F487573

General Info

Members Datasets Scaffolds Average Seq Length
988 532 1976 272

Family's Representative Sequence

Representative Sequence 3300047319|Ga0495674_0009261|Ga0495674_0009261_4255_5202
Length 308
Sequence VLARCCPALTDAPATSSDTINFEAGMSETTFLYGGNVHANGIRQHYLRYGAHTGERARRDAIIIVPGITSPAVTWGFVGEHFGTTFDTYVLDIRGRGLSAASDTLDYSLDAQAADLVAFAQALALERYSVVGHSMGARIGIRAARTQPDGLARLVLVDPPVSGPGRRSYPAQLPWYIDSIRLARSGTDHHGMRGFCPNWTDKQLRLRAEWLHTCDERAVRTSFDGFHTDDVHADLAHIGIPVMLMTAGRGDVVREADSAEIRTLLPHLVHSHVSDAGHMIPWDDAAGFYRAFGDFLGEPLPMLDTPRA

Samples

Sample ID Description Type Environment
1 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
12 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
13 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
21 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
22 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
23 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
24 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
25 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
26 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
29 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
30 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
71 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
72 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
102 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
105 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
106 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
108 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
110 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
111 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
112 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
114 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
115 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
116 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
125 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
128 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
163 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
164 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
166 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
167 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
171 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
172 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
173 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
189 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
190 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
191 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
192 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
193 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
194 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
195 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
196 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
197 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
198 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
199 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
200 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
201 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
202 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
203 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
206 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
209 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
210 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
211 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
212 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
213 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
214 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
215 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
216 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
217 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
218 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
219 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
220 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
221 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
222 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
226 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
227 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
228 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
229 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
230 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
231 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
232 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
233 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
234 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
235 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
236 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
237 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
238 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
239 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
240 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
241 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
242 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
243 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
244 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
245 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
246 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
247 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
248 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
249 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
250 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
251 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
252 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
253 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
254 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
255 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
256 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
257 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
258 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
259 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
260 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
261 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
262 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
263 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
264 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
265 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
266 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
267 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
268 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
269 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
270 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
271 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
272 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
273 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
274 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
275 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
276 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
279 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
280 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
281 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
282 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
283 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
284 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
285 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
286 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
287 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
288 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
289 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
290 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
291 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
292 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
293 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
294 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
295 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
296 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
297 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
298 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
299 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
300 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
301 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
302 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
303 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
308 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
309 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
310 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
311 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
312 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
313 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
314 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
315 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
317 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
318 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
319 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
320 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
321 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
322 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
323 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
324 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
325 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
326 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
327 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
328 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
329 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
330 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
331 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
332 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
333 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
334 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
335 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
336 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
337 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
338 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
339 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
340 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
341 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
342 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
343 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
344 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
345 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
346 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
347 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
348 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
349 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
350 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
351 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
352 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
353 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
355 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
356 2506520008 Serratia plymuthica AS12 Isolate Unclassified
357 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
358 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
359 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
360 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
361 2511231017 Pseudomonas sp. GM55 Isolate Nodule
362 2511231024 Pseudomonas sp. GM84 Isolate Nodule
363 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
364 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
365 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
366 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
367 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
368 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
369 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
370 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
371 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
372 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
373 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
374 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
375 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
376 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
377 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
378 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
379 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
380 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
381 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
382 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
383 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
384 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
385 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
386 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
387 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
388 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
389 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
390 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
391 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
392 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
393 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
394 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
395 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
396 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
397 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
398 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
399 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
400 2643221558 Rhizobium sp. Root149 Isolate Unclassified
401 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
402 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
403 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
404 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
405 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
406 2721755523 Delftia sp. HK171 Isolate Unclassified
407 2738541307 Variovorax sp. GV008 Isolate Unclassified
408 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
409 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
410 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
411 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
412 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
413 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
414 2818991446 Variovorax sp. 1180 Isolate Unclassified
415 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
416 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
417 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
418 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
419 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
420 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
421 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
422 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
423 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
424 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
425 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
426 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
427 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
428 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
429 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
430 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
431 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
432 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
433 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
434 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
435 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
436 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
437 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
438 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
439 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
440 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
441 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
442 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
443 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
444 2855730933 Achromobacter sp. HZ28 Isolate Nodule
445 2855767633 Achromobacter sp. HZ34 Isolate Nodule
446 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
447 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
448 2858950400 Achromobacter sp. K91 Isolate Unclassified
449 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
450 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
451 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
452 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
453 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
454 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
455 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
456 2899924645 Variovorax sp. 369 Isolate Unclassified
457 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
458 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
459 2904456579 Variovorax sp. 2002 Isolate Unclassified
460 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
461 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
462 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
463 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
464 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
465 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
466 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
467 2928037797 Variovorax sp. 1126 Isolate Unclassified
468 2928044640 Variovorax sp. 1128 Isolate Unclassified
469 2928051484 Variovorax sp. 1133 Isolate Unclassified
470 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
471 2928070936 Variovorax gossypii 1167 Isolate Unclassified
472 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
473 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
474 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
475 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
476 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
477 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
478 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
479 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
480 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
481 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
482 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
483 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
484 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
485 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
486 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
487 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
488 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
489 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
490 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
491 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
492 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
493 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
494 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
495 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
496 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
497 2941479691
498 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
499 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
500 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
501 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
502 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
503 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
504 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
505 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
506 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
507 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
508 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
509 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
510 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
511 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
512 640753048 Serratia proteamaculans 568 Isolate Endosphere
513 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
514 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
515 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
516 8004592986 Serratia sp. S119 Isolate Unclassified
517 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
518 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
519 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
520 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
521 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
522 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
523 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
524 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
525 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
526 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
527 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
528 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
529 8052494512 Pseudomonas putida LD6 Isolate Unclassified
530 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
531 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
532 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.48
Metatranscriptomes 0.1
Isolates 18.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.5
Nodule 10.63
Rhizoplane 5.16
Rhizosphere 49.7
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495674_0009261 3300047319 Bacteria 9358
2 MRS2a_Contig_7280 2124908027 Bacteria 5201
3 SwRhRL2b_contig_2571238 2162886007 Bacteria 2013
4 JGI24740J21852_10000003 3300001979 Bacteria 127453
5 JGI24735J21928_10000668 3300002067 Bacteria 12140
6 JGI25155J39150_1000133 3300002704 Bacteria 35480
7 JGI25156J39149_1000263 3300002705 Bacteria 35480
8 JGI25162J39368_1000069 3300002737 Bacteria 125244
9 JGI25154J39366_1000338 3300002738 Bacteria 26999
10 JGI25157J39369_1000306 3300002741 Bacteria 35480
11 JGI25152J39213_1000122 3300002773 Bacteria 54029
12 JGI25152J39213_1010718 3300002773 Bacteria 2074
13 JGI25150J39212_1001287 3300002774 Bacteria 7166
14 JGI25159J45721_1000987 3300002987 Bacteria 12285
15 JGI25159J45721_1010275 3300002987 Bacteria 2399
16 JGI25159J45721_1011002 3300002987 Bacteria 2253
17 JGI25151J46595_10000401 3300003187 Bacteria 45001
18 JGI25151J46595_10000448 3300003187 Bacteria 39942
19 JGI25151J46595_10000608 3300003187 Bacteria 31358
20 JGI25151J46595_10018070 3300003187 Bacteria 3040
21 JGI25151J46595_10031433 3300003187 Bacteria 2074
22 JGI25165J46597_1000018 3300003214 Bacteria 374701
23 JGI25153J46596_10000159 3300003215 Bacteria 68077
24 JGI25153J46596_10002484 3300003215 Bacteria 10584
25 JGI25153J46596_10026123 3300003215 Bacteria 2074
26 rootL2_10210444 3300003322 Bacteria 2367
27 rootH1_10167920 3300003323 Bacteria 5206
28 rootH1_10274232 3300003323 Bacteria 4469
29 JGI25160J50197_1000058 3300003354 Bacteria 117529
30 JGI25160J50197_1016303 3300003354 Bacteria 2399
31 JGI25161J50226_1000044 3300003374 Bacteria 117529
32 JGI25161J50226_1005119 3300003374 Bacteria 2608
33 Ga0055532_1011066 3300003758 Bacteria 1069
34 Ga0055535_1002066 3300003761 Bacteria 8032
35 Ga0055542_1000381 3300003762 Bacteria 45199
36 Ga0055526_1021376 3300003771 Bacteria 2253
37 Ga0055526_1023143 3300003771 Bacteria 2084
38 Ga0055537_1001819 3300003773 Bacteria 7723
39 Ga0055537_1009806 3300003773 Bacteria 2074
40 Ga0055524_1018681 3300003775 Bacteria 2399
41 Ga0055524_1020192 3300003775 Bacteria 2253
42 Ga0055536_1018491 3300003781 Bacteria 2232
43 Ga0055534_1000260 3300003784 Bacteria 36676
44 Ga0055534_1009685 3300003784 Bacteria 2074
45 Ga0055528_1010747 3300003790 Bacteria 3695
46 Ga0055528_1021187 3300003790 Bacteria 2074
47 Ga0055540_1000890 3300003792 Bacteria 19699
48 Ga0055540_1010767 3300003792 Bacteria 3017
49 Ga0055531_10007399 3300003794 Bacteria 6007
50 Ga0055543_1006413 3300004625 Bacteria 2845
51 Ga0055543_1010321 3300004625 Bacteria 1962
52 Ga0065165_1000158 3300005262 Bacteria 117567
53 Ga0065165_1000618 3300005262 Bacteria 51600
54 Ga0065165_1015909 3300005262 Bacteria 2845
55 Ga0065714_10003745 3300005288 Bacteria 11353
56 Ga0065714_10022924 3300005288 Bacteria 1259
57 Ga0065704_10096997 3300005289 Bacteria 2414
58 Ga0065704_10110782 3300005289 Bacteria 1973
59 Ga0070658_10011628 3300005327 Bacteria 7060
60 Ga0070658_10113096 3300005327 Bacteria 2251
61 Ga0070683_100044621 3300005329 Bacteria 4089
62 Ga0070670_100000722 3300005331 Bacteria 25662
63 Ga0070680_100020564 3300005336 Bacteria 5240
64 Ga0070680_100576270 3300005336 Bacteria 965
65 Ga0070660_100010431 3300005339 Bacteria 6564
66 Ga0070661_100000040 3300005344 Bacteria 99921
67 Ga0070661_100011546 3300005344 Bacteria 6154
68 Ga0070673_100171680 3300005364 Bacteria 1851
69 Ga0070659_100040888 3300005366 Bacteria 3624
70 Ga0070659_100114731 3300005366 Bacteria 2177
71 Ga0070667_100019539 3300005367 Bacteria 5622
72 Ga0070714_100003508 3300005435 Bacteria 11706
73 Ga0070681_10006959 3300005458 Bacteria 11004
74 Ga0070679_100030891 3300005530 Bacteria 5292
75 Ga0070679_100054041 3300005530 Bacteria 3998
76 Ga0070684_100002664 3300005535 Bacteria 13191
77 Ga0068853_100002331 3300005539 Bacteria 14200
78 Ga0068853_100114040 3300005539 Bacteria 2403
79 Ga0070693_100007035 3300005547 Bacteria 5479
80 Ga0068855_100000037 3300005563 Bacteria 158161
81 Ga0068855_100008499 3300005563 Bacteria 12411
82 Ga0070664_100043080 3300005564 Bacteria 3808
83 Ga0068857_100003638 3300005577 Bacteria 12922
84 Ga0068857_100209354 3300005577 Bacteria 1779
85 Ga0068854_100008606 3300005578 Bacteria 6570
86 Ga0068852_100000513 3300005616 Bacteria 25506
87 Ga0068852_100035844 3300005616 Bacteria 4143
88 Ga0068851_10028683 3300005834 Bacteria 2750
89 Ga0068863_100186825 3300005841 Bacteria 1991
90 Ga0068860_100002725 3300005843 Bacteria 18383
91 Ga0081540_1020081 3300005983 Bacteria 4032
92 Ga0075365_10151781 3300006038 Bacteria 1612
93 Ga0075368_10022562 3300006042 Bacteria 2397
94 Ga0075364_10016197 3300006051 Bacteria 4636
95 Ga0075432_10012455 3300006058 Bacteria 2889
96 Ga0075432_10026499 3300006058 Bacteria 1992
97 Ga0075362_10012710 3300006177 Bacteria 3351
98 Ga0075362_10140473 3300006177 Bacteria 1154
99 Ga0075367_10101029 3300006178 Bacteria 1763
100 Ga0075369_10011291 3300006186 Bacteria 3512
101 Ga0075369_10068311 3300006186 Bacteria 1562
102 Ga0075369_10126160 3300006186 Bacteria 1161
103 Ga0075370_10000965 3300006353 Bacteria 11870
104 Ga0075370_10211189 3300006353 Bacteria 1146
105 Ga0068871_100377361 3300006358 Bacteria 1259
106 Ga0075428_100185933 3300006844 Bacteria 2248
107 Ga0099823_1000006 3300006944 Bacteria 135028
108 Ga0079104_1000072 3300006946 Bacteria 152567
109 Ga0079104_1001229 3300006946 Bacteria 18067
110 Ga0079104_1044692 3300006946 Bacteria 1014
111 Ga0099826_10000044 3300006948 Bacteria 88060
112 Ga0105251_10000002 3300009011 Bacteria 350843
113 Ga0105251_10000066 3300009011 Bacteria 99856
114 Ga0105251_10002189 3300009011 Bacteria 15637
115 Ga0105251_10016021 3300009011 Bacteria 4069
116 Ga0105244_10004003 3300009036 Bacteria 10307
117 Ga0105244_10020922 3300009036 Bacteria 3625
118 Ga0105244_10072214 3300009036 Bacteria 1719
119 Ga0105244_10135184 3300009036 Bacteria 1188
120 Ga0105250_10000992 3300009092 Bacteria 16492
121 Ga0105250_10005221 3300009092 Bacteria 5849
122 Ga0105250_10026569 3300009092 Bacteria 2333
123 Ga0105240_10008252 3300009093 Bacteria 14909
124 Ga0105240_10056923 3300009093 Bacteria 4889
125 Ga0105240_10098178 3300009093 Bacteria 3567
126 Ga0105240_10656503 3300009093 Bacteria 1149
127 Ga0105245_10049230 3300009098 Bacteria 3773
128 Ga0105247_10000128 3300009101 Bacteria 73288
129 Ga0114129_10463539 3300009147 Bacteria 1660
130 Ga0105243_10003192 3300009148 Bacteria 13428
131 Ga0105241_10000002 3300009174 Bacteria 869480
132 Ga0105241_10043125 3300009174 Bacteria 3415
133 Ga0105241_10058427 3300009174 Bacteria 2962
134 Ga0105242_10003142 3300009176 Bacteria 12894
135 Ga0105248_11025050 3300009177 Archaea 932
136 Ga0105237_10000933 3300009545 Bacteria 39346
137 Ga0105237_10015089 3300009545 Bacteria 8051
138 Ga0105237_10226444 3300009545 Bacteria 1870
139 Ga0105238_10001084 3300009551 Bacteria 27454
140 Ga0105238_10038832 3300009551 Bacteria 4834
141 Ga0105238_10061454 3300009551 Bacteria 3759
142 Ga0105239_10010763 3300010375 Bacteria 10219
143 Ga0105239_10013297 3300010375 Bacteria 9146
144 Ga0105246_10381816 3300011119 Bacteria 1164
145 Ga0157373_10005574 3300013100 Bacteria 9436
146 Ga0157373_10014879 3300013100 Bacteria 5697
147 Ga0157373_10016159 3300013100 Bacteria 5448
148 Ga0157373_10306061 3300013100 Bacteria 1129
149 Ga0157371_10012334 3300013102 Bacteria 6539
150 Ga0157371_10025042 3300013102 Bacteria 4354
151 Ga0157370_10014861 3300013104 Bacteria 7944
152 Ga0157370_10139328 3300013104 Bacteria 2260
153 Ga0157369_10000456 3300013105 Bacteria 54115
154 Ga0157369_10314399 3300013105 Bacteria 1628
155 Ga0157369_10771175 3300013105 Bacteria 989
156 Ga0157374_10041472 3300013296 Bacteria 4242
157 Ga0163162_10038626 3300013306 Bacteria 4764
158 Ga0157372_10108470 3300013307 Bacteria 3177
159 Ga0157375_10138188 3300013308 Bacteria 2562
160 Ga0157375_10604402 3300013308 Bacteria 1256
161 Ga0182008_10000107 3300014497 Bacteria 64378
162 Ga0182008_10000644 3300014497 Bacteria 25500
163 Ga0182008_10006362 3300014497 Bacteria 6612
164 Ga0182008_10017638 3300014497 Bacteria 3702
165 Ga0157379_10745795 3300014968 Archaea 921
166 Ga0157376_10906501 3300014969 Bacteria 900
167 Ga0182006_1012688 3300015261 Bacteria 3681
168 Ga0182006_1022628 3300015261 Bacteria 2611
169 Ga0182007_10001168 3300015262 Bacteria 14232
170 Ga0182007_10036575 3300015262 Bacteria 1651
171 Ga0182005_1000979 3300015265 Bacteria 12386
172 Ga0183362_10006 3300015683 Bacteria 287231
173 Ga0163161_10000001 3300017792 Bacteria 2041488
174 Ga0163161_10000308 3300017792 Bacteria 42596
175 Ga0163161_10014069 3300017792 Bacteria 5570
176 Ga0163161_10116368 3300017792 Bacteria 2004
177 Ga0209435_100083 3300025206 Bacteria 45292
178 Ga0209435_101941 3300025206 Bacteria 2490
179 Ga0209436_110831 3300025208 Bacteria 1641
180 Ga0209147_102644 3300025229 Bacteria 4189
181 Ga0209437_100022 3300025233 Bacteria 625694
182 Ga0209258_100454 3300025242 Bacteria 45089
183 Ga0207425_1000483 3300025245 Bacteria 25107
184 Ga0209646_1000278 3300025246 Bacteria 45214
185 Ga0209026_1000339 3300025250 Bacteria 45292
186 Ga0209148_1000449 3300025254 Bacteria 45110
187 Ga0209759_1000469 3300025256 Bacteria 45292
188 Ga0209129_1000030 3300025258 Bacteria 391958
189 Ga0209129_1006426 3300025258 Bacteria 3796
190 Ga0209233_1000031 3300025261 Bacteria 624646
191 Ga0209233_1005675 3300025261 Bacteria 4117
192 Ga0209565_1000019 3300025263 Bacteria 438920
193 Ga0209565_1000047 3300025263 Bacteria 225745
194 Ga0209565_1007509 3300025263 Bacteria 2933
195 Ga0209455_1013693 3300025272 Bacteria 1871
196 Ga0209673_1000079 3300025273 Bacteria 225746
197 Ga0209673_1000095 3300025273 Bacteria 197466
198 Ga0209673_1012683 3300025273 Bacteria 3379
199 Ga0209130_1000011 3300025284 Bacteria 431723
200 Ga0209130_1000085 3300025284 Bacteria 158670
201 Ga0209130_1000272 3300025284 Bacteria 64696
202 Ga0209130_1002673 3300025284 Bacteria 8502
203 Ga0209675_1000046 3300025291 Bacteria 225746
204 Ga0209675_1000073 3300025291 Bacteria 163009
205 Ga0209675_1004206 3300025291 Bacteria 6501
206 Ga0209675_1008546 3300025291 Bacteria 3744
207 Ga0209675_1012745 3300025291 Bacteria 2684
208 Ga0209676_1003773 3300025292 Bacteria 8977
209 Ga0209676_1005770 3300025292 Bacteria 6341
210 Ga0209676_1027740 3300025292 Bacteria 1777
211 Ga0209025_1000028 3300025294 Bacteria 490678
212 Ga0209025_1000055 3300025294 Bacteria 316748
213 Ga0209025_1000471 3300025294 Bacteria 78395
214 Ga0209025_1000494 3300025294 Bacteria 75744
215 Ga0209025_1000973 3300025294 Bacteria 42929
216 Ga0209025_1017045 3300025294 Bacteria 4228
217 Ga0209025_1029664 3300025294 Bacteria 2640
218 Ga0209564_1000725 3300025295 Bacteria 47333
219 Ga0209564_1014616 3300025295 Bacteria 3249
220 Ga0209758_1000037 3300025297 Bacteria 439101
221 Ga0209758_1018973 3300025297 Bacteria 3341
222 Ga0209050_1041390 3300025298 Bacteria 1271
223 Ga0209256_1000023 3300025299 Bacteria 461150
224 Ga0209256_1001930 3300025299 Bacteria 18911
225 Ga0207426_1000029 3300025302 Bacteria 473835
226 Ga0207426_1000076 3300025302 Bacteria 320851
227 Ga0207426_1000835 3300025302 Bacteria 32700
228 Ga0207426_1007595 3300025302 Bacteria 4513
229 Ga0207426_1019688 3300025302 Bacteria 2356
230 Ga0209051_1000128 3300025303 Bacteria 142159
231 Ga0209051_1004231 3300025303 Bacteria 8948
232 Ga0209051_1007641 3300025303 Bacteria 5877
233 Ga0209051_1035753 3300025303 Bacteria 1843
234 Ga0209051_1040679 3300025303 Bacteria 1663
235 Ga0209257_1010457 3300025304 Bacteria 4692
236 Ga0207656_10012577 3300025321 Bacteria 3221
237 Ga0207696_1000001 3300025711 Bacteria 2579611
238 Ga0207696_1003281 3300025711 Bacteria 7467
239 Ga0207696_1007082 3300025711 Bacteria 4433
240 Ga0207655_1000081 3300025728 Bacteria 214272
241 Ga0207655_1000180 3300025728 Bacteria 112767
242 Ga0207655_1104552 3300025728 Bacteria 968
243 Ga0207713_1000008 3300025735 Bacteria 553952
244 Ga0207713_1000016 3300025735 Bacteria 421689
245 Ga0207713_1000193 3300025735 Bacteria 85067
246 Ga0207713_1002232 3300025735 Bacteria 14352
247 Ga0207713_1021468 3300025735 Bacteria 3094
248 Ga0207710_10000224 3300025900 Bacteria 49005
249 Ga0207705_10035521 3300025909 Bacteria 3566
250 Ga0207705_10130272 3300025909 Bacteria 1872
251 Ga0207654_10000005 3300025911 Bacteria 869492
252 Ga0207654_10046835 3300025911 Bacteria 2468
253 Ga0207654_10110251 3300025911 Bacteria 1711
254 Ga0207695_10128426 3300025913 Bacteria 2494
255 Ga0207695_10372910 3300025913 Bacteria 1313
256 Ga0207671_10174376 3300025914 Bacteria 1671
257 Ga0207660_10062792 3300025917 Bacteria 2677
258 Ga0207657_10002914 3300025919 Bacteria 18368
259 Ga0207649_10070214 3300025920 Bacteria 2233
260 Ga0207652_10025294 3300025921 Bacteria 4933
261 Ga0207652_10080692 3300025921 Bacteria 2844
262 Ga0207694_10000833 3300025924 Bacteria 27460
263 Ga0207694_10103017 3300025924 Bacteria 2263
264 Ga0207694_10126979 3300025924 Bacteria 2041
265 Ga0207687_10029533 3300025927 Bacteria 3688
266 Ga0207664_10143199 3300025929 Bacteria 2024
267 Ga0207690_10035802 3300025932 Bacteria 3210
268 Ga0207690_10143778 3300025932 Bacteria 1761
269 Ga0207686_10012369 3300025934 Bacteria 4693
270 Ga0207709_10000104 3300025935 Bacteria 130964
271 Ga0207661_10325648 3300025944 Bacteria 1382
272 Ga0207661_10575746 3300025944 Bacteria 1033
273 Ga0207679_10014861 3300025945 Bacteria 5129
274 Ga0207667_10000053 3300025949 Bacteria 226712
275 Ga0207667_10011698 3300025949 Bacteria 10180
276 Ga0207668_10104234 3300025972 Bacteria 2114
277 Ga0207640_10008079 3300025981 Bacteria 5820
278 Ga0207658_10165261 3300025986 Bacteria 1817
279 Ga0207639_10002786 3300026041 Bacteria 11739
280 Ga0207702_10007049 3300026078 Bacteria 9617
281 Ga0207641_10035601 3300026088 Bacteria 4149
282 Ga0207648_10077499 3300026089 Bacteria 2898
283 Ga0207674_10000994 3300026116 Bacteria 37007
284 Ga0207674_10291049 3300026116 Bacteria 1582
285 Ga0207683_10141845 3300026121 Bacteria 2165
286 Ga0207698_10152222 3300026142 Bacteria 2009
287 Ga0209281_1000002 3300027111 Bacteria 1924012
288 Ga0209281_1000003 3300027111 Bacteria 1260089
289 Ga0209281_1023761 3300027111 Bacteria 1158
290 Ga0209389_1000003 3300027296 Bacteria 268927
291 Ga0209389_1000030 3300027296 Bacteria 139329
292 Ga0209371_1000409 3300027312 Bacteria 44442
293 Ga0209489_100022 3300027361 Bacteria 202016
294 Ga0209700_100023 3300027363 Bacteria 229662
295 Ga0209282_1001203 3300027666 Bacteria 13962
296 Ga0207428_10024062 3300027907 Bacteria 5114
297 Ga0268264_10004086 3300028381 Bacteria 12491
298 Ga0307515_10000115 3300028794 Bacteria 193697
299 Ga0307515_10004008 3300028794 Bacteria 30737
300 Ga0307515_10038642 3300028794 Bacteria 7626
301 Ga0307515_10121696 3300028794 Bacteria 2950
302 Ga0268256_1000350 3300030500 Bacteria 44442
303 Ga0265327_10005883 3300031251 Bacteria 10021
304 Ga0307513_10000931 3300031456 Bacteria 42258
305 Ga0307513_10057631 3300031456 Bacteria 4136
306 Ga0307513_10106562 3300031456 Bacteria 2809
307 Ga0307408_100005155 3300031548 Bacteria 8761
308 Ga0307508_10102253 3300031616 Bacteria 2462
309 Ga0265314_10002400 3300031711 Bacteria 19257
310 Ga0265314_10040524 3300031711 Bacteria 3342
311 Ga0307516_10006311 3300031730 Bacteria 13930
312 Ga0307405_10000548 3300031731 Bacteria 14272
313 Ga0307405_10002875 3300031731 Bacteria 7742
314 Ga0307405_10274248 3300031731 Bacteria 1266
315 Ga0307405_10494364 3300031731 Bacteria 979
316 Ga0307406_10327556 3300031901 Bacteria 1187
317 Ga0307412_10000123 3300031911 Bacteria 59156
318 Ga0307412_10000487 3300031911 Bacteria 23696
319 Ga0307412_10107044 3300031911 Bacteria 1989
320 Ga0307416_100013723 3300032002 Bacteria 5518
321 Ga0307416_100038208 3300032002 Bacteria 3702
322 Ga0307416_100655794 3300032002 Bacteria 1135
323 Ga0307414_10021385 3300032004 Bacteria 4058
324 Ga0307414_10206106 3300032004 Bacteria 1604
325 Ga0307414_10213411 3300032004 Bacteria 1579
326 Ga0307414_10347015 3300032004 Bacteria 1273
327 Ga0307411_10106748 3300032005 Bacteria 1994
328 Ga0373925_0008436 3300037068 Bacteria 7505
329 Ga0395900_0002965 3300037418 Bacteria 18476
330 Ga0395900_0039763 3300037418 Bacteria 4846
331 Ga0395898_0106298 3300037466 Bacteria 2692
332 Ga0395905_0000330 3300037471 Bacteria 67978
333 Ga0395905_0050737 3300037471 Bacteria 3886
334 Ga0395905_0115577 3300037471 Bacteria 2522
335 Ga0436361_0282271 3300039447 Bacteria 8908
336 Ga0439436_0055836 3300041404 Bacteria 1109
337 Ga0439438_001817 3300041405 Bacteria 9356
338 Ga0451835_0099071 3300041492 Bacteria 4534
339 Ga0451841_1152441 3300041498 Bacteria 1881
340 Ga0451845_0146513 3300041501 Bacteria 1336
341 Ga0451855_0112004 3300041511 Bacteria 1894
342 Ga0451853_0494432 3300041512 Bacteria 924
343 Ga0439432_001581 3300042006 Bacteria 8522
344 Ga0439432_016922 3300042006 Bacteria 2451
345 Ga0439452_009979 3300042010 Bacteria 2778
346 Ga0450911_000058 3300042115 Bacteria 45420
347 Ga0450902_000607 3300042137 Bacteria 4544
348 Ga0450905_011319 3300042142 Bacteria 1246
349 Ga0450901_000408 3300042533 Bacteria 5174
350 Ga0495617_000082 3300046452 Bacteria 71035
351 Ga0495617_025514 3300046452 Bacteria 1992
352 Ga0495617_038087 3300046452 Bacteria 1609
353 Ga0495617_070725 3300046452 Bacteria 1148
354 Ga0495627_000070 3300046453 Bacteria 125171
355 Ga0495627_016113 3300046453 Bacteria 2566
356 Ga0495603_0005865 3300046455 Bacteria 7346
357 Ga0495590_0002468 3300046457 Bacteria 7656
358 Ga0495591_003453 3300046458 Bacteria 8148
359 Ga0495591_007354 3300046458 Bacteria 4696
360 Ga0495591_008555 3300046458 Bacteria 4180
361 Ga0495591_012751 3300046458 Bacteria 3111
362 Ga0495629_0009217 3300046459 Bacteria 7223
363 Ga0495638_0000216 3300046460 Bacteria 80528
364 Ga0495638_0000518 3300046460 Bacteria 45116
365 Ga0495638_0005479 3300046460 Bacteria 9435
366 Ga0495638_0020423 3300046460 Bacteria 4377
367 Ga0495638_0083882 3300046460 Bacteria 1929
368 Ga0495638_0175068 3300046460 Bacteria 1228
369 Ga0495653_0000460 3300046463 Bacteria 31749
370 Ga0495653_0002626 3300046463 Bacteria 14299
371 Ga0495650_0000143 3300046471 Bacteria 168096
372 Ga0495650_0010402 3300046471 Bacteria 5192
373 Ga0495650_0039603 3300046471 Bacteria 2032
374 Ga0495580_0012949 3300046472 Bacteria 6385
375 Ga0495605_0000401 3300046474 Bacteria 39759
376 Ga0495605_0006510 3300046474 Bacteria 6706
377 Ga0495605_0008765 3300046474 Bacteria 5706
378 Ga0495605_0013692 3300046474 Bacteria 4457
379 Ga0495664_0015752 3300046477 Bacteria 4302
380 Ga0495664_0034121 3300046477 Bacteria 2992
381 Ga0495664_0161927 3300046477 Bacteria 1357
382 Ga0495664_0217329 3300046477 Bacteria 1157
383 Ga0495585_0000300 3300046492 Bacteria 49530
384 Ga0495585_0001961 3300046492 Bacteria 15338
385 Ga0495585_0009470 3300046492 Bacteria 5841
386 Ga0495585_0015901 3300046492 Bacteria 4366
387 Ga0495585_0044825 3300046492 Bacteria 2470
388 Ga0495585_0084926 3300046492 Bacteria 1711
389 Ga0495596_0040257 3300046500 Bacteria 1845
390 Ga0495607_0001528 3300046501 Bacteria 20344
391 Ga0495607_0004890 3300046501 Bacteria 9748
392 Ga0495607_0008626 3300046501 Bacteria 6951
393 Ga0495607_0018423 3300046501 Bacteria 4451
394 Ga0495607_0031773 3300046501 Bacteria 3230
395 Ga0495607_0040498 3300046501 Bacteria 2774
396 Ga0495583_0000124 3300046506 Bacteria 130757
397 Ga0495583_0000181 3300046506 Bacteria 107973
398 Ga0495583_0000283 3300046506 Bacteria 81166
399 Ga0495583_0011914 3300046506 Bacteria 4962
400 Ga0495606_0000013 3300046507 Bacteria 292850
401 Ga0495606_0004709 3300046507 Bacteria 13458
402 Ga0495606_0005549 3300046507 Bacteria 12034
403 Ga0495606_0008182 3300046507 Bacteria 9149
404 Ga0495606_0013479 3300046507 Bacteria 6451
405 Ga0495606_0013628 3300046507 Bacteria 6410
406 Ga0495606_0030652 3300046507 Bacteria 3753
407 Ga0495606_0033875 3300046507 Bacteria 3515
408 Ga0495606_0040943 3300046507 Bacteria 3109
409 Ga0495606_0120660 3300046507 Bacteria 1570
410 Ga0495608_0190927 3300046511 Bacteria 1293
411 Ga0495610_0000379 3300046512 Bacteria 45939
412 Ga0495610_0023910 3300046512 Bacteria 3309
413 Ga0495610_0039870 3300046512 Bacteria 2371
414 Ga0495610_0041757 3300046512 Bacteria 2300
415 Ga0495610_0049767 3300046512 Bacteria 2050
416 Ga0495610_0128269 3300046512 Bacteria 1104
417 Ga0495616_0001220 3300046513 Bacteria 18108
418 Ga0495616_0022532 3300046513 Bacteria 3402
419 Ga0495616_0037115 3300046513 Bacteria 2509
420 Ga0495620_0000058 3300046515 Bacteria 96873
421 Ga0495628_0003162 3300046516 Bacteria 14753
422 Ga0495628_0022973 3300046516 Bacteria 5119
423 Ga0495630_0000726 3300046517 Bacteria 23297
424 Ga0495631_0003886 3300046518 Bacteria 8079
425 Ga0495631_0010898 3300046518 Bacteria 4488
426 Ga0495631_0040319 3300046518 Bacteria 2069
427 Ga0495632_0000838 3300046519 Bacteria 27076
428 Ga0495632_0007273 3300046519 Bacteria 6981
429 Ga0495632_0034611 3300046519 Bacteria 2583
430 Ga0495632_0035654 3300046519 Bacteria 2537
431 Ga0495632_0125168 3300046519 Bacteria 1198
432 Ga0495637_0000021 3300046520 Bacteria 179141
433 Ga0495637_0000282 3300046520 Bacteria 39834
434 Ga0495637_0006029 3300046520 Bacteria 6122
435 Ga0495637_0024633 3300046520 Bacteria 2722
436 Ga0495637_0070543 3300046520 Bacteria 1411
437 Ga0495637_0117789 3300046520 Bacteria 1024
438 Ga0495643_0000508 3300046522 Bacteria 48532
439 Ga0495643_0054569 3300046522 Bacteria 2138
440 Ga0495643_0141856 3300046522 Bacteria 1197
441 Ga0495644_0008858 3300046523 Bacteria 3868
442 Ga0495648_0001313 3300046524 Bacteria 24626
443 Ga0495648_0004836 3300046524 Bacteria 11367
444 Ga0495648_0010321 3300046524 Bacteria 7124
445 Ga0495648_0018664 3300046524 Bacteria 4899
446 Ga0495648_0033997 3300046524 Bacteria 3324
447 Ga0495648_0049671 3300046524 Bacteria 2569
448 Ga0495648_0119297 3300046524 Bacteria 1420
449 Ga0495652_0004289 3300046529 Bacteria 13675
450 Ga0495654_0000379 3300046530 Bacteria 38260
451 Ga0495654_0001416 3300046530 Bacteria 16598
452 Ga0495654_0007575 3300046530 Bacteria 6048
453 Ga0495654_0045589 3300046530 Bacteria 2162
454 Ga0495654_0046362 3300046530 Bacteria 2141
455 Ga0495654_0064016 3300046530 Bacteria 1759
456 Ga0495654_0074601 3300046530 Bacteria 1601
457 Ga0495654_0104263 3300046530 Bacteria 1301
458 Ga0495665_0000144 3300046531 Bacteria 34978
459 Ga0495665_0097272 3300046531 Bacteria 1545
460 Ga0495665_0169460 3300046531 Bacteria 1137
461 Ga0495586_0043755 3300046535 Bacteria 2412
462 Ga0495586_0064320 3300046535 Bacteria 1999
463 Ga0495609_0000062 3300046538 Bacteria 138094
464 Ga0495609_0000706 3300046538 Bacteria 25687
465 Ga0495609_0082525 3300046538 Bacteria 1404
466 Ga0495597_0000109 3300046542 Bacteria 73193
467 Ga0495597_0005857 3300046542 Bacteria 6425
468 Ga0495597_0006216 3300046542 Bacteria 6194
469 Ga0495597_0013772 3300046542 Bacteria 3867
470 Ga0495622_0008380 3300046557 Bacteria 4786
471 Ga0495622_0008444 3300046557 Bacteria 4768
472 Ga0495633_0000168 3300046558 Bacteria 86321
473 Ga0495633_0042286 3300046558 Bacteria 2165
474 Ga0495668_0015505 3300046616 Bacteria 4448
475 Ga0495668_0021620 3300046616 Bacteria 3686
476 Ga0495668_0038102 3300046616 Bacteria 2688
477 Ga0495611_0001757 3300046648 Bacteria 10477
478 Ga0495611_0002586 3300046648 Bacteria 8195
479 Ga0495611_0010031 3300046648 Bacteria 4007
480 Ga0495625_0000028 3300046660 Bacteria 256946
481 Ga0495625_0010130 3300046660 Bacteria 7832
482 Ga0495625_0014308 3300046660 Bacteria 6339
483 Ga0495625_0077770 3300046660 Bacteria 2317
484 Ga0495635_0001829 3300046663 Bacteria 14383
485 Ga0495635_0053270 3300046663 Bacteria 2788
486 Ga0495659_0091739 3300046664 Bacteria 1167
487 Ga0495661_0000001 3300046665 Bacteria 898372
488 Ga0495661_0000013 3300046665 Bacteria 259387
489 Ga0495661_0001016 3300046665 Bacteria 25033
490 Ga0495661_0003810 3300046665 Bacteria 11038
491 Ga0495661_0008465 3300046665 Bacteria 7111
492 Ga0495661_0032611 3300046665 Bacteria 3291
493 Ga0495588_0006483 3300046674 Bacteria 5275
494 Ga0495588_0036530 3300046674 Bacteria 2493
495 Ga0495588_0088308 3300046674 Bacteria 1622
496 Ga0495657_0076360 3300046675 Bacteria 2176
497 Ga0495599_0020738 3300046678 Bacteria 4095
498 Ga0495623_0002095 3300046679 Bacteria 13335
499 Ga0495646_0234091 3300046680 Bacteria 989
500 Ga0495669_0007329 3300046684 Bacteria 4622
501 Ga0495669_0012505 3300046684 Bacteria 3614
502 Ga0495624_0143254 3300046690 Bacteria 1463
503 Ga0495670_0000809 3300046691 Bacteria 15073
504 Ga0495670_0007933 3300046691 Bacteria 5218
505 Ga0495670_0031795 3300046691 Bacteria 2623
506 Ga0495670_0068448 3300046691 Bacteria 1794
507 Ga0495670_0101312 3300046691 Bacteria 1483
508 Ga0495670_0117308 3300046691 Bacteria 1381
509 Ga0495671_0001413 3300046692 Bacteria 16136
510 Ga0495671_0007853 3300046692 Bacteria 6036
511 Ga0495671_0017251 3300046692 Bacteria 3844
512 Ga0495671_0094418 3300046692 Bacteria 1463
513 Ga0495649_0003338 3300046694 Bacteria 10888
514 Ga0495649_0065376 3300046694 Bacteria 1952
515 Ga0495589_0000001 3300046794 Bacteria 888100
516 Ga0495589_0000767 3300046794 Bacteria 20524
517 Ga0495589_0029858 3300046794 Bacteria 2748
518 Ga0495600_0026821 3300046809 Bacteria 3721
519 Ga0495660_0001061 3300046810 Bacteria 19874
520 Ga0495660_0001202 3300046810 Bacteria 18131
521 Ga0495660_0030230 3300046810 Bacteria 3052
522 Ga0495660_0220253 3300046810 Bacteria 895
523 Ga0495604_0002608 3300047317 Bacteria 14455
524 Ga0495604_0025994 3300047317 Bacteria 4662
525 Ga0495636_0016843 3300047318 Bacteria 2923
526 Ga0495674_0003450 3300047319 Bacteria 15359
527 Ga0495674_0004344 3300047319 Bacteria 13626
528 Ga0495674_0316535 3300047319 Bacteria 1272
529 Ga0495672_0000912 3300047320 Bacteria 30930
530 Ga0495672_0005501 3300047320 Bacteria 10036
531 Ga0495672_0026007 3300047320 Bacteria 3739
532 Ga0495672_0127544 3300047320 Bacteria 1343
533 Ga0495676_0000006 3300047321 Bacteria 280508
534 Ga0495676_0056728 3300047321 Bacteria 3095
535 Ga0495676_0091183 3300047321 Bacteria 2279
536 Ga0495680_0001386 3300047322 Bacteria 26182
537 Ga0495683_0000185 3300047323 Bacteria 61212
538 Ga0495683_0000673 3300047323 Bacteria 25234
539 Ga0495683_0001189 3300047323 Bacteria 17742
540 Ga0495683_0014792 3300047323 Bacteria 4063
541 Ga0495683_0016469 3300047323 Bacteria 3838
542 Ga0495683_0090691 3300047323 Bacteria 1481
543 Ga0495687_000784 3300047443 Bacteria 34187
544 Ga0495687_009122 3300047443 Bacteria 5587
545 Ga0495687_089050 3300047443 Bacteria 1187
546 Ga0495675_0043309 3300047444 Bacteria 2868
547 Ga0495679_000148 3300047446 Bacteria 63053
548 Ga0495679_000203 3300047446 Bacteria 51947
549 Ga0495685_077901 3300047447 Bacteria 1106
550 Ga0495673_0004182 3300047469 Bacteria 9118
551 Ga0495673_0005131 3300047469 Bacteria 7985
552 Ga0495673_0007202 3300047469 Bacteria 6430
553 Ga0495673_0014894 3300047469 Bacteria 4026
554 Ga0495673_0025263 3300047469 Bacteria 2856
555 Ga0495673_0125942 3300047469 Bacteria 1010
556 Ga0495681_0000653 3300047470 Bacteria 26356
557 Ga0495681_0000803 3300047470 Bacteria 24200
558 Ga0495681_0005526 3300047470 Bacteria 8447
559 Ga0495686_0000045 3300047472 Bacteria 284761
560 Ga0495686_0005840 3300047472 Bacteria 9600
561 Ga0495686_0016711 3300047472 Bacteria 4967
562 Ga0495686_0031403 3300047472 Bacteria 3444
563 Ga0495686_0078738 3300047472 Bacteria 2017
564 Ga0495686_0171279 3300047472 Bacteria 1262
565 Ga0495686_0193019 3300047472 Bacteria 1173
566 Ga0495593_0002697 3300047673 Bacteria 10685
567 Ga0495593_0008883 3300047673 Bacteria 5831
568 Ga0495593_0013971 3300047673 Bacteria 4574
569 Ga0495602_0004972 3300048088 Bacteria 13931
570 Ga0495602_0045254 3300048088 Bacteria 3984
571 Ga0495602_0061771 3300048088 Bacteria 3255
572 Ga0495615_0061209 3300048090 Bacteria 994
573 Ga0495626_0000019 3300048091 Bacteria 225494
574 Ga0495626_0001519 3300048091 Bacteria 18245
575 Ga0495626_0091028 3300048091 Bacteria 1341
576 Ga0496100_0008194 3300048903 Bacteria 5819
577 Ga0496101_0002200 3300048904 Bacteria 11916
578 Ga0496101_0023922 3300048904 Bacteria 4223
579 Ga0496101_0203978 3300048904 Bacteria 1529
580 Ga0496102_0002501 3300048905 Bacteria 15698
581 Ga0496102_0009781 3300048905 Bacteria 8247
582 Ga0496102_0049467 3300048905 Bacteria 3824
583 Ga0496102_0519249 3300048905 Bacteria 1113
584 Ga0496103_0006426 3300048906 Bacteria 7020
585 Ga0496103_0009825 3300048906 Bacteria 5666
586 Ga0496103_0171022 3300048906 Bacteria 1395
587 Ga0496104_0024714 3300048907 Bacteria 5530
588 Ga0496104_0051878 3300048907 Bacteria 3872
589 Ga0496104_0193752 3300048907 Bacteria 1944
590 Ga0496105_0002786 3300048908 Bacteria 12782
591 Ga0496105_0016402 3300048908 Bacteria 5914
592 Ga0496105_0023953 3300048908 Bacteria 4958
593 Ga0496106_0013396 3300048909 Bacteria 6055
594 Ga0496106_0017119 3300048909 Bacteria 5365
595 Ga0496106_0241956 3300048909 Bacteria 1442
596 Ga0496107_0005965 3300048910 Bacteria 8347
597 Ga0496107_0041431 3300048910 Bacteria 3306
598 Ga0496107_0261726 3300048910 Bacteria 1287
599 Ga0496109_0325806 3300048912 Bacteria 1450
600 Ga0496110_0003473 3300048913 Bacteria 12086
601 Ga0496110_0012286 3300048913 Bacteria 7038
602 Ga0496110_0425536 3300048913 Bacteria 1210
603 Ga0496110_0625009 3300048913 Bacteria 976
604 Ga0496111_0017806 3300048914 Bacteria 4913
605 Ga0496111_0171455 3300048914 Bacteria 1612
606 Ga0496111_0315808 3300048914 Bacteria 1157
607 Ga0496112_0005936 3300048915 Bacteria 10652
608 Ga0496113_0077820 3300048916 Bacteria 2537
609 Ga0496113_0766816 3300048916 Bacteria 767
610 Ga0496114_0001598 3300048917 Bacteria 17186
611 Ga0496114_0015328 3300048917 Bacteria 6162
612 Ga0496114_0138462 3300048917 Bacteria 2106
613 Ga0496114_0544534 3300048917 Bacteria 1026
614 Ga0496115_0110618 3300048918 Bacteria 2257
615 Ga0496116_0000001 3300048919 Bacteria 1501681
616 Ga0496116_0004925 3300048919 Bacteria 12582
617 Ga0496116_0006000 3300048919 Bacteria 11134
618 Ga0496116_0010671 3300048919 Bacteria 7677
619 Ga0496116_0011008 3300048919 Bacteria 7528
620 Ga0496116_0037904 3300048919 Bacteria 3355
621 Ga0496117_0000958 3300048920 Bacteria 44157
622 Ga0496117_0000965 3300048920 Bacteria 44061
623 Ga0496117_0001888 3300048920 Bacteria 28090
624 Ga0496117_0002440 3300048920 Bacteria 23448
625 Ga0496117_0003572 3300048920 Bacteria 17940
626 Ga0496117_0004240 3300048920 Bacteria 16002
627 Ga0496117_0041762 3300048920 Bacteria 3355
628 Ga0496117_0089604 3300048920 Bacteria 1986
629 Ga0496117_0142075 3300048920 Bacteria 1436
630 Ga0496118_0000568 3300048921 Bacteria 61136
631 Ga0496118_0001301 3300048921 Bacteria 38037
632 Ga0496118_0004937 3300048921 Bacteria 15461
633 Ga0496118_0005145 3300048921 Bacteria 14996
634 Ga0496118_0036182 3300048921 Bacteria 3996
635 Ga0496118_0086465 3300048921 Bacteria 2178
636 Ga0496118_0128695 3300048921 Bacteria 1631
637 Ga0496118_0131904 3300048921 Bacteria 1603
638 Ga0496118_0165062 3300048921 Bacteria 1362
639 Ga0496119_0000011 3300048922 Bacteria 438315
640 Ga0496119_0002074 3300048922 Bacteria 22650
641 Ga0496119_0003186 3300048922 Bacteria 17202
642 Ga0496119_0005028 3300048922 Bacteria 12861
643 Ga0496119_0025377 3300048922 Bacteria 4141
644 Ga0496119_0026843 3300048922 Bacteria 3980
645 Ga0496119_0152593 3300048922 Bacteria 1236
646 Ga0496119_0212843 3300048922 Bacteria 993
647 Ga0496120_0000051 3300048923 Bacteria 186239
648 Ga0496120_0000092 3300048923 Bacteria 148990
649 Ga0496120_0000627 3300048923 Bacteria 52784
650 Ga0496120_0010894 3300048923 Bacteria 6290
651 Ga0496120_0018559 3300048923 Bacteria 4477
652 Ga0496120_0127969 3300048923 Bacteria 1304
653 Ga0496121_0000275 3300048924 Bacteria 107073
654 Ga0496121_0000590 3300048924 Bacteria 68048
655 Ga0496121_0001459 3300048924 Bacteria 39949
656 Ga0496121_0002682 3300048924 Bacteria 26627
657 Ga0496121_0004343 3300048924 Bacteria 19165
658 Ga0496121_0005254 3300048924 Bacteria 16736
659 Ga0496121_0006478 3300048924 Bacteria 14510
660 Ga0496121_0019538 3300048924 Bacteria 6766
661 Ga0496121_0069887 3300048924 Bacteria 2831
662 Ga0496121_0075624 3300048924 Bacteria 2689
663 Ga0496121_0103649 3300048924 Bacteria 2188
664 Ga0496121_0121197 3300048924 Bacteria 1975
665 Ga0496121_0152801 3300048924 Bacteria 1696
666 Ga0496121_0178652 3300048924 Bacteria 1534
667 Ga0496121_0343949 3300048924 Bacteria 996
668 Ga0496122_0000363 3300048925 Bacteria 97542
669 Ga0496122_0000451 3300048925 Bacteria 85677
670 Ga0496122_0004519 3300048925 Bacteria 17177
671 Ga0496122_0005094 3300048925 Bacteria 15856
672 Ga0496122_0005170 3300048925 Bacteria 15699
673 Ga0496122_0007206 3300048925 Bacteria 12448
674 Ga0496122_0035300 3300048925 Bacteria 4070
675 Ga0496122_0124986 3300048925 Bacteria 1649
676 Ga0496122_0150230 3300048925 Bacteria 1439
677 Ga0496123_0000136 3300048926 Bacteria 152399
678 Ga0496123_0000271 3300048926 Bacteria 102859
679 Ga0496123_0000639 3300048926 Bacteria 58527
680 Ga0496123_0004166 3300048926 Bacteria 15465
681 Ga0496123_0005138 3300048926 Bacteria 13346
682 Ga0496123_0010618 3300048926 Bacteria 8104
683 Ga0496123_0017281 3300048926 Bacteria 5813
684 Ga0496123_0050892 3300048926 Bacteria 2764
685 Ga0496123_0107397 3300048926 Bacteria 1606
686 Ga0496124_0000103 3300048927 Bacteria 179162
687 Ga0496124_0000195 3300048927 Bacteria 119909
688 Ga0496124_0000248 3300048927 Bacteria 104502
689 Ga0496124_0002867 3300048927 Bacteria 21798
690 Ga0496124_0005108 3300048927 Bacteria 14942
691 Ga0496124_0006092 3300048927 Bacteria 13266
692 Ga0496124_0009336 3300048927 Bacteria 10105
693 Ga0496124_0028018 3300048927 Bacteria 5043
694 Ga0496124_0080861 3300048927 Bacteria 2673
695 Ga0496124_0087337 3300048927 Bacteria 2550
696 Ga0496124_0235075 3300048927 Bacteria 1367
697 Ga0496125_0000023 3300048928 Bacteria 449042
698 Ga0496125_0000269 3300048928 Bacteria 106605
699 Ga0496125_0000361 3300048928 Bacteria 85699
700 Ga0496125_0000502 3300048928 Bacteria 68171
701 Ga0496125_0003272 3300048928 Bacteria 19921
702 Ga0496125_0010599 3300048928 Bacteria 9311
703 Ga0496125_0015010 3300048928 Bacteria 7522
704 Ga0496125_0032286 3300048928 Bacteria 4652
705 Ga0496125_0051940 3300048928 Bacteria 3375
706 Ga0496125_0066629 3300048928 Bacteria 2844
707 Ga0496125_0082116 3300048928 Bacteria 2458
708 Ga0496125_0083661 3300048928 Bacteria 2426
709 Ga0496125_0126515 3300048928 Bacteria 1810
710 Ga0496125_0208089 3300048928 Bacteria 1273
711 Ga0496126_0002450 3300048929 Bacteria 25049
712 Ga0496126_0003075 3300048929 Bacteria 21581
713 Ga0496126_0014791 3300048929 Bacteria 7872
714 Ga0496126_0022492 3300048929 Bacteria 6134
715 Ga0496126_0024999 3300048929 Bacteria 5757
716 Ga0496126_0031321 3300048929 Bacteria 5028
717 Ga0496126_0056934 3300048929 Bacteria 3532
718 Ga0496126_0063270 3300048929 Bacteria 3317
719 Ga0496126_0088155 3300048929 Bacteria 2734
720 Ga0496126_0133837 3300048929 Bacteria 2140
721 Ga0496126_0244575 3300048929 Bacteria 1497
722 Ga0495678_000138 3300049459 Bacteria 87271
723 Ga0495678_005713 3300049459 Bacteria 6767
724 Ga0495678_008918 3300049459 Bacteria 5014
725 Ga0495678_009445 3300049459 Bacteria 4824
726 Ga0495678_018353 3300049459 Bacteria 3147
727 Ga0495682_0002747 3300049460 Bacteria 8155
728 Ga0495682_0003903 3300049460 Bacteria 6513
729 Ga0501032_0064833 3300049569 Bacteria 2445
730 Ga0501034_0000067 3300049571 Bacteria 184398
731 Ga0501034_0000411 3300049571 Bacteria 72008
732 Ga0501034_0000969 3300049571 Bacteria 41330
733 Ga0501034_0117187 3300049571 Bacteria 2651
734 Ga0501038_0124549 3300049574 Bacteria 2122
735 Ga0501047_0005850 3300049581 Bacteria 11575
736 Ga0501047_0474055 3300049581 Bacteria 1080
737 Ga0501069_0026589 3300049585 Bacteria 3169
738 Ga0501070_0003372 3300049586 Bacteria 13862
739 Ga0501073_0003130 3300049589 Bacteria 12402
740 Ga0501074_0003900 3300049590 Bacteria 10629
741 Ga0501079_0013758 3300049741 Bacteria 6170
742 Ga0501080_0008917 3300049742 Bacteria 9120
743 Ga0501083_0001432 3300049744 Bacteria 16284
744 Ga0501083_0075678 3300049744 Bacteria 2236
745 Ga0501262_000023 3300049759 Bacteria 21585
746 Ga0501035_0030816 3300049822 Bacteria 4888
747 Ga0501044_0019060 3300049823 Bacteria 7345
748 nmdc:mga03683_3815_c1 3300050489 Bacteria 4922
749 nmdc:mga03n38_180050_c1 3300050490 Bacteria 1082
750 nmdc:mga00v17_42544_c2 3300050491 Bacteria 1131
751 nmdc:mga0yw44_290053_c1 3300050492 Bacteria 1095
752 nmdc:mga0yw44_43558_c1 3300050492 Bacteria 2680
753 nmdc:mga06z11_106634_c1 3300050494 Bacteria 1545
754 nmdc:mga07m45_131526_c1 3300050496 Bacteria 1159
755 nmdc:mga07m45_23805_c1 3300050496 Bacteria 3350
756 nmdc:mga07m45_77748_c1 3300050496 Bacteria 1893
757 nmdc:mga05p37_423978_c1 3300050507 Bacteria 1547
758 nmdc:mga0sz30_144709_c1 3300050516 Bacteria 1050
759 nmdc:mga0sz30_2557_c1 3300050516 Bacteria 6477
760 nmdc:mga0sz30_51021_c2 3300050516 Bacteria 1187
761 Ga0500610_0002836 3300053079 Bacteria 6502
762 Ga0500643_027219 3300053087 Bacteria 1780
763 Ga0500641_0049477 3300053096 Bacteria 1724
764 Ga0500650_0000063 3300053098 Bacteria 34213
765 Ga0500556_0009668 3300053104 Bacteria 2809
766 Ga0500557_025410 3300053105 Bacteria 1741
767 Ga0500562_000113 3300053108 Bacteria 27908
768 Ga0500562_013490 3300053108 Bacteria 2088
769 Ga0500569_000924 3300053109 Bacteria 5278
770 Ga0500572_001665 3300053111 Bacteria 5820
771 Ga0500608_058236 3300053122 Bacteria 1850
772 Ga0500608_104707 3300053122 Bacteria 1306
773 Ga0500618_026479 3300053125 Bacteria 1385
774 Ga0500626_082159 3300053128 Bacteria 1423
775 Ga0500642_0110031 3300053130 Bacteria 1286
776 Ga0500658_0000070 3300053134 Bacteria 48197
777 Ga0500658_0000102 3300053134 Bacteria 39059
778 Ga0500658_0001588 3300053134 Bacteria 9082
779 Ga0500658_0047632 3300053134 Bacteria 1740
780 Ga0500659_0001037 3300053135 Bacteria 17855
781 Ga0500659_0211279 3300053135 Bacteria 925
782 Ga0500559_0027737 3300053136 Bacteria 2417
783 Ga0500559_0128397 3300053136 Bacteria 1183
784 Ga0500568_0000375 3300053139 Bacteria 34271
785 Ga0500568_0000604 3300053139 Bacteria 26015
786 Ga0500568_0000686 3300053139 Bacteria 24412
787 Ga0500568_0003547 3300053139 Bacteria 8635
788 Ga0500577_0000018 3300053142 Bacteria 48454
789 Ga0500577_0007804 3300053142 Bacteria 3018
790 Ga0500588_0003446 3300053146 Bacteria 3339
791 Ga0500590_005262 3300053148 Bacteria 6213
792 Ga0500603_010192 3300053150 Bacteria 2116
793 Ga0500604_0000104 3300053151 Bacteria 26172
794 Ga0500604_0017316 3300053151 Bacteria 1993
795 Ga0500616_0000057 3300053153 Bacteria 278571
796 Ga0500616_0001104 3300053153 Bacteria 27910
797 Ga0500616_0041529 3300053153 Bacteria 2467
798 Ga0500622_0000060 3300053156 Bacteria 133737
799 Ga0500634_0055094 3300053161 Bacteria 2128
800 Ga0500636_0000914 3300053177 Bacteria 15902
801 Ga0500636_0094542 3300053177 Bacteria 1707
802 Ga0500599_000112 3300053736 Bacteria 7459
803 Ga0501084_0037477 3300054114 Bacteria 4051
804 Ga0501084_0203163 3300054114 Bacteria 1672
805 Ga0587128_005133 3300059630 Bacteria 1552
806 Ga0501082_0051239 3300060353 Bacteria 3558
807 2506578337 2506520007 Bacteria 5442880
808 2506583475 2506520008 Bacteria 5443009
809 2508693084 2508501042 Bacteria 8719808
810 2508852338 2508501071 Bacteria 5454741
811 2510893229 2510461076 Bacteria 8618824
812 2511194172 2510917030 Bacteria 7460662
813 2511330144 2511231017 Bacteria 6503007
814 2511330400 2511231017 Bacteria 6503007
815 2511376646 2511231024 Bacteria 5835885
816 2512037160 2511231221 Bacteria 6846400
817 2513574292 2513237085 Bacteria 7695351
818 2513634707 2513237093 Bacteria 7545552
819 2513660956 2513237096 Bacteria 8722461
820 2513670963 2513237098 Bacteria 9902361
821 2513861813 2513237137 Bacteria 9558895
822 2513915637 2513237145 Bacteria 8979722
823 2513952704 2513237150 Bacteria 6553639
824 2513953151 2513237150 Bacteria 6553639
825 2514000792 2513237159 Bacteria 6810126
826 2514024288 2513237162 Bacteria 7468464
827 2514042116 2513237165 Bacteria 6771773
828 2515637284 2515154113 Bacteria 7807172
829 2515645210 2515154114 Bacteria 7848616
830 2515661593 2515154116 Bacteria 7552979
831 2515737800 2515154134 Bacteria 7220242
832 2517079753 2516653085 Bacteria 7346596
833 2517099336 2517093000 Bacteria 7412387
834 2524465520 2524023210 Bacteria 9029266
835 2528851396 2528768022 Bacteria 10457665
836 2585268594 2582581306 Bacteria 6450535
837 2585333109 2582581316 Bacteria 7774528
838 2585389258 2582581865 Bacteria 6644329
839 2585393657 2582581866 Bacteria 6859583
840 2585525896 2585427526 Bacteria 7258840
841 2585847597 2585427594 Bacteria 6180594
842 2599101781 2597490356 Bacteria 7030811
843 2599627751 2599185214 Bacteria 8209958
844 2599677328 2599185226 Bacteria 8233575
845 2599685392 2599185227 Bacteria 8246414
846 2599697194 2599185229 Bacteria 8216126
847 2599723581 2599185236 Bacteria 6875203
848 2600024933 2599185316 Bacteria 6320029
849 2600029440 2599185317 Bacteria 6435722
850 2600041055 2599185319 Bacteria 6637840
851 2600065422 2599185323 Bacteria 6688755
852 2600079060 2599185325 Bacteria 6324919
853 2600358876 2600254930 Bacteria 6431253
854 2643810975 2643221558 Bacteria 5460675
855 2644498332 2643221689 Bacteria 6042950
856 2656279148 2654587920 Bacteria 5475511
857 2671113210 2667528174 Bacteria 6435400
858 2671130169 2667528176 Bacteria 6724917
859 2689444885 2687453601 Bacteria 5546041
860 2722885409 2721755523 Bacteria 6430384
861 2738885337 2738541307 Bacteria 8606193
862 2739199704 2738543004 Bacteria 6381073
863 2746087042 2744054900 Bacteria 8399525
864 2746094677 2744054901 Bacteria 8397047
865 2766066515 2765235942 Bacteria 7445910
866 2793072252 2791355197 Bacteria 8420563
867 2807177537 2806310673 Bacteria 4801221
868 2819598493 2818991446 Bacteria 7757362
869 2819617776 2818991449 Bacteria 5518009
870 2831268385 2831265667 Bacteria 7184833
871 2834645871 2834641062 Bacteria 5559922
872 2838031730 2838029111 Bacteria 6603031
873 2838061385 2838054893 Bacteria 7451788
874 2838687981 2838686498 Bacteria 7807632
875 2838733704 2838729681 Bacteria 7400765
876 2838746374 2838742623 Bacteria 7396178
877 2839140402 2839138175 Bacteria 6549354
878 2841857620 2841851746 Bacteria 7532261
879 2842111913 2842110456 Bacteria 7656360
880 2842159203 2842156927 Bacteria 6894975
881 2842163739 2842163707 Bacteria 6916235
882 2842183228 2842180545 Bacteria 6888678
883 2842234492 2842229732 Bacteria 7475766
884 2842248014 2842243621 Bacteria 7421798
885 2842259609 2842257432 Bacteria 7401195
886 2842271988 2842271015 Bacteria 7807131
887 2842309710 2842304105 Bacteria 7023636
888 2842324895 2842324504 Bacteria 9364110
889 2842349174 2842348783 Bacteria 9002918
890 2842457032 2842454564 Bacteria 8730687
891 2842478462 2842475841 Bacteria 6603183
892 2842505592 2842502639 Bacteria 6604161
893 2842515791 2842509118 Bacteria 6850950
894 2842525419 2842521101 Bacteria 6569494
895 2844459938 2844454524 Bacteria 7952546
896 2846957925 2846952575 Bacteria 6587527
897 2852393898 2852387548 Bacteria 8025568
898 2855733412 2855730933 Bacteria 7047938
899 2855772371 2855767633 Bacteria 7049357
900 2857523570 2857516855 Bacteria 7787325
901 2857543514 2857542790 Bacteria 5326616
902 2858951771 2858950400 Bacteria 6783797
903 2858952486 2858950400 Bacteria 6783797
904 2869554293 2869551831 Bacteria 5474685
905 2874628525 2874620515 Bacteria 8290088
906 2881413878 2881412998 Bacteria 6492157
907 2885384113 2885383462 Bacteria 9473874
908 2888368949 2888366609 Bacteria 5155009
909 2891378098 2891373044 Bacteria 5202277
910 2893066672 2893066018 Bacteria 6158120
911 2899926279 2899924645 Bacteria 7487985
912 2903749977 2903748898 Bacteria 9972761
913 2904453798 2904449895 Bacteria 6927402
914 2904462273 2904456579 Bacteria 6819253
915 2904482799 2904479285 Bacteria 5073931
916 2904550019 2904541872 Bacteria 8915136
917 2904667195 2904666416 Bacteria 8226587
918 2909401414 2909399089 Bacteria 3922598
919 2913041221 2913036834 Bacteria 6704877
920 2919157135 2919155634 Bacteria 4860545
921 2919412978 2919408235 Bacteria 6149349
922 2928044212 2928037797 Bacteria 7273642
923 2928051051 2928044640 Bacteria 7271509
924 2928057114 2928051484 Bacteria 7773759
925 2928069370 2928064002 Bacteria 7419480
926 2928077120 2928070936 Bacteria 8062541
927 2928089891 2928084124 Bacteria 7159212
928 2928118698 2928115317 Bacteria 6477646
929 2928133337 2928130867 Bacteria 5467269
930 2929166513 2929160207 Bacteria 9075316
931 2932792160 2932784394 Bacteria 9704911
932 2932814473 2932809354 Bacteria 9135765
933 2932837349 2932828146 Bacteria 9745859
934 2933576152 2933570622 Bacteria 7023390
935 2933588188 2933586486 Bacteria 7667493
936 2935623412 2935616580 Bacteria 9032984
937 2935652546 2935648319 Bacteria 8801166
938 2935661128 2935656913 Bacteria 8965014
939 2935672738 2935665750 Bacteria 9571747
940 2935845018 2935837841 Bacteria 9454360
941 2935861588 2935855204 Bacteria 9035059
942 2935902840 2935901341 Bacteria 7341747
943 2936015185 2936011229 Bacteria 8801034
944 2936023330 2936019824 Bacteria 8804134
945 2936032217 2936028420 Bacteria 8965941
946 2936050078 2936046547 Bacteria 8903709
947 2936061820 2936055302 Bacteria 8785755
948 2936371301 2936367885 Bacteria 7324495
949 2936375496 2936375103 Bacteria 6652732
950 2937053825 2937049772 Bacteria 6757901
951 2939632206 2939631187 Bacteria 6118131
952 2941479751
953 2941480830
954 2945963914 2945961074 Bacteria 7342064
955 2954767901 2954767861 Bacteria 5535784
956 2957415532 2957415311 Bacteria 6991633
957 2957447389 2957443900 Bacteria 6869977
958 2960623168 2960617483 Bacteria 6727748
959 2960663177 2960660292 Bacteria 7041660
960 2970044156 2970040964 Bacteria 6731123
961 2970119377 2970116247 Bacteria 6501857
962 2970153564 2970149975 Bacteria 6779706
963 2977526488 2977523885 Bacteria 6960446
964 2977583208 2977579622 Bacteria 6772100
965 3005419360 3005416602 Bacteria 7064308
966 3005477345 3005474847 Bacteria 9259049
967 3007319683 3007315729 Bacteria 5076637
968 640937849 640753048 Bacteria 5495657
969 644747181 644736347 Bacteria 6476522
970 8002396191 8002392321 Bacteria 4159911
971 8003405135 8003400568 Bacteria 5535898
972 8004595831 8004592986 Bacteria 5122074
973 8005307610 8005307578 Bacteria 7395396
974 8005380285 8005376324 Bacteria 6590079
975 8015398173 8015394850 Bacteria 5064660
976 8016515593 8016511872 Bacteria 9921665
977 8016588089 8016583857 Bacteria 10421953
978 8016633243 8016630954 Bacteria 9217207
979 8017060902 8017057580 Bacteria 10023680
980 8019559072 8019555841 Bacteria 9642137
981 8019566231 8019565922 Bacteria 9639779
982 8023687798 8023680758 Bacteria 7729763
983 8045868269 8045864390 Bacteria 5043873
984 8046767856 8046767195 Bacteria 7547379
985 8052498070 8052494512 Bacteria 5765634
986 8054005310 8054002106 Bacteria 7987183
987 8056154613 8056148874 Bacteria 6479865
988 8056974437 8056967851 Bacteria 9038162
989 Ga0495674_0009261
990 MRS2a_Contig_7280
991 SwRhRL2b_contig_2571238
992 JGI24740J21852_10000003
993 JGI24735J21928_10000668
994 JGI25155J39150_1000133
995 JGI25156J39149_1000263
996 JGI25162J39368_1000069
997 JGI25154J39366_1000338
998 JGI25157J39369_1000306
999 JGI25152J39213_1000122
1000 JGI25152J39213_1010718
1001 JGI25150J39212_1001287
1002 JGI25159J45721_1000987
1003 JGI25159J45721_1010275
1004 JGI25159J45721_1011002
1005 JGI25151J46595_10000401
1006 JGI25151J46595_10000448
1007 JGI25151J46595_10000608
1008 JGI25151J46595_10018070
1009 JGI25151J46595_10031433
1010 JGI25165J46597_1000018
1011 JGI25153J46596_10000159
1012 JGI25153J46596_10002484
1013 JGI25153J46596_10026123
1014 rootL2_10210444
1015 rootH1_10167920
1016 rootH1_10274232
1017 JGI25160J50197_1000058
1018 JGI25160J50197_1016303
1019 JGI25161J50226_1000044
1020 JGI25161J50226_1005119
1021 Ga0055532_1011066
1022 Ga0055535_1002066
1023 Ga0055542_1000381
1024 Ga0055526_1021376
1025 Ga0055526_1023143
1026 Ga0055537_1001819
1027 Ga0055537_1009806
1028 Ga0055524_1018681
1029 Ga0055524_1020192
1030 Ga0055536_1018491
1031 Ga0055534_1000260
1032 Ga0055534_1009685
1033 Ga0055528_1010747
1034 Ga0055528_1021187
1035 Ga0055540_1000890
1036 Ga0055540_1010767
1037 Ga0055531_10007399
1038 Ga0055543_1006413
1039 Ga0055543_1010321
1040 Ga0065165_1000158
1041 Ga0065165_1000618
1042 Ga0065165_1015909
1043 Ga0065714_10003745
1044 Ga0065714_10022924
1045 Ga0065704_10096997
1046 Ga0065704_10110782
1047 Ga0070658_10011628
1048 Ga0070658_10113096
1049 Ga0070683_100044621
1050 Ga0070670_100000722
1051 Ga0070680_100020564
1052 Ga0070680_100576270
1053 Ga0070660_100010431
1054 Ga0070661_100000040
1055 Ga0070661_100011546
1056 Ga0070673_100171680
1057 Ga0070659_100040888
1058 Ga0070659_100114731
1059 Ga0070667_100019539
1060 Ga0070714_100003508
1061 Ga0070681_10006959
1062 Ga0070679_100030891
1063 Ga0070679_100054041
1064 Ga0070684_100002664
1065 Ga0068853_100002331
1066 Ga0068853_100114040
1067 Ga0070693_100007035
1068 Ga0068855_100000037
1069 Ga0068855_100008499
1070 Ga0070664_100043080
1071 Ga0068857_100003638
1072 Ga0068857_100209354
1073 Ga0068854_100008606
1074 Ga0068852_100000513
1075 Ga0068852_100035844
1076 Ga0068851_10028683
1077 Ga0068863_100186825
1078 Ga0068860_100002725
1079 Ga0081540_1020081
1080 Ga0075365_10151781
1081 Ga0075368_10022562
1082 Ga0075364_10016197
1083 Ga0075432_10012455
1084 Ga0075432_10026499
1085 Ga0075362_10012710
1086 Ga0075362_10140473
1087 Ga0075367_10101029
1088 Ga0075369_10011291
1089 Ga0075369_10068311
1090 Ga0075369_10126160
1091 Ga0075370_10000965
1092 Ga0075370_10211189
1093 Ga0068871_100377361
1094 Ga0075428_100185933
1095 Ga0099823_1000006
1096 Ga0079104_1000072
1097 Ga0079104_1001229
1098 Ga0079104_1044692
1099 Ga0099826_10000044
1100 Ga0105251_10000002
1101 Ga0105251_10000066
1102 Ga0105251_10002189
1103 Ga0105251_10016021
1104 Ga0105244_10004003
1105 Ga0105244_10020922
1106 Ga0105244_10072214
1107 Ga0105244_10135184
1108 Ga0105250_10000992
1109 Ga0105250_10005221
1110 Ga0105250_10026569
1111 Ga0105240_10008252
1112 Ga0105240_10056923
1113 Ga0105240_10098178
1114 Ga0105240_10656503
1115 Ga0105245_10049230
1116 Ga0105247_10000128
1117 Ga0114129_10463539
1118 Ga0105243_10003192
1119 Ga0105241_10000002
1120 Ga0105241_10043125
1121 Ga0105241_10058427
1122 Ga0105242_10003142
1123 Ga0105248_11025050
1124 Ga0105237_10000933
1125 Ga0105237_10015089
1126 Ga0105237_10226444
1127 Ga0105238_10001084
1128 Ga0105238_10038832
1129 Ga0105238_10061454
1130 Ga0105239_10010763
1131 Ga0105239_10013297
1132 Ga0105246_10381816
1133 Ga0157373_10005574
1134 Ga0157373_10014879
1135 Ga0157373_10016159
1136 Ga0157373_10306061
1137 Ga0157371_10012334
1138 Ga0157371_10025042
1139 Ga0157370_10014861
1140 Ga0157370_10139328
1141 Ga0157369_10000456
1142 Ga0157369_10314399
1143 Ga0157369_10771175
1144 Ga0157374_10041472
1145 Ga0163162_10038626
1146 Ga0157372_10108470
1147 Ga0157375_10138188
1148 Ga0157375_10604402
1149 Ga0182008_10000107
1150 Ga0182008_10000644
1151 Ga0182008_10006362
1152 Ga0182008_10017638
1153 Ga0157379_10745795
1154 Ga0157376_10906501
1155 Ga0182006_1012688
1156 Ga0182006_1022628
1157 Ga0182007_10001168
1158 Ga0182007_10036575
1159 Ga0182005_1000979
1160 Ga0183362_10006
1161 Ga0163161_10000001
1162 Ga0163161_10000308
1163 Ga0163161_10014069
1164 Ga0163161_10116368
1165 Ga0209435_100083
1166 Ga0209435_101941
1167 Ga0209436_110831
1168 Ga0209147_102644
1169 Ga0209437_100022
1170 Ga0209258_100454
1171 Ga0207425_1000483
1172 Ga0209646_1000278
1173 Ga0209026_1000339
1174 Ga0209148_1000449
1175 Ga0209759_1000469
1176 Ga0209129_1000030
1177 Ga0209129_1006426
1178 Ga0209233_1000031
1179 Ga0209233_1005675
1180 Ga0209565_1000019
1181 Ga0209565_1000047
1182 Ga0209565_1007509
1183 Ga0209455_1013693
1184 Ga0209673_1000079
1185 Ga0209673_1000095
1186 Ga0209673_1012683
1187 Ga0209130_1000011
1188 Ga0209130_1000085
1189 Ga0209130_1000272
1190 Ga0209130_1002673
1191 Ga0209675_1000046
1192 Ga0209675_1000073
1193 Ga0209675_1004206
1194 Ga0209675_1008546
1195 Ga0209675_1012745
1196 Ga0209676_1003773
1197 Ga0209676_1005770
1198 Ga0209676_1027740
1199 Ga0209025_1000028
1200 Ga0209025_1000055
1201 Ga0209025_1000471
1202 Ga0209025_1000494
1203 Ga0209025_1000973
1204 Ga0209025_1017045
1205 Ga0209025_1029664
1206 Ga0209564_1000725
1207 Ga0209564_1014616
1208 Ga0209758_1000037
1209 Ga0209758_1018973
1210 Ga0209050_1041390
1211 Ga0209256_1000023
1212 Ga0209256_1001930
1213 Ga0207426_1000029
1214 Ga0207426_1000076
1215 Ga0207426_1000835
1216 Ga0207426_1007595
1217 Ga0207426_1019688
1218 Ga0209051_1000128
1219 Ga0209051_1004231
1220 Ga0209051_1007641
1221 Ga0209051_1035753
1222 Ga0209051_1040679
1223 Ga0209257_1010457
1224 Ga0207656_10012577
1225 Ga0207696_1000001
1226 Ga0207696_1003281
1227 Ga0207696_1007082
1228 Ga0207655_1000081
1229 Ga0207655_1000180
1230 Ga0207655_1104552
1231 Ga0207713_1000008
1232 Ga0207713_1000016
1233 Ga0207713_1000193
1234 Ga0207713_1002232
1235 Ga0207713_1021468
1236 Ga0207710_10000224
1237 Ga0207705_10035521
1238 Ga0207705_10130272
1239 Ga0207654_10000005
1240 Ga0207654_10046835
1241 Ga0207654_10110251
1242 Ga0207695_10128426
1243 Ga0207695_10372910
1244 Ga0207671_10174376
1245 Ga0207660_10062792
1246 Ga0207657_10002914
1247 Ga0207649_10070214
1248 Ga0207652_10025294
1249 Ga0207652_10080692
1250 Ga0207694_10000833
1251 Ga0207694_10103017
1252 Ga0207694_10126979
1253 Ga0207687_10029533
1254 Ga0207664_10143199
1255 Ga0207690_10035802
1256 Ga0207690_10143778
1257 Ga0207686_10012369
1258 Ga0207709_10000104
1259 Ga0207661_10325648
1260 Ga0207661_10575746
1261 Ga0207679_10014861
1262 Ga0207667_10000053
1263 Ga0207667_10011698
1264 Ga0207668_10104234
1265 Ga0207640_10008079
1266 Ga0207658_10165261
1267 Ga0207639_10002786
1268 Ga0207702_10007049
1269 Ga0207641_10035601
1270 Ga0207648_10077499
1271 Ga0207674_10000994
1272 Ga0207674_10291049
1273 Ga0207683_10141845
1274 Ga0207698_10152222
1275 Ga0209281_1000002
1276 Ga0209281_1000003
1277 Ga0209281_1023761
1278 Ga0209389_1000003
1279 Ga0209389_1000030
1280 Ga0209371_1000409
1281 Ga0209489_100022
1282 Ga0209700_100023
1283 Ga0209282_1001203
1284 Ga0207428_10024062
1285 Ga0268264_10004086
1286 Ga0307515_10000115
1287 Ga0307515_10004008
1288 Ga0307515_10038642
1289 Ga0307515_10121696
1290 Ga0268256_1000350
1291 Ga0265327_10005883
1292 Ga0307513_10000931
1293 Ga0307513_10057631
1294 Ga0307513_10106562
1295 Ga0307408_100005155
1296 Ga0307508_10102253
1297 Ga0265314_10002400
1298 Ga0265314_10040524
1299 Ga0307516_10006311
1300 Ga0307405_10000548
1301 Ga0307405_10002875
1302 Ga0307405_10274248
1303 Ga0307405_10494364
1304 Ga0307406_10327556
1305 Ga0307412_10000123
1306 Ga0307412_10000487
1307 Ga0307412_10107044
1308 Ga0307416_100013723
1309 Ga0307416_100038208
1310 Ga0307416_100655794
1311 Ga0307414_10021385
1312 Ga0307414_10206106
1313 Ga0307414_10213411
1314 Ga0307414_10347015
1315 Ga0307411_10106748
1316 Ga0373925_0008436
1317 Ga0395900_0002965
1318 Ga0395900_0039763
1319 Ga0395898_0106298
1320 Ga0395905_0000330
1321 Ga0395905_0050737
1322 Ga0395905_0115577
1323 Ga0436361_0282271
1324 Ga0439436_0055836
1325 Ga0439438_001817
1326 Ga0451835_0099071
1327 Ga0451841_1152441
1328 Ga0451845_0146513
1329 Ga0451855_0112004
1330 Ga0451853_0494432
1331 Ga0439432_001581
1332 Ga0439432_016922
1333 Ga0439452_009979
1334 Ga0450911_000058
1335 Ga0450902_000607
1336 Ga0450905_011319
1337 Ga0450901_000408
1338 Ga0495617_000082
1339 Ga0495617_025514
1340 Ga0495617_038087
1341 Ga0495617_070725
1342 Ga0495627_000070
1343 Ga0495627_016113
1344 Ga0495603_0005865
1345 Ga0495590_0002468
1346 Ga0495591_003453
1347 Ga0495591_007354
1348 Ga0495591_008555
1349 Ga0495591_012751
1350 Ga0495629_0009217
1351 Ga0495638_0000216
1352 Ga0495638_0000518
1353 Ga0495638_0005479
1354 Ga0495638_0020423
1355 Ga0495638_0083882
1356 Ga0495638_0175068
1357 Ga0495653_0000460
1358 Ga0495653_0002626
1359 Ga0495650_0000143
1360 Ga0495650_0010402
1361 Ga0495650_0039603
1362 Ga0495580_0012949
1363 Ga0495605_0000401
1364 Ga0495605_0006510
1365 Ga0495605_0008765
1366 Ga0495605_0013692
1367 Ga0495664_0015752
1368 Ga0495664_0034121
1369 Ga0495664_0161927
1370 Ga0495664_0217329
1371 Ga0495585_0000300
1372 Ga0495585_0001961
1373 Ga0495585_0009470
1374 Ga0495585_0015901
1375 Ga0495585_0044825
1376 Ga0495585_0084926
1377 Ga0495596_0040257
1378 Ga0495607_0001528
1379 Ga0495607_0004890
1380 Ga0495607_0008626
1381 Ga0495607_0018423
1382 Ga0495607_0031773
1383 Ga0495607_0040498
1384 Ga0495583_0000124
1385 Ga0495583_0000181
1386 Ga0495583_0000283
1387 Ga0495583_0011914
1388 Ga0495606_0000013
1389 Ga0495606_0004709
1390 Ga0495606_0005549
1391 Ga0495606_0008182
1392 Ga0495606_0013479
1393 Ga0495606_0013628
1394 Ga0495606_0030652
1395 Ga0495606_0033875
1396 Ga0495606_0040943
1397 Ga0495606_0120660
1398 Ga0495608_0190927
1399 Ga0495610_0000379
1400 Ga0495610_0023910
1401 Ga0495610_0039870
1402 Ga0495610_0041757
1403 Ga0495610_0049767
1404 Ga0495610_0128269
1405 Ga0495616_0001220
1406 Ga0495616_0022532
1407 Ga0495616_0037115
1408 Ga0495620_0000058
1409 Ga0495628_0003162
1410 Ga0495628_0022973
1411 Ga0495630_0000726
1412 Ga0495631_0003886
1413 Ga0495631_0010898
1414 Ga0495631_0040319
1415 Ga0495632_0000838
1416 Ga0495632_0007273
1417 Ga0495632_0034611
1418 Ga0495632_0035654
1419 Ga0495632_0125168
1420 Ga0495637_0000021
1421 Ga0495637_0000282
1422 Ga0495637_0006029
1423 Ga0495637_0024633
1424 Ga0495637_0070543
1425 Ga0495637_0117789
1426 Ga0495643_0000508
1427 Ga0495643_0054569
1428 Ga0495643_0141856
1429 Ga0495644_0008858
1430 Ga0495648_0001313
1431 Ga0495648_0004836
1432 Ga0495648_0010321
1433 Ga0495648_0018664
1434 Ga0495648_0033997
1435 Ga0495648_0049671
1436 Ga0495648_0119297
1437 Ga0495652_0004289
1438 Ga0495654_0000379
1439 Ga0495654_0001416
1440 Ga0495654_0007575
1441 Ga0495654_0045589
1442 Ga0495654_0046362
1443 Ga0495654_0064016
1444 Ga0495654_0074601
1445 Ga0495654_0104263
1446 Ga0495665_0000144
1447 Ga0495665_0097272
1448 Ga0495665_0169460
1449 Ga0495586_0043755
1450 Ga0495586_0064320
1451 Ga0495609_0000062
1452 Ga0495609_0000706
1453 Ga0495609_0082525
1454 Ga0495597_0000109
1455 Ga0495597_0005857
1456 Ga0495597_0006216
1457 Ga0495597_0013772
1458 Ga0495622_0008380
1459 Ga0495622_0008444
1460 Ga0495633_0000168
1461 Ga0495633_0042286
1462 Ga0495668_0015505
1463 Ga0495668_0021620
1464 Ga0495668_0038102
1465 Ga0495611_0001757
1466 Ga0495611_0002586
1467 Ga0495611_0010031
1468 Ga0495625_0000028
1469 Ga0495625_0010130
1470 Ga0495625_0014308
1471 Ga0495625_0077770
1472 Ga0495635_0001829
1473 Ga0495635_0053270
1474 Ga0495659_0091739
1475 Ga0495661_0000001
1476 Ga0495661_0000013
1477 Ga0495661_0001016
1478 Ga0495661_0003810
1479 Ga0495661_0008465
1480 Ga0495661_0032611
1481 Ga0495588_0006483
1482 Ga0495588_0036530
1483 Ga0495588_0088308
1484 Ga0495657_0076360
1485 Ga0495599_0020738
1486 Ga0495623_0002095
1487 Ga0495646_0234091
1488 Ga0495669_0007329
1489 Ga0495669_0012505
1490 Ga0495624_0143254
1491 Ga0495670_0000809
1492 Ga0495670_0007933
1493 Ga0495670_0031795
1494 Ga0495670_0068448
1495 Ga0495670_0101312
1496 Ga0495670_0117308
1497 Ga0495671_0001413
1498 Ga0495671_0007853
1499 Ga0495671_0017251
1500 Ga0495671_0094418
1501 Ga0495649_0003338
1502 Ga0495649_0065376
1503 Ga0495589_0000001
1504 Ga0495589_0000767
1505 Ga0495589_0029858
1506 Ga0495600_0026821
1507 Ga0495660_0001061
1508 Ga0495660_0001202
1509 Ga0495660_0030230
1510 Ga0495660_0220253
1511 Ga0495604_0002608
1512 Ga0495604_0025994
1513 Ga0495636_0016843
1514 Ga0495674_0003450
1515 Ga0495674_0004344
1516 Ga0495674_0316535
1517 Ga0495672_0000912
1518 Ga0495672_0005501
1519 Ga0495672_0026007
1520 Ga0495672_0127544
1521 Ga0495676_0000006
1522 Ga0495676_0056728
1523 Ga0495676_0091183
1524 Ga0495680_0001386
1525 Ga0495683_0000185
1526 Ga0495683_0000673
1527 Ga0495683_0001189
1528 Ga0495683_0014792
1529 Ga0495683_0016469
1530 Ga0495683_0090691
1531 Ga0495687_000784
1532 Ga0495687_009122
1533 Ga0495687_089050
1534 Ga0495675_0043309
1535 Ga0495679_000148
1536 Ga0495679_000203
1537 Ga0495685_077901
1538 Ga0495673_0004182
1539 Ga0495673_0005131
1540 Ga0495673_0007202
1541 Ga0495673_0014894
1542 Ga0495673_0025263
1543 Ga0495673_0125942
1544 Ga0495681_0000653
1545 Ga0495681_0000803
1546 Ga0495681_0005526
1547 Ga0495686_0000045
1548 Ga0495686_0005840
1549 Ga0495686_0016711
1550 Ga0495686_0031403
1551 Ga0495686_0078738
1552 Ga0495686_0171279
1553 Ga0495686_0193019
1554 Ga0495593_0002697
1555 Ga0495593_0008883
1556 Ga0495593_0013971
1557 Ga0495602_0004972
1558 Ga0495602_0045254
1559 Ga0495602_0061771
1560 Ga0495615_0061209
1561 Ga0495626_0000019
1562 Ga0495626_0001519
1563 Ga0495626_0091028
1564 Ga0496100_0008194
1565 Ga0496101_0002200
1566 Ga0496101_0023922
1567 Ga0496101_0203978
1568 Ga0496102_0002501
1569 Ga0496102_0009781
1570 Ga0496102_0049467
1571 Ga0496102_0519249
1572 Ga0496103_0006426
1573 Ga0496103_0009825
1574 Ga0496103_0171022
1575 Ga0496104_0024714
1576 Ga0496104_0051878
1577 Ga0496104_0193752
1578 Ga0496105_0002786
1579 Ga0496105_0016402
1580 Ga0496105_0023953
1581 Ga0496106_0013396
1582 Ga0496106_0017119
1583 Ga0496106_0241956
1584 Ga0496107_0005965
1585 Ga0496107_0041431
1586 Ga0496107_0261726
1587 Ga0496109_0325806
1588 Ga0496110_0003473
1589 Ga0496110_0012286
1590 Ga0496110_0425536
1591 Ga0496110_0625009
1592 Ga0496111_0017806
1593 Ga0496111_0171455
1594 Ga0496111_0315808
1595 Ga0496112_0005936
1596 Ga0496113_0077820
1597 Ga0496113_0766816
1598 Ga0496114_0001598
1599 Ga0496114_0015328
1600 Ga0496114_0138462
1601 Ga0496114_0544534
1602 Ga0496115_0110618
1603 Ga0496116_0000001
1604 Ga0496116_0004925
1605 Ga0496116_0006000
1606 Ga0496116_0010671
1607 Ga0496116_0011008
1608 Ga0496116_0037904
1609 Ga0496117_0000958
1610 Ga0496117_0000965
1611 Ga0496117_0001888
1612 Ga0496117_0002440
1613 Ga0496117_0003572
1614 Ga0496117_0004240
1615 Ga0496117_0041762
1616 Ga0496117_0089604
1617 Ga0496117_0142075
1618 Ga0496118_0000568
1619 Ga0496118_0001301
1620 Ga0496118_0004937
1621 Ga0496118_0005145
1622 Ga0496118_0036182
1623 Ga0496118_0086465
1624 Ga0496118_0128695
1625 Ga0496118_0131904
1626 Ga0496118_0165062
1627 Ga0496119_0000011
1628 Ga0496119_0002074
1629 Ga0496119_0003186
1630 Ga0496119_0005028
1631 Ga0496119_0025377
1632 Ga0496119_0026843
1633 Ga0496119_0152593
1634 Ga0496119_0212843
1635 Ga0496120_0000051
1636 Ga0496120_0000092
1637 Ga0496120_0000627
1638 Ga0496120_0010894
1639 Ga0496120_0018559
1640 Ga0496120_0127969
1641 Ga0496121_0000275
1642 Ga0496121_0000590
1643 Ga0496121_0001459
1644 Ga0496121_0002682
1645 Ga0496121_0004343
1646 Ga0496121_0005254
1647 Ga0496121_0006478
1648 Ga0496121_0019538
1649 Ga0496121_0069887
1650 Ga0496121_0075624
1651 Ga0496121_0103649
1652 Ga0496121_0121197
1653 Ga0496121_0152801
1654 Ga0496121_0178652
1655 Ga0496121_0343949
1656 Ga0496122_0000363
1657 Ga0496122_0000451
1658 Ga0496122_0004519
1659 Ga0496122_0005094
1660 Ga0496122_0005170
1661 Ga0496122_0007206
1662 Ga0496122_0035300
1663 Ga0496122_0124986
1664 Ga0496122_0150230
1665 Ga0496123_0000136
1666 Ga0496123_0000271
1667 Ga0496123_0000639
1668 Ga0496123_0004166
1669 Ga0496123_0005138
1670 Ga0496123_0010618
1671 Ga0496123_0017281
1672 Ga0496123_0050892
1673 Ga0496123_0107397
1674 Ga0496124_0000103
1675 Ga0496124_0000195
1676 Ga0496124_0000248
1677 Ga0496124_0002867
1678 Ga0496124_0005108
1679 Ga0496124_0006092
1680 Ga0496124_0009336
1681 Ga0496124_0028018
1682 Ga0496124_0080861
1683 Ga0496124_0087337
1684 Ga0496124_0235075
1685 Ga0496125_0000023
1686 Ga0496125_0000269
1687 Ga0496125_0000361
1688 Ga0496125_0000502
1689 Ga0496125_0003272
1690 Ga0496125_0010599
1691 Ga0496125_0015010
1692 Ga0496125_0032286
1693 Ga0496125_0051940
1694 Ga0496125_0066629
1695 Ga0496125_0082116
1696 Ga0496125_0083661
1697 Ga0496125_0126515
1698 Ga0496125_0208089
1699 Ga0496126_0002450
1700 Ga0496126_0003075
1701 Ga0496126_0014791
1702 Ga0496126_0022492
1703 Ga0496126_0024999
1704 Ga0496126_0031321
1705 Ga0496126_0056934
1706 Ga0496126_0063270
1707 Ga0496126_0088155
1708 Ga0496126_0133837
1709 Ga0496126_0244575
1710 Ga0495678_000138
1711 Ga0495678_005713
1712 Ga0495678_008918
1713 Ga0495678_009445
1714 Ga0495678_018353
1715 Ga0495682_0002747
1716 Ga0495682_0003903
1717 Ga0501032_0064833
1718 Ga0501034_0000067
1719 Ga0501034_0000411
1720 Ga0501034_0000969
1721 Ga0501034_0117187
1722 Ga0501038_0124549
1723 Ga0501047_0005850
1724 Ga0501047_0474055
1725 Ga0501069_0026589
1726 Ga0501070_0003372
1727 Ga0501073_0003130
1728 Ga0501074_0003900
1729 Ga0501079_0013758
1730 Ga0501080_0008917
1731 Ga0501083_0001432
1732 Ga0501083_0075678
1733 Ga0501262_000023
1734 Ga0501035_0030816
1735 Ga0501044_0019060
1736 nmdc:mga03683_3815_c1
1737 nmdc:mga03n38_180050_c1
1738 nmdc:mga00v17_42544_c2
1739 nmdc:mga0yw44_290053_c1
1740 nmdc:mga0yw44_43558_c1
1741 nmdc:mga06z11_106634_c1
1742 nmdc:mga07m45_131526_c1
1743 nmdc:mga07m45_23805_c1
1744 nmdc:mga07m45_77748_c1
1745 nmdc:mga05p37_423978_c1
1746 nmdc:mga0sz30_144709_c1
1747 nmdc:mga0sz30_2557_c1
1748 nmdc:mga0sz30_51021_c2
1749 Ga0500610_0002836
1750 Ga0500643_027219
1751 Ga0500641_0049477
1752 Ga0500650_0000063
1753 Ga0500556_0009668
1754 Ga0500557_025410
1755 Ga0500562_000113
1756 Ga0500562_013490
1757 Ga0500569_000924
1758 Ga0500572_001665
1759 Ga0500608_058236
1760 Ga0500608_104707
1761 Ga0500618_026479
1762 Ga0500626_082159
1763 Ga0500642_0110031
1764 Ga0500658_0000070
1765 Ga0500658_0000102
1766 Ga0500658_0001588
1767 Ga0500658_0047632
1768 Ga0500659_0001037
1769 Ga0500659_0211279
1770 Ga0500559_0027737
1771 Ga0500559_0128397
1772 Ga0500568_0000375
1773 Ga0500568_0000604
1774 Ga0500568_0000686
1775 Ga0500568_0003547
1776 Ga0500577_0000018
1777 Ga0500577_0007804
1778 Ga0500588_0003446
1779 Ga0500590_005262
1780 Ga0500603_010192
1781 Ga0500604_0000104
1782 Ga0500604_0017316
1783 Ga0500616_0000057
1784 Ga0500616_0001104
1785 Ga0500616_0041529
1786 Ga0500622_0000060
1787 Ga0500634_0055094
1788 Ga0500636_0000914
1789 Ga0500636_0094542
1790 Ga0500599_000112
1791 Ga0501084_0037477
1792 Ga0501084_0203163
1793 Ga0587128_005133
1794 Ga0501082_0051239
1795 2506578337
1796 2506583475
1797 2508693084
1798 2508852338
1799 2510893229
1800 2511194172
1801 2511330144
1802 2511330400
1803 2511376646
1804 2512037160
1805 2513574292
1806 2513634707
1807 2513660956
1808 2513670963
1809 2513861813
1810 2513915637
1811 2513952704
1812 2513953151
1813 2514000792
1814 2514024288
1815 2514042116
1816 2515637284
1817 2515645210
1818 2515661593
1819 2515737800
1820 2517079753
1821 2517099336
1822 2524465520
1823 2528851396
1824 2585268594
1825 2585333109
1826 2585389258
1827 2585393657
1828 2585525896
1829 2585847597
1830 2599101781
1831 2599627751
1832 2599677328
1833 2599685392
1834 2599697194
1835 2599723581
1836 2600024933
1837 2600029440
1838 2600041055
1839 2600065422
1840 2600079060
1841 2600358876
1842 2643810975
1843 2644498332
1844 2656279148
1845 2671113210
1846 2671130169
1847 2689444885
1848 2722885409
1849 2738885337
1850 2739199704
1851 2746087042
1852 2746094677
1853 2766066515
1854 2793072252
1855 2807177537
1856 2819598493
1857 2819617776
1858 2831268385
1859 2834645871
1860 2838031730
1861 2838061385
1862 2838687981
1863 2838733704
1864 2838746374
1865 2839140402
1866 2841857620
1867 2842111913
1868 2842159203
1869 2842163739
1870 2842183228
1871 2842234492
1872 2842248014
1873 2842259609
1874 2842271988
1875 2842309710
1876 2842324895
1877 2842349174
1878 2842457032
1879 2842478462
1880 2842505592
1881 2842515791
1882 2842525419
1883 2844459938
1884 2846957925
1885 2852393898
1886 2855733412
1887 2855772371
1888 2857523570
1889 2857543514
1890 2858951771
1891 2858952486
1892 2869554293
1893 2874628525
1894 2881413878
1895 2885384113
1896 2888368949
1897 2891378098
1898 2893066672
1899 2899926279
1900 2903749977
1901 2904453798
1902 2904462273
1903 2904482799
1904 2904550019
1905 2904667195
1906 2909401414
1907 2913041221
1908 2919157135
1909 2919412978
1910 2928044212
1911 2928051051
1912 2928057114
1913 2928069370
1914 2928077120
1915 2928089891
1916 2928118698
1917 2928133337
1918 2929166513
1919 2932792160
1920 2932814473
1921 2932837349
1922 2933576152
1923 2933588188
1924 2935623412
1925 2935652546
1926 2935661128
1927 2935672738
1928 2935845018
1929 2935861588
1930 2935902840
1931 2936015185
1932 2936023330
1933 2936032217
1934 2936050078
1935 2936061820
1936 2936371301
1937 2936375496
1938 2937053825
1939 2939632206
1940 2941479751
1941 2941480830
1942 2945963914
1943 2954767901
1944 2957415532
1945 2957447389
1946 2960623168
1947 2960663177
1948 2970044156
1949 2970119377
1950 2970153564
1951 2977526488
1952 2977583208
1953 3005419360
1954 3005477345
1955 3007319683
1956 640937849
1957 644747181
1958 8002396191
1959 8003405135
1960 8004595831
1961 8005307610
1962 8005380285
1963 8015398173
1964 8016515593
1965 8016588089
1966 8016633243
1967 8017060902
1968 8019559072
1969 8019566231
1970 8023687798
1971 8045868269
1972 8046767856
1973 8052498070
1974 8054005310
1975 8056154613
1976 8056974437

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

60

285

0.91

PF12146

Hydrolase_4

Serine aminopeptidase, S33

56

280

0.77

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

62

291

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
4l0c-assembly6.cif.gz_F crystal structure of the n-fopmylmaleamic acid deformylase nfo(s94a) from pseudomonas putida s16 0.9733 6 258
4l0c-assembly7.cif.gz_G crystal structure of the n-fopmylmaleamic acid deformylase nfo(s94a) from pseudomonas putida s16 0.9729 6 257
4l0c-assembly6.cif.gz_F crystal structure of the n-fopmylmaleamic acid deformylase nfo(s94a) from pseudomonas putida s16 0.9695 6 258
4l0c-assembly7.cif.gz_G crystal structure of the n-fopmylmaleamic acid deformylase nfo(s94a) from pseudomonas putida s16 0.9691 6 257
8b6n-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) 0.8695 6 120
ID Description Score Start End Superfamily
4l0cD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.973 6 255 3.40.50.1820
4l0cD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9614 6 255 3.40.50.1820
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8742 3 88 3.40.50.12270
af_A0A1D8PIA5_80_305_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8269 25 123 3.40.50.1820
2dstB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8235 5 121 3.40.50.12270
ID Description Score Start End GO Terms
AF-Q9P418-F1-model_v4 Hypothetical alpha/beta hydrolase 0.9985 50 241 GO:0016020
GO:0016787
AF-A0A520B6Z3-F1-model_v4 Alpha/beta fold hydrolase 0.9916 56 263 GO:0016787
AF-A0A076PVH7-F1-model_v4 Alpha/beta hydrolase 0.9905 1 264 GO:0016787
AF-A0A076PVH7-F1-model_v4 Alpha/beta hydrolase 0.9831 1 264 GO:0016787
AF-A0A3P4AZI7-F1-model_v4 N-formylmaleamate deformylase (EC 3.5.1.106) 0.9685 1 265 GO:0016787

Map