bacteria 1820
269 Ga0207677_10111086 3300026023 Bacteria 2041
270 Ga0207703_10106496 3300026035 Bacteria 2385
271 Ga0207703_10363723 3300026035 Bacteria 1335
272 Ga0207639_10197023 3300026041 Bacteria 1725
273 Ga0207678_10017546 3300026067 Bacteria 6287
274 Ga0207678_10035287 3300026067 Bacteria 4354
275 Ga0207678_10082834 3300026067 Bacteria 2744
276 Ga0207678_10124265 3300026067 Bacteria 2202
277 Ga0207641_10029014 3300026088 Bacteria 4574
278 Ga0207641_10260941 3300026088 Bacteria 1622
279 Ga0207648_10228656 3300026089 Bacteria 1654
280 Ga0207674_10066740 3300026116 Bacteria 3623
281 Ga0207674_10247135 3300026116 Bacteria 1731
282 Ga0207674_10295465 3300026116 Bacteria 1569
283 Ga0207683_10012926 3300026121 Bacteria 7128
284 Ga0207683_10111222 3300026121 Bacteria 2453
285 Ga0207683_10341545 3300026121 Bacteria 1373
286 Ga0207683_10393857 3300026121 Bacteria 1274
287 Ga0207698_10011050 3300026142 Bacteria 5837
288 Ga0209389_1000016 3300027296 Bacteria 184844
289 Ga0209389_1000027 3300027296 Bacteria 146917
290 Ga0209589_1000031 3300027357 Bacteria 147054
291 Ga0209489_100057 3300027361 Bacteria 147398
292 Ga0209489_100063 3300027361 Bacteria 144408
293 Ga0209700_100012 3300027363 Bacteria 357892
294 Ga0209588_1003621 3300027671 Bacteria 4291
295 Ga0209813_10003650 3300027866 Bacteria 3617
296 Ga0207428_10000115 3300027907 Bacteria 109072
297 Ga0207428_10005963 3300027907 Bacteria 11282
298 Ga0207428_10105287 3300027907 Bacteria 2176
299 Ga0268266_10063727 3300028379 Bacteria 3182
300 Ga0268266_10072985 3300028379 Bacteria 2977
301 Ga0268266_10079592 3300028379 Bacteria 2853
302 Ga0268266_10243943 3300028379 Bacteria 1659
303 Ga0268264_10000042 3300028381 Bacteria 372069
304 Ga0268264_10196256 3300028381 Bacteria 1843
305 Ga0268264_10242994 3300028381 Bacteria 1668
306 Ga0268264_10363661 3300028381 Bacteria 1381
307 Ga0265334_10029740 3300028573 Bacteria 2189
308 Ga0307517_10092417 3300028786 Bacteria 2462
309 Ga0307517_10156434 3300028786 Bacteria 1545
310 Ga0265338_10100786 3300028800 Bacteria 2353
311 Ga0307511_10123445 3300030521 Bacteria 1590
312 Ga0265330_10006763 3300031235 Bacteria 5653
313 Ga0265330_10008114 3300031235 Bacteria 5070
314 Ga0265332_10002834 3300031238 Bacteria 8597
315 Ga0265332_10012634 3300031238 Bacteria 3744
316 Ga0265325_10000026 3300031241 Bacteria 109937
317 Ga0265325_10008677 3300031241 Bacteria 5982
318 Ga0265325_10008781 3300031241 Bacteria 5941
319 Ga0265325_10013389 3300031241 Bacteria 4671
320 Ga0265325_10051223 3300031241 Bacteria 2123
321 Ga0265340_10001337 3300031247 Bacteria 14130
322 Ga0265340_10003564 3300031247 Bacteria 8764
323 Ga0265339_10003955 3300031249 Bacteria 10246
324 Ga0265339_10028820 3300031249 Bacteria 3154
325 Ga0265331_10006990 3300031250 Bacteria 6589
326 Ga0265331_10059477 3300031250 Bacteria 1807
327 Ga0265313_10013520 3300031595 Bacteria 4893
328 Ga0265313_10027363 3300031595 Bacteria 2985
329 Ga0265313_10027511 3300031595 Bacteria 2975
330 Ga0265313_10049471 3300031595 Bacteria 2022
331 Ga0265314_10002205 3300031711 Bacteria 20322
332 Ga0265314_10008159 3300031711 Bacteria 9012
333 Ga0265342_10000082 3300031712 Bacteria 102532
334 Ga0265342_10000291 3300031712 Bacteria 56828
335 Ga0265342_10005588 3300031712 Bacteria 9535
336 Ga0265342_10010349 3300031712 Bacteria 6481
337 Ga0265342_10014750 3300031712 Bacteria 5175
338 Ga0307516_10094154 3300031730 Bacteria 2820
339 Ga0307507_10021924 3300033179 Bacteria 7087
340 Ga0307510_10026321 3300033180 Bacteria 6688
341 Ga0307510_10230366 3300033180 Bacteria 1356
342 Ga0373959_0008517 3300034820 Bacteria 1748
343 Ga0373934_0047419 3300035086 Bacteria 1699
344 Ga0373949_0033249 3300035090 Bacteria 1238
345 Ga0373952_0016608 3300035092 Bacteria 1500
346 Ga0373923_0001865 3300035111 Bacteria 6270
347 Ga0373936_0006791 3300035113 Bacteria 4308
348 Ga0373936_0030592 3300035113 Bacteria 2123
349 Ga0373936_0049669 3300035113 Bacteria 1695
350 Ga0373941_0021210 3300035115 Bacteria 1830
351 Ga0373945_0000946 3300035116 Bacteria 8634
352 Ga0373945_0039019 3300035116 Bacteria 1710
353 Ga0373945_0124728 3300035116 Bacteria 1027
354 Ga0373953_0000156 3300035117 Bacteria 17676
355 Ga0373953_0062323 3300035117 Bacteria 1527
356 Ga0373954_0011119 3300035118 Bacteria 3982
357 Ga0373954_0013754 3300035118 Bacteria 3606
358 Ga0373954_0053883 3300035118 Bacteria 1891
359 Ga0373956_0004148 3300035119 Bacteria 5813
360 Ga0373956_0011980 3300035119 Bacteria 3584
361 Ga0373956_0118121 3300035119 Bacteria 1237
362 Ga0373957_0001409 3300035120 Bacteria 6498
363 Ga0373957_0006204 3300035120 Bacteria 3757
364 Ga0373957_0022408 3300035120 Bacteria 2251
365 Ga0373943_0001934 3300035170 Bacteria 9384
366 Ga0373943_0019251 3300035170 Bacteria 3139
367 Ga0373943_0086878 3300035170 Bacteria 1613
368 Ga0373946_0007183 3300035171 Bacteria 4068
369 Ga0373946_0024460 3300035171 Bacteria 2366
370 Ga0373955_0000395 3300035172 Bacteria 18509
371 Ga0373955_0002215 3300035172 Bacteria 8432
372 Ga0373955_0009768 3300035172 Bacteria 4508
373 Ga0373955_0050440 3300035172 Bacteria 2263
374 Ga0373924_0007061 3300035410 Bacteria 4043
375 Ga0373924_0011377 3300035410 Bacteria 3304
376 Ga0373924_0043936 3300035410 Bacteria 1836
377 Ga0373931_0013339 3300035691 Bacteria 3999
378 Ga0373931_0029855 3300035691 Bacteria 2803
379 Ga0373931_0094834 3300035691 Bacteria 1669
380 Ga0373935_0001093 3300035692 Bacteria 14823
381 Ga0373935_0029981 3300035692 Bacteria 3368
382 Ga0373935_0033201 3300035692 Bacteria 3211
383 Ga0373935_0034411 3300035692 Bacteria 3157
384 Ga0373927_0004563 3300035695 Bacteria 9675
385 Ga0373927_0021903 3300035695 Bacteria 4188
386 Ga0373927_0052489 3300035695 Bacteria 2637
387 Ga0373927_0175979 3300035695 Bacteria 1403
388 Ga0373933_0004898 3300035724 Bacteria 7306
389 Ga0373933_0007313 3300035724 Bacteria 6024
390 Ga0373933_0032029 3300035724 Bacteria 3054
391 Ga0373933_0102588 3300035724 Bacteria 1776
392 Ga0373947_0000288 3300035725 Bacteria 28482
393 Ga0373947_0024233 3300035725 Bacteria 3535
394 Ga0373947_0031415 3300035725 Bacteria 3125
395 Ga0373947_0056162 3300035725 Bacteria 2379
396 Ga0373947_0163548 3300035725 Bacteria 1440
397 Ga0373937_0000996 3300036401 Bacteria 24045
398 Ga0373937_0012002 3300036401 Bacteria 7606
399 Ga0373937_0147147 3300036401 Bacteria 2206
400 Ga0373937_0300677 3300036401 Bacteria 1517
401 Ga0373937_0566416 3300036401 Bacteria 1079
402 Ga0373925_0002967 3300037068 Bacteria 13392
403 Ga0373925_0018541 3300037068 Bacteria 5059
404 Ga0373925_0018593 3300037068 Bacteria 5052
405 Ga0373925_0021989 3300037068 Bacteria 4648
406 Ga0373925_0027832 3300037068 Bacteria 4138
407 Ga0373925_0277657 3300037068 Bacteria 1349
408 Ga0395899_0009357 3300037312 Bacteria 7526
409 Ga0395900_0119313 3300037418 Bacteria 2707
410 Ga0395898_0014236 3300037466 Bacteria 8176
411 Ga0395898_0073654 3300037466 Bacteria 3299
412 Ga0395905_0028290 3300037471 Bacteria 5283
413 Ga0395901_0078788 3300038443 Bacteria 3440
414 Ga0395901_0127711 3300038443 Bacteria 2672
415 Ga0395901_0366626 3300038443 Bacteria 1484
416 Ga0436365_1106099 3300039437 Bacteria 4187
417 Ga0436365_1584283 3300039437 Bacteria 16431
418 Ga0436360_0575108 3300039438 Bacteria 1546
419 Ga0436362_1127865 3300039453 Bacteria 2188
420 Ga0451793_1689633 3300041452 Bacteria 4087
421 Ga0439444_0004615 3300042437 Bacteria 2011
422 Ga0466972_0000177 3300044658 Bacteria 49318
423 Ga0466966_0000474 3300044684 Bacteria 25834
424 Ga0466966_0259602 3300044684 Bacteria 1046
425 Ga0466961_0000023 3300044693 Bacteria 97134
426 Ga0466963_0113294 3300044694 Bacteria 1863
427 Ga0466964_0036413 3300044706 Bacteria 1973
428 Ga0466959_0000726 3300045049 Bacteria 19220
429 Ga0466958_0050655 3300045836 Bacteria 2514
430 Ga0466967_0351957 3300045976 Bacteria 1426
431 Ga0495592_0016624 3300046454 Bacteria 5584
432 Ga0495592_0025569 3300046454 Bacteria 4481
433 Ga0495592_0041102 3300046454 Bacteria 3466
434 Ga0495592_0067804 3300046454 Bacteria 2606
435 Ga0495592_0181855 3300046454 Bacteria 1431
436 Ga0495603_0008338 3300046455 Bacteria 6265
437 Ga0495603_0026574 3300046455 Bacteria 3496
438 Ga0495603_0027248 3300046455 Bacteria 3449
439 Ga0495603_0067670 3300046455 Bacteria 2102
440 Ga0495603_0074304 3300046455 Bacteria 1996
441 Ga0495591_030268 3300046458 Bacteria 1636
442 Ga0495591_051529 3300046458 Bacteria 1123
443 Ga0495629_0000183 3300046459 Bacteria 56534
444 Ga0495629_0000655 3300046459 Bacteria 27984
445 Ga0495629_0064830 3300046459 Bacteria 2550
446 Ga0495629_0337319 3300046459 Bacteria 1029
447 Ga0495638_0009065 3300046460 Bacteria 7011
448 Ga0495638_0051383 3300046460 Bacteria 2570
449 Ga0495641_0054290 3300046461 Bacteria 1821
450 Ga0495651_0005368 3300046462 Bacteria 9782
451 Ga0495651_0007056 3300046462 Bacteria 8588
452 Ga0495651_0008033 3300046462 Bacteria 8090
453 Ga0495651_0010752 3300046462 Bacteria 7037
454 Ga0495651_0077352 3300046462 Bacteria 2519
455 Ga0495653_0004854 3300046463 Bacteria 10903
456 Ga0495653_0025885 3300046463 Bacteria 4708
457 Ga0495653_0035742 3300046463 Bacteria 3918
458 Ga0495653_0142291 3300046463 Bacteria 1685
459 Ga0495580_0106313 3300046472 Bacteria 1949
460 Ga0495582_0001121 3300046473 Bacteria 15057
461 Ga0495582_0097360 3300046473 Bacteria 1645
462 Ga0495605_0041457 3300046474 Bacteria 2293
463 Ga0495605_0069308 3300046474 Bacteria 1670
464 Ga0495639_0009485 3300046475 Bacteria 4174
465 Ga0495662_0072451 3300046476 Bacteria 1670
466 Ga0495664_0018150 3300046477 Bacteria 4025
467 Ga0495664_0032191 3300046477 Bacteria 3076
468 Ga0495664_0102880 3300046477 Bacteria 1721
469 Ga0495584_0067035 3300046491 Bacteria 1805
470 Ga0495585_0003428 3300046492 Bacteria 10719
471 Ga0495594_0017097 3300046499 Bacteria 3828
472 Ga0495594_0155501 3300046499 Bacteria 1298
473 Ga0495596_0000078 3300046500 Bacteria 67709
474 Ga0495596_0103616 3300046500 Bacteria 1105
475 Ga0495607_0009340 3300046501 Bacteria 6643
476 Ga0495606_0010252 3300046507 Bacteria 7806
477 Ga0495608_0002221 3300046511 Bacteria 14008
478 Ga0495608_0009154 3300046511 Bacteria 6922
479 Ga0495608_0015766 3300046511 Bacteria 5230
480 Ga0495610_0057636 3300046512 Bacteria 1862
481 Ga0495616_0093166 3300046513 Bacteria 1423
482 Ga0495618_0013409 3300046514 Bacteria 4987
483 Ga0495618_0049560 3300046514 Bacteria 2652
484 Ga0495620_0014591 3300046515 Bacteria 3990
485 Ga0495620_0052579 3300046515 Bacteria 1729
486 Ga0495628_0000950 3300046516 Bacteria 26607
487 Ga0495628_0008803 3300046516 Bacteria 8638
488 Ga0495628_0049682 3300046516 Bacteria 3320
489 Ga0495628_0207020 3300046516 Bacteria 1476
490 Ga0495630_0069053 3300046517 Bacteria 2658
491 Ga0495630_0127087 3300046517 Bacteria 1935
492 Ga0495631_0000031 3300046518 Bacteria 85555
493 Ga0495631_0060865 3300046518 Bacteria 1638
494 Ga0495631_0081087 3300046518 Bacteria 1400
495 Ga0495637_0000365 3300046520 Bacteria 34448
496 Ga0495643_0104565 3300046522 Bacteria 1447
497 Ga0495644_0000234 3300046523 Bacteria 26118
498 Ga0495648_0017345 3300046524 Bacteria 5150
499 Ga0495648_0023302 3300046524 Bacteria 4244
500 Ga0495648_0163601 3300046524 Bacteria 1147
501 Ga0495666_0046661 3300046526 Bacteria 2088
502 Ga0495642_0017866 3300046528 Bacteria 2772
503 Ga0495652_0002257 3300046529 Bacteria 20113
504 Ga0495652_0026522 3300046529 Bacteria 5118
505 Ga0495652_0030285 3300046529 Bacteria 4747
506 Ga0495652_0038700 3300046529 Bacteria 4129
507 Ga0495652_0056866 3300046529 Bacteria 3320
508 Ga0495652_0106339 3300046529 Bacteria 2266
509 Ga0495652_0136539 3300046529 Bacteria 1934
510 Ga0495652_0278038 3300046529 Bacteria 1227
511 Ga0495665_0028743 3300046531 Bacteria 2979
512 Ga0495640_0009446 3300046533 Bacteria 7597
513 Ga0495640_0011385 3300046533 Bacteria 6843
514 Ga0495640_0012912 3300046533 Bacteria 6368
515 Ga0495640_0018366 3300046533 Bacteria 5190
516 Ga0495640_0042700 3300046533 Bacteria 3161
517 Ga0495640_0068492 3300046533 Bacteria 2388
518 Ga0495587_0002956 3300046536 Bacteria 11364
519 Ga0495587_0007940 3300046536 Bacteria 6854
520 Ga0495587_0018590 3300046536 Bacteria 4309
521 Ga0495587_0029301 3300046536 Bacteria 3342
522 Ga0495587_0029645 3300046536 Bacteria 3321
523 Ga0495621_0000357 3300046539 Bacteria 11123
524 Ga0495645_0001487 3300046543 Bacteria 15879
525 Ga0495645_0002475 3300046543 Bacteria 12548
526 Ga0495645_0002973 3300046543 Bacteria 11471
527 Ga0495645_0014710 3300046543 Bacteria 5557
528 Ga0495645_0042082 3300046543 Bacteria 3330
529 Ga0495622_0008747 3300046557 Bacteria 4691
530 Ga0495622_0015742 3300046557 Bacteria 3517
531 Ga0495622_0064788 3300046557 Bacteria 1690
532 Ga0495633_0002692 3300046558 Bacteria 12335
533 Ga0495667_0008800 3300046559 Bacteria 6864
534 Ga0495667_0034771 3300046559 Bacteria 3369
535 Ga0495667_0230581 3300046559 Bacteria 1180
536 Ga0495667_0250542 3300046559 Bacteria 1127
537 Ga0495656_0000174 3300046615 Bacteria 22784
538 Ga0495668_0012879 3300046616 Bacteria 4952
539 Ga0495668_0156697 3300046616 Bacteria 1247
540 Ga0495668_0212793 3300046616 Bacteria 1058
541 Ga0495634_0011443 3300046642 Bacteria 6457
542 Ga0495634_0025684 3300046642 Bacteria 4115
543 Ga0495634_0028246 3300046642 Bacteria 3895
544 Ga0495634_0030566 3300046642 Bacteria 3719
545 Ga0495634_0038590 3300046642 Bacteria 3255
546 Ga0495611_0054934 3300046648 Bacteria 1801
547 Ga0495625_0005608 3300046660 Bacteria 11377
548 Ga0495635_0000380 3300046663 Bacteria 28177
549 Ga0495635_0006494 3300046663 Bacteria 8155
550 Ga0495635_0036420 3300046663 Bacteria 3411
551 Ga0495635_0102821 3300046663 Bacteria 1952
552 Ga0495635_0257140 3300046663 Bacteria 1176
553 Ga0495659_0000220 3300046664 Bacteria 24427
554 Ga0495661_0147563 3300046665 Bacteria 1273
555 Ga0495588_0011399 3300046674 Bacteria 4170
556 Ga0495588_0017305 3300046674 Bacteria 3497
557 Ga0495588_0096356 3300046674 Bacteria 1552
558 Ga0495588_0134287 3300046674 Bacteria 1306
559 Ga0495657_0001852 3300046675 Bacteria 18026
560 Ga0495657_0004929 3300046675 Bacteria 10619
561 Ga0495657_0005248 3300046675 Bacteria 10255
562 Ga0495657_0021999 3300046675 Bacteria 4571
563 Ga0495657_0098633 3300046675 Bacteria 1864
564 Ga0495657_0187104 3300046675 Bacteria 1267
565 Ga0495599_0004515 3300046678 Bacteria 8252
566 Ga0495599_0027283 3300046678 Bacteria 3579
567 Ga0495599_0068007 3300046678 Bacteria 2224
568 Ga0495623_0001484 3300046679 Bacteria 15894
569 Ga0495623_0002235 3300046679 Bacteria 12884
570 Ga0495623_0004582 3300046679 Bacteria 9082
571 Ga0495646_0006953 3300046680 Bacteria 7181
572 Ga0495646_0055279 3300046680 Bacteria 2384
573 Ga0495647_0029945 3300046681 Bacteria 2016
574 Ga0495647_0055145 3300046681 Bacteria 1555
575 Ga0495658_0000357 3300046683 Bacteria 25736
576 Ga0495658_0040718 3300046683 Bacteria 2584
577 Ga0495669_0015903 3300046684 Bacteria 3221
578 Ga0495613_0009346 3300046689 Bacteria 7273
579 Ga0495613_0013096 3300046689 Bacteria 6163
580 Ga0495613_0030108 3300046689 Bacteria 4033
581 Ga0495613_0086422 3300046689 Bacteria 2274
582 Ga0495613_0153263 3300046689 Bacteria 1642
583 Ga0495624_0100338 3300046690 Bacteria 1782
584 Ga0495624_0151959 3300046690 Bacteria 1416
585 Ga0495670_0000414 3300046691 Bacteria 20494
586 Ga0495671_0061704 3300046692 Bacteria 1849
587 Ga0495649_0018372 3300046694 Bacteria 3934
588 Ga0495600_0007486 3300046809 Bacteria 6681
589 Ga0495600_0014864 3300046809 Bacteria 4911
590 Ga0495600_0067298 3300046809 Bacteria 2341
591 Ga0495600_0215515 3300046809 Bacteria 1229
592 Ga0495660_0050315 3300046810 Bacteria 2271
593 Ga0495581_0010000 3300047315 Bacteria 5486
594 Ga0495581_0103688 3300047315 Bacteria 1653
595 Ga0495604_0008886 3300047317 Bacteria 7941
596 Ga0495604_0017648 3300047317 Bacteria 5712
597 Ga0495604_0038454 3300047317 Bacteria 3764
598 Ga0495604_0050016 3300047317 Bacteria 3246
599 Ga0495604_0071653 3300047317 Bacteria 2620
600 Ga0495604_0138503 3300047317 Bacteria 1741
601 Ga0495636_0002324 3300047318 Bacteria 7303
602 Ga0495674_0024907 3300047319 Bacteria 5492
603 Ga0495674_0044316 3300047319 Bacteria 3955
604 Ga0495674_0055217 3300047319 Bacteria 3484
605 Ga0495674_0083157 3300047319 Bacteria 2744
606 Ga0495674_0168794 3300047319 Bacteria 1827
607 Ga0495676_0014158 3300047321 Bacteria 7141
608 Ga0495680_0001462 3300047322 Bacteria 25495
609 Ga0495680_0002016 3300047322 Bacteria 21294
610 Ga0495680_0012241 3300047322 Bacteria 7561
611 Ga0495680_0081922 3300047322 Bacteria 2435
612 Ga0495680_0281194 3300047322 Bacteria 1173
613 Ga0495675_0001856 3300047444 Bacteria 12578
614 Ga0495675_0014120 3300047444 Bacteria 5049
615 Ga0495675_0060074 3300047444 Bacteria 2409
616 Ga0495677_0081228 3300047445 Bacteria 1215
617 Ga0495685_018416 3300047447 Bacteria 2397
618 Ga0495673_0074730 3300047469 Bacteria 1417
619 Ga0495684_0000294 3300047471 Bacteria 40596
620 Ga0495684_0001528 3300047471 Bacteria 18538
621 Ga0495684_0048992 3300047471 Bacteria 3230
622 Ga0495684_0066991 3300047471 Bacteria 2730
623 Ga0495684_0103985 3300047471 Bacteria 2146
624 Ga0495686_0052087 3300047472 Bacteria 2567
625 Ga0495593_0000744 3300047673 Bacteria 18938
626 Ga0495593_0010818 3300047673 Bacteria 5260
627 Ga0495593_0036316 3300047673 Bacteria 2672
628 Ga0495602_0001368 3300048088 Bacteria 24064
629 Ga0495602_0004084 3300048088 Bacteria 15203
630 Ga0495614_0005613 3300048089 Bacteria 5658
631 Ga0495614_0093364 3300048089 Bacteria 1310
632 Ga0495614_0114140 3300048089 Bacteria 1187
633 Ga0496100_0002106 3300048903 Bacteria 10022
634 Ga0496100_0111181 3300048903 Bacteria 1903
635 Ga0496100_0152266 3300048903 Bacteria 1651
636 Ga0496101_0015113 3300048904 Bacteria 5195
637 Ga0496101_0028676 3300048904 Bacteria 3888
638 Ga0496102_0005062 3300048905 Bacteria 11158
639 Ga0496104_0001363 3300048907 Bacteria 21131
640 Ga0496104_0002005 3300048907 Bacteria 17670
641 Ga0496104_0023320 3300048907 Bacteria 5689
642 Ga0496104_0158815 3300048907 Bacteria 2169
643 Ga0496104_0210555 3300048907 Bacteria 1855
644 Ga0496104_0513471 3300048907 Bacteria 1109
645 Ga0496105_0033897 3300048908 Bacteria 4197
646 Ga0496105_0045632 3300048908 Bacteria 3616
647 Ga0496105_0124238 3300048908 Bacteria 2127
648 Ga0496105_0133756 3300048908 Bacteria 2043
649 Ga0496106_0014884 3300048909 Bacteria 5755
650 Ga0496107_0001189 3300048910 Bacteria 15840
651 Ga0496107_0054251 3300048910 Bacteria 2892
652 Ga0496107_0111890 3300048910 Bacteria 2007
653 Ga0496108_0010537 3300048911 Bacteria 7512
654 Ga0496108_0050304 3300048911 Bacteria 3488
655 Ga0496109_0000700 3300048912 Bacteria 27897
656 Ga0496109_0171908 3300048912 Bacteria 2033
657 Ga0496109_0208827 3300048912 Bacteria 1836
658 Ga0496110_0073990 3300048913 Bacteria 3024
659 Ga0496110_0150513 3300048913 Bacteria 2107
660 Ga0496110_0197818 3300048913 Bacteria 1826
661 Ga0496110_0217372 3300048913 Bacteria 1738
662 Ga0496111_0002128 3300048914 Bacteria 11829
663 Ga0496111_0030278 3300048914 Bacteria 3849
664 Ga0496111_0075974 3300048914 Bacteria 2448
665 Ga0496111_0199970 3300048914 Bacteria 1486
666 Ga0496112_0006626 3300048915 Bacteria 10196
667 Ga0496112_0043988 3300048915 Bacteria 4373
668 Ga0496112_0140196 3300048915 Bacteria 2387
669 Ga0496113_0001279 3300048916 Bacteria 13876
670 Ga0496113_0064157 3300048916 Bacteria 2776
671 Ga0496113_0153261 3300048916 Bacteria 1819
672 Ga0496113_0292007 3300048916 Bacteria 1304
673 Ga0496114_0155999 3300048917 Bacteria 1982
674 Ga0496114_0354705 3300048917 Bacteria 1297
675 Ga0496115_0024926 3300048918 Bacteria 4652
676 Ga0496115_0050932 3300048918 Bacteria 3320
677 Ga0496115_0109328 3300048918 Bacteria 2270
678 Ga0496116_0182671 3300048919 Bacteria 1120
679 Ga0496117_0081359 3300048920 Bacteria 2126
680 Ga0496118_0107467 3300048921 Bacteria 1863
681 Ga0496118_0183053 3300048921 Bacteria 1263
682 Ga0496119_0012670 3300048922 Bacteria 6823
683 Ga0496119_0058223 3300048922 Bacteria 2330
684 Ga0496121_0031768 3300048924 Bacteria 4816
685 Ga0496121_0050990 3300048924 Bacteria 3489
686 Ga0496121_0298115 3300048924 Bacteria 1095
687 Ga0496124_0061180 3300048927 Bacteria 3157
688 Ga0496126_0044707 3300048929 Bacteria 4076
689 Ga0496126_0053837 3300048929 Bacteria 3648
690 Ga0496126_0195743 3300048929 Bacteria 1709
691 Ga0501032_0095172 3300049569 Bacteria 1974
692 Ga0501033_0232716 3300049570 Bacteria 1308
693 Ga0501034_0064750 3300049571 Bacteria 3669
694 Ga0501034_0264153 3300049571 Bacteria 1663
695 Ga0501036_0005977 3300049572 Bacteria 9869
696 Ga0501037_0003231 3300049573 Bacteria 11812
697 Ga0501037_0031825 3300049573 Bacteria 3895
698 Ga0501038_0020838 3300049574 Bacteria 5891
699 Ga0501038_0058873 3300049574 Bacteria 3292
700 Ga0501038_0089706 3300049574 Bacteria 2578
701 Ga0501039_0001869 3300049575 Bacteria 15563
702 Ga0501043_0134930 3300049579 Bacteria 1934
703 Ga0501047_0008244 3300049581 Bacteria 9834
704 Ga0501047_0011033 3300049581 Bacteria 8549
705 Ga0501047_0045692 3300049581 Bacteria 4234
706 Ga0501047_0128370 3300049581 Bacteria 2415
707 Ga0501048_0034771 3300049582 Bacteria 3632
708 Ga0501067_0172555 3300049583 Bacteria 1204
709 Ga0501068_0014174 3300049584 Bacteria 4553
710 Ga0501069_0000929 3300049585 Bacteria 13961
711 Ga0501070_0038726 3300049586 Bacteria 3978
712 Ga0501071_0079370 3300049587 Bacteria 2399
713 Ga0501072_0177907 3300049588 Bacteria 1697
714 Ga0501072_0186968 3300049588 Bacteria 1652
715 Ga0501073_0017185 3300049589 Bacteria 5239
716 Ga0501074_0022225 3300049590 Bacteria 4609
717 Ga0501074_0089456 3300049590 Bacteria 2205
718 Ga0501076_0362473 3300049592 Bacteria 1191
719 Ga0501079_0064503 3300049741 Bacteria 2825
720 Ga0501079_0099173 3300049741 Bacteria 2258
721 Ga0501079_0210187 3300049741 Bacteria 1520
722 Ga0501080_0031235 3300049742 Bacteria 4963
723 Ga0501081_0168148 3300049743 Bacteria 1582
724 Ga0501083_0010731 3300049744 Bacteria 6442
725 Ga0501083_0047864 3300049744 Bacteria 2887
726 Ga0501035_0014209 3300049822 Bacteria 7348
727 Ga0501035_0060738 3300049822 Bacteria 3365
728 Ga0501035_0340851 3300049822 Bacteria 1256
729 Ga0501044_0000286 3300049823 Bacteria 64389
730 Ga0501044_0003023 3300049823 Bacteria 19032
731 Ga0501044_0034776 3300049823 Bacteria 5282
732 Ga0501044_0093844 3300049823 Bacteria 3025
733 Ga0501045_0114802 3300049824 Bacteria 1997
734 nmdc:mga03683_4316_c1 3300050489 Bacteria 4700
735 nmdc:mga03n38_13494_c2 3300050490 Bacteria 2796
736 nmdc:mga00v17_80108_c1 3300050491 Bacteria 2038
737 nmdc:mga0yw44_18826_c1 3300050492 Bacteria 3792
738 nmdc:mga0yw44_40147_c1 3300050492 Bacteria 2779
739 nmdc:mga0k408_6246_c1 3300050493 Bacteria 6358
740 nmdc:mga0k408_8333_c1 3300050493 Bacteria 5562
741 nmdc:mga0k408_94704_c1 3300050493 Bacteria 1756
742 nmdc:mga06z11_112871_c1 3300050494 Bacteria 1507
743 nmdc:mga06z11_43584_c1 3300050494 Bacteria 2259
744 nmdc:mga04h51_4263_c1 3300050495 Bacteria 3542
745 nmdc:mga04h51_6786_c1 3300050495 Bacteria 2990
746 nmdc:mga07m45_126220_c1 3300050496 Bacteria 1479
747 nmdc:mga07m45_177281_c1 3300050496 Bacteria 1239
748 nmdc:mga07m45_5888_c1 3300050496 Bacteria 6153
749 nmdc:mga07m45_81446_c1 3300050496 Bacteria 1848
750 nmdc:mga07m45_8967_c1 3300050496 Bacteria 5164
751 nmdc:mga05p37_2742_c1 3300050507 Bacteria 20456
752 nmdc:mga05p37_828_c1 3300050507 Bacteria 34679
753 nmdc:mga09592_103801_c1 3300050508 Bacteria 2436
754 nmdc:mga09592_21763_c1 3300050508 Bacteria 5287
755 nmdc:mga0qj67_165_c1 3300050509 Bacteria 44307
756 nmdc:mga0qj67_64106_c1 3300050509 Bacteria 2922
757 nmdc:mga06r32_253385_c1 3300050510 Bacteria 1748
758 nmdc:mga06r32_513_c1 3300050510 Bacteria 33328
759 nmdc:mga08y16_228014_c1 3300050511 Bacteria 1927
760 nmdc:mga08y16_3986_c1 3300050511 Bacteria 15398
761 nmdc:mga08y16_4405_c1 3300050511 Bacteria 14718
762 nmdc:mga0n895_18031_c1 3300050512 Bacteria 6525
763 nmdc:mga0n895_385578_c1 3300050512 Bacteria 1418
764 nmdc:mga0n895_4431_c1 3300050512 Bacteria 11539
765 nmdc:mga0n895_94685_c1 3300050512 Bacteria 2991
766 nmdc:mga0rr50_4443_c1 3300050513 Bacteria 8252
767 nmdc:mga0a205_12519_c1 3300050515 Bacteria 7852
768 nmdc:mga0a205_75792_c2 3300050515 Bacteria 2296
769 nmdc:mga0sz30_17557_c1 3300050516 Bacteria 2855
770 nmdc:mga0sz30_20084_c1 3300050516 Bacteria 2692
771 Ga0495601_0000075 3300053077 Bacteria 54434
772 Ga0495601_0003475 3300053077 Bacteria 9043
773 Ga0495601_0007907 3300053077 Bacteria 6263
774 Ga0495601_0028022 3300053077 Bacteria 3486
775 Ga0495612_0002526 3300053078 Bacteria 7556
776 Ga0495612_0008861 3300053078 Bacteria 4076
777 Ga0495612_0011526 3300053078 Bacteria 3564
778 Ga0495612_0017374 3300053078 Bacteria 2881
779 Ga0495612_0077915 3300053078 Bacteria 1389
780 Ga0500610_0015285 3300053079 Bacteria 3631
781 Ga0500635_0004404 3300053080 Bacteria 3627
782 Ga0495595_0000253 3300053084 Bacteria 21240
783 Ga0495595_0000311 3300053084 Bacteria 18978
784 Ga0495595_0000670 3300053084 Bacteria 13076
785 Ga0495595_0002803 3300053084 Bacteria 6859
786 Ga0495595_0009800 3300053084 Bacteria 3971
787 Ga0495619_0000301 3300053085 Bacteria 34829
788 Ga0495619_0000315 3300053085 Bacteria 33904
789 Ga0495619_0000645 3300053085 Bacteria 22971
790 Ga0495619_0003855 3300053085 Bacteria 9655
791 Ga0495619_0036799 3300053085 Bacteria 3188
792 Ga0495619_0065853 3300053085 Bacteria 2418
793 Ga0495619_0191487 3300053085 Bacteria 1415
794 Ga0495619_0223462 3300053085 Bacteria 1304
795 Ga0500643_000052 3300053087 Bacteria 144656
796 Ga0500643_004518 3300053087 Bacteria 6255
797 Ga0500651_0004830 3300053093 Bacteria 7608
798 Ga0500566_0002512 3300053094 Bacteria 10894
799 Ga0500641_0007654 3300053096 Bacteria 3851
800 Ga0500648_136430 3300053097 Bacteria 1324
801 Ga0500650_0131108 3300053098 Bacteria 1165
802 Ga0500555_039695 3300053103 Bacteria 1313
803 Ga0500556_0008815 3300053104 Bacteria 2916
804 Ga0500557_000057 3300053105 Bacteria 47849
805 Ga0500569_004458 3300053109 Bacteria 2944
806 Ga0500593_003210 3300053117 Bacteria 6136
807 Ga0500594_0000589 3300053118 Bacteria 7788
808 Ga0500595_000002 3300053119 Bacteria 1074388
809 Ga0500595_000558 3300053119 Bacteria 22207
810 Ga0500595_002578 3300053119 Bacteria 8853
811 Ga0500607_103185 3300053121 Bacteria 1412
812 Ga0500642_0000263 3300053130 Bacteria 19627
813 Ga0500642_0016379 3300053130 Bacteria 2814
814 Ga0500658_0099854 3300053134 Bacteria 1265
815 Ga0500559_0025253 3300053136 Bacteria 2528
816 Ga0500564_093204 3300053138 Bacteria 1339
817 Ga0500568_0010868 3300053139 Bacteria 4245
818 Ga0500568_0038089 3300053139 Bacteria 1948
819 Ga0500568_0095310 3300053139 Bacteria 1120
820 Ga0500590_059797 3300053148 Bacteria 1917
821 Ga0500590_150761 3300053148 Bacteria 1049
822 Ga0500604_0040168 3300053151 Bacteria 1409
823 Ga0500616_0000002 3300053153 Bacteria 1611257
824 Ga0500616_0013214 3300053153 Bacteria 4804
825 Ga0500622_0004797 3300053156 Bacteria 8308
826 Ga0500622_0103055 3300053156 Bacteria 1403
827 Ga0500627_0085024 3300053158 Bacteria 1412
828 Ga0500638_152727 3300053162 Bacteria 1025
829 Ga0500636_0001378 3300053177 Bacteria 13188
830 Ga0500636_0002410 3300053177 Bacteria 10348
831 Ga0500636_0020617 3300053177 Bacteria 3902
832 Ga0500636_0037056 3300053177 Bacteria 2885
833 Ga0500625_003219 3300053729 Bacteria 6391
834 Ga0500596_003341 3300053735 Bacteria 3065
835 Ga0500599_009231 3300053736 Bacteria 1289
836 Ga0501084_0035333 3300054114 Bacteria 4178
837 Ga0500661_022306 3300055283 Bacteria 1122
838 2508545757 2508501009 Bacteria 7784016
839 2508694582 2508501042 Bacteria 8719808
840 2511398413 2511231028 Bacteria 8046582
841 2513624505 2513237092 Bacteria 8341956
842 2513638631 2513237094 Bacteria 8789602
843 2513649981 2513237095 Bacteria 8976980
844 2513716826 2513237104 Bacteria 10034502
845 2513874273 2513237139 Bacteria 8737671
846 2513892373 2513237141 Bacteria 8496279
847 2515624489 2515154112 Bacteria 8294334
848 2517104581 2517093001 Bacteria 9002274
849 2524438538 2524023205 Bacteria 8918781
850 2528850385 2528768022 Bacteria 10457665
851 2617354178 2617270735 Bacteria 9163226
852 2643757459 2643221547 Bacteria 4740017
853 2723842586 2721755755 Bacteria 8322773
854 2745077237 2744054633 Bacteria 8678936
855 2793059409 2791355196 Bacteria 7323613
856 2793078542
857 2805916039 2802429603 Bacteria 8777136
858 2818240981 2816332527 Bacteria 8933356
859 2824604431 2824600985 Bacteria 8488197
860 2824615028 2824609381 Bacteria 8672835
861 2824659188 2824653114 Bacteria 8493680
862 2824665218 2824661429 Bacteria 9877870
863 2824701854 2824696289 Bacteria 8335049
864 2824778256 2824773399 Bacteria 8360218
865 2841960688 2841957949 Bacteria 8652217
866 2842041788 2842038055 Bacteria 8002051
867 2842049830 2842045827 Bacteria 8006841
868 2844321329 2844315083 Bacteria 8138177
869 2847932081 2847930680 Bacteria 9342022
870 2847943318 2847939898 Bacteria 8606328
871 2849077046 2849076700 Bacteria 7039503
872 2857514669 2857509624 Bacteria 7472071
873 2874595720 2874590934 Bacteria 8299676
874 2874606729 2874604998 Bacteria 7834745
875 2874624216 2874620515 Bacteria 8290088
876 2874630313 2874628541 Bacteria 8630250
877 2874651648 2874645413 Bacteria 8214782
878 2876767655 2876761206 Bacteria 10111113
879 2876775915 2876771140 Bacteria 8287509
880 2876821543 2876818435 Bacteria 8274608
881 2879080006 2879074833 Bacteria 8279565
882 2879100589 2879099564 Bacteria 10442239
883 2879134089 2879127579 Bacteria 8294491
884 2879148574 2879142872 Bacteria 8267021
885 2881669308 2881665667 Bacteria 8175609
886 2885412175 2885409591 Bacteria 9235467
887 2888387626 2888378607 Bacteria 9652610
888 2888391536 2888388044 Bacteria 7304136
889 2888426842 2888419890 Bacteria 7857137
890 2903731481 2903727486 Bacteria 8281579
891 2904483567 2904479285 Bacteria 5073931
892 2904670927 2904666416 Bacteria 8226587
893 2906607943 2906602504 Bacteria 8295279
894 2906650121 2906643746 Bacteria 8722424
895 2922376610
896 2929201839 2929199973 Bacteria 7260745
897 2929619886 2929615660 Bacteria 9193770
898 2929629198 2929624759 Bacteria 9339455
899 2932789671 2932784394 Bacteria 9704911
900 2932796661 2932794094 Bacteria 7915132
901 2932802559 2932801729 Bacteria 7987968
902 2932814823 2932809354 Bacteria 9135765
903 2932824320 2932818245 Bacteria 9955613
904 2932833952 2932828146 Bacteria 9745859
905 2933581804 2933577622 Bacteria 9116884
906 2935613262 2935608549 Bacteria 8203142
907 2935623658 2935616580 Bacteria 9032984
908 2935645045 2935638405 Bacteria 10015038
909 2935656624 2935648319 Bacteria 8801166
910 2935665452 2935656913 Bacteria 8965014
911 2935672094 2935665750 Bacteria 9571747
912 2935684100 2935675223 Bacteria 9928132
913 2935689149 2935684952 Bacteria 9590419
914 2935697591 2935694250 Bacteria 9291695
915 2935711383 2935703347 Bacteria 10242284
916 2935720095 2935713505 Bacteria 9608509
917 2935728288 2935722832 Bacteria 9608746
918 2935737115 2935732158 Bacteria 9706831
919 2935746824 2935741537 Bacteria 9707219
920 2935757791 2935750917 Bacteria 9590372
921 2935764171 2935760218 Bacteria 9817913
922 2935775201 2935769743 Bacteria 7878163
923 2935780103 2935777560 Bacteria 8077691
924 2935790225 2935785616 Bacteria 7962367
925 2935798733 2935793552 Bacteria 8012592
926 2935808757 2935801545 Bacteria 9301974
927 2935817554 2935810662 Bacteria 9401221
928 2935824884 2935819856 Bacteria 8261050
929 2935834109 2935827899 Bacteria 10038562
930 2935844711 2935837841 Bacteria 9454360
931 2935852104 2935847175 Bacteria 8228321
932 2935861735 2935855204 Bacteria 9035059
933 2935868629 2935864058 Bacteria 9784707
934 2935879403 2935873716 Bacteria 9632195
935 2935887001 2935883170 Bacteria 7964738
936 2935911451 2935908558 Bacteria 8568796
937 2935920986 2935916978 Bacteria 9113783
938 2935928480 2935926038 Bacteria 8601059
939 2935938125 2935934488 Bacteria 8602579
940 2935945407 2935942939 Bacteria 8599779
941 2935954087 2935951376 Bacteria 8602333
942 2935965466 2935959822 Bacteria 7869783
943 2935971645 2935967501 Bacteria 8603075
944 2935980049 2935975950 Bacteria 8347125
945 2935989477 2935984226 Bacteria 8302647
946 2935998429 2935992306 Bacteria 9802711
947 2936009110 2936002035 Bacteria 9362176
948 2936019487 2936011229 Bacteria 8801034
949 2936028103 2936019824 Bacteria 8804134
950 2936036937 2936028420 Bacteria 8965941
951 2936044351 2936037263 Bacteria 9446081
952 2936054960 2936046547 Bacteria 8903709
953 2936060733 2936055302 Bacteria 8785755
954 2940563387 2940556831 Bacteria 9590747
955 2941531902 2941531003 Bacteria 7653939
956 2941545394 2941538514 Bacteria 9402094
957 3005601681 3005594810 Bacteria 8716512
958 3005724363 3005718088 Bacteria 8283608
959 8006999137 8006994254 Bacteria 8309700
960 8016525096 8016522445 Bacteria 8156687
961 8016538672 8016530956 Bacteria 8155261
962 8016542959 8016539877 Bacteria 8155419
963 8016558739 8016557553 Bacteria 8154380
964 8016581015 8016575299 Bacteria 8154085
965 8016596715 8016595262 Bacteria 8149947
966 8016630208 8016622563 Bacteria 7999408
967 8016636942 8016630954 Bacteria 9217207
968 8017066283 8017057580 Bacteria 10023680
969 8019538344 8019530166 Bacteria 8155624
970 8019541478 8019538911 Bacteria 7872763
971 8019549149 8019547302 Bacteria 7996444
972 8019578340 8019576017 Bacteria 10049540
973 8019596378 8019586578 Bacteria 10212056
974 8019605323 8019597564 Bacteria 10041141
975 8019613219 8019608314 Bacteria 10042931
976 8019623901 8019619141 Bacteria 9218857
977 8019638139 8019629233 Bacteria 8687553
978 8019641497 8019638758 Bacteria 9062356
979 8019651545 8019648815 Bacteria 10014479
980 8019666053 8019659431 Bacteria 8577854
981 8019675572 8019668869 Bacteria 8791617
982 8019680527 8019678201 Bacteria 8863603
983 8019695226 8019687851 Bacteria 8712826
984 8055228655 8055225921 Bacteria 3341787
985 8055750362 8055742211 Bacteria 9226248
986 8055916289 8055909800 Bacteria 7278581
987 8056678856 8056673599 Bacteria 7871253
988 8056976133 8056967851 Bacteria 9038162
989 Ga0395900_0178657
990 JGI25406J46586_10000359
991 JGI25406J46586_10006073
992 JGI25153J46596_10004803
993 JGI25153J46596_10005279
994 JGI25153J46596_10005848
995 JGI25153J46596_10007756
996 rootH2_10062151
997 JGI25160J50197_1008171
998 JGI25160J50197_1031104
999 JGI25404J52841_10030037
1000 Ga0055543_1011624
1001 Ga0065165_1000919
1002 Ga0065165_1002792
1003 Ga0065165_1005273
1004 Ga0070658_10045234
1005 Ga0070658_10093766
1006 Ga0070658_10293588
1007 Ga0070676_10044708
1008 Ga0070676_10136276
1009 Ga0070683_100149805
1010 Ga0070690_100059558
1011 Ga0070690_100078710
1012 Ga0070680_100077218
1013 Ga0070680_100131705
1014 Ga0070682_100190506
1015 Ga0068868_100030792
1016 Ga0070660_100151829
1017 Ga0070660_100220170
1018 Ga0070689_100219789
1019 Ga0070687_100055331
1020 Ga0070661_100271496
1021 Ga0070668_100076521
1022 Ga0070668_100133095
1023 Ga0070668_100217989
1024 Ga0070675_100118178
1025 Ga0070671_100055275
1026 Ga0070674_100386901
1027 Ga0070673_100069800
1028 Ga0070709_10007358
1029 Ga0070709_10024332
1030 Ga0070709_10078062
1031 Ga0070709_10141936
1032 Ga0070714_100024637
1033 Ga0070713_100007733
1034 Ga0070713_100039241
1035 Ga0070710_10002417
1036 Ga0070710_10038634
1037 Ga0070711_100006676
1038 Ga0070663_100069526
1039 Ga0070663_100300982
1040 Ga0070662_100351488
1041 Ga0070681_10050857
1042 Ga0070681_10074250
1043 Ga0070681_10223614
1044 Ga0068853_100042910
1045 Ga0068853_100449012
1046 Ga0070686_100008070
1047 Ga0070696_100048131
1048 Ga0070696_100107754
1049 Ga0070665_100015092
1050 Ga0070665_100099359
1051 Ga0070665_100405452
1052 Ga0068855_100001526
1053 Ga0068855_100037526
1054 Ga0068855_100076692
1055 Ga0068857_100266693
1056 Ga0068856_100365997
1057 Ga0068856_100392745
1058 Ga0068852_100141999
1059 Ga0068852_100216491
1060 Ga0068859_100092180
1061 Ga0068866_10080273
1062 Ga0068851_10141729
1063 Ga0068863_100036014
1064 Ga0068863_100116459
1065 Ga0068863_100151155
1066 Ga0068863_100445265
1067 Ga0068863_100455047
1068 Ga0068858_100029243
1069 Ga0068858_100091077
1070 Ga0068860_100000441
1071 Ga0068862_100662443
1072 Ga0081455_10001479
1073 Ga0081455_10003833
1074 Ga0081455_10053122
1075 Ga0081455_10085161
1076 Ga0081538_10025304
1077 Ga0081538_10120242
1078 Ga0081540_1004960
1079 Ga0081540_1006444
1080 Ga0081540_1021674
1081 Ga0081540_1025036
1082 Ga0081540_1026089
1083 Ga0081540_1026760
1084 Ga0081540_1026892
1085 Ga0081539_10001114
1086 Ga0081539_10001128
1087 Ga0070717_10051443
1088 Ga0070717_10057816
1089 Ga0075365_10016412
1090 Ga0075365_10078393
1091 Ga0075365_10224578
1092 Ga0075365_10240526
1093 Ga0075368_10002709
1094 Ga0075368_10032382
1095 Ga0075363_100012045
1096 Ga0075363_100016422
1097 Ga0075364_10034512
1098 Ga0075364_10062765
1099 Ga0075364_10184785
1100 Ga0075432_10017317
1101 Ga0070715_10005346
1102 Ga0070715_10022360
1103 Ga0070716_100001217
1104 Ga0070712_100102915
1105 Ga0070712_100177090
1106 Ga0070712_100449722
1107 Ga0075362_10004628
1108 Ga0075367_10024485
1109 Ga0075367_10041204
1110 Ga0075369_10080344
1111 Ga0075369_10102720
1112 Ga0075366_10019905
1113 Ga0075366_10023974
1114 Ga0075366_10073632
1115 Ga0075366_10134994
1116 Ga0097621_100010589
1117 Ga0075370_10029799
1118 Ga0075370_10032951
1119 Ga0068871_100036409
1120 Ga0075428_100000476
1121 Ga0075428_100001723
1122 Ga0075428_100274360
1123 Ga0075430_100000201
1124 Ga0075430_100000244
1125 Ga0075430_100136323
1126 Ga0075431_100000260
1127 Ga0075433_10000007
1128 Ga0075433_10127889
1129 Ga0075433_10196700
1130 Ga0075434_100000091
1131 Ga0075434_100034266
1132 Ga0075434_100110129
1133 Ga0075434_100210094
1134 Ga0075434_100276410
1135 Ga0075429_100001265
1136 Ga0075429_100063046
1137 Ga0068865_100115705
1138 Ga0068865_100121134
1139 Ga0097620_100092182
1140 Ga0099825_1020668
1141 Ga0099824_1018360
1142 Ga0075435_100003301
1143 Ga0075435_100011769
1144 Ga0075435_100312517
1145 Ga0099795_10017367
1146 Ga0105251_10119249
1147 Ga0105240_10014700
1148 Ga0111539_10001412
1149 Ga0111539_10071975
1150 Ga0111539_10569547
1151 Ga0105245_10145957
1152 Ga0105245_10221927
1153 Ga0105245_10249822
1154 Ga0114129_10002772
1155 Ga0114129_10007261
1156 Ga0114129_10071187
1157 Ga0105243_10125749
1158 Ga0105242_10004266
1159 Ga0105242_10353114
1160 Ga0105248_10047962
1161 Ga0105248_10145936
1162 Ga0105237_10023192
1163 Ga0105238_10064515
1164 Ga0105249_10083546
1165 Ga0105239_10141596
1166 Ga0105239_10166820
1167 Ga0105239_10219240
1168 Ga0105239_10253395
1169 Ga0105239_10275570
1170 Ga0105246_10034641
1171 Ga0105246_10076063
1172 Ga0105246_10126198
1173 Ga0157371_10163070
1174 Ga0157370_10232451
1175 Ga0163162_10278586
1176 Ga0163162_10311618
1177 Ga0157375_10053365
1178 Ga0163163_10006941
1179 Ga0163163_10313152
1180 Ga0157380_10347142
1181 Ga0157379_10012889
1182 Ga0157376_10288393
1183 Ga0213876_10097083
1184 Ga0209563_101090
1185 Ga0209677_102351
1186 Ga0209148_1000316
1187 Ga0209233_1004623
1188 Ga0209673_1025297
1189 Ga0209564_1037958
1190 Ga0209758_1000106
1191 Ga0209758_1001405
1192 Ga0209758_1002396
1193 Ga0209758_1005929
1194 Ga0209758_1006430
1195 Ga0209758_1011834
1196 Ga0209758_1024111
1197 Ga0209758_1045760
1198 Ga0209256_1002946
1199 Ga0207426_1000374
1200 Ga0207426_1001007
1201 Ga0207426_1003263
1202 Ga0207426_1008613
1203 Ga0207426_1055401
1204 Ga0209257_1001741
1205 Ga0207692_10015365
1206 Ga0207710_10007424
1207 Ga0207688_10048222
1208 Ga0207688_10079889
1209 Ga0207680_10063441
1210 Ga0207647_10152140
1211 Ga0207699_10001489
1212 Ga0207645_10021194
1213 Ga0207645_10133652
1214 Ga0207707_10122357
1215 Ga0207707_10204665
1216 Ga0207695_10000478
1217 Ga0207671_10003084
1218 Ga0207693_10005512
1219 Ga0207693_10008449
1220 Ga0207693_10027452
1221 Ga0207693_10107351
1222 Ga0207663_10000425
1223 Ga0207660_10190158
1224 Ga0207657_10130332
1225 Ga0207649_10051415
1226 Ga0207652_10166552
1227 Ga0207681_10276192
1228 Ga0207694_10114799
1229 Ga0207650_10263109
1230 Ga0207687_10029064
1231 Ga0207687_10118046
1232 Ga0207700_10005022
1233 Ga0207700_10200398
1234 Ga0207700_10321855
1235 Ga0207664_10070747
1236 Ga0207664_10146369
1237 Ga0207644_10041059
1238 Ga0207644_10048873
1239 Ga0207690_10061018
1240 Ga0207706_10057132
1241 Ga0207686_10026307
1242 Ga0207709_10018115
1243 Ga0207670_10156546
1244 Ga0207704_10163037
1245 Ga0207665_10003367
1246 Ga0207665_10021180
1247 Ga0207691_10154586
1248 Ga0207711_10009422
1249 Ga0207711_10087313
1250 Ga0207689_10058438
1251 Ga0207661_10091550
1252 Ga0207661_10302400
1253 Ga0207667_10017077
1254 Ga0207668_10036615
1255 Ga0207640_10148610
1256 Ga0207658_10164790
1257 Ga0207677_10111086
1258 Ga0207703_10106496
1259 Ga0207703_10363723
1260 Ga0207639_10197023
1261 Ga0207678_10017546
1262 Ga0207678_10035287
1263 Ga0207678_10082834
1264 Ga0207678_10124265
1265 Ga0207641_10029014
1266 Ga0207641_10260941
1267 Ga0207648_10228656
1268 Ga0207674_10066740
1269 Ga0207674_10247135
1270 Ga0207674_10295465
1271 Ga0207683_10012926
1272 Ga0207683_10111222
1273 Ga0207683_10341545
1274 Ga0207683_10393857
1275 Ga0207698_10011050
1276 Ga0209389_1000016
1277 Ga0209389_1000027
1278 Ga0209589_1000031
1279 Ga0209489_100057
1280 Ga0209489_100063
1281 Ga0209700_100012
1282 Ga0209588_1003621
1283 Ga0209813_10003650
1284 Ga0207428_10000115
1285 Ga0207428_10005963
1286 Ga0207428_10105287
1287 Ga0268266_10063727
1288 Ga0268266_10072985
1289 Ga0268266_10079592
1290 Ga0268266_10243943
1291 Ga0268264_10000042
1292 Ga0268264_10196256
1293 Ga0268264_10242994
1294 Ga0268264_10363661
1295 Ga0265334_10029740
1296 Ga0307517_10092417
1297 Ga0307517_10156434
1298 Ga0265338_10100786
1299 Ga0307511_10123445
1300 Ga0265330_10006763
1301 Ga0265330_10008114
1302 Ga0265332_10002834
1303 Ga0265332_10012634
1304 Ga0265325_10000026
1305 Ga0265325_10008677
1306 Ga0265325_10008781
1307 Ga0265325_10013389
1308 Ga0265325_10051223
1309 Ga0265340_10001337
1310 Ga0265340_10003564
1311 Ga0265339_10003955
1312 Ga0265339_10028820
1313 Ga0265331_10006990
1314 Ga0265331_10059477
1315 Ga0265313_10013520
1316 Ga0265313_10027363
1317 Ga0265313_10027511
1318 Ga0265313_10049471
1319 Ga0265314_10002205
1320 Ga0265314_10008159
1321 Ga0265342_10000082
1322 Ga0265342_10000291
1323 Ga0265342_10005588
1324 Ga0265342_10010349
1325 Ga0265342_10014750
1326 Ga0307516_10094154
1327 Ga0307507_10021924
1328 Ga0307510_10026321
1329 Ga0307510_10230366
1330 Ga0373959_0008517
1331 Ga0373934_0047419
1332 Ga0373949_0033249
1333 Ga0373952_0016608
1334 Ga0373923_0001865
1335 Ga0373936_0006791
1336 Ga0373936_0030592
1337 Ga0373936_0049669
1338 Ga0373941_0021210
1339 Ga0373945_0000946
1340 Ga0373945_0039019
1341 Ga0373945_0124728
1342 Ga0373953_0000156
1343 Ga0373953_0062323
1344 Ga0373954_0011119
1345 Ga0373954_0013754
1346 Ga0373954_0053883
1347 Ga0373956_0004148
1348 Ga0373956_0011980
1349 Ga0373956_0118121
1350 Ga0373957_0001409
1351 Ga0373957_0006204
1352 Ga0373957_0022408
1353 Ga0373943_0001934
1354 Ga0373943_0019251
1355 Ga0373943_0086878
1356 Ga0373946_0007183
1357 Ga0373946_0024460
1358 Ga0373955_0000395
1359 Ga0373955_0002215
1360 Ga0373955_0009768
1361 Ga0373955_0050440
1362 Ga0373924_0007061
1363 Ga0373924_0011377
1364 Ga0373924_0043936
1365 Ga0373931_0013339
1366 Ga0373931_0029855
1367 Ga0373931_0094834
1368 Ga0373935_0001093
1369 Ga0373935_0029981
1370 Ga0373935_0033201
1371 Ga0373935_0034411
1372 Ga0373927_0004563
1373 Ga0373927_0021903
1374 Ga0373927_0052489
1375 Ga0373927_0175979
1376 Ga0373933_0004898
1377 Ga0373933_0007313
1378 Ga0373933_0032029
1379 Ga0373933_0102588
1380 Ga0373947_0000288
1381 Ga0373947_0024233
1382 Ga0373947_0031415
1383 Ga0373947_0056162
1384 Ga0373947_0163548
1385 Ga0373937_0000996
1386 Ga0373937_0012002
1387 Ga0373937_0147147
1388 Ga0373937_0300677
1389 Ga0373937_0566416
1390 Ga0373925_0002967
1391 Ga0373925_0018541
1392 Ga0373925_0018593
1393 Ga0373925_0021989
1394 Ga0373925_0027832
1395 Ga0373925_0277657
1396 Ga0395899_0009357
1397 Ga0395900_0119313
1398 Ga0395898_0014236
1399 Ga0395898_0073654
1400 Ga0395905_0028290
1401 Ga0395901_0078788
1402 Ga0395901_0127711
1403 Ga0395901_0366626
1404 Ga0436365_1106099
1405 Ga0436365_1584283
1406 Ga0436360_0575108
1407 Ga0436362_1127865
1408 Ga0451793_1689633
1409 Ga0439444_0004615
1410 Ga0466972_0000177
1411 Ga0466966_0000474
1412 Ga0466966_0259602
1413 Ga0466961_0000023
1414 Ga0466963_0113294
1415 Ga0466964_0036413
1416 Ga0466959_0000726
1417 Ga0466958_0050655
1418 Ga0466967_0351957
1419 Ga0495592_0016624
1420 Ga0495592_0025569
1421 Ga0495592_0041102
1422 Ga0495592_0067804
1423 Ga0495592_0181855
1424 Ga0495603_0008338
1425 Ga0495603_0026574
1426 Ga0495603_0027248
1427 Ga0495603_0067670
1428 Ga0495603_0074304
1429 Ga0495591_030268
1430 Ga0495591_051529
1431 Ga0495629_0000183
1432 Ga0495629_0000655
1433 Ga0495629_0064830
1434 Ga0495629_0337319
1435 Ga0495638_0009065
1436 Ga0495638_0051383
1437 Ga0495641_0054290
1438 Ga0495651_0005368
1439 Ga0495651_0007056
1440 Ga0495651_0008033
1441 Ga0495651_0010752
1442 Ga0495651_0077352
1443 Ga0495653_0004854
1444 Ga0495653_0025885
1445 Ga0495653_0035742
1446 Ga0495653_0142291
1447 Ga0495580_0106313
1448 Ga0495582_0001121
1449 Ga0495582_0097360
1450 Ga0495605_0041457
1451 Ga0495605_0069308
1452 Ga0495639_0009485
1453 Ga0495662_0072451
1454 Ga0495664_0018150
1455 Ga0495664_0032191
1456 Ga0495664_0102880
1457 Ga0495584_0067035
1458 Ga0495585_0003428
1459 Ga0495594_0017097
1460 Ga0495594_0155501
1461 Ga0495596_0000078
1462 Ga0495596_0103616
1463 Ga0495607_0009340
1464 Ga0495606_0010252
1465 Ga0495608_0002221
1466 Ga0495608_0009154
1467 Ga0495608_0015766
1468 Ga0495610_0057636
1469 Ga0495616_0093166
1470 Ga0495618_0013409
1471 Ga0495618_0049560
1472 Ga0495620_0014591
1473 Ga0495620_0052579
1474 Ga0495628_0000950
1475 Ga0495628_0008803
1476 Ga0495628_0049682
1477 Ga0495628_0207020
1478 Ga0495630_0069053
1479 Ga0495630_0127087
1480 Ga0495631_0000031
1481 Ga0495631_0060865
1482 Ga0495631_0081087
1483 Ga0495637_0000365
1484 Ga0495643_0104565
1485 Ga0495644_0000234
1486 Ga0495648_0017345
1487 Ga0495648_0023302
1488 Ga0495648_0163601
1489 Ga0495666_0046661
1490 Ga0495642_0017866
1491 Ga0495652_0002257
1492 Ga0495652_0026522
1493 Ga0495652_0030285
1494 Ga0495652_0038700
1495 Ga0495652_0056866
1496 Ga0495652_0106339
1497 Ga0495652_0136539
1498 Ga0495652_0278038
1499 Ga0495665_0028743
1500 Ga0495640_0009446
1501 Ga0495640_0011385
1502 Ga0495640_0012912
1503 Ga0495640_0018366
1504 Ga0495640_0042700
1505 Ga0495640_0068492
1506 Ga0495587_0002956
1507 Ga0495587_0007940
1508 Ga0495587_0018590
1509 Ga0495587_0029301
1510 Ga0495587_0029645
1511 Ga0495621_0000357
1512 Ga0495645_0001487
1513 Ga0495645_0002475
1514 Ga0495645_0002973
1515 Ga0495645_0014710
1516 Ga0495645_0042082
1517 Ga0495622_0008747
1518 Ga0495622_0015742
1519 Ga0495622_0064788
1520 Ga0495633_0002692
1521 Ga0495667_0008800
1522 Ga0495667_0034771
1523 Ga0495667_0230581
1524 Ga0495667_0250542
1525 Ga0495656_0000174
1526 Ga0495668_0012879
1527 Ga0495668_0156697
1528 Ga0495668_0212793
1529 Ga0495634_0011443
1530 Ga0495634_0025684
1531 Ga0495634_0028246
1532 Ga0495634_0030566
1533 Ga0495634_0038590
1534 Ga0495611_0054934
1535 Ga0495625_0005608
1536 Ga0495635_0000380
1537 Ga0495635_0006494
1538 Ga0495635_0036420
1539 Ga0495635_0102821
1540 Ga0495635_0257140
1541 Ga0495659_0000220
1542 Ga0495661_0147563
1543 Ga0495588_0011399
1544 Ga0495588_0017305
1545 Ga0495588_0096356
1546 Ga0495588_0134287
1547 Ga0495657_0001852
1548 Ga0495657_0004929
1549 Ga0495657_0005248
1550 Ga0495657_0021999
1551 Ga0495657_0098633
1552 Ga0495657_0187104
1553 Ga0495599_0004515
1554 Ga0495599_0027283
1555 Ga0495599_0068007
1556 Ga0495623_0001484
1557 Ga0495623_0002235
1558 Ga0495623_0004582
1559 Ga0495646_0006953
1560 Ga0495646_0055279
1561 Ga0495647_0029945
1562 Ga0495647_0055145
1563 Ga0495658_0000357
1564 Ga0495658_0040718
1565 Ga0495669_0015903
1566 Ga0495613_0009346
1567 Ga0495613_0013096
1568 Ga0495613_0030108
1569 Ga0495613_0086422
1570 Ga0495613_0153263
1571 Ga0495624_0100338
1572 Ga0495624_0151959
1573 Ga0495670_0000414
1574 Ga0495671_0061704
1575 Ga0495649_0018372
1576 Ga0495600_0007486
1577 Ga0495600_0014864
1578 Ga0495600_0067298
1579 Ga0495600_0215515
1580 Ga0495660_0050315
1581 Ga0495581_0010000
1582 Ga0495581_0103688
1583 Ga0495604_0008886
1584 Ga0495604_0017648
1585 Ga0495604_0038454
1586 Ga0495604_0050016
1587 Ga0495604_0071653
1588 Ga0495604_0138503
1589 Ga0495636_0002324
1590 Ga0495674_0024907
1591 Ga0495674_0044316
1592 Ga0495674_0055217
1593 Ga0495674_0083157
1594 Ga0495674_0168794
1595 Ga0495676_0014158
1596 Ga0495680_0001462
1597 Ga0495680_0002016
1598 Ga0495680_0012241
1599 Ga0495680_0081922
1600 Ga0495680_0281194
1601 Ga0495675_0001856
1602 Ga0495675_0014120
1603 Ga0495675_0060074
1604 Ga0495677_0081228
1605 Ga0495685_018416
1606 Ga0495673_0074730
1607 Ga0495684_0000294
1608 Ga0495684_0001528
1609 Ga0495684_0048992
1610 Ga0495684_0066991
1611 Ga0495684_0103985
1612 Ga0495686_0052087
1613 Ga0495593_0000744
1614 Ga0495593_0010818
1615 Ga0495593_0036316
1616 Ga0495602_0001368
1617 Ga0495602_0004084
1618 Ga0495614_0005613
1619 Ga0495614_0093364
1620 Ga0495614_0114140
1621 Ga0496100_0002106
1622 Ga0496100_0111181
1623 Ga0496100_0152266
1624 Ga0496101_0015113
1625 Ga0496101_0028676
1626 Ga0496102_0005062
1627 Ga0496104_0001363
1628 Ga0496104_0002005
1629 Ga0496104_0023320
1630 Ga0496104_0158815
1631 Ga0496104_0210555
1632 Ga0496104_0513471
1633 Ga0496105_0033897
1634 Ga0496105_0045632
1635 Ga0496105_0124238
1636 Ga0496105_0133756
1637 Ga0496106_0014884
1638 Ga0496107_0001189
1639 Ga0496107_0054251
1640 Ga0496107_0111890
1641 Ga0496108_0010537
1642 Ga0496108_0050304
1643 Ga0496109_0000700
1644 Ga0496109_0171908
1645 Ga0496109_0208827
1646 Ga0496110_0073990
1647 Ga0496110_0150513
1648 Ga0496110_0197818
1649 Ga0496110_0217372
1650 Ga0496111_0002128
1651 Ga0496111_0030278
1652 Ga0496111_0075974
1653 Ga0496111_0199970
1654 Ga0496112_0006626
1655 Ga0496112_0043988
1656 Ga0496112_0140196
1657 Ga0496113_0001279
1658 Ga0496113_0064157
1659 Ga0496113_0153261
1660 Ga0496113_0292007
1661 Ga0496114_0155999
1662 Ga0496114_0354705
1663 Ga0496115_0024926
1664 Ga0496115_0050932
1665 Ga0496115_0109328
1666 Ga0496116_0182671
1667 Ga0496117_0081359
1668 Ga0496118_0107467
1669 Ga0496118_0183053
1670 Ga0496119_0012670
1671 Ga0496119_0058223
1672 Ga0496121_0031768
1673 Ga0496121_0050990
1674 Ga0496121_0298115
1675 Ga0496124_0061180
1676 Ga0496126_0044707
1677 Ga0496126_0053837
1678 Ga0496126_0195743
1679 Ga0501032_0095172
1680 Ga0501033_0232716
1681 Ga0501034_0064750
1682 Ga0501034_0264153
1683 Ga0501036_0005977
1684 Ga0501037_0003231
1685 Ga0501037_0031825
1686 Ga0501038_0020838
1687 Ga0501038_0058873
1688 Ga0501038_0089706
1689 Ga0501039_0001869
1690 Ga0501043_0134930
1691 Ga0501047_0008244
1692 Ga0501047_0011033
1693 Ga0501047_0045692
1694 Ga0501047_0128370
1695 Ga0501048_0034771
1696 Ga0501067_0172555
1697 Ga0501068_0014174
1698 Ga0501069_0000929
1699 Ga0501070_0038726
1700 Ga0501071_0079370
1701 Ga0501072_0177907
1702 Ga0501072_0186968
1703 Ga0501073_0017185
1704 Ga0501074_0022225
1705 Ga0501074_0089456
1706 Ga0501076_0362473
1707 Ga0501079_0064503
1708 Ga0501079_0099173
1709 Ga0501079_0210187
1710 Ga0501080_0031235
1711 Ga0501081_0168148
1712 Ga0501083_0010731
1713 Ga0501083_0047864
1714 Ga0501035_0014209
1715 Ga0501035_0060738
1716 Ga0501035_0340851
1717 Ga0501044_0000286
1718 Ga0501044_0003023
1719 Ga0501044_0034776
1720 Ga0501044_0093844
1721 Ga0501045_0114802
1722 nmdc:mga03683_4316_c1
1723 nmdc:mga03n38_13494_c2
1724 nmdc:mga00v17_80108_c1
1725 nmdc:mga0yw44_18826_c1
1726 nmdc:mga0yw44_40147_c1
1727 nmdc:mga0k408_6246_c1
1728 nmdc:mga0k408_8333_c1
1729 nmdc:mga0k408_94704_c1
1730 nmdc:mga06z11_112871_c1
1731 nmdc:mga06z11_43584_c1
1732 nmdc:mga04h51_4263_c1
1733 nmdc:mga04h51_6786_c1
1734 nmdc:mga07m45_126220_c1
1735 nmdc:mga07m45_177281_c1
1736 nmdc:mga07m45_5888_c1
1737 nmdc:mga07m45_81446_c1
1738 nmdc:mga07m45_8967_c1
1739 nmdc:mga05p37_2742_c1
1740 nmdc:mga05p37_828_c1
1741 nmdc:mga09592_103801_c1
1742 nmdc:mga09592_21763_c1
1743 nmdc:mga0qj67_165_c1
1744 nmdc:mga0qj67_64106_c1
1745 nmdc:mga06r32_253385_c1
1746 nmdc:mga06r32_513_c1
1747 nmdc:mga08y16_228014_c1
1748 nmdc:mga08y16_3986_c1
1749 nmdc:mga08y16_4405_c1
1750 nmdc:mga0n895_18031_c1
1751 nmdc:mga0n895_385578_c1
1752 nmdc:mga0n895_4431_c1
1753 nmdc:mga0n895_94685_c1
1754 nmdc:mga0rr50_4443_c1
1755 nmdc:mga0a205_12519_c1
1756 nmdc:mga0a205_75792_c2
1757 nmdc:mga0sz30_17557_c1
1758 nmdc:mga0sz30_20084_c1
1759 Ga0495601_0000075
1760 Ga0495601_0003475
1761 Ga0495601_0007907
1762 Ga0495601_0028022
1763 Ga0495612_0002526
1764 Ga0495612_0008861
1765 Ga0495612_0011526
1766 Ga0495612_0017374
1767 Ga0495612_0077915
1768 Ga0500610_0015285
1769 Ga0500635_0004404
1770 Ga0495595_0000253
1771 Ga0495595_0000311
1772 Ga0495595_0000670
1773 Ga0495595_0002803
1774 Ga0495595_0009800
1775 Ga0495619_0000301
1776 Ga0495619_0000315
1777 Ga0495619_0000645
1778 Ga0495619_0003855
1779 Ga0495619_0036799
1780 Ga0495619_0065853
1781 Ga0495619_0191487
1782 Ga0495619_0223462
1783 Ga0500643_000052
1784 Ga0500643_004518
1785 Ga0500651_0004830
1786 Ga0500566_0002512
1787 Ga0500641_0007654
1788 Ga0500648_136430
1789 Ga0500650_0131108
1790 Ga0500555_039695
1791 Ga0500556_0008815
1792 Ga0500557_000057
1793 Ga0500569_004458
1794 Ga0500593_003210
1795 Ga0500594_0000589
1796 Ga0500595_000002
1797 Ga0500595_000558
1798 Ga0500595_002578
1799 Ga0500607_103185
1800 Ga0500642_0000263
1801 Ga0500642_0016379
1802 Ga0500658_0099854
1803 Ga0500559_0025253
1804 Ga0500564_093204
1805 Ga0500568_0010868
1806 Ga0500568_0038089
1807 Ga0500568_0095310
1808 Ga0500590_059797
1809 Ga0500590_150761
1810 Ga0500604_0040168
1811 Ga0500616_0000002
1812 Ga0500616_0013214
1813 Ga0500622_0004797
1814 Ga0500622_0103055
1815 Ga0500627_0085024
1816 Ga0500638_152727
1817 Ga0500636_0001378
1818 Ga0500636_0002410
1819 Ga0500636_0020617
1820 Ga0500636_0037056
1821 Ga0500625_003219
1822 Ga0500596_003341
1823 Ga0500599_009231
1824 Ga0501084_0035333
1825 Ga0500661_022306
1826 2508545757
1827 2508694582
1828 2511398413
1829 2513624505
1830 2513638631
1831 2513649981
1832 2513716826
1833 2513874273
1834 2513892373
1835 2515624489
1836 2517104581
1837 2524438538
1838 2528850385
1839 2617354178
1840 2643757459
1841 2723842586
1842 2745077237
1843 2793059409
1844 2793078542
1845 2805916039
1846 2818240981
1847 2824604431
1848 2824615028
1849 2824659188
1850 2824665218
1851 2824701854
1852 2824778256
1853 2841960688
1854 2842041788
1855 2842049830
1856 2844321329
1857 2847932081
1858 2847943318
1859 2849077046
1860 2857514669
1861 2874595720
1862 2874606729
1863 2874624216
1864 2874630313
1865 2874651648
1866 2876767655
1867 2876775915
1868 2876821543
1869 2879080006
1870 2879100589
1871 2879134089
1872 2879148574
1873 2881669308
1874 2885412175
1875 2888387626
1876 2888391536
1877 2888426842
1878 2903731481
1879 2904483567
1880 2904670927
1881 2906607943
1882 2906650121
1883 2922376610
1884 2929201839
1885 2929619886
1886 2929629198
1887 2932789671
1888 2932796661
1889 2932802559
1890 2932814823
1891 2932824320
1892 2932833952
1893 2933581804
1894 2935613262
1895 2935623658
1896 2935645045
1897 2935656624
1898 2935665452
1899 2935672094
1900 2935684100
1901 2935689149
1902 2935697591
1903 2935711383
1904 2935720095
1905 2935728288
1906 2935737115
1907 2935746824
1908 2935757791
1909 2935764171
1910 2935775201
1911 2935780103
1912 2935790225
1913 2935798733
1914 2935808757
1915 2935817554
1916 2935824884
1917 2935834109
1918 2935844711
1919 2935852104
1920 2935861735
1921 2935868629
1922 2935879403
1923 2935887001
1924 2935911451
1925 2935920986
1926 2935928480
1927 2935938125
1928 2935945407
1929 2935954087
1930 2935965466
1931 2935971645
1932 2935980049
1933 2935989477
1934 2935998429
1935 2936009110
1936 2936019487
1937 2936028103
1938 2936036937
1939 2936044351
1940 2936054960
1941 2936060733
1942 2940563387
1943 2941531902
1944 2941545394
1945 3005601681
1946 3005724363
1947 8006999137
1948 8016525096
1949 8016538672
1950 8016542959
1951 8016558739
1952 8016581015
1953 8016596715
1954 8016630208
1955 8016636942
1956 8017066283
1957 8019538344
1958 8019541478
1959 8019549149
1960 8019578340
1961 8019596378
1962 8019605323
1963 8019613219
1964 8019623901
1965 8019638139
1966 8019641497
1967 8019651545
1968 8019666053
1969 8019675572
1970 8019680527
1971 8019695226
1972 8055228655
1973 8055750362
1974 8055916289
1975 8056678856
1976 8056976133

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

91

364

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ndr-assembly1.cif.gz_E crystal structure of tphc in an open conformation 0.894 33 285
4x9t-assembly1.cif.gz_A crystal structure of a tctc solute binding protein from polaromonas (bpro_3516, target efi-510338), no ligand 0.8862 31 287
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.885 32 288
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.8848 31 288
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.8608 35 301
ID Description Score Start End Superfamily
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9647 131 251 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9626 131 244 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9445 131 252 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9345 131 251 3.40.190.10
2f5xC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9229 132 241 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A6P2FGX3-F1-model_v4 Argininosuccinate lyase 0.9226 18 291 GO:0016829
AF-A0A537CYK4-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9165 27 288
AF-A0A537VTQ8-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9037 43 290
AF-A0A0A1VID7-F1-model_v4 Extra-cytoplasmic solute receptor 0.9001 19 287
AF-A0A359LVB0-F1-model_v4 Prohead serine protease domain-containing protein 0.8998 45 291

Map